Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_56.237768.267ON1301305988e-81
SAKL0H16918g8.267ON1111123294e-40
KLTH0G13574g8.267ON1121123112e-37
KLLA0F19250g8.267ON1161162852e-33
Ecym_43038.267ON1091132758e-32
TDEL0F039408.267ON1101152741e-31
AGR081C8.267ON1301152639e-30
ZYRO0C01540g8.267ON971072609e-30
Suva_2.2748.267ON1051102382e-26
TPHA0A017708.267ON104832322e-25
CAGL0B01793g8.267ON98912279e-25
Smik_4.3598.267ON1051102243e-24
KAFR0B054908.267ON85552207e-24
YDR115W8.267ON105552192e-23
Skud_4.3758.267ON1051192192e-23
Kpol_543.428.267ON112912183e-23
NCAS0B038208.267ON115542184e-23
NDAI0J013408.267ON141542143e-22
KNAG0H032208.267ON86492024e-21
TBLA0E044708.267ON94521912e-19
SAKL0H00484g5.15ON38639624.7
Kpol_513.265.15ON39339617.4
KLTH0H10736g1.317ON81033617.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_56.23776
         (130 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_56.23776 s56 complement(701147..701539) [393 bp, 130 aa] {O...   234   8e-81
SAKL0H16918g Chr8 complement(1487378..1487713) [336 bp, 111 aa] ...   131   4e-40
KLTH0G13574g Chr7 complement(1164609..1164947) [339 bp, 112 aa] ...   124   2e-37
KLLA0F19250g Chr6 (1782824..1783174) [351 bp, 116 aa] {ON} simil...   114   2e-33
Ecym_4303 Chr4 complement(647272..647601) [330 bp, 109 aa] {ON} ...   110   8e-32
TDEL0F03940 Chr6 (732097..732429) [333 bp, 110 aa] {ON} Anc_8.26...   110   1e-31
AGR081C Chr7 complement(882207..882599) [393 bp, 130 aa] {ON} Sy...   105   9e-30
ZYRO0C01540g Chr3 complement(110968..111261) [294 bp, 97 aa] {ON...   104   9e-30
Suva_2.274 Chr2 (476840..477157) [318 bp, 105 aa] {ON} YDR115W (...    96   2e-26
TPHA0A01770 Chr1 complement(360221..360535) [315 bp, 104 aa] {ON...    94   2e-25
CAGL0B01793g Chr2 (165053..165349) [297 bp, 98 aa] {ON} some sim...    92   9e-25
Smik_4.359 Chr4 (643476..643793) [318 bp, 105 aa] {ON} YDR115W (...    91   3e-24
KAFR0B05490 Chr2 complement(1123665..1123922) [258 bp, 85 aa] {O...    89   7e-24
YDR115W Chr4 (682175..682492) [318 bp, 105 aa] {ON} Putative mit...    89   2e-23
Skud_4.375 Chr4 (653818..654135) [318 bp, 105 aa] {ON} YDR115W (...    89   2e-23
Kpol_543.42 s543 (92324..92662) [339 bp, 112 aa] {ON} (92324..92...    89   3e-23
NCAS0B03820 Chr2 complement(681940..682287) [348 bp, 115 aa] {ON...    89   4e-23
NDAI0J01340 Chr10 complement(310691..311116) [426 bp, 141 aa] {O...    87   3e-22
KNAG0H03220 Chr8 complement(602460..602720) [261 bp, 86 aa] {ON}...    82   4e-21
TBLA0E04470 Chr5 (1143613..1143897) [285 bp, 94 aa] {ON} Anc_8.2...    78   2e-19
SAKL0H00484g Chr8 complement(57353..58513) [1161 bp, 386 aa] {ON...    28   4.7  
Kpol_513.26 s513 complement(75128..76309) [1182 bp, 393 aa] {ON}...    28   7.4  
KLTH0H10736g Chr8 complement(924558..926990) [2433 bp, 810 aa] {...    28   7.4  

>Kwal_56.23776 s56 complement(701147..701539) [393 bp, 130 aa] {ON}
           YDR115W - Hypothetical ORF [contig 173] FULL
          Length = 130

 Score =  234 bits (598), Expect = 8e-81,   Method: Compositional matrix adjust.
 Identities = 118/130 (90%), Positives = 118/130 (90%)

Query: 1   MIRHIVTLRGWSFPILETMSFLSSRLFQFSARRSLTTMSSFSPLNVCMFRSPVSQVNNSI 60
           MIRHIVTLRGWSFPILETMSFLSSRLFQFSARRSLTTMSSFSPLNVCMFRSPVSQVNNSI
Sbjct: 1   MIRHIVTLRGWSFPILETMSFLSSRLFQFSARRSLTTMSSFSPLNVCMFRSPVSQVNNSI 60

Query: 61  ATGXXXXXXXXXXXXLFGLTQKRWKSRGNTYQPSTLKRKRRVGFLARVKSKQGSKILKRR 120
           ATG            LFGLTQKRWKSRGNTYQPSTLKRKRRVGFLARVKSKQGSKILKRR
Sbjct: 61  ATGSSSSAMPSYLSSLFGLTQKRWKSRGNTYQPSTLKRKRRVGFLARVKSKQGSKILKRR 120

Query: 121 REKGRWYLTH 130
           REKGRWYLTH
Sbjct: 121 REKGRWYLTH 130

>SAKL0H16918g Chr8 complement(1487378..1487713) [336 bp, 111 aa]
           {ON} similar to uniprot|Q04598 Saccharomyces cerevisiae
           YDR115W
          Length = 111

 Score =  131 bits (329), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 71/112 (63%), Positives = 80/112 (71%), Gaps = 1/112 (0%)

Query: 19  MSFLSSRLFQFSARRSLTTMSSFSPLNVCMFRSPVSQVNNSIATGXXXXXXXXXXXXLFG 78
           MSFLS  LF FSARR+ TT SSFSPL     ++ V+  NN + +             L G
Sbjct: 1   MSFLSKHLFHFSARRTFTTFSSFSPLRSLNSQALVNH-NNPLLSQSQSQQPSSIMNILLG 59

Query: 79  LTQKRWKSRGNTYQPSTLKRKRRVGFLARVKSKQGSKILKRRREKGRWYLTH 130
           LTQ+RWKSRGNTYQPSTLKRKRRVGFLAR K+KQ SKILK R+EKGRWYLTH
Sbjct: 60  LTQRRWKSRGNTYQPSTLKRKRRVGFLARAKNKQASKILKSRKEKGRWYLTH 111

>KLTH0G13574g Chr7 complement(1164609..1164947) [339 bp, 112 aa]
           {ON} some similarities with uniprot|Q04598 Saccharomyces
           cerevisiae YDR115W
          Length = 112

 Score =  124 bits (311), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 75/112 (66%), Positives = 83/112 (74%)

Query: 19  MSFLSSRLFQFSARRSLTTMSSFSPLNVCMFRSPVSQVNNSIATGXXXXXXXXXXXXLFG 78
           MSF+ +RLFQFSARRSL+++SSFSPLN    R  V Q    +A              LFG
Sbjct: 1   MSFIYNRLFQFSARRSLSSLSSFSPLNAVSCRPSVFQAAAPMAAERSSQGSSPLFSALFG 60

Query: 79  LTQKRWKSRGNTYQPSTLKRKRRVGFLARVKSKQGSKILKRRREKGRWYLTH 130
            TQ+RWKSRGNTYQPSTLKRKRRVGFLAR KSKQG K+LKRRREKGRWYLTH
Sbjct: 61  FTQRRWKSRGNTYQPSTLKRKRRVGFLARAKSKQGYKVLKRRREKGRWYLTH 112

>KLLA0F19250g Chr6 (1782824..1783174) [351 bp, 116 aa] {ON} similar
           to uniprot|Q04598 Saccharomyces cerevisiae YDR115W
          Length = 116

 Score =  114 bits (285), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 80/116 (68%), Gaps = 4/116 (3%)

Query: 19  MSFLSSRLFQFSARRSLTTMSSFSPLNVCMFR--SPVSQVNNSIAT--GXXXXXXXXXXX 74
           MSF++  L Q++++R+LT+ SSFSPL     R   P++QVN    T              
Sbjct: 1   MSFITRNLLQWTSKRTLTSFSSFSPLRTLDSRLHRPLAQVNPMEITLQSQTQANGSSIFG 60

Query: 75  XLFGLTQKRWKSRGNTYQPSTLKRKRRVGFLARVKSKQGSKILKRRREKGRWYLTH 130
            LF LTQ+RWKSRGNT+QPSTLKRKRRVGFLAR +S+ G +ILKRR+ KGRWYLT+
Sbjct: 61  MLFDLTQRRWKSRGNTFQPSTLKRKRRVGFLARARSRSGQQILKRRKNKGRWYLTY 116

>Ecym_4303 Chr4 complement(647272..647601) [330 bp, 109 aa] {ON}
           similar to Ashbya gossypii AGR081C
          Length = 109

 Score =  110 bits (275), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 63/113 (55%), Positives = 76/113 (67%), Gaps = 5/113 (4%)

Query: 19  MSFLSSRLFQFSARRSLTTM-SSFSPLNVCMFRSPVSQVNNSIATGXXXXXXXXXXXXLF 77
           M + S  L Q+  RRSL T+ SSFSP+   +     S  N S++T             +F
Sbjct: 1   MLYKSRSLLQWFPRRSLVTLVSSFSPMKSLVQPLATSAANTSVST----FQRPSVISLVF 56

Query: 78  GLTQKRWKSRGNTYQPSTLKRKRRVGFLARVKSKQGSKILKRRREKGRWYLTH 130
           GL Q+RWKSRGNT+QPSTLKRKRRVGFLAR +SK G KILKRR+EKGRWYLT+
Sbjct: 57  GLNQRRWKSRGNTFQPSTLKRKRRVGFLARARSKTGQKILKRRKEKGRWYLTY 109

>TDEL0F03940 Chr6 (732097..732429) [333 bp, 110 aa] {ON} Anc_8.267
           YDR115W
          Length = 110

 Score =  110 bits (274), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 79/115 (68%), Gaps = 8/115 (6%)

Query: 19  MSFLSSRLFQFSARRSLTTMSSFSPLNVCMFRSPVSQVNNSIATGXXXXXXXXXXXXL-- 76
           MSFL+ +  Q +ARR+LT++SSFSPL     RS  +Q  +    G            L  
Sbjct: 1   MSFLARKPLQLNARRTLTSLSSFSPL-----RSLFAQNKSQGLLGVPETHSPLSSISLLF 55

Query: 77  -FGLTQKRWKSRGNTYQPSTLKRKRRVGFLARVKSKQGSKILKRRREKGRWYLTH 130
            FG+ Q+RWKSRGNT+QPSTLKRKRR+GFLAR +SK GS++L+RR+ KGRWYLT+
Sbjct: 56  PFGIMQRRWKSRGNTFQPSTLKRKRRIGFLARARSKTGSRVLQRRKAKGRWYLTY 110

>AGR081C Chr7 complement(882207..882599) [393 bp, 130 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR115W
          Length = 130

 Score =  105 bits (263), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 62/115 (53%), Positives = 72/115 (62%), Gaps = 7/115 (6%)

Query: 18  TMSFLSSRLFQFSARRSLTTMSSFSPLNVCMFRSPVSQVNNSI--ATGXXXXXXXXXXXX 75
           TM  +   + Q+S+RR  T M+  SP+      +PV Q+      A              
Sbjct: 21  TMFSMYRSMLQWSSRR--TIMTVVSPVRKM---APVPQIQYGAIGAFTPAAAPKPSMLSM 75

Query: 76  LFGLTQKRWKSRGNTYQPSTLKRKRRVGFLARVKSKQGSKILKRRREKGRWYLTH 130
           L GLTQKRWKSRGNTYQPSTLKRKRRVGFLAR +S+ G  ILKRRREKGRWYLTH
Sbjct: 76  LLGLTQKRWKSRGNTYQPSTLKRKRRVGFLARARSRTGRNILKRRREKGRWYLTH 130

>ZYRO0C01540g Chr3 complement(110968..111261) [294 bp, 97 aa] {ON}
           similar to uniprot|Q04598 Saccharomyces cerevisiae
           YDR115W
          Length = 97

 Score =  104 bits (260), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 76/107 (71%), Gaps = 19/107 (17%)

Query: 26  LFQFSARRSLTTMSSFSPLNVCMFRSPVSQV--NNSIATGXXXXXXXXXXXXLFGLTQKR 83
           +FQ  ARRSL TM +++P  V    SP+ ++   + +++G             FG+ Q+R
Sbjct: 8   IFQVGARRSLFTMGNWTPTTV----SPLQRLLGPSPLSSG-------------FGMGQRR 50

Query: 84  WKSRGNTYQPSTLKRKRRVGFLARVKSKQGSKILKRRREKGRWYLTH 130
           WKSRGNT+QPSTLKRKRRVGFLAR +SKQGSKIL+RR+ KGRW+LTH
Sbjct: 51  WKSRGNTFQPSTLKRKRRVGFLARARSKQGSKILQRRKHKGRWFLTH 97

>Suva_2.274 Chr2 (476840..477157) [318 bp, 105 aa] {ON} YDR115W
           (REAL)
          Length = 105

 Score = 96.3 bits (238), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 59/110 (53%), Positives = 71/110 (64%), Gaps = 8/110 (7%)

Query: 22  LSSRLFQFSARRSLTTMSSFSPLNVCMFRSPVSQVNNSIATGXXXXXXXXXXXXLFG-LT 80
           L  RL+QF +RR  +++S  S L+V   R   S + NS                 FG + 
Sbjct: 3   LFGRLYQFQSRRMFSSISPISALSVL--RPQTSMLLNSSPLKTMSLTPFG-----FGFIG 55

Query: 81  QKRWKSRGNTYQPSTLKRKRRVGFLARVKSKQGSKILKRRREKGRWYLTH 130
           Q+RWKSRGNTYQPSTLKRKR  GFLAR KSKQGSKILKRR+ KGRW+L+H
Sbjct: 56  QRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105

>TPHA0A01770 Chr1 complement(360221..360535) [315 bp, 104 aa] {ON}
           Anc_8.267 YDR115W
          Length = 104

 Score = 94.0 bits (232), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 50/83 (60%), Positives = 57/83 (68%), Gaps = 6/83 (7%)

Query: 53  VSQVNNSIATGXXXXXXXXXXXXL-----FGLTQKRWKSRGNTYQPSTLKRKRRVGFLAR 107
           V  + NSI  G            L      GL Q+RWKSRGNTYQPSTLKRKRR+GFLAR
Sbjct: 23  VDSIKNSILGGNAIGSRTGLASILGLNLDLGL-QRRWKSRGNTYQPSTLKRKRRIGFLAR 81

Query: 108 VKSKQGSKILKRRREKGRWYLTH 130
            +SKQG+KIL+RR+ KGRWYLTH
Sbjct: 82  ARSKQGNKILERRKAKGRWYLTH 104

>CAGL0B01793g Chr2 (165053..165349) [297 bp, 98 aa] {ON} some
           similarities with uniprot|Q04598 Saccharomyces
           cerevisiae YDR115w
          Length = 98

 Score = 92.0 bits (227), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 49/91 (53%), Positives = 65/91 (71%), Gaps = 5/91 (5%)

Query: 40  SFSPLNVCMFRSPVSQVNNSIATGXXXXXXXXXXXXLFGLTQKRWKSRGNTYQPSTLKRK 99
           + +P N  + ++ VS + N I++G            LF L Q+RWKSRGNTYQPSTLKRK
Sbjct: 13  NLTPGNGMIGKNSVSLIRNEISSGTSFSSILT----LFPL-QRRWKSRGNTYQPSTLKRK 67

Query: 100 RRVGFLARVKSKQGSKILKRRREKGRWYLTH 130
           R+ GFLAR+ +K+ +KI+KRR+EKGRWYLTH
Sbjct: 68  RKFGFLARMTNKRTAKIIKRRKEKGRWYLTH 98

>Smik_4.359 Chr4 (643476..643793) [318 bp, 105 aa] {ON} YDR115W
           (REAL)
          Length = 105

 Score = 90.9 bits (224), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 60/110 (54%), Positives = 73/110 (66%), Gaps = 8/110 (7%)

Query: 22  LSSRLFQFSARRSLTTMSSFSPLNVCMFRSPVSQVNNSIATGXXXXXXXXXXXXLFG-LT 80
           L +RL+Q  +RR ++++SSFS L V   R   S + NS                 FG + 
Sbjct: 3   LFARLYQLQSRRMISSISSFSALTVL--RPQTSMIMNSSPLKTMSLTTFG-----FGFID 55

Query: 81  QKRWKSRGNTYQPSTLKRKRRVGFLARVKSKQGSKILKRRREKGRWYLTH 130
           Q+RWKSRGNTYQPSTLKRKR  GFLAR KSKQGSKILKRR+ KGRW+L+H
Sbjct: 56  QRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105

>KAFR0B05490 Chr2 complement(1123665..1123922) [258 bp, 85 aa] {ON}
           Anc_8.267 YDR115W
          Length = 85

 Score = 89.4 bits (220), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 48/55 (87%), Gaps = 2/55 (3%)

Query: 76  LFGLTQKRWKSRGNTYQPSTLKRKRRVGFLARVKSKQGSKILKRRREKGRWYLTH 130
            FG  QKRWKSRGNTYQPSTLKRKR+ GFL+R KSKQ SKILK R+EKGRWYL+H
Sbjct: 33  FFG--QKRWKSRGNTYQPSTLKRKRKFGFLSRAKSKQKSKILKDRKEKGRWYLSH 85

>YDR115W Chr4 (682175..682492) [318 bp, 105 aa] {ON} Putative
           mitochondrial ribosomal protein of the large subunit,
           has similarity to E. coli L34 ribosomal protein;
           required for respiratory growth, as are most
           mitochondrial ribosomal proteins
          Length = 105

 Score = 89.0 bits (219), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 45/55 (81%), Positives = 49/55 (89%), Gaps = 1/55 (1%)

Query: 77  FGLT-QKRWKSRGNTYQPSTLKRKRRVGFLARVKSKQGSKILKRRREKGRWYLTH 130
           FGL  Q+RWKSRGNTYQPSTLKRKR  GFLAR KSKQGSKILKRR+ KGRW+L+H
Sbjct: 51  FGLIGQRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105

>Skud_4.375 Chr4 (653818..654135) [318 bp, 105 aa] {ON} YDR115W
           (REAL)
          Length = 105

 Score = 89.0 bits (219), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 58/119 (48%), Positives = 75/119 (63%), Gaps = 21/119 (17%)

Query: 19  MSFLSSRLFQFSARRSLTTMSS------FSPLNVCMFRSPVSQVNNSIATGXXXXXXXXX 72
           M+ L+S L+Q  ++R L+++SS        P +  +  SP  +  +  A G         
Sbjct: 1   MTLLTS-LYQLQSKRMLSSISSFSALSVLRPQSSMLLNSPPMKTMSLTALG--------- 50

Query: 73  XXXLFG-LTQKRWKSRGNTYQPSTLKRKRRVGFLARVKSKQGSKILKRRREKGRWYLTH 130
               FG + Q+RWKSRGNTYQPSTLKRKR  GFLAR KSKQGSKILKRR+ KGRW+L+H
Sbjct: 51  ----FGFIGQRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105

>Kpol_543.42 s543 (92324..92662) [339 bp, 112 aa] {ON}
           (92324..92662) [339 nt, 113 aa]
          Length = 112

 Score = 88.6 bits (218), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 50/91 (54%), Positives = 60/91 (65%), Gaps = 14/91 (15%)

Query: 41  FSPLN-VCMFRSPVSQVNNSIATGXXXXXXXXXXXXLFGLTQKRWKSRGNTYQPSTLKRK 99
           F+ LN V +F    +    S  TG            L GL Q+RWKSRGNTYQPSTLKRK
Sbjct: 35  FAGLNSVGLFPGTATNTFGSAITG------------LLGL-QRRWKSRGNTYQPSTLKRK 81

Query: 100 RRVGFLARVKSKQGSKILKRRREKGRWYLTH 130
           R+ GFLAR +S+ GSKIL+RR+ KGRWYL+H
Sbjct: 82  RKFGFLARARSRSGSKILERRKAKGRWYLSH 112

>NCAS0B03820 Chr2 complement(681940..682287) [348 bp, 115 aa] {ON}
           Anc_8.267 YDR115W
          Length = 115

 Score = 88.6 bits (218), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 41/54 (75%), Positives = 46/54 (85%)

Query: 77  FGLTQKRWKSRGNTYQPSTLKRKRRVGFLARVKSKQGSKILKRRREKGRWYLTH 130
           FG+ Q+RWKSRGNTYQPSTLKRKR+ GFLA+ +  Q  KILKRRR KGRWYLTH
Sbjct: 62  FGILQRRWKSRGNTYQPSTLKRKRKFGFLAKARDSQKCKILKRRRLKGRWYLTH 115

>NDAI0J01340 Chr10 complement(310691..311116) [426 bp, 141 aa] {ON}
           Anc_8.267 YDR115W
          Length = 141

 Score = 87.0 bits (214), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 48/54 (88%)

Query: 77  FGLTQKRWKSRGNTYQPSTLKRKRRVGFLARVKSKQGSKILKRRREKGRWYLTH 130
           F + QKRWKSRGNTYQPSTLKRKR+ GFL+R++ +Q SKILKRR+ KGRW+L+H
Sbjct: 88  FMINQKRWKSRGNTYQPSTLKRKRKYGFLSRMRDRQASKILKRRKLKGRWFLSH 141

>KNAG0H03220 Chr8 complement(602460..602720) [261 bp, 86 aa] {ON}
           Anc_8.267 YDR115W
          Length = 86

 Score = 82.4 bits (202), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 38/49 (77%), Positives = 45/49 (91%)

Query: 82  KRWKSRGNTYQPSTLKRKRRVGFLARVKSKQGSKILKRRREKGRWYLTH 130
           +RWKSRGNTYQPSTLKRKR+ GFLARV++   SK+LKRR+EKGRWYL+H
Sbjct: 38  RRWKSRGNTYQPSTLKRKRKFGFLARVRASFRSKVLKRRKEKGRWYLSH 86

>TBLA0E04470 Chr5 (1143613..1143897) [285 bp, 94 aa] {ON} Anc_8.267
           YDR115W
          Length = 94

 Score = 78.2 bits (191), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 44/52 (84%)

Query: 79  LTQKRWKSRGNTYQPSTLKRKRRVGFLARVKSKQGSKILKRRREKGRWYLTH 130
           +  +RWKSRGNTYQPSTLKRKR+ GFL+R KS   +KILKRR+ KGRW+L+H
Sbjct: 43  IDSRRWKSRGNTYQPSTLKRKRKHGFLSRAKSYTMNKILKRRKAKGRWFLSH 94

>SAKL0H00484g Chr8 complement(57353..58513) [1161 bp, 386 aa] {ON}
           some similarities with uniprot|P53334 Saccharomyces
           cerevisiae YGR279C
          Length = 386

 Score = 28.5 bits (62), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 10/39 (25%), Positives = 21/39 (53%)

Query: 79  LTQKRWKSRGNTYQPSTLKRKRRVGFLARVKSKQGSKIL 117
           +T+  W S+G TY  +   +K +   ++ +KS  G  ++
Sbjct: 321 ITESGWPSKGQTYGKAVASKKNQETAVSSIKSSCGDAVI 359

>Kpol_513.26 s513 complement(75128..76309) [1182 bp, 393 aa] {ON}
           complement(75128..76309) [1182 nt, 394 aa]
          Length = 393

 Score = 28.1 bits (61), Expect = 7.4,   Method: Composition-based stats.
 Identities = 12/39 (30%), Positives = 22/39 (56%)

Query: 79  LTQKRWKSRGNTYQPSTLKRKRRVGFLARVKSKQGSKIL 117
           +T+  W S+G+TY  +   +  +   +A +K K GS+ L
Sbjct: 328 ITESGWPSKGDTYGAAIPSKANQETAIAAIKEKCGSQTL 366

>KLTH0H10736g Chr8 complement(924558..926990) [2433 bp, 810 aa] {ON}
           similar to uniprot|P40367 Saccharomyces cerevisiae
           YJL062W LAS21 Integral plasma membrane protein involved
           in the synthesis of the glycosylphosphatidylinositol
           (GPI) core structure mutations affect cell wall
           integrity
          Length = 810

 Score = 28.1 bits (61), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 2/33 (6%)

Query: 9   RGWSFPILETMSFLSSRL--FQFSARRSLTTMS 39
           R WSFP+L T++ +   L  FQF    S+ T+S
Sbjct: 661 RQWSFPVLMTVNLVLQHLSFFQFGNTNSIATVS 693

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.133    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 10,945,825
Number of extensions: 333668
Number of successful extensions: 1029
Number of sequences better than 10.0: 26
Number of HSP's gapped: 1020
Number of HSP's successfully gapped: 26
Length of query: 130
Length of database: 53,481,399
Length adjustment: 97
Effective length of query: 33
Effective length of database: 42,358,797
Effective search space: 1397840301
Effective search space used: 1397840301
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 59 (27.3 bits)