Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_56.237758.268ON28128113000.0
KLTH0G13552g8.268ON28128110201e-140
SAKL0H16896g8.268ON2852618961e-121
KLLA0F19272g8.268ON2662698081e-108
ZYRO0C01518g8.268ON2772607681e-102
Ecym_43028.268ON2752587571e-100
TPHA0J007708.268ON2782747571e-100
TDEL0F039508.268ON2762617434e-98
AGR080W8.268ON2752647155e-94
YDR116C (MRPL1)8.268ON2852427132e-93
Kpol_392.38.268ON2812857097e-93
NCAS0B038108.268ON3142707057e-92
Smik_4.3608.268ON2852646922e-90
Skud_4.3768.268ON2852646768e-88
Suva_2.2758.268ON2852716723e-87
NDAI0J013308.268ON3142486396e-82
KAFR0B054808.268ON2802445723e-72
KNAG0H032108.268ON2852435351e-66
CAGL0B01815g8.268ON2902475351e-66
TBLA0I031908.268ON2412154353e-52
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_56.23775
         (281 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_56.23775 s56 (700146..700991) [846 bp, 281 aa] {ON} YDR116C...   505   0.0  
KLTH0G13552g Chr7 (1163624..1164469) [846 bp, 281 aa] {ON} simil...   397   e-140
SAKL0H16896g Chr8 (1486354..1487211) [858 bp, 285 aa] {ON} simil...   349   e-121
KLLA0F19272g Chr6 complement(1783497..1784297) [801 bp, 266 aa] ...   315   e-108
ZYRO0C01518g Chr3 (110061..110894) [834 bp, 277 aa] {ON} similar...   300   e-102
Ecym_4302 Chr4 (646221..647048) [828 bp, 275 aa] {ON} similar to...   296   e-100
TPHA0J00770 Chr10 complement(179754..180590) [837 bp, 278 aa] {O...   296   e-100
TDEL0F03950 Chr6 complement(732544..733374) [831 bp, 276 aa] {ON...   290   4e-98
AGR080W Chr7 (881213..882040) [828 bp, 275 aa] {ON} Syntenic hom...   280   5e-94
YDR116C Chr4 complement(682724..683581) [858 bp, 285 aa] {ON}  M...   279   2e-93
Kpol_392.3 s392 (3674..4519) [846 bp, 281 aa] {ON} (3674..4519) ...   277   7e-93
NCAS0B03810 Chr2 (680870..681814) [945 bp, 314 aa] {ON} Anc_8.26...   276   7e-92
Smik_4.360 Chr4 complement(644029..644886) [858 bp, 285 aa] {ON}...   271   2e-90
Skud_4.376 Chr4 complement(654375..655232) [858 bp, 285 aa] {ON}...   265   8e-88
Suva_2.275 Chr2 complement(477386..478243) [858 bp, 285 aa] {ON}...   263   3e-87
NDAI0J01330 Chr10 (309586..310530) [945 bp, 314 aa] {ON} Anc_8.2...   250   6e-82
KAFR0B05480 Chr2 (1122727..1123569) [843 bp, 280 aa] {ON} Anc_8....   224   3e-72
KNAG0H03210 Chr8 (601470..602327) [858 bp, 285 aa] {ON} Anc_8.26...   210   1e-66
CAGL0B01815g Chr2 complement(165648..166520) [873 bp, 290 aa] {O...   210   1e-66
TBLA0I03190 Chr9 complement(768942..769667) [726 bp, 241 aa] {ON...   172   3e-52

>Kwal_56.23775 s56 (700146..700991) [846 bp, 281 aa] {ON} YDR116C -
           Hypothetical ORF [contig 173] FULL
          Length = 281

 Score =  505 bits (1300), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 255/281 (90%), Positives = 255/281 (90%)

Query: 1   MLSRLSKRIVPLVQFPYARNLHAFSALRAEETPSPVVSKLSKDQLRKREIXXXXXXXXXX 60
           MLSRLSKRIVPLVQFPYARNLHAFSALRAEETPSPVVSKLSKDQLRKREI          
Sbjct: 1   MLSRLSKRIVPLVQFPYARNLHAFSALRAEETPSPVVSKLSKDQLRKREIRKLAQKKAAA 60

Query: 61  XXXXTDHPLYMPVDKALRFLRAAEAGQPHSQQTLSVTTIVISERGAPPLSGNLSFPKPLK 120
               TDHPLYMPVDKALRFLRAAEAGQPHSQQTLSVTTIVISERGAPPLSGNLSFPKPLK
Sbjct: 61  RRPATDHPLYMPVDKALRFLRAAEAGQPHSQQTLSVTTIVISERGAPPLSGNLSFPKPLK 120

Query: 121 DLKIAVFTNDEQQAQIAREKFGCHLVGGSDLVEKIKEGAVSLDFDKSFATPEITTLLASQ 180
           DLKIAVFTNDEQQAQIAREKFGCHLVGGSDLVEKIKEGAVSLDFDKSFATPEITTLLASQ
Sbjct: 121 DLKIAVFTNDEQQAQIAREKFGCHLVGGSDLVEKIKEGAVSLDFDKSFATPEITTLLASQ 180

Query: 181 XXXXXXXXXXXXAAKKGTVAENLEPLLKNSMGTLPFRQRGNVVSVAVGKCSFTDKQLLEN 240
                       AAKKGTVAENLEPLLKNSMGTLPFRQRGNVVSVAVGKCSFTDKQLLEN
Sbjct: 181 LGRILGPRGLLPAAKKGTVAENLEPLLKNSMGTLPFRQRGNVVSVAVGKCSFTDKQLLEN 240

Query: 241 ILAAQKGLKEALATQKTKKPSLLGQTTLTSTHGPGIVIDFA 281
           ILAAQKGLKEALATQKTKKPSLLGQTTLTSTHGPGIVIDFA
Sbjct: 241 ILAAQKGLKEALATQKTKKPSLLGQTTLTSTHGPGIVIDFA 281

>KLTH0G13552g Chr7 (1163624..1164469) [846 bp, 281 aa] {ON} similar
           to uniprot|Q04599 Saccharomyces cerevisiae YDR116C MRPL1
           Mitochondrial ribosomal protein of the large subunit
          Length = 281

 Score =  397 bits (1020), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 202/281 (71%), Positives = 223/281 (79%)

Query: 1   MLSRLSKRIVPLVQFPYARNLHAFSALRAEETPSPVVSKLSKDQLRKREIXXXXXXXXXX 60
           M S LS R +PLV+    R LH  ++LRAEE      SKLSKDQL+KRE+          
Sbjct: 1   MFSGLSSRFLPLVRASPVRRLHVSASLRAEEPVGNATSKLSKDQLKKREVRRFAQKKAAA 60

Query: 61  XXXXTDHPLYMPVDKALRFLRAAEAGQPHSQQTLSVTTIVISERGAPPLSGNLSFPKPLK 120
               ++HPLYMPVDKALRFLRAAE GQP SQQTLSVTTIVISERGAP LSGN+SFP  LK
Sbjct: 61  RRPASEHPLYMPVDKALRFLRAAEVGQPQSQQTLSVTTIVISERGAPLLSGNVSFPNALK 120

Query: 121 DLKIAVFTNDEQQAQIAREKFGCHLVGGSDLVEKIKEGAVSLDFDKSFATPEITTLLASQ 180
           +LKIAVFTNDEQQAQIAREKF CH+VGGS+LVEKIK+G V LDFDKSFATPEI TLLASQ
Sbjct: 121 ELKIAVFTNDEQQAQIAREKFNCHVVGGSELVEKIKQGQVPLDFDKSFATPEIATLLASQ 180

Query: 181 XXXXXXXXXXXXAAKKGTVAENLEPLLKNSMGTLPFRQRGNVVSVAVGKCSFTDKQLLEN 240
                       AAKKGTV+ENLE L+K+SMGTLPFRQRGN +S+AVG+CSFTDKQLLEN
Sbjct: 181 LGRILGPRGLLPAAKKGTVSENLESLIKDSMGTLPFRQRGNNISIAVGRCSFTDKQLLEN 240

Query: 241 ILAAQKGLKEALATQKTKKPSLLGQTTLTSTHGPGIVIDFA 281
           I+AAQK +KEALA QK KKPSLLGQTTLTST GPGIVIDFA
Sbjct: 241 IVAAQKSVKEALANQKAKKPSLLGQTTLTSTRGPGIVIDFA 281

>SAKL0H16896g Chr8 (1486354..1487211) [858 bp, 285 aa] {ON} similar
           to uniprot|Q04599 Saccharomyces cerevisiae YDR116C MRPL1
           Mitochondrial ribosomal protein of the large subunit
          Length = 285

 Score =  349 bits (896), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 170/261 (65%), Positives = 204/261 (78%), Gaps = 1/261 (0%)

Query: 21  LHAFSALRAEETPSPVVSKLSKDQLRKREIXXXXXXXXXXXXXXTDHPLYMPVDKALRFL 80
            H F+AL++EE PS + +KLSKDQL++RE+               DHPLYMPV +ALRFL
Sbjct: 26  FHTFTALKSEE-PSTIATKLSKDQLKRRELRRLVQRKAAARKPAADHPLYMPVTQALRFL 84

Query: 81  RAAEAGQPHSQQTLSVTTIVISERGAPPLSGNLSFPKPLKDLKIAVFTNDEQQAQIAREK 140
           RAAE GQP SQQT+S+TT+VISERGAP L+GN+SFPKPLKD+KIAVFTNDE + +IAR++
Sbjct: 85  RAAEVGQPQSQQTISLTTLVISERGAPQLNGNISFPKPLKDVKIAVFTNDEDKLKIARDQ 144

Query: 141 FGCHLVGGSDLVEKIKEGAVSLDFDKSFATPEITTLLASQXXXXXXXXXXXXAAKKGTVA 200
           F CHLVGGS+L+EKIK+G V LDFDK+FATP+I   L SQ             AKKGTV 
Sbjct: 145 FNCHLVGGSELIEKIKKGEVPLDFDKAFATPDIAISLTSQLGRILGPRGLLPNAKKGTVT 204

Query: 201 ENLEPLLKNSMGTLPFRQRGNVVSVAVGKCSFTDKQLLENILAAQKGLKEALATQKTKKP 260
           E++  L+K+SMGTLPFRQRGN +S+AV KCSFTD Q+LENILAAQK  K ALA QK KKP
Sbjct: 205 EDISSLIKDSMGTLPFRQRGNCISIAVAKCSFTDTQVLENILAAQKSFKLALANQKAKKP 264

Query: 261 SLLGQTTLTSTHGPGIVIDFA 281
           S+LGQTTLT+THGPG+VIDFA
Sbjct: 265 SILGQTTLTTTHGPGLVIDFA 285

>KLLA0F19272g Chr6 complement(1783497..1784297) [801 bp, 266 aa]
           {ON} similar to uniprot|Q04599 Saccharomyces cerevisiae
           YDR116C MRPL1 Mitochondrial ribosomal protein of the
           large subunit
          Length = 266

 Score =  315 bits (808), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 156/269 (57%), Positives = 197/269 (73%), Gaps = 6/269 (2%)

Query: 15  FP--YARNLHAFSALRAEETPSPVVSKLSKDQLRKREIXXXXXXXXXXXXXXTDHPLYMP 72
           FP  + R     S   AEET +    KL+K+QLRKRE+              +DHPLYMP
Sbjct: 2   FPRIFTRQFQITSFRLAEETGT----KLTKEQLRKRELRKMVQRRLQAKTPASDHPLYMP 57

Query: 73  VDKALRFLRAAEAGQPHSQQTLSVTTIVISERGAPPLSGNLSFPKPLKDLKIAVFTNDEQ 132
           V +ALR+LRA E GQP SQQT+++TT+V++ERG PPL+GN+SF KPLKD+K+AVFTNDE 
Sbjct: 58  VSRALRYLRAIEVGQPASQQTITLTTLVVAERGVPPLTGNVSFGKPLKDVKVAVFTNDEA 117

Query: 133 QAQIAREKFGCHLVGGSDLVEKIKEGAVSLDFDKSFATPEITTLLASQXXXXXXXXXXXX 192
           QA + ++K+  HLVGGSDLV +IK G VS+DFDK+FATP+I   LASQ            
Sbjct: 118 QAALMKDKYSVHLVGGSDLVSQIKAGEVSIDFDKAFATPDIVPQLASQVGRILGPRGLLP 177

Query: 193 AAKKGTVAENLEPLLKNSMGTLPFRQRGNVVSVAVGKCSFTDKQLLENILAAQKGLKEAL 252
            AKKGTVAE+LEPL+K+SM ++PFRQRGN +S+ V K  FTDK++LEN+LA QK  K+++
Sbjct: 178 TAKKGTVAEDLEPLIKDSMSSVPFRQRGNSISLGVAKTHFTDKEVLENLLATQKAFKQSI 237

Query: 253 ATQKTKKPSLLGQTTLTSTHGPGIVIDFA 281
             Q+TKKPS+L QTTLTSTHGPGIVIDFA
Sbjct: 238 TNQQTKKPSILSQTTLTSTHGPGIVIDFA 266

>ZYRO0C01518g Chr3 (110061..110894) [834 bp, 277 aa] {ON} similar to
           uniprot|Q04599 Saccharomyces cerevisiae YDR116C MRPL1
           Mitochondrial ribosomal protein of the large subunit
          Length = 277

 Score =  300 bits (768), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 142/260 (54%), Positives = 186/260 (71%), Gaps = 4/260 (1%)

Query: 21  LHAFSALRAEETPSPVVSKLSKDQLRKREIXXXXXXXXXXXXXXTDHPLYMPVDKALRFL 80
            H  + LRAEE  S    KL+K+QLRKRE+                HPLYMP   ALR+L
Sbjct: 21  FHTAALLRAEEAGS----KLTKEQLRKREVRRAARRKVEAKKPAHTHPLYMPTPLALRYL 76

Query: 81  RAAEAGQPHSQQTLSVTTIVISERGAPPLSGNLSFPKPLKDLKIAVFTNDEQQAQIAREK 140
           RA E G P SQQ ++VTT V+++RG PP++GN+S P PLKD+ +AVF+NDEQQ  +AR+K
Sbjct: 77  RAVEVGYPASQQVITVTTSVVADRGNPPIAGNVSLPSPLKDVLVAVFSNDEQQLSMARDK 136

Query: 141 FGCHLVGGSDLVEKIKEGAVSLDFDKSFATPEITTLLASQXXXXXXXXXXXXAAKKGTVA 200
           F CHLVGGSD++ KIK+G + +DFDK+FATP+I   L SQ             AK+GTVA
Sbjct: 137 FRCHLVGGSDIIAKIKQGEIPVDFDKAFATPDIAQELTSQVARILGPKQVLPMAKRGTVA 196

Query: 201 ENLEPLLKNSMGTLPFRQRGNVVSVAVGKCSFTDKQLLENILAAQKGLKEALATQKTKKP 260
            +LEPL+K+S G++PFRQ+GN +S+AV KC F+D+Q+LEN+LA Q   KEA++ QK K+P
Sbjct: 197 SDLEPLIKDSFGSIPFRQKGNSISLAVAKCEFSDRQVLENLLAVQTAFKEAVSNQKAKRP 256

Query: 261 SLLGQTTLTSTHGPGIVIDF 280
           S+LG+TTLT+THGPGIVID 
Sbjct: 257 SILGRTTLTTTHGPGIVIDL 276

>Ecym_4302 Chr4 (646221..647048) [828 bp, 275 aa] {ON} similar to
           Ashbya gossypii AGR080W
          Length = 275

 Score =  296 bits (757), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 141/258 (54%), Positives = 190/258 (73%), Gaps = 1/258 (0%)

Query: 24  FSALRAEETPSPV-VSKLSKDQLRKREIXXXXXXXXXXXXXXTDHPLYMPVDKALRFLRA 82
           F+++R     SP   +KLSK+Q++K+E+               +HPLYMPV +A RFLRA
Sbjct: 17  FTSVRCAANNSPSSTTKLSKEQMKKKELRALLQKRAAAKKSPFEHPLYMPVQQAFRFLRA 76

Query: 83  AEAGQPHSQQTLSVTTIVISERGAPPLSGNLSFPKPLKDLKIAVFTNDEQQAQIAREKFG 142
           AE GQP SQQT+S+TT+V+S++GAP LSGN+ FP PL+D+K+AVFTN+++Q ++ARE+F 
Sbjct: 77  AEVGQPPSQQTISLTTVVVSDKGAPLLSGNILFPNPLRDVKVAVFTNNKEQEEVAREQFK 136

Query: 143 CHLVGGSDLVEKIKEGAVSLDFDKSFATPEITTLLASQXXXXXXXXXXXXAAKKGTVAEN 202
           CHLVGG++L+E IK G   +DFDK+ ATP++   L SQ            A KKGTV+EN
Sbjct: 137 CHLVGGTELIEAIKNGDTPIDFDKALATPDVVAQLTSQLASVLGPRRLLPAVKKGTVSEN 196

Query: 203 LEPLLKNSMGTLPFRQRGNVVSVAVGKCSFTDKQLLENILAAQKGLKEALATQKTKKPSL 262
           +  L++ +M T+PFRQRG  +SVAVGKC F+DKQLL+NI+A QK  K+ALA Q+ KK S+
Sbjct: 197 IANLIRENMFTVPFRQRGPFLSVAVGKCDFSDKQLLQNIVAVQKAFKQALADQQGKKSSI 256

Query: 263 LGQTTLTSTHGPGIVIDF 280
           LG+TT+TSTHGPGIVIDF
Sbjct: 257 LGKTTVTSTHGPGIVIDF 274

>TPHA0J00770 Chr10 complement(179754..180590) [837 bp, 278 aa] {ON}
           Anc_8.268 YDR116C
          Length = 278

 Score =  296 bits (757), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 142/274 (51%), Positives = 198/274 (72%), Gaps = 5/274 (1%)

Query: 12  LVQFPYARNLHAFSALRAE----ETPSPVVSKLSKDQLRKREIXXXXXXXXXXXXXXTDH 67
            +Q       H    +R E    E P   VSKLSKDQL+KRE+              T H
Sbjct: 6   FLQVTRKNAFHVSRIIREEITGAEGPIAQVSKLSKDQLKKRELRRFTIRKREAKMPATSH 65

Query: 68  PLYMPVDKALRFLRAAEAGQPHSQQTLSVTTIVISERGAPPLSGNLSFPKPLKDLKIAVF 127
           PLYM V +ALRFLRAAE GQP SQQT+++TT+V+SE+G+P L+G+++F  PLK++KIA+F
Sbjct: 66  PLYMQVPQALRFLRAAEVGQPLSQQTINLTTLVVSEKGSPNLAGDIAFVTPLKEVKIAIF 125

Query: 128 TNDEQQAQIAREKFGCHLVGGSDLVEKIKEGAVSLDFDKSFATPEITTLLASQXXXXXXX 187
           TNDE Q +IA+EKF C++VGGS+L+ KIK G + +DFDK+FATP+I   L S        
Sbjct: 126 TNDETQMKIAKEKFNCYVVGGSELISKIKNGEIEVDFDKAFATPDIVQELGS-VARILGP 184

Query: 188 XXXXXAAKKGTVAENLEPLLKNSMGTLPFRQRGNVVSVAVGKCSFTDKQLLENILAAQKG 247
                + KKGTV+EN+E L+K ++G++PFRQ GN +SVA+GKC+F+D+Q+LEN+++ +K 
Sbjct: 185 RGVFPSIKKGTVSENVEDLIKGNLGSIPFRQLGNCISVAIGKCNFSDRQILENLISVRKA 244

Query: 248 LKEALATQKTKKPSLLGQTTLTSTHGPGIVIDFA 281
            K++++TQKTKKPS+LG+T L++THGPGIVIDF+
Sbjct: 245 FKDSVSTQKTKKPSILGKTILSTTHGPGIVIDFS 278

>TDEL0F03950 Chr6 complement(732544..733374) [831 bp, 276 aa] {ON}
           Anc_8.268 YDR116C
          Length = 276

 Score =  290 bits (743), Expect = 4e-98,   Method: Compositional matrix adjust.
 Identities = 150/261 (57%), Positives = 194/261 (74%), Gaps = 1/261 (0%)

Query: 21  LHAFSALRAEETPSPVVSKLSKDQLRKREIXXXXXXXXXXXXXXTDHPLYMPVDKALRFL 80
           LH  + LRAEE  + V SKLSKDQL+KREI              +DHPLYM +  ALRFL
Sbjct: 17  LHTGNVLRAEEAAANV-SKLSKDQLKKREIRRLAQRKAAAKKSPSDHPLYMSIPMALRFL 75

Query: 81  RAAEAGQPHSQQTLSVTTIVISERGAPPLSGNLSFPKPLKDLKIAVFTNDEQQAQIAREK 140
           RAAE GQP +QQT+++TT V++ERG P L+G++SFPKPLK++KIAVF+ DE Q ++AREK
Sbjct: 76  RAAEVGQPQTQQTITLTTAVVAERGVPALAGSVSFPKPLKEVKIAVFSGDEDQLKVAREK 135

Query: 141 FGCHLVGGSDLVEKIKEGAVSLDFDKSFATPEITTLLASQXXXXXXXXXXXXAAKKGTVA 200
           F CHLVGG++++EKIK G + +DFDK+FATP+I   L SQ              KKGTVA
Sbjct: 136 FNCHLVGGTEIIEKIKSGEIPVDFDKAFATPDIAPALTSQLARILGPRGVLPTVKKGTVA 195

Query: 201 ENLEPLLKNSMGTLPFRQRGNVVSVAVGKCSFTDKQLLENILAAQKGLKEALATQKTKKP 260
            ++  L+++SMG++PFRQRGN +S+AVGK SF+D+Q+LEN +A    +KEALA Q +KK 
Sbjct: 196 TDVSRLVQDSMGSMPFRQRGNAISIAVGKSSFSDRQILENAIATHDAVKEALANQVSKKT 255

Query: 261 SLLGQTTLTSTHGPGIVIDFA 281
           SLLG+TTL+STHGPGIVIDFA
Sbjct: 256 SLLGKTTLSSTHGPGIVIDFA 276

>AGR080W Chr7 (881213..882040) [828 bp, 275 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR116C (MRPL1)
          Length = 275

 Score =  280 bits (715), Expect = 5e-94,   Method: Compositional matrix adjust.
 Identities = 134/264 (50%), Positives = 186/264 (70%), Gaps = 1/264 (0%)

Query: 17  YARNLHAFSALRAEETPSPVVSKLSKDQLRKREIXXXXXXXXXXXXXXTDHPLYMPVDKA 76
           + R LH  +A++  +  +   SKLSKDQL+KRE+              +  PLYMPV +A
Sbjct: 11  FRRGLH-LTAVQLSQEAAATSSKLSKDQLKKRELRRLAQRKAAARRPASASPLYMPVQQA 69

Query: 77  LRFLRAAEAGQPHSQQTLSVTTIVISERGAPPLSGNLSFPKPLKDLKIAVFTNDEQQAQI 136
           LRFLRAAE GQP +QQT+SV T+VI ++GA  LSG ++ P P+++ K+AVFTND +QA+ 
Sbjct: 70  LRFLRAAEVGQPATQQTISVNTMVIGDKGAALLSGTVTLPSPMRETKVAVFTNDPEQAET 129

Query: 137 AREKFGCHLVGGSDLVEKIKEGAVSLDFDKSFATPEITTLLASQXXXXXXXXXXXXAAKK 196
           AR K+GC+LVGG++LVE++K G V +DFDK+FATP+I  L+A++            + KK
Sbjct: 130 ARTKYGCYLVGGAELVEQLKSGEVKVDFDKAFATPDIAPLMAAKLGRVLGPKGLLPSVKK 189

Query: 197 GTVAENLEPLLKNSMGTLPFRQRGNVVSVAVGKCSFTDKQLLENILAAQKGLKEALATQK 256
           GTVA +L  LL + + + PF+QR N +S+A+GKC F+D+Q++EN+LA Q   + A+ +QK
Sbjct: 190 GTVAGDLSELLGDDINSTPFKQRNNCISLAIGKCHFSDRQIMENLLAVQAAFRAAMTSQK 249

Query: 257 TKKPSLLGQTTLTSTHGPGIVIDF 280
           TKK SL G TTLTSTHGPGIVIDF
Sbjct: 250 TKKTSLFGTTTLTSTHGPGIVIDF 273

>YDR116C Chr4 complement(682724..683581) [858 bp, 285 aa] {ON}
           MRPL1Mitochondrial ribosomal protein of the large
           subunit
          Length = 285

 Score =  279 bits (713), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 130/242 (53%), Positives = 178/242 (73%)

Query: 40  LSKDQLRKREIXXXXXXXXXXXXXXTDHPLYMPVDKALRFLRAAEAGQPHSQQTLSVTTI 99
           L+KDQ +KRE+              T  PLYMPV KALR+LRAAE G+P SQQT+++TT+
Sbjct: 44  LTKDQAKKRELKRLVQRKAEAKRPATASPLYMPVTKALRYLRAAEVGRPQSQQTINLTTL 103

Query: 100 VISERGAPPLSGNLSFPKPLKDLKIAVFTNDEQQAQIAREKFGCHLVGGSDLVEKIKEGA 159
           V+ ERG  PLSG+++FPKPL+ +KIA FTNDE + +  REK+  HL+GG+DLV KIK G 
Sbjct: 104 VVGERGTAPLSGSVTFPKPLRYIKIAAFTNDESKLEELREKYPNHLIGGADLVAKIKSGE 163

Query: 160 VSLDFDKSFATPEITTLLASQXXXXXXXXXXXXAAKKGTVAENLEPLLKNSMGTLPFRQR 219
           +S+DFDK+FATP+I   L SQ            + KKGTV++++  LL+ S+G++PFRQR
Sbjct: 164 ISVDFDKAFATPDIVPALQSQVARILGPRGVLPSVKKGTVSDDISSLLQESLGSMPFRQR 223

Query: 220 GNVVSVAVGKCSFTDKQLLENILAAQKGLKEALATQKTKKPSLLGQTTLTSTHGPGIVID 279
           GN +S+ VGKC FTD+++L+NI++A+   K A+  QK+KKP++L +TTL+STHGPGIVID
Sbjct: 224 GNSISIGVGKCYFTDREILQNIISARAAFKTAVDNQKSKKPNILSKTTLSSTHGPGIVID 283

Query: 280 FA 281
           FA
Sbjct: 284 FA 285

>Kpol_392.3 s392 (3674..4519) [846 bp, 281 aa] {ON} (3674..4519)
           [846 nt, 282 aa]
          Length = 281

 Score =  277 bits (709), Expect = 7e-93,   Method: Compositional matrix adjust.
 Identities = 139/285 (48%), Positives = 194/285 (68%), Gaps = 8/285 (2%)

Query: 1   MLSR----LSKRIVPLVQFPYARNLHAFSALRAEETPSPVVSKLSKDQLRKREIXXXXXX 56
           MLSR    LS+R     ++   R L A +   +E   +  VSK  KD+L++RE+      
Sbjct: 1   MLSRSFGILSRR----CEYHSGRVLLAEAVAASETASAKPVSKSVKDKLKRRELRRHSKR 56

Query: 57  XXXXXXXXTDHPLYMPVDKALRFLRAAEAGQPHSQQTLSVTTIVISERGAPPLSGNLSFP 116
                   + +PLYMP+ +ALR+LRAAE GQP SQQ +++TT V+SERG   L+GN+S+ 
Sbjct: 57  KADARKPASSYPLYMPISQALRYLRAAEVGQPISQQIITITTDVVSERGNLNLNGNISYN 116

Query: 117 KPLKDLKIAVFTNDEQQAQIAREKFGCHLVGGSDLVEKIKEGAVSLDFDKSFATPEITTL 176
            P+KD+KIAVF+ND ++    +E+  CHL+GG+DLVEKIK G   +DFDK+FATP+I+ +
Sbjct: 117 TPIKDVKIAVFSNDPEKLAKIKEEHNCHLIGGTDLVEKIKSGKQPVDFDKAFATPDISPM 176

Query: 177 LASQXXXXXXXXXXXXAAKKGTVAENLEPLLKNSMGTLPFRQRGNVVSVAVGKCSFTDKQ 236
           L SQ              KKGTV+E++  L+K S+G +PFRQ GN +SV+VG+C+F+DKQ
Sbjct: 177 LTSQLARVLGPRGVLPTIKKGTVSEDVSSLIKGSIGLMPFRQTGNSISVSVGRCNFSDKQ 236

Query: 237 LLENILAAQKGLKEALATQKTKKPSLLGQTTLTSTHGPGIVIDFA 281
           +LENI+A +      L++QK+KKPSLLG+TT+TSTHGPGI IDFA
Sbjct: 237 ILENIIAVRSAYNTTLSSQKSKKPSLLGKTTITSTHGPGITIDFA 281

>NCAS0B03810 Chr2 (680870..681814) [945 bp, 314 aa] {ON} Anc_8.268
           YDR116C
          Length = 314

 Score =  276 bits (705), Expect = 7e-92,   Method: Compositional matrix adjust.
 Identities = 130/270 (48%), Positives = 191/270 (70%), Gaps = 7/270 (2%)

Query: 18  ARNLHAFSALRAEETPS-------PVVSKLSKDQLRKREIXXXXXXXXXXXXXXTDHPLY 70
           +R +H+ S + AEE  S       PVV  LSK+QL+KRE+              + HPLY
Sbjct: 44  SRGIHSTSNVGAEEAASTTTSATIPVVPTLSKEQLKKRELRRLSQRKTEAKRPASIHPLY 103

Query: 71  MPVDKALRFLRAAEAGQPHSQQTLSVTTIVISERGAPPLSGNLSFPKPLKDLKIAVFTND 130
           MPV +ALR++RAAE G+P  QQT+++T++V++E+G  PL+G++S P+PLK LK+AVF+ +
Sbjct: 104 MPVVEALRYIRAAEVGRPSGQQTITLTSLVVNEKGVAPLNGHISLPRPLKALKVAVFSQN 163

Query: 131 EQQAQIAREKFGCHLVGGSDLVEKIKEGAVSLDFDKSFATPEITTLLASQXXXXXXXXXX 190
           E+     +EK+ CHLVGG +L+ KIK G V  DFDK+FA+ ++  +L++Q          
Sbjct: 164 EELLTRMKEKYHCHLVGGVELINKIKNGEVKTDFDKAFASSDMANILSAQLGKTLGRRGL 223

Query: 191 XXAAKKGTVAENLEPLLKNSMGTLPFRQRGNVVSVAVGKCSFTDKQLLENILAAQKGLKE 250
              AKKGTV+++LE LL + +G+LPFRQ GN +S+ +GKC F+D+++L NI+AA+  + +
Sbjct: 224 LPNAKKGTVSDDLESLLADKIGSLPFRQTGNCISIGIGKCHFSDEEILRNIIAARSAVMK 283

Query: 251 ALATQKTKKPSLLGQTTLTSTHGPGIVIDF 280
           AL+ QK+KKPS+LG+TTL+STHGPGIVIDF
Sbjct: 284 ALSEQKSKKPSILGKTTLSSTHGPGIVIDF 313

>Smik_4.360 Chr4 complement(644029..644886) [858 bp, 285 aa] {ON}
           YDR116C (REAL)
          Length = 285

 Score =  271 bits (692), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 130/264 (49%), Positives = 183/264 (69%), Gaps = 4/264 (1%)

Query: 22  HAFSALRAEETPSPVVSK----LSKDQLRKREIXXXXXXXXXXXXXXTDHPLYMPVDKAL 77
           H    L AEE     +S     L+KDQ +KRE+                +PLYMPV  AL
Sbjct: 22  HTAKKLYAEEYKPTAMSSNAPSLTKDQAKKRELKRLAQRKAEAKRPAATNPLYMPVTMAL 81

Query: 78  RFLRAAEAGQPHSQQTLSVTTIVISERGAPPLSGNLSFPKPLKDLKIAVFTNDEQQAQIA 137
           R+LRAAE G+P SQQT+++TT+V+ ERG  PLSG+++FPKPL+ +K+A FTNDE + +  
Sbjct: 82  RYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVTFPKPLRYIKVAAFTNDENKLEEL 141

Query: 138 REKFGCHLVGGSDLVEKIKEGAVSLDFDKSFATPEITTLLASQXXXXXXXXXXXXAAKKG 197
           R+K+  HL+GG+DLV +IK G + +DFDK+FATP+I   L SQ            + KKG
Sbjct: 142 RKKYPNHLIGGADLVARIKSGEIPVDFDKAFATPDIVPTLQSQVARILGPRGVLPSLKKG 201

Query: 198 TVAENLEPLLKNSMGTLPFRQRGNVVSVAVGKCSFTDKQLLENILAAQKGLKEALATQKT 257
           TV++++  LL+ S+G++PFRQRGN +S+ VGKC F+D+++L+NI++A+   K A+  QK+
Sbjct: 202 TVSDDINSLLEESLGSMPFRQRGNSISLGVGKCYFSDREILQNIISARSAFKAAVNNQKS 261

Query: 258 KKPSLLGQTTLTSTHGPGIVIDFA 281
           KKP+LL +TTL+STHGPGIVIDFA
Sbjct: 262 KKPNLLSKTTLSSTHGPGIVIDFA 285

>Skud_4.376 Chr4 complement(654375..655232) [858 bp, 285 aa] {ON}
           YDR116C (REAL)
          Length = 285

 Score =  265 bits (676), Expect = 8e-88,   Method: Compositional matrix adjust.
 Identities = 131/264 (49%), Positives = 186/264 (70%), Gaps = 4/264 (1%)

Query: 22  HAFSALRAEETPSPVVSK----LSKDQLRKREIXXXXXXXXXXXXXXTDHPLYMPVDKAL 77
           H  S L AEE  S  +S     L+K+Q +KRE+                +PLYMPV  AL
Sbjct: 22  HTASKLYAEEYKSTAMSSNAPSLTKEQAKKRELKRLAQRRAEAKRPAATNPLYMPVTVAL 81

Query: 78  RFLRAAEAGQPHSQQTLSVTTIVISERGAPPLSGNLSFPKPLKDLKIAVFTNDEQQAQIA 137
           R+LRAAE G+P SQQT+++TT+V+ ERG  PLSG+++FPKPL+ +K+AVFTNDE + +  
Sbjct: 82  RYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVAFPKPLRYIKVAVFTNDENKLKEL 141

Query: 138 REKFGCHLVGGSDLVEKIKEGAVSLDFDKSFATPEITTLLASQXXXXXXXXXXXXAAKKG 197
           REK+  HL+GG+DLV +IK G + +DFDK++AT +I   L SQ            + KKG
Sbjct: 142 REKYPNHLIGGADLVSRIKNGEIPVDFDKAYATADIVPALQSQVARILGPRGVLPSVKKG 201

Query: 198 TVAENLEPLLKNSMGTLPFRQRGNVVSVAVGKCSFTDKQLLENILAAQKGLKEALATQKT 257
           TV++++  LL+ S+G++PFRQRGN +S+ +GKC FTD+++L+NI+AA+   K A++ QK+
Sbjct: 202 TVSDDITSLLQESLGSMPFRQRGNSISLGIGKCYFTDREVLQNIIAARAAFKAAVSDQKS 261

Query: 258 KKPSLLGQTTLTSTHGPGIVIDFA 281
           KKP++L +TTL+STHGPGIVIDFA
Sbjct: 262 KKPNILSKTTLSSTHGPGIVIDFA 285

>Suva_2.275 Chr2 complement(477386..478243) [858 bp, 285 aa] {ON}
           YDR116C (REAL)
          Length = 285

 Score =  263 bits (672), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 133/271 (49%), Positives = 182/271 (67%), Gaps = 5/271 (1%)

Query: 16  PYARNL-HAFSALRAEETPSPVVSK----LSKDQLRKREIXXXXXXXXXXXXXXTDHPLY 70
           P  R L H    L AEE  +  +S     L+KDQ +KRE+                 PL+
Sbjct: 15  PIRRYLSHTARQLYAEEYKTAAMSSNAPSLTKDQAKKRELKRLAQRRAEAKRPAATSPLH 74

Query: 71  MPVDKALRFLRAAEAGQPHSQQTLSVTTIVISERGAPPLSGNLSFPKPLKDLKIAVFTND 130
           MPV  ALR+LRAAE G+P SQQT+++TT+V+ ERG  P+SGN++F KPL+ +K+AVFTND
Sbjct: 75  MPVTMALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPISGNVTFSKPLRYVKVAVFTND 134

Query: 131 EQQAQIAREKFGCHLVGGSDLVEKIKEGAVSLDFDKSFATPEITTLLASQXXXXXXXXXX 190
           E + +  REK+   +VGG+DLV KIK     +DFDK+FATP+I   L SQ          
Sbjct: 135 EVKLKELREKYPNLIVGGTDLVAKIKNNESPVDFDKAFATPDIVPTLQSQVARILGPRGV 194

Query: 191 XXAAKKGTVAENLEPLLKNSMGTLPFRQRGNVVSVAVGKCSFTDKQLLENILAAQKGLKE 250
             + KKGTV++++  LL+ S+G++PFRQRGN +S+ +GKC FTD++LL+NI++A+   + 
Sbjct: 195 LPSVKKGTVSDDITSLLQESLGSMPFRQRGNAISLGIGKCYFTDRELLQNIISARTAFRA 254

Query: 251 ALATQKTKKPSLLGQTTLTSTHGPGIVIDFA 281
           A+  QK KKPSLL +TTL+STHGPGIVIDFA
Sbjct: 255 AVDNQKAKKPSLLSKTTLSSTHGPGIVIDFA 285

>NDAI0J01330 Chr10 (309586..310530) [945 bp, 314 aa] {ON} Anc_8.268
           YDR116C
          Length = 314

 Score =  250 bits (639), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 120/248 (48%), Positives = 166/248 (66%)

Query: 33  PSPVVSKLSKDQLRKREIXXXXXXXXXXXXXXTDHPLYMPVDKALRFLRAAEAGQPHSQQ 92
           P    +KLSK+QL+KREI                HPLYM V  ALRF+RAAE G+P  QQ
Sbjct: 66  PPANATKLSKEQLKKREIRRLSQRKQQARQPANSHPLYMEVVDALRFIRAAEVGRPEGQQ 125

Query: 93  TLSVTTIVISERGAPPLSGNLSFPKPLKDLKIAVFTNDEQQAQIAREKFGCHLVGGSDLV 152
           T+++TT+++SE+G   L+GN+   +PLK+LKIAVF+ D++  +  + +F C LVGG++ V
Sbjct: 126 TITLTTLIVSEKGTSLLNGNMKLFRPLKELKIAVFSTDKELLEEVKSQFNCQLVGGNETV 185

Query: 153 EKIKEGAVSLDFDKSFATPEITTLLASQXXXXXXXXXXXXAAKKGTVAENLEPLLKNSMG 212
           E IK+G +  +FD +FATPEI   + SQ              KKGTV+++L  L+   MG
Sbjct: 186 EGIKDGTIRANFDVAFATPEIVPFINSQLGKQLGRRGILPNTKKGTVSDDLVTLMNAKMG 245

Query: 213 TLPFRQRGNVVSVAVGKCSFTDKQLLENILAAQKGLKEALATQKTKKPSLLGQTTLTSTH 272
            +PF+Q GN +S+ +GKC F+DK +L NI+AA+   KEALA QK K+PS+L +TTL+STH
Sbjct: 246 NIPFKQTGNNISIPIGKCYFSDKDILLNIIAARDAFKEALANQKAKRPSILSKTTLSSTH 305

Query: 273 GPGIVIDF 280
           GPGIVIDF
Sbjct: 306 GPGIVIDF 313

>KAFR0B05480 Chr2 (1122727..1123569) [843 bp, 280 aa] {ON} Anc_8.268
           YDR116C
          Length = 280

 Score =  224 bits (572), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 111/244 (45%), Positives = 155/244 (63%), Gaps = 1/244 (0%)

Query: 38  SKLSKDQLRKREIXXXXXXXXXXXXXXTDHPLYMPVDKALRFLRAAEAGQPHSQQTLSVT 97
           SK +K Q +K+ +              ++HPLYM V  ALRFLRA E GQP SQQT+++T
Sbjct: 36  SKTNKQQAKKKMLRDFLRSRKQAREPASNHPLYMKVPDALRFLRAVEVGQPRSQQTITLT 95

Query: 98  TIVISERGAPPLSGNLSFPKPLKDLKIAVFTNDEQQAQIAREKF-GCHLVGGSDLVEKIK 156
           T+VISE+G PP+ GN+  P PL++ K+ V ++D ++ +  ++ F   HLVGG +LV+K K
Sbjct: 96  TLVISEKGVPPVYGNVQLPTPLRNSKVVVLSDDPKKLEEVQDNFKNVHLVGGRELVDKFK 155

Query: 157 EGAVSLDFDKSFATPEITTLLASQXXXXXXXXXXXXAAKKGTVAENLEPLLKNSMGTLPF 216
              + +DFDK  ATP+I                     KKGTV+ENL  L+  ++ ++PF
Sbjct: 156 NEDIEIDFDKVVATPDILNYTNQNLGKMFGPKGLLPNVKKGTVSENLIELMNENVSSMPF 215

Query: 217 RQRGNVVSVAVGKCSFTDKQLLENILAAQKGLKEALATQKTKKPSLLGQTTLTSTHGPGI 276
           RQR   +S+ +GK  F+DKQ+LENI+A ++     L+ QKTKK S LG+TTLTSTHGPGI
Sbjct: 216 RQRAGCISLGIGKVEFSDKQILENIIATREAFLNTLSNQKTKKQSTLGKTTLTSTHGPGI 275

Query: 277 VIDF 280
           VIDF
Sbjct: 276 VIDF 279

>KNAG0H03210 Chr8 (601470..602327) [858 bp, 285 aa] {ON} Anc_8.268
           YDR116C
          Length = 285

 Score =  210 bits (535), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 101/243 (41%), Positives = 160/243 (65%)

Query: 39  KLSKDQLRKREIXXXXXXXXXXXXXXTDHPLYMPVDKALRFLRAAEAGQPHSQQTLSVTT 98
           KL+K+QLR+RE+              +   +Y+ V +A+R LRA E GQP SQQT+++TT
Sbjct: 43  KLTKEQLRRRELRKMIRSKMLAKRPASQDKVYLSVPEAMRILRAVEVGQPTSQQTITLTT 102

Query: 99  IVISERGAPPLSGNLSFPKPLKDLKIAVFTNDEQQAQIAREKFGCHLVGGSDLVEKIKEG 158
           +V+SE+G PPL G++  P PLK ++IA F+ D +  +  +E+    +VGG++L++++K G
Sbjct: 103 MVVSEKGVPPLHGDVVLPTPLKPVRIAAFSADPELLKRLQEEVELEIVGGAELIDQLKSG 162

Query: 159 AVSLDFDKSFATPEITTLLASQXXXXXXXXXXXXAAKKGTVAENLEPLLKNSMGTLPFRQ 218
            V + FDK+FATP+I   L S+              KKGTV  +L  ++++ +G +PFRQ
Sbjct: 163 EVPVQFDKAFATPDIAPQLNSKLGALLGRRGLLPNIKKGTVGPDLLAMIRSKVGAMPFRQ 222

Query: 219 RGNVVSVAVGKCSFTDKQLLENILAAQKGLKEALATQKTKKPSLLGQTTLTSTHGPGIVI 278
           R   ++  + KC F+D+Q+L N++AA++  + A+  QK+KK S+LG++TL+STHGPGIVI
Sbjct: 223 RAANLAFGIAKCHFSDRQVLGNLIAAREAFQLAIQNQKSKKRSILGRSTLSSTHGPGIVI 282

Query: 279 DFA 281
           D A
Sbjct: 283 DLA 285

>CAGL0B01815g Chr2 complement(165648..166520) [873 bp, 290 aa] {ON}
           similar to uniprot|Q04599 Saccharomyces cerevisiae
           YDR116c
          Length = 290

 Score =  210 bits (535), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 103/247 (41%), Positives = 163/247 (65%), Gaps = 6/247 (2%)

Query: 40  LSKDQLRKREIXXXXXXXXXXXXXXTDHPLYMPVDKALRFLRAAEAGQPHSQQTLSVTTI 99
           L+K+Q +KRE+                HPLYMP+  ALR+LR+AE G+P   QT++VTT+
Sbjct: 43  LTKEQAKKREMKRLALKKAEAKKPANIHPLYMPIPLALRYLRSAEVGRPTQHQTITVTTL 102

Query: 100 VISERGAPPLSGNLSFPKPLKDLKIAVFTNDEQQAQIAREKFG--CHLVGGSDLVEKIKE 157
           V++++G   L+GN+ FP PLK +KIA+F++++++    + K+     + GG D++  IK 
Sbjct: 103 VVADKGNAALAGNILFPHPLKQMKIAIFSSNKEKLDELKSKYSKQVKIAGGEDMIADIKS 162

Query: 158 GAVSLD-FDKSFATPEITTLLASQXXXXXXXXXXXXAAKK---GTVAENLEPLLKNSMGT 213
           G + +D  +K FATPEI   +ASQ              KK    TV E+L+ L++ ++G 
Sbjct: 163 GKIKVDGVNKVFATPEIFPTIASQLGRVLGPKGLMPNLKKQHQNTVGEDLDSLIEENLGQ 222

Query: 214 LPFRQRGNVVSVAVGKCSFTDKQLLENILAAQKGLKEALATQKTKKPSLLGQTTLTSTHG 273
           + FRQRGN +SV+VG+C+F+D+ +LENI+A +   K+++++Q  KKPS+LG+TT+++T G
Sbjct: 223 VSFRQRGNSLSVSVGRCNFSDRDILENIIAVRNAFKQSVSSQVAKKPSILGKTTISTTAG 282

Query: 274 PGIVIDF 280
           PGIVIDF
Sbjct: 283 PGIVIDF 289

>TBLA0I03190 Chr9 complement(768942..769667) [726 bp, 241 aa] {ON}
           Anc_8.268 YDR116C
          Length = 241

 Score =  172 bits (435), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 90/215 (41%), Positives = 138/215 (64%), Gaps = 2/215 (0%)

Query: 66  DHPLYMPVDKALRFLRAAEAGQPHSQQTLSVTTIVISERGAPPLSGNLSFPKPLKDLKIA 125
           +HPL M V  ALR+LRA E+G+  S+QT+++ T+V + RG  PL G ++F   ++   IA
Sbjct: 28  NHPLKMEVPLALRYLRAIESGRKSSEQTVTLQTVVAAARGNTPLRGEINFHMLIRKPVIA 87

Query: 126 VFTNDEQQAQIAREKFGCHLVGGSDLVEKIKEGAVSLDFDKSFATPEITTLLASQXXXXX 185
           VFT D +Q +IA+E  G  ++GGS+L++KI  G   + F  +FAT ++   LA +     
Sbjct: 88  VFTEDPEQHKIAKE-MGIDIIGGSELIDKIASGEQKITFQTAFATTDMVQDLA-RVAQKL 145

Query: 186 XXXXXXXAAKKGTVAENLEPLLKNSMGTLPFRQRGNVVSVAVGKCSFTDKQLLENILAAQ 245
                    KK TV +N+  LL++ +  +PF ++ + +S  VGKCSFTD+++L N++ A+
Sbjct: 146 GKQKVLPQLKKKTVGDNIRELLQDKLYVVPFAEKASFISFPVGKCSFTDEEILRNLIKAR 205

Query: 246 KGLKEALATQKTKKPSLLGQTTLTSTHGPGIVIDF 280
           +GL++AL  Q  KKPS + + TLTSTHGPGI ID 
Sbjct: 206 EGLQKALREQNNKKPSTIIKATLTSTHGPGIDIDL 240

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.131    0.363 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 23,900,102
Number of extensions: 836337
Number of successful extensions: 1958
Number of sequences better than 10.0: 23
Number of HSP's gapped: 2003
Number of HSP's successfully gapped: 23
Length of query: 281
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 173
Effective length of database: 41,097,471
Effective search space: 7109862483
Effective search space used: 7109862483
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 65 (29.6 bits)