Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_56.237718.269ON56255324500.0
KLTH0G13530g8.269ON57456419820.0
SAKL0H16874g8.269ON56355415870.0
TDEL0F039608.269ON55855213800.0
Suva_2.2768.269ON56555813291e-178
YDR117C (TMA64)8.269ON56555813151e-176
Skud_4.3778.269ON56256513141e-176
ZYRO0C01496g8.269ON56756212961e-173
NCAS0B038008.269ON56555712751e-170
Smik_4.3618.269ON56555812411e-165
TPHA0J007808.269ON58357412401e-164
NDAI0J013108.269ON57957611871e-156
CAGL0B01837g8.269ON56956011701e-154
Kpol_392.28.269ON56656611311e-148
KAFR0B054708.269ON56255911271e-148
Ecym_43018.269ON56456810901e-142
KLLA0F19294g8.269ON57056610701e-139
TBLA0I032008.269ON56356610511e-136
AGR079W8.269ON5425639871e-127
KNAG0H032008.269ON5615649051e-114
Suva_8.2658.631ON42387742.1
Smik_15.3988.631ON42546723.2
YOR212W (STE4)8.631ON42343705.6
SAKL0G15620g5.94ON87962706.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_56.23771
         (562 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_56.23771 s56 (698257..699945) [1689 bp, 562 aa] {ON} YDR117...   948   0.0  
KLTH0G13530g Chr7 (1161702..1163426) [1725 bp, 574 aa] {ON} simi...   768   0.0  
SAKL0H16874g Chr8 (1484425..1486116) [1692 bp, 563 aa] {ON} simi...   615   0.0  
TDEL0F03960 Chr6 complement(733512..735188) [1677 bp, 558 aa] {O...   536   0.0  
Suva_2.276 Chr2 complement(478604..480301) [1698 bp, 565 aa] {ON...   516   e-178
YDR117C Chr4 complement(683946..685643) [1698 bp, 565 aa] {ON}  ...   511   e-176
Skud_4.377 Chr4 complement(655577..657265) [1689 bp, 562 aa] {ON...   510   e-176
ZYRO0C01496g Chr3 (108150..109853) [1704 bp, 567 aa] {ON} simila...   503   e-173
NCAS0B03800 Chr2 (678984..680681) [1698 bp, 565 aa] {ON} Anc_8.2...   495   e-170
Smik_4.361 Chr4 complement(645227..646924) [1698 bp, 565 aa] {ON...   482   e-165
TPHA0J00780 Chr10 complement(180939..182690) [1752 bp, 583 aa] {...   482   e-164
NDAI0J01310 Chr10 (306474..308213) [1740 bp, 579 aa] {ON} Anc_8....   461   e-156
CAGL0B01837g Chr2 complement(166953..168662) [1710 bp, 569 aa] {...   455   e-154
Kpol_392.2 s392 (1564..3264) [1701 bp, 566 aa] {ON} (1564..3264)...   440   e-148
KAFR0B05470 Chr2 (1120794..1122482) [1689 bp, 562 aa] {ON} Anc_8...   438   e-148
Ecym_4301 Chr4 (644340..646034) [1695 bp, 564 aa] {ON} similar t...   424   e-142
KLLA0F19294g Chr6 complement(1784664..1786376) [1713 bp, 570 aa]...   416   e-139
TBLA0I03200 Chr9 complement(769960..771651) [1692 bp, 563 aa] {O...   409   e-136
AGR079W Chr7 (879417..881045) [1629 bp, 542 aa] {ON} Syntenic ho...   384   e-127
KNAG0H03200 Chr8 (599611..601296) [1686 bp, 561 aa] {ON} Anc_8.2...   353   e-114
Suva_8.265 Chr8 (481783..483054) [1272 bp, 423 aa] {ON} YOR212W ...    33   2.1  
Smik_15.398 Chr15 (692606..693883) [1278 bp, 425 aa] {ON} YOR212...    32   3.2  
YOR212W Chr15 (742910..744181) [1272 bp, 423 aa] {ON}  STE4G pro...    32   5.6  
SAKL0G15620g Chr7 (1342049..1344688) [2640 bp, 879 aa] {ON} some...    32   6.4  

>Kwal_56.23771 s56 (698257..699945) [1689 bp, 562 aa] {ON} YDR117C -
           Hypothetical ORF [contig 173] FULL
          Length = 562

 Score =  948 bits (2450), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 473/553 (85%), Positives = 473/553 (85%)

Query: 1   MFKKEPQIKALSNLKNSERKKLQSQCREQVQPSDYSFPSQVIKQXXXXXXXXXXXXXXDD 60
           MFKKEPQIKALSNLKNSERKKLQSQCREQVQPSDYSFPSQVIKQ              DD
Sbjct: 1   MFKKEPQIKALSNLKNSERKKLQSQCREQVQPSDYSFPSQVIKQTTFKTPFTTGTVYTDD 60

Query: 61  KNIPIWFKEKFSDLLYPTVFSCWSNKDLVPIVLAHEYVVEEKLLKGANLMLPGTVPPFDE 120
           KNIPIWFKEKFSDLLYPTVFSCWSNKDLVPIVLAHEYVVEEKLLKGANLMLPGTVPPFDE
Sbjct: 61  KNIPIWFKEKFSDLLYPTVFSCWSNKDLVPIVLAHEYVVEEKLLKGANLMLPGTVPPFDE 120

Query: 121 RCVKTKMVGVASTHSPDVVKAIGIVQLNLPQYSRVIGESGVAVEIVHTFDDELCKAFKVK 180
           RCVKTKMVGVASTHSPDVVKAIGIVQLNLPQYSRVIGESGVAVEIVHTFDDELCKAFKVK
Sbjct: 121 RCVKTKMVGVASTHSPDVVKAIGIVQLNLPQYSRVIGESGVAVEIVHTFDDELCKAFKVK 180

Query: 181 LQPPEGADGIXXXXXXXXXXXXXXGAIKIEPKPSAPLQEPIVNIDDAAEQLSQLSVEDVD 240
           LQPPEGADGI              GAIKIEPKPSAPLQEPIVNIDDAAEQLSQLSVEDVD
Sbjct: 181 LQPPEGADGIAESDSEENSDAEVSGAIKIEPKPSAPLQEPIVNIDDAAEQLSQLSVEDVD 240

Query: 241 HFFTRALYYTLTQDSKLEVPCSASNFVSNHILRNLPPLDHTQVNMKKTSWKKTAKFLKHX 300
           HFFTRALYYTLTQDSKLEVPCSASNFVSNHILRNLPPLDHTQVNMKKTSWKKTAKFLKH 
Sbjct: 241 HFFTRALYYTLTQDSKLEVPCSASNFVSNHILRNLPPLDHTQVNMKKTSWKKTAKFLKHF 300

Query: 301 XXXXXXXXXXXXXXXTIVGLDKTKDELKHFVPYRXXXXXXXXXXXXXXXXXMMKALVIYK 360
                          TIVGLDKTKDELKHFVPYR                 MMKALVIYK
Sbjct: 301 EKEGFLKLKGKGDDLTIVGLDKTKDELKHFVPYRTGGNSGGSTGSESEQNSMMKALVIYK 360

Query: 361 PMSSAKPFLCATDLSPNSMFSPQELKGAVDAYIASKGLVSQDNKAAVRLDDLLFSLVNRS 420
           PMSSAKPFLCATDLSPNSMFSPQELKGAVDAYIASKGLVSQDNKAAVRLDDLLFSLVNRS
Sbjct: 361 PMSSAKPFLCATDLSPNSMFSPQELKGAVDAYIASKGLVSQDNKAAVRLDDLLFSLVNRS 420

Query: 421 TKKENAVRTILRAQIMPPILKGNFAEHFLVLKPDGTPLFKHPVKGDIPQIQIVTEMKIGR 480
           TKKENAVRTILRAQIMPPILKGNFAEHFLVLKPDGTPLFKHPVKGDIPQIQIVTEMKIGR
Sbjct: 421 TKKENAVRTILRAQIMPPILKGNFAEHFLVLKPDGTPLFKHPVKGDIPQIQIVTEMKIGR 480

Query: 481 KVVTKVSNFEKFQVDADELAEALRKKCSXXXXXXXXXXXXXXXXXXXQGPHGPAVIELLN 540
           KVVTKVSNFEKFQVDADELAEALRKKCS                   QGPHGPAVIELLN
Sbjct: 481 KVVTKVSNFEKFQVDADELAEALRKKCSGSTTIGETTTSPKTTEVTVQGPHGPAVIELLN 540

Query: 541 QLAIPTKWINFVN 553
           QLAIPTKWINFVN
Sbjct: 541 QLAIPTKWINFVN 553

>KLTH0G13530g Chr7 (1161702..1163426) [1725 bp, 574 aa] {ON} similar
           to uniprot|Q04600 Saccharomyces cerevisiae YDR117C RBF64
           Hypothetical ORF
          Length = 574

 Score =  768 bits (1982), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/564 (67%), Positives = 427/564 (75%), Gaps = 12/564 (2%)

Query: 1   MFKKEPQIKALSNLKNSERKKLQSQCREQVQPSDYSFPSQVIKQXXXXXXXXXXXXXXDD 60
           MFKKEPQIKALSNLKNSERK +QSQC+EQ   S+Y+FPSQVIKQ              D 
Sbjct: 1   MFKKEPQIKALSNLKNSERKNIQSQCKEQTGSSEYAFPSQVIKQTTFKTPFTTGTVFTDQ 60

Query: 61  KNIPIWFKEKFSDLLYPTVFSCWSNKDLVPIVLAHEYVVEEKLLKGANLMLPGTVPPFDE 120
           KN+PIWFKEKFSDLLYPTVF+CWSN  L+PIVLAHEYVVEEKLLKGANLMLPGTVPPFDE
Sbjct: 61  KNVPIWFKEKFSDLLYPTVFTCWSNSKLLPIVLAHEYVVEEKLLKGANLMLPGTVPPFDE 120

Query: 121 RCVKTKMVGVASTHSPDVVKAIGIVQLNLPQYSRVIGESGVAVEIVHTFDDELCKAFKVK 180
           RCVKT+MV VAST +PDVVKAIGIVQ+NLPQYSRVIGESGVAVEIVHTF DELCK FKVK
Sbjct: 121 RCVKTRMVSVASTAAPDVVKAIGIVQINLPQYSRVIGESGVAVEIVHTFGDELCKVFKVK 180

Query: 181 LQPPEGADGIXXXXXXXXXXXXXXGAIKIEPKP-SAP-----LQEPIVNIDDAAEQLSQL 234
           LQPPEG+  I                +   P+  +AP     +QEP+VN++D +EQL++L
Sbjct: 181 LQPPEGSAAILDSESEEEADIEDDTGVPSAPESLAAPKSLQDVQEPLVNVEDISEQLTEL 240

Query: 235 SVEDVDHFFTRALYYTLTQDSKLEVPCSASNFVSNHILRNLPPLDHTQVNMKKTSWKKTA 294
            VEDVDHFFTR+LYY+L  D+KLE P SASNFVSNHILRNLPP+DHTQVNMKKTSWKKTA
Sbjct: 241 RVEDVDHFFTRSLYYSLAHDAKLETPISASNFVSNHILRNLPPIDHTQVNMKKTSWKKTA 300

Query: 295 KFLKHXXXXXXXXXXXXXXXXTIVGLDKTKDELKHFVPYR------XXXXXXXXXXXXXX 348
           KFLK+                TI+G+D+TK ELK+F PYR                    
Sbjct: 301 KFLKYFEKEGFLKLKGKGDDLTIIGVDRTKSELKNFAPYRIGGGASSSEKGASSVANEKE 360

Query: 349 XXXMMKALVIYKPMSSAKPFLCATDLSPNSMFSPQELKGAVDAYIASKGLVSQDNKAAVR 408
              +MKA+ +Y+P+SS K FL ATDL PN MF+ Q++K AVD YI++K LVS DNK+AVR
Sbjct: 361 QASVMKAVSLYRPISSTKAFLSATDLPPNQMFTQQDIKSAVDKYISAKNLVSPDNKSAVR 420

Query: 409 LDDLLFSLVNRSTKKENAVRTILRAQIMPPILKGNFAEHFLVLKPDGTPLFKHPVKGDIP 468
           LDDLL+ LVNRS+KKENAVRTI RAQIM P+LKGNF+EHFL+LK DGTPLFKHPVKG IP
Sbjct: 421 LDDLLYDLVNRSSKKENAVRTIARAQIMAPVLKGNFSEHFLILKADGTPLFKHPVKGSIP 480

Query: 469 QIQIVTEMKIGRKVVTKVSNFEKFQVDADELAEALRKKCSXXXXXXXXXXXXXXXXXXXQ 528
           Q+QIVTEMKIGRKVVTKVSNFEKFQVDADELAEALRKKCS                   Q
Sbjct: 481 QVQIVTEMKIGRKVVTKVSNFEKFQVDADELAEALRKKCSGSTTIGEANTSPKTLEVTVQ 540

Query: 529 GPHGPAVIELLNQLAIPTKWINFV 552
           GPHGPAVIELLN+  IPTKWINFV
Sbjct: 541 GPHGPAVIELLNESGIPTKWINFV 564

>SAKL0H16874g Chr8 (1484425..1486116) [1692 bp, 563 aa] {ON} similar
           to uniprot|Q04600 Saccharomyces cerevisiae YDR117C RBF64
           Hypothetical ORF
          Length = 563

 Score =  615 bits (1587), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/554 (57%), Positives = 384/554 (69%), Gaps = 7/554 (1%)

Query: 1   MFKKEPQIKALSNLKNSERKKLQSQCREQVQPSDYSFPSQVIKQXXXXXXXXXXXXXXDD 60
           MFKK+P IKALSNLKNSERKKL +  REQ + SDY FP+QV+KQ              D+
Sbjct: 1   MFKKDPHIKALSNLKNSERKKLLASVREQREVSDYQFPTQVVKQTTFKGQTSAGTVYTDE 60

Query: 61  KNIPIWFKEKFSDLLYPTVFSCWSNKDLVPIVLAHEYVVEEKLLKGANLMLPGTVPPFDE 120
           +N+PIWFKEK   L++PTVF+CWSN D++P+V  H++VVEEKLLKGA+LMLPG VPPF  
Sbjct: 61  QNVPIWFKEKHGSLMFPTVFTCWSNPDILPVVQTHKHVVEEKLLKGADLMLPGMVPPFSS 120

Query: 121 RCVKTKMVGVASTHSPDVVKAIGIVQLNLPQYSRVIGESGVAVEIVHTFDDELCKAFKVK 180
           +C K  +VGVAST SP V+KAIGIVQL+LP Y+RVIGE+GVAV I+HTFDD LCKAFK+K
Sbjct: 121 KCSKGSLVGVASTRSPRVIKAIGIVQLDLPSYTRVIGETGVAVNIIHTFDDGLCKAFKMK 180

Query: 181 LQPPEGADGIXXXXXXXXXXXXXXGAIKIEPKPSA-PLQEPIVNIDDAAEQLSQLSVEDV 239
           L+PPE  +                     E K  A   Q  +VN +DA+EQL++LS ED+
Sbjct: 181 LEPPEAIEDTSSKTEEQEEEHVDSAD---EAKAIATTTQARMVNTEDASEQLNELSAEDI 237

Query: 240 DHFFTRALYYTLTQDSKLEVPCSASNFVSNHILRNLPPLDHTQVNMKKTSWKKTAKFLKH 299
           DHF TR+LYYTLTQD +L++P +ASNFVSNHIL NLPP+DH Q+NMKK+SWKK+AKFLKH
Sbjct: 238 DHFLTRSLYYTLTQDDRLQLPVNASNFVSNHILHNLPPVDHNQINMKKSSWKKSAKFLKH 297

Query: 300 XXXXXXXXXXXXXXXXTIVGLDKTKDELKHFVPYRXXXXX--XXXXXXXXXXXXMMKALV 357
                            +VG++K KDELK FVPYR                   MM+A+ 
Sbjct: 298 FEKANFLKLKGKGDDLVVVGINKDKDELKKFVPYRIGSHGEPTQTKAKAQENSNMMQAVS 357

Query: 358 IYKPMSSAKPFLCATDLSPNSMFSPQELKGAVDAYIASKGLVSQDNKAAVRLDDLLFSLV 417
           +YKP+SSAK F  A DL PN +F+ QELK A+D+YI  K LV++D+K  V LDD LF ++
Sbjct: 358 LYKPISSAKEFSKAVDLPPNKIFTAQELKAALDSYILKKNLVNKDDKKMVLLDDTLFPMI 417

Query: 418 NRSTKKENAVRTILRAQIMPPILKGNFAEHFLVLKPDGTPLFKHPVKGDIPQIQIVTEMK 477
           NRSTKKENA+RTI RAQIMPP L  NF EHF +LK D  PLFK  +KG IP+IQIVTEMK
Sbjct: 418 NRSTKKENALRTISRAQIMPPFLANNFTEHFQILKGD-VPLFKTALKGAIPEIQIVTEMK 476

Query: 478 IGRKVVTKVSNFEKFQVDADELAEALRKKCSXXXXXXXXXXXXXXXXXXXQGPHGPAVIE 537
           IGRKVVTKVSNFEKFQ+DA+ LA  LRK+CS                   QGPHG  VI 
Sbjct: 477 IGRKVVTKVSNFEKFQLDAETLAAELRKRCSGSTTIGETMSSPKTLEVTVQGPHGAIVIG 536

Query: 538 LLNQLAIPTKWINF 551
           +LN+  IPTKWINF
Sbjct: 537 MLNEYGIPTKWINF 550

>TDEL0F03960 Chr6 complement(733512..735188) [1677 bp, 558 aa] {ON}
           Anc_8.269 YDR117C
          Length = 558

 Score =  536 bits (1380), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/552 (48%), Positives = 352/552 (63%), Gaps = 7/552 (1%)

Query: 1   MFKKEPQIKALSNLKNSERKKLQSQCREQVQPSDYSFPSQVIKQXXXXXXXXXXXXXXDD 60
           MFKKEP IKALSNLKNSERKKL   C+EQ   SDY+F + ++KQ              D 
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQSCKEQTGASDYNFSTSIVKQTNYKGQHSDGTVYTDQ 60

Query: 61  KNIPIWFKEKFSDLLYPTVFSCWSNKDLVPIVLAHEYVVEEKLLKGANLMLPGTVPPFDE 120
            N+PIWFKEK  +LL+PTV+SCW+  +L+PIVL H++V+EE+L  GANLML GT+PPFDE
Sbjct: 61  NNVPIWFKEKHGELLFPTVYSCWTAPNLLPIVLTHDFVIEERLFNGANLMLAGTLPPFDE 120

Query: 121 RCVKTKMVGVASTHSPDVVKAIGIVQLNLPQYSRVIGESGVAVEIVHTFDDELCKAFKVK 180
           RCV  K+ G+AS   P V+ AIG+VQLNLP YS VIG+ G+AV+++H F D LC+AFK+ 
Sbjct: 121 RCVPAKVCGIASRTDPKVILAIGVVQLNLPSYSSVIGQPGIAVKVMHYFTDGLCQAFKID 180

Query: 181 LQPPEGADGIXXXXXXXXXXXXXXGAIKIEPKPSAPLQEPIVNIDDAAEQLSQLSVEDVD 240
           ++P      +                +   PK      E  ++I+D A+ L +LSVEDVD
Sbjct: 181 IEPAV----LSSEPVEEEEEEEGKEKLTESPKRETFHTE--ISIEDVAQVLDELSVEDVD 234

Query: 241 HFFTRALYYTLTQDSKLEVPCSASNFVSNHILRNLPPLDHTQVNMKKTSWKKTAKFLKHX 300
           HFFTRALYYT T D+ L +P +ASNF+SNHIL NLPP+D +QVNMKKTSWKKTAKFLKH 
Sbjct: 235 HFFTRALYYTFTHDTGLNIPINASNFISNHILPNLPPVDQSQVNMKKTSWKKTAKFLKHF 294

Query: 301 XXXXXXXXXXXXXXXTIVGLDKTKDELKHFVPYRXXXXXXXXXXXXXXXX-XMMKALVIY 359
                           IVG++K KDELK+FVPY+                  MM +  +Y
Sbjct: 295 EKVGFLQLKGKGDDLVIVGVNKNKDELKNFVPYKTSGQTASKKNSNKDSSPGMMYSEKLY 354

Query: 360 KPMSSAKPFLCATDLSPNSMFSPQELKGAVDAYIASKGLVSQDNKAAVRLDDLLFSLVNR 419
           KP++  K F+  +DL P ++++  ELK +V+ YI +K LV   NK  V LDDLLF +  R
Sbjct: 355 KPINLGKDFIQCSDLPPKNLYTVTELKDSVNQYITAKKLVDSKNKKMVLLDDLLFDMFYR 414

Query: 420 STKKENAVRTILRAQIMPPILKGNFAEHFLVLKPDGTPLFKHPVKGDIPQIQIVTEMKIG 479
             K +   R + RAQIM P +  NF E + + K + TPLFK+P++G +P+++IVTEMKIG
Sbjct: 415 KKKTQETPRCVSRAQIMDPFIANNFTEFYQLFKDEDTPLFKNPIRGPLPRVKIVTEMKIG 474

Query: 480 RKVVTKVSNFEKFQVDADELAEALRKKCSXXXXXXXXXXXXXXXXXXXQGPHGPAVIELL 539
           RKVVT+VS+FE F++D ++LA  LRK CS                   QG HGP +I+ L
Sbjct: 475 RKVVTRVSHFETFKLDPEDLAANLRKLCSGSTTIGETVTSPKVAEVQVQGAHGPLIIDYL 534

Query: 540 NQLAIPTKWINF 551
           N+  IPTKWI+F
Sbjct: 535 NKQGIPTKWIDF 546

>Suva_2.276 Chr2 complement(478604..480301) [1698 bp, 565 aa] {ON}
           YDR117C (REAL)
          Length = 565

 Score =  516 bits (1329), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 263/558 (47%), Positives = 343/558 (61%), Gaps = 6/558 (1%)

Query: 1   MFKKEPQIKALSNLKNSERKKLQSQCREQVQPSDYSFPSQVIKQXXXXXXXXXXXXXXDD 60
           MFKKEP IKALSNLKNSERKKL   C++Q    +Y+FP+  IKQ              D+
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQTCKKQTNNEEYTFPTSTIKQTNFSGQKSLGTVYTDE 60

Query: 61  KNIPIWFKEKFSDLLYPTVFSCWSNKDLVPIVLAHEYVVEEKLLKGANLMLPGTVPPFDE 120
            N PI FKEK ++ L+PTV+SCW N  L+PIVL H +V+EE L  GANLM+ G++PPFD 
Sbjct: 61  NNTPILFKEKHNEQLFPTVYSCWENHTLLPIVLTHGFVIEEHLFNGANLMISGSIPPFDP 120

Query: 121 RCVKTKMVGVASTHSPDVVKAIGIVQLNLPQYSRVIGESGVAVEIVHTFDDELCKAFKVK 180
           RC    + GVAS  +P +V A+GIV+++LP YSRVIGE+GVAV+IVH F+D L KAFKVK
Sbjct: 121 RCKIGTLCGVASRQAPKIVLAVGIVEMDLPSYSRVIGETGVAVKIVHHFNDGLSKAFKVK 180

Query: 181 LQPPEGADGIXXXXXXXXXXXXXXGAIKIEPKPSAPLQEPIVNIDDAAEQLSQLSVEDVD 240
           L+PP   D                   K   K    +QE  +NI++ AE L  LSV DVD
Sbjct: 181 LEPPAAFDVASEDEDIDNTQIEIQEGTKTTEKTRENVQEANINIEEIAEVLDHLSVSDVD 240

Query: 241 HFFTRALYYTLTQDSKLEVPCSASNFVSNHILRNLPPLDHTQVNMKKTSWKKTAKFLKHX 300
           +F TRALYYTLTQD  L +P SASNF+SNHI+RNLPP+DH +VN+K+TSWKK+AKFLKH 
Sbjct: 241 YFITRALYYTLTQDKSLALPISASNFISNHIMRNLPPIDHNEVNVKRTSWKKSAKFLKHF 300

Query: 301 XXXXXXXXXXXXXXXTIVGLDKTKDELKHFVPYR-----XXXXXXXXXXXXXXXXXMMKA 355
                          TIVG +  KDELK+FVPY+                      MM +
Sbjct: 301 EKEGFLKLKGKGDDLTIVGKNTDKDELKNFVPYKLGVNNSAKEKGENTNSKEKTSGMMYS 360

Query: 356 LVIYKPMSSAKPFLCATDLSPNSMFSPQELKGAVDAYIASKGLVSQDNKAAVRLDDLLFS 415
           L +YKP + AK  +   +L   + ++ Q+++ A+  YI+ K LV   +K  V +DDLL++
Sbjct: 361 LTLYKPFNLAKDLVKEANLPFQTYYTSQDIRSAITQYISIKNLVDAKDKGKVVMDDLLYN 420

Query: 416 LVNRSTKKENAVRTILRAQIMPPILKGNFAEHFLVLKPDGTPLFKHPVKGDIPQIQIVTE 475
           +VN+  K  +  R I RAQI+ P+L  NF E + + K D T L + P+KG  P+I+I+TE
Sbjct: 421 MVNKKKKDPDVARVIPRAQILDPLLANNFTEFYQIYKNDDTLLSRTPMKGSPPRIKIITE 480

Query: 476 MKIGRKVVTKVSNFEKFQVDADELAEALRKKCSXXXXXXXXXXXXXXXXXXXQGPHGPAV 535
           MKIGRKV+TKVSNFE  Q+D + LA  LRK CS                   QGPHG  +
Sbjct: 481 MKIGRKVITKVSNFEALQIDPELLAADLRKICS-GSTTIGESQTFKSAEVQVQGPHGQLI 539

Query: 536 IELLNQLAIPTKWINFVN 553
           I+ LN+  +P KWI+F N
Sbjct: 540 IDHLNKSGVPNKWIDFEN 557

>YDR117C Chr4 complement(683946..685643) [1698 bp, 565 aa] {ON}
           TMA64Protein of unknown function that associates with
           ribosomes; has a putative RNA binding domain; in mammals
           the corresponding protein, eIF2D, has been shown to
           possess translation initiation factor activity
          Length = 565

 Score =  511 bits (1315), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 261/558 (46%), Positives = 342/558 (61%), Gaps = 6/558 (1%)

Query: 1   MFKKEPQIKALSNLKNSERKKLQSQCREQVQPSDYSFPSQVIKQXXXXXXXXXXXXXXDD 60
           MFKKEP IKALSNLKNSERKKL    ++Q    +YSF +  IKQ              D+
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQTFQKQTNNEEYSFRTSTIKQTNFNGQKSVGTVYTDE 60

Query: 61  KNIPIWFKEKFSDLLYPTVFSCWSNKDLVPIVLAHEYVVEEKLLKGANLMLPGTVPPFDE 120
            N PI FKEK  + L+PTV+SCW    L+PIVL H +V+EE L  GANLM+ G++PPFD 
Sbjct: 61  NNTPILFKEKHKEQLFPTVYSCWEYPALLPIVLTHGFVIEEHLFNGANLMISGSIPPFDP 120

Query: 121 RCVKTKMVGVASTHSPDVVKAIGIVQLNLPQYSRVIGESGVAVEIVHTFDDELCKAFKVK 180
           RC    + G+AS  +P+ V AIGIV+L+LP + +VIGE+GVAV+I+H F+D L K FK+K
Sbjct: 121 RCKIGTLCGIASKQAPETVLAIGIVELDLPSFDKVIGETGVAVKIIHHFNDGLSKVFKMK 180

Query: 181 LQPPEGADGIXXXXXXXXXXXXXXGAIKIEPKPSAPLQEPIVNIDDAAEQLSQLSVEDVD 240
           L+PP                      IK   K    ++E  V++++ AE L   +V DVD
Sbjct: 181 LEPPFVLSTQSKDNNISSKQIESSEQIKAVEKEQEDVKEASVDVEEIAEVLDHFTVSDVD 240

Query: 241 HFFTRALYYTLTQDSKLEVPCSASNFVSNHILRNLPPLDHTQVNMKKTSWKKTAKFLKHX 300
           +F TRALYYTLTQD  LE+P SASNF+SNHI+RNLPP+DH +VN+KKTSWKK+AKFLKH 
Sbjct: 241 YFITRALYYTLTQDKGLELPISASNFISNHIMRNLPPIDHNEVNVKKTSWKKSAKFLKHF 300

Query: 301 XXXXXXXXXXXXXXXTIVGLDKTKDELKHFVPY-----RXXXXXXXXXXXXXXXXXMMKA 355
                          TIVG +  KDELK+FVPY     +                 MM +
Sbjct: 301 EKEGFLKLKGKGDDLTIVGKNTDKDELKNFVPYKLGCSKSATESRESTTSKEKTSGMMYS 360

Query: 356 LVIYKPMSSAKPFLCATDLSPNSMFSPQELKGAVDAYIASKGLVSQDNKAAVRLDDLLFS 415
           L +YKP + AK  L   +L+ ++ ++ Q+++ AV  YI+ K L    +K  V +DDLLF 
Sbjct: 361 LTLYKPFNLAKDLLKEVNLASHTYYTSQDIRSAVSQYISVKNLADTKDKGKVIMDDLLFD 420

Query: 416 LVNRSTKKENAVRTILRAQIMPPILKGNFAEHFLVLKPDGTPLFKHPVKGDIPQIQIVTE 475
           +VN+  K  NA R I R +I+ P+L  NF E + + K D T LFK P+KG +P I+I+TE
Sbjct: 421 MVNKKKKVLNASRIIARGEILHPLLTNNFTEFYQIFKSDDTLLFKAPMKGSLPHIKIITE 480

Query: 476 MKIGRKVVTKVSNFEKFQVDADELAEALRKKCSXXXXXXXXXXXXXXXXXXXQGPHGPAV 535
           MKIGRKV+T+VSNFE FQVD + LA  LRK CS                   QGPHG ++
Sbjct: 481 MKIGRKVITRVSNFEVFQVDPESLAADLRKICS-GSTTISESQTFKCAEVQVQGPHGQSI 539

Query: 536 IELLNQLAIPTKWINFVN 553
           I+ LN+L IP+KWI+F N
Sbjct: 540 IDHLNKLGIPSKWIDFEN 557

>Skud_4.377 Chr4 complement(655577..657265) [1689 bp, 562 aa] {ON}
           YDR117C (REAL)
          Length = 562

 Score =  510 bits (1314), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 263/565 (46%), Positives = 344/565 (60%), Gaps = 9/565 (1%)

Query: 1   MFKKEPQIKALSNLKNSERKKLQSQCREQVQPSDYSFPSQVIKQXXXXXXXXXXXXXXDD 60
           MFKKEP IKALSNLKNSERKKL   C++Q    +Y+FP+  IKQ              D+
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQTCKKQTNNDEYTFPTSTIKQTNFCSQKSVGVVYTDE 60

Query: 61  KNIPIWFKEKFSDLLYPTVFSCWSNKDLVPIVLAHEYVVEEKLLKGANLMLPGTVPPFDE 120
            N PI FKEK ++ L+PTV+SCW N  L+PI+L H +V+EE L  GANLM+ G++PPFD 
Sbjct: 61  NNTPILFKEKHNEQLFPTVYSCWENPTLLPIILTHGFVIEEHLFNGANLMISGSIPPFDP 120

Query: 121 RCVKTKMVGVASTHSPDVVKAIGIVQLNLPQYSRVIGESGVAVEIVHTFDDELCKAFKVK 180
           R     + GVAS  +P VV AIGIV+++LP Y RV+GE+GVAV+++H F+D L KA KVK
Sbjct: 121 RSKVGTLCGVASREAPKVVLAIGIVEMDLPSYDRVLGETGVAVKVIHHFNDGLSKALKVK 180

Query: 181 LQPPEGADGIXXXXXXXXXXXXXXGAIKIEPKPSAPLQEPIVNIDDAAEQLSQLSVEDVD 240
           L PP    G                  KI       +Q+  V++++ AE L   SV DVD
Sbjct: 181 LDPPIAKSG---DEDINSKQVQPPEEAKIVENAQENMQKAQVHVEELAEVLDHFSVSDVD 237

Query: 241 HFFTRALYYTLTQDSKLEVPCSASNFVSNHILRNLPPLDHTQVNMKKTSWKKTAKFLKHX 300
           +F TRALYYTLTQD  L +P S SNF+SNHI+RNLPP+DH +VN+KKTSW+K+AKFLKH 
Sbjct: 238 YFITRALYYTLTQDKSLVLPISPSNFISNHIMRNLPPIDHNEVNVKKTSWRKSAKFLKHF 297

Query: 301 XXXXXXXXXXXXXXXTIVGLDKTKDELKHFVPYRXXXXXXXXXXXXXXXXX-----MMKA 355
                          TIVG    KDELK+FVPY+                      MM +
Sbjct: 298 EKEGFLKLKGKGDDLTIVGKTIDKDELKNFVPYKVGSSTSAQESGEHANSKEKTPGMMYS 357

Query: 356 LVIYKPMSSAKPFLCATDLSPNSMFSPQELKGAVDAYIASKGLVSQDNKAAVRLDDLLFS 415
           + +YKP S AK FL   +L   + ++ Q+++ A+  YI++  L    +K  V +DDLLF+
Sbjct: 358 MTLYKPFSIAKDFLKEANLGFRTYYTSQDIRSALSQYISTNNLADTKDKGKVVMDDLLFN 417

Query: 416 LVNRSTKKENAVRTILRAQIMPPILKGNFAEHFLVLKPDGTPLFKHPVKGDIPQIQIVTE 475
           +VN+  K  NA R + RAQI+ P+L  NF E + + K D + LFK P+KG  P+I+I TE
Sbjct: 418 MVNKKKKNLNAARIMPRAQILDPLLANNFTEFYQIFKNDDSLLFKAPIKGSPPRIKITTE 477

Query: 476 MKIGRKVVTKVSNFEKFQVDADELAEALRKKCSXXXXXXXXXXXXXXXXXXXQGPHGPAV 535
           MKIGRKV+T+VSNFE FQ+D + LA  LRK CS                   QGPHG  +
Sbjct: 478 MKIGRKVITRVSNFEVFQIDPESLAGDLRKICS-GSTTIGESQTFKSAEVQVQGPHGQLI 536

Query: 536 IELLNQLAIPTKWINFVNKLKKSKK 560
           I+ LN L +P KWI+F NKLKK K+
Sbjct: 537 IDHLNNLGVPNKWIDFENKLKKKKR 561

>ZYRO0C01496g Chr3 (108150..109853) [1704 bp, 567 aa] {ON} similar
           to uniprot|Q04600 Saccharomyces cerevisiae YDR117C RBF64
           Hypothetical ORF
          Length = 567

 Score =  503 bits (1296), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 267/562 (47%), Positives = 343/562 (61%), Gaps = 15/562 (2%)

Query: 1   MFKKEPQIKALSNLKNSERKKLQSQCREQVQPSDYSFPSQVIKQXXXXXXXXXXXXXXDD 60
           MFKK+P +KALSNLKNSE KKL + CR Q    +YSFP+ VIKQ              D 
Sbjct: 1   MFKKDPHVKALSNLKNSEAKKLLATCRAQTGNQEYSFPTGVIKQTNFQAQSGIGTVYTDA 60

Query: 61  KNIPIWFKEKFSDLLYPTVFSCWSNKDLVPIVLAHEYVVEEKLLKGANLMLPGTVPPFDE 120
            N PIWFKEK  +LLYPTVF+CWS+  L+P+VL H +VVEE+L  GANLML GTV PFD 
Sbjct: 61  DNKPIWFKEKHGNLLYPTVFACWSHPGLLPVVLTHGFVVEERLFNGANLMLAGTVLPFDS 120

Query: 121 RCVKTKMVGVASTHSPDVVKAIGIVQLNLPQYSRVIGESGVAVEIVHTFDDELCKAFKVK 180
           R     + G+AS ++PDVV A+G+VQL+LP Y  V+G++GVAV++VH   D L K FKV 
Sbjct: 121 RLKPGTVCGIASKNAPDVVMAVGVVQLDLPSYDSVLGKTGVAVQLVHYLPDGLSKVFKVN 180

Query: 181 LQPPEGADGIXXXXXXXXXXXXXXGAIKIEPKPSA---PLQEPIVNIDDAAEQLSQLSVE 237
            +PP     +                 +   +PS+   P QE  V+IDD AE L +  +E
Sbjct: 181 AEPP-----VSLEDSDEEEEEEEEVLEESAQQPSSQEIPSQEKAVDIDDIAEVLDEFRLE 235

Query: 238 DVDHFFTRALYYTLTQDSKLEVPCSASNFVSNHILRNLPPLDHTQVNMKKTSWKKTAKFL 297
           DVD F TRALYYTLT D+KLE+P SASNF+SNHI  NLP +DH +VN+KK+SWKKTAKFL
Sbjct: 236 DVDQFLTRALYYTLTHDTKLELPISASNFISNHINHNLPSVDHEKVNVKKSSWKKTAKFL 295

Query: 298 KHXXXXXXXXXXXXXXXXTIVGLDKTKDELKHFVPYRXXXXXXXXXXXXXXXXX-----M 352
           K+                TI+G++K K EL++F PY+                       
Sbjct: 296 KNFEKEGFLKLKGKGDDLTIIGINKQKPELQNFQPYQISGGSGGGGNSSSNNNKKDGSPQ 355

Query: 353 MKALVIYKPMSSAKPFLCATDLSPNS-MFSPQELKGAVDAYIASKGLVSQDNKAAVRLDD 411
           ++   +YKP++ AK F+  TDL+P   +++ QELK A++ YIAS  L    NK  V LDD
Sbjct: 356 LRCETLYKPINLAKDFIQQTDLNPQDILYTAQELKNALNDYIASNNLADSKNKKMVILDD 415

Query: 412 LLFSLVNRSTKKENAVRTILRAQIMPPILKGNFAEHFLVLKPDGTPLFKHPVKGDIPQIQ 471
           LL+ LVN+  K   A R + RA I+ P+L  +F  HF + K D  PLFK+P +G++P I+
Sbjct: 416 LLYHLVNKKQKDTTAPRLVSRATIIEPLLANSFTPHFQIYKGD-IPLFKNPSRGNLPNIE 474

Query: 472 IVTEMKIGRKVVTKVSNFEKFQVDADELAEALRKKCSXXXXXXXXXXXXXXXXXXXQGPH 531
           IVTEMKIGRKV+T+VS FE F +D DELA  LR+ CS                   QGPH
Sbjct: 475 IVTEMKIGRKVITRVSRFEIFHIDEDELAATLRRLCSGSTTIGETMTSPKYKEVTVQGPH 534

Query: 532 GPAVIELLNQLAIPTKWINFVN 553
           GP +I+ LN L IPTKWI F N
Sbjct: 535 GPLIIDHLNSLGIPTKWIKFDN 556

>NCAS0B03800 Chr2 (678984..680681) [1698 bp, 565 aa] {ON} Anc_8.269
           YDR117C
          Length = 565

 Score =  495 bits (1275), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 255/557 (45%), Positives = 340/557 (61%), Gaps = 5/557 (0%)

Query: 1   MFKKEPQIKALSNLKNSERKKLQSQCREQVQPSDYSFPSQVIKQXXXXXXXXXXXXXXDD 60
           MF+KEP IKALSNLKNS+RKKL      Q     Y+ PS ++KQ              D+
Sbjct: 1   MFRKEPHIKALSNLKNSDRKKLAQTIHAQTGNDKYTCPS-IVKQTNFQTPTTIGTIYTDE 59

Query: 61  KNIPIWFKEKFSDLLYPTVFSCWSNKDLVPIVLAHEYVVEEKLLKGANLMLPGTVPPFDE 120
           KNIPIWFKEK    LY TV++CW+ +DL+PI L+H++V++EKL  GANLM+ GT+PPFDE
Sbjct: 60  KNIPIWFKEKHDPRLYATVYTCWNCEDLLPICLSHDFVIQEKLFNGANLMISGTIPPFDE 119

Query: 121 RCVKTKMVGVASTHSPD-VVKAIGIVQLNLPQYSRVIGESGVAVEIVHTFDDELCKAFKV 179
           +     + GVAS   P  VV AIGIV ++LP++ +V+GESGVAV+I+H F+DEL K+FK+
Sbjct: 120 KLKVGTLCGVASCQDPGRVVYAIGIVMMDLPKFEKVVGESGVAVQIIHHFEDELFKSFKI 179

Query: 180 KLQPPEGADGIXXXXXXXXXXXXXXGAIKIEPKPSAPLQEPIVNIDDAAEQLSQLSVEDV 239
            L+PP                         E   +        N++D AE L  LSV+DV
Sbjct: 180 DLKPPVVDVQKGSVNDEEEEEEEKEQEKANEEDETTKEMSTATNVEDLAEVLDHLSVQDV 239

Query: 240 DHFFTRALYYTLTQDSKLEVPCSASNFVSNHILRNLPPLDHTQVNMKKTSWKKTAKFLKH 299
           D+F TRALYYT+T D+KL +P SASNF+S HI +NLP +DH +VN+KK+SWKKTAKFLKH
Sbjct: 240 DYFITRALYYTITTDTKLSLPISASNFISQHINKNLPDVDHNEVNIKKSSWKKTAKFLKH 299

Query: 300 XXXXXXXXXXXXXXXXTIVGLDKTKDELKHFVPYRXXXXXXXXXXXXX---XXXXMMKAL 356
                           T+VG++KTKDELK+FVPY+                    MM ++
Sbjct: 300 FEKEGFLKLKGKGDDLTVVGMNKTKDELKNFVPYKLGSSNGENKGAKKEGDSQSGMMYSI 359

Query: 357 VIYKPMSSAKPFLCATDLSPNSMFSPQELKGAVDAYIASKGLVSQDNKAAVRLDDLLFSL 416
             YKP++ AK  +  + +   +++ P E++  V+ YI  K LV   NK  V LDDLLF +
Sbjct: 360 TFYKPINLAKDLIKESGMPMKNLYLPTEIRDGVNNYITLKNLVDNKNKKMVLLDDLLFGM 419

Query: 417 VNRSTKKENAVRTILRAQIMPPILKGNFAEHFLVLKPDGTPLFKHPVKGDIPQIQIVTEM 476
           VN+        R+I RAQI+ P LK NF EHF +    GTPLFK P++G  P+I+I+TEM
Sbjct: 420 VNKKRTDPTVSRSISRAQILEPTLKNNFTEHFQIYDSQGTPLFKSPMRGSPPRIKILTEM 479

Query: 477 KIGRKVVTKVSNFEKFQVDADELAEALRKKCSXXXXXXXXXXXXXXXXXXXQGPHGPAVI 536
           KIGRKV+TKVSNFE+F ++ + LA  LRK CS                   QGPHG  +I
Sbjct: 480 KIGRKVITKVSNFEQFGINPETLAADLRKMCSGSTTIGETMTSPKTAEVQVQGPHGQIII 539

Query: 537 ELLNQLAIPTKWINFVN 553
           + LN+L +PTKWI++ N
Sbjct: 540 DHLNKLGVPTKWIDYEN 556

>Smik_4.361 Chr4 complement(645227..646924) [1698 bp, 565 aa] {ON}
           YDR117C (REAL)
          Length = 565

 Score =  482 bits (1241), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 259/558 (46%), Positives = 342/558 (61%), Gaps = 6/558 (1%)

Query: 1   MFKKEPQIKALSNLKNSERKKLQSQCREQVQPSDYSFPSQVIKQXXXXXXXXXXXXXXDD 60
           MFKKEP IKALSNLKNSERKKL   C +Q    +Y+FP+ +IKQ              D+
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQTCIKQTNNEEYTFPTSIIKQTNFGGQKSVGTVYTDE 60

Query: 61  KNIPIWFKEKFSDLLYPTVFSCWSNKDLVPIVLAHEYVVEEKLLKGANLMLPGTVPPFDE 120
            NIPI FKEK  + LYPTV+SCW N  L+PIVL H +V+EE L  GANLM+ G++PPFD 
Sbjct: 61  NNIPILFKEKHCEQLYPTVYSCWKNPSLLPIVLTHGFVIEEHLFNGANLMISGSIPPFDS 120

Query: 121 RCVKTKMVGVASTHSPDVVKAIGIVQLNLPQYSRVIGESGVAVEIVHTFDDELCKAFKVK 180
           RC    + GVA   SP VV AIG+V+L+LP Y RVIGE+GVAV+++H F+D L KAFKVK
Sbjct: 121 RCNVGTLCGVAGKQSPKVVLAIGVVELDLPSYDRVIGETGVAVKVIHHFNDGLFKAFKVK 180

Query: 181 LQPPEGADGIXXXXXXXXXXXXXXGAIKIEPKPSAPLQEPIVNIDDAAEQLSQLSVEDVD 240
           L+PP   +                  +K   K    +++   ++++ AE L  L+V DVD
Sbjct: 181 LEPPVVLNTESEDENINSKQTETPEQVKSADKSQESIKKTAPDLEEVAEVLDHLTVSDVD 240

Query: 241 HFFTRALYYTLTQDSKLEVPCSASNFVSNHILRNLPPLDHTQVNMKKTSWKKTAKFLKHX 300
           +F TRALYY+LTQD  L +P SAS F+SNHI+RNLPP+DH +VN+KK+SWKK+AKFLKH 
Sbjct: 241 YFITRALYYSLTQDKGLILPISASKFISNHIMRNLPPIDHNEVNVKKSSWKKSAKFLKHF 300

Query: 301 XXXXXXXXXXXXXXXTIVGLDKTKDELKHFVPYRX-----XXXXXXXXXXXXXXXXMMKA 355
                          TIVG +  KDELK+FVPY+                      MM +
Sbjct: 301 EKEGILKLKGKGDDLTIVGKNTDKDELKNFVPYKLGCSSPSKGSGENATSKDRTSGMMHS 360

Query: 356 LVIYKPMSSAKPFLCATDLSPNSMFSPQELKGAVDAYIASKGLVSQDNKAAVRLDDLLFS 415
           L +YKP S AK  L    L  ++ ++ Q+++ AV  YI+ K L  + +K  V +DDLLF+
Sbjct: 361 LTLYKPFSLAKDLLREAKLGCDTYYTSQDVRNAVSEYISVKNLADKKDKRKVVMDDLLFN 420

Query: 416 LVNRSTKKENAVRTILRAQIMPPILKGNFAEHFLVLKPDGTPLFKHPVKGDIPQIQIVTE 475
           +VN+  K  +  R I R++I+ P+L  NF E + + + D T LF+ P+KG  P+I+IVTE
Sbjct: 421 MVNKKKKTPDTTRIIARSEILQPLLSNNFTEFYQIFRNDDTLLFRVPMKGCPPRIKIVTE 480

Query: 476 MKIGRKVVTKVSNFEKFQVDADELAEALRKKCSXXXXXXXXXXXXXXXXXXXQGPHGPAV 535
           MKIGRKV+TKVSNFE F +D + LA  LRK CS                   QGPHG  +
Sbjct: 481 MKIGRKVITKVSNFEVFHIDPELLAADLRKICS-GSTTIGESQTFKSAEVQVQGPHGQFI 539

Query: 536 IELLNQLAIPTKWINFVN 553
           I+ LN+  IP+KWI+F N
Sbjct: 540 IDYLNKSGIPSKWIDFEN 557

>TPHA0J00780 Chr10 complement(180939..182690) [1752 bp, 583 aa] {ON}
           Anc_8.269 YDR117C
          Length = 583

 Score =  482 bits (1240), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 253/574 (44%), Positives = 340/574 (59%), Gaps = 19/574 (3%)

Query: 1   MFKKEPQIKALSNLKNSERKKLQSQCREQVQPSDYSFPSQVIKQXXXXXXXXXXXXXXDD 60
           MFKK P +KA SNLKNSERKKL   C+EQ   SDY+FPS +IKQ              D+
Sbjct: 1   MFKKTPNVKASSNLKNSERKKLLQSCKEQRNSSDYNFPSSIIKQANYKGQTSAGTVYTDE 60

Query: 61  KNIPIWFKEKFSDLLYPTVFSCWSNKDLVPIVLAHEYVVEEKLLKGANLMLPGTVPPFDE 120
           +N+PIWFKEK SD+L+P+V++CW N  L+PI++ + YV+EEK+L GANLM+ GT+ PFDE
Sbjct: 61  QNVPIWFKEKHSDMLFPSVYTCWKNPKLLPIIVTNSYVIEEKILNGANLMISGTLLPFDE 120

Query: 121 RCVKTKMVGVASTHSPDVVKAIGIVQLNLPQYSRVIGESGVAVEIVHTFDDELCKAFKVK 180
           R +   + G+AS   P+VV AIGIVQL+L  Y++V+GE+GVAV ++H   D L  +FK+ 
Sbjct: 121 RLICGALCGIASYKKPNVVMAIGIVQLDLQSYTKVVGETGVAVNVLHYLGDGLSDSFKMN 180

Query: 181 LQPPEGADGIXXXXXX--XXXXXXXXGAIKIEPKPSAPLQEPIVNIDDAAEQLSQLSVED 238
           L+PPE    +                  +    K  AP   P    DD AE L  L V+ 
Sbjct: 181 LEPPETGAEVDETNEMLLNQDKQDVNNELTNSNKDLAPDARP---NDDLAEVLETLPVDI 237

Query: 239 VDHFFTRALYYTLTQDSKLEVPCSASNFVSNHILRNLPPLDHTQVNMKKTSWKKTAKFLK 298
           +D F T++LYY+LT D KLE P SASNF+SN+I+ NLPP+D+  VN+KK+SWKKTAKFL+
Sbjct: 238 IDDFITKSLYYSLTNDPKLEFPISASNFISNYIMSNLPPVDNDMVNLKKSSWKKTAKFLR 297

Query: 299 HXXXXXXXXXXXXXXXXTIVGLDKTKDELKHFVPYRXXXXXXXXXXXXXXXXX-----MM 353
           H                 I G +K K ELK FVPYR                      MM
Sbjct: 298 HFEKEGFIKLKGKNDDLVITGFNKEKTELKSFVPYRTGNGNSTKSKKDKTNDTSDNGDMM 357

Query: 354 KALVIYKPMSSAKPFLCATDLSPNSMFSPQELKGAVDAYIASKGLVSQDNKAAVRLDDLL 413
           +++  YKP+S  K  +  +     S+++  EL+  +  YI  K LV   NK  + +DDL+
Sbjct: 358 QSVSYYKPISLGKDLIRESVAPEKSLYTAHELRDFITEYINKKNLVDSKNKKMILMDDLM 417

Query: 414 FSLVNRSTKKENAV--RTILRAQIMPPILKGNFAEHFLVLKPD----GTPLFKHPVKGDI 467
           +SLV    KK+N+   R I RA ++ PI K NF EHF + K        PLFK P++G I
Sbjct: 418 YSLV---YKKKNSAEPRLISRADVIEPITKNNFNEHFQIYKKGDNETAVPLFKKPIRGSI 474

Query: 468 PQIQIVTEMKIGRKVVTKVSNFEKFQVDADELAEALRKKCSXXXXXXXXXXXXXXXXXXX 527
           P+++IVTEMKIGRKV+T+VSNFE F +DA+ LA  LRK C+                   
Sbjct: 475 PKVEIVTEMKIGRKVITRVSNFEVFHIDAETLAADLRKLCNGATTIGETLTSPKTAEVQV 534

Query: 528 QGPHGPAVIELLNQLAIPTKWINFVNKLKKSKKR 561
           QGPH   +I+ LN L+IPTKWI+F N +K  +K+
Sbjct: 535 QGPHSQVIIKHLNSLSIPTKWIDFKNSVKPKRKK 568

>NDAI0J01310 Chr10 (306474..308213) [1740 bp, 579 aa] {ON} Anc_8.269
           YDR117C
          Length = 579

 Score =  461 bits (1187), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 252/576 (43%), Positives = 338/576 (58%), Gaps = 31/576 (5%)

Query: 1   MFKKEPQIKALSNLKNSERKKLQSQCREQVQPSDYSFP-SQVIKQXXXXXXX--XXXXXX 57
           MFKKEP IKALSNLKNS+RKKL    + Q     Y+F  S +IKQ               
Sbjct: 1   MFKKEPHIKALSNLKNSDRKKLLQTIKTQTNLETYNFNNSNIIKQTNFQTTNPPSIGTIF 60

Query: 58  XDDKNIPIWFKEKFSDLLYPTVFSCWSNKDLVPIVLAHEYVVEEKLLKGANLMLPGTVPP 117
            +D NIPIWFK K +DLLYPTVF+CW+N D++P +L+H++V++EKL  GANLM+ GT+PP
Sbjct: 61  TNDSNIPIWFKSKHNDLLYPTVFTCWNNHDILPTLLSHDFVIQEKLFNGANLMISGTIPP 120

Query: 118 FDERCVKTKMVGVASTHSPD-VVKAIGIVQLNLPQYSRVIGESGVAVEIVHTFDDELCKA 176
           FD R +   + G+AS   P  +V AIG+V++N+P + +V+GE+GVAVE++H F+DEL K 
Sbjct: 121 FDSRLIPGTLCGIASVQDPKRIVWAIGVVKMNMPSFDKVVGETGVAVEVIHHFEDELFKI 180

Query: 177 FKVK-LQPPEGADGIXXXXXXXXXXXXXXGAIKIEPKPSAPLQEPIVNIDDAAEQLSQLS 235
           FK   L+P E                      + + + +    EP        E L    
Sbjct: 181 FKCNDLKPDEFVKEQLNTEHPQDNDVADEDTTR-KKEENRESNEP------DFEVLDHFK 233

Query: 236 VEDVDHFFTRALYYTLTQDSKLEVPCSASNFVSNHILRNLPPLDHTQVNMKKTSWKKTAK 295
            EDVD+F TR+LYYT+TQD+K+E+P SASNF+S HI +NLP + H +VN+KKTSWKKTAK
Sbjct: 234 TEDVDYFITRSLYYTITQDTKVELPISASNFISQHINKNLPDISHNEVNIKKTSWKKTAK 293

Query: 296 FLKHXXXXXXXXXXXXXXXXTIVGLDKTKDELKHFVPYRXXXXXXXX-------XXXXXX 348
           FLKH                T+VG++KTKDELK+FVPY+                     
Sbjct: 294 FLKHFEKEGFLKLKGKGDDLTVVGMNKTKDELKNFVPYKIGKSTTPSFSLSSPNTNDKSD 353

Query: 349 XXXMMKALVIYKPMSSAKPFLCATDLSPNS-MFSPQELKGAVDAYIASKGLVSQDNKAAV 407
              MM +   YKP++ AK  L A    P   +++ QE++  V +YI SK L+   NK  +
Sbjct: 354 TKGMMYSETFYKPINHAKDLLKAVPTIPTKPLYTQQEIRDIVTSYINSKNLIDMKNKKMI 413

Query: 408 RLDDLLFSLVNRSTKKENAV-RTILRAQIMPPILKGNFAEHFLV---------LKPDGTP 457
            LDDLLF++V++   + NA  RT++R  I+ PIL  NF EH+ +         L  D  P
Sbjct: 414 LLDDLLFNMVHKRQSEANAAPRTMMRGTILEPILANNFTEHYQIYRKRNGKGELMEDVEP 473

Query: 458 LFKHPVKGDIPQIQIVTEMKIGRKVVTKVSNFEKFQVDADELAEALRKKCSXXXXXXXXX 517
           LFK P +G +PQI I+TEMKIGRKV+TKVSNFE F + +D LA  LRK CS         
Sbjct: 474 LFKSPQRGHLPQIDILTEMKIGRKVITKVSNFEIFGISSDFLAADLRKLCSGSTTIGETM 533

Query: 518 XXXXXXXXXXQGPHGPAVIELLN-QLAIPTKWINFV 552
                     QGPHG  +I+ LN +  +PTKWIN+V
Sbjct: 534 TSPKTPEVQVQGPHGQIIIDHLNKKFGVPTKWINYV 569

>CAGL0B01837g Chr2 complement(166953..168662) [1710 bp, 569 aa] {ON}
           similar to uniprot|Q04600 Saccharomyces cerevisiae
           YDR117c
          Length = 569

 Score =  455 bits (1170), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 247/560 (44%), Positives = 337/560 (60%), Gaps = 11/560 (1%)

Query: 1   MFKKEPQIKALSNLKNSERKKLQSQCREQVQPSDYSFPSQVIKQXXXXXXXXXXXXXXDD 60
           MFKKEP IKALSNLKNSERKKLQ +CR Q    +YSF S  IKQ              D+
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLQEKCRIQTSNEEYSFGSNTIKQTNFKGITTIGTIYTDE 60

Query: 61  KNIPIWFKEKFSDLLYPTVFSCWSNKDLVPIVLAHEYVVEEKLLKGANLMLPGTVPPFDE 120
            N PIWFKEK  + LYPTV +CW   +L+P+VL H  V+E+ +  GANLM+ GT+PPFDE
Sbjct: 61  GNAPIWFKEKHDEKLYPTVLACWRCPNLIPVVLTHSIVLEDHIFNGANLMISGTIPPFDE 120

Query: 121 RCVKTKMVGVASTHSPDVVKAIGIVQLNLPQYSRVIGESGVAVEIVHTFDDELCKAFKVK 180
           R     + G+A   +P+++ A+GIVQ+NLP ++RVIGE+GVAV+IVH  +DEL K FKVK
Sbjct: 121 RLTVGTVCGIADKRTPNLIVAVGIVQMNLPSFTRVIGETGVAVQIVHHLEDELFKVFKVK 180

Query: 181 LQPPEGADGIXXXXXXXXXXXXXXGAIKIEPKPSAPLQEPIVNIDDAAEQLSQLSVEDVD 240
            +PP                       + + + ++  ++   N+DD AE L +L +ED+D
Sbjct: 181 EEPPAELLQTQSSSSEELELEADIHEDETKVESNSDTEKEKSNLDDMAEVLDELRLEDID 240

Query: 241 HFFTRALYYTLTQDSKLEVPCSASNFVSNHILRNLPP-LDHTQVNMKKTSWKKTAKFLKH 299
           +F TRALYYT++QD+KLE P SASNFVSNHI  NLP   +  +VN+KK+SWKKTAKFLKH
Sbjct: 241 YFITRALYYTISQDTKLETPTSASNFVSNHINHNLPKGTNLAEVNIKKSSWKKTAKFLKH 300

Query: 300 XXXXXXXXXXXXXXXXTIVGLDKTKDELKHFVPY-RXXXXXXXXXXXXXXXXXMMKALVI 358
                           TIV ++K KDE+K F+PY                    +K + +
Sbjct: 301 FEKEGFLKLKGVGDDLTIVEVNKDKDEIKQFLPYPVIGNQGSNTGSEGGNAKTTIKIVTL 360

Query: 359 YKPMSSAKPFLCATDLSPNSMFSPQELKGAVDAYIASKGLVSQDNKAAVRLDDLLFSLVN 418
           YKP++ AK F+ +  +    ++   E+K  ++ YI  K LV + +K  V +DD+L +++ 
Sbjct: 361 YKPINLAKDFISSNKVPLKQLYMEPEIKELINKYITMKDLVDKKDKKCVLVDDMLMTMIY 420

Query: 419 RSTKKENAV---RTILRAQIMPPILKGNFAEHFLVLKPDG---TPLFKHPVKGDIPQIQI 472
           +  KKE+     R I RA I+ P+L+ NF +++ + +  G   TPL K P+KG+ P+I I
Sbjct: 421 K--KKEDQATKSRVIPRANILQPVLQNNFNKNYHLFRITGNEQTPLTKTPLKGEPPKINI 478

Query: 473 VTEMKIGRKVVTKVSNFEKFQVDADELAEALRKKCSXXXX-XXXXXXXXXXXXXXXQGPH 531
           VTEMKIGRKV+TKVSNFE FQ+D +E A  +RKKCS                    QGPH
Sbjct: 479 VTEMKIGRKVITKVSNFEVFQIDPEEFAADIRKKCSGSTTIGETTSSAKKTAEVQVQGPH 538

Query: 532 GPAVIELLNQLAIPTKWINF 551
           G  ++  LN L IP KWI+F
Sbjct: 539 GQLIMSYLNDLGIPNKWIDF 558

>Kpol_392.2 s392 (1564..3264) [1701 bp, 566 aa] {ON} (1564..3264)
           [1701 nt, 567 aa]
          Length = 566

 Score =  440 bits (1131), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 250/566 (44%), Positives = 332/566 (58%), Gaps = 6/566 (1%)

Query: 1   MFKKEPQIKALSNLKNSERKKLQSQCREQVQPSDYSFPSQVIKQXXXXXXXXXXXXXXDD 60
           MFKK P IK+LSNLKNSERKKL   C+ Q   +DY+FP+ VIKQ              D+
Sbjct: 1   MFKKTPHIKSLSNLKNSERKKLLQSCKAQTGSTDYNFPTSVIKQTNFNAQTSVGVIYTDE 60

Query: 61  KNIPIWFKEKFSDLLYPTVFSCWSNKDLVPIVLAHEYVVEEKLLKGANLMLPGTVPPFDE 120
           +  P+WFKEK S+LL+PTV++CW +  L+PIVL H+ V+ E +  GANLM+ GT+PPFD 
Sbjct: 61  EGSPLWFKEKHSELLFPTVYTCWEDPTLLPIVLTHDIVINEHIFNGANLMISGTLPPFDS 120

Query: 121 RCVKTKMVGVASTHSPDVVKAIGIVQLNLPQYSRVIGESGVAVEIVHTFDDELCKAFKVK 180
           R V   + G+A+ ++P+ + A+G+VQL++P YS VIG++GVAV ++H + D +  AFK+K
Sbjct: 121 RLVPATICGIATRNNPNTIVAVGVVQLDMPSYSSVIGKTGVAVNVLHYWGDGMSVAFKMK 180

Query: 181 LQPPEGADGIXXXXXXXXXXXXXXGAIKIEPKPSAPLQEPIVN-IDDAAEQLSQLSVEDV 239
              P    G                  + E      + E   N + + A++ S L+VED+
Sbjct: 181 RDIPTIVGGKDKSVDATENDQSPVIITEEEKTEDDSIPEISSNDVSELAQEESALTVEDI 240

Query: 240 DHFFTRALYYTLTQDSKLEVPCSASNFVSNHILRNLPPLDHTQVNMKKTSWKKTAKFLKH 299
           DHF TR+LYYTLT D KL  P  +S+F+SNHI+RNLPP+DH  VN+KKTSWKK++KFLKH
Sbjct: 241 DHFITRSLYYTLTNDLKLAFPIPSSSFISNHIMRNLPPVDHNLVNIKKTSWKKSSKFLKH 300

Query: 300 XXXXXXXXXXXXXXXXTIVGLDKTKDELKHFVPYRXXXXXXXX----XXXXXXXXXMMKA 355
                           TIVG +K K+ELK F PYR                     MM +
Sbjct: 301 FEKEGFIKLKGKGEDLTIVGSNKEKEELKKFEPYRISNSSSNSGKKINSNRQESENMMYS 360

Query: 356 LVIYKPMSSAKPFLCATDLSPNSMFSPQELKGAVDAYIASKGLVSQDNKAAVRLDDLLFS 415
           LV Y P  SAK F+  T+L   + ++  ELK AV  YI  K LV + N     LDD L+ 
Sbjct: 361 LVFYSPKGSAKQFMTLTELPYKNWYTAIELKNAVTEYIKKKELVDKKNPKMANLDDRLYD 420

Query: 416 LVNRSTKKENAVRTILRAQIMPPILKGNFAEHFLVLKPDGTPLFKHPVKGDIPQIQIVTE 475
           +   + K  N  R I RA ++      NF E + + K D TPL K+PV+G  P+I+IVTE
Sbjct: 421 MC-YTKKSTNPPRHITRAAVIESFTTNNFTELYQLFKNDDTPLTKNPVRGSPPRIKIVTE 479

Query: 476 MKIGRKVVTKVSNFEKFQVDADELAEALRKKCSXXXXXXXXXXXXXXXXXXXQGPHGPAV 535
           MKIGRK+VT+VSNFE F +DAD LA  LR+ CS                   QGPH   +
Sbjct: 480 MKIGRKIVTRVSNFESFGIDADALAGDLRRLCSGSTTIGETTTSPKTTEVQVQGPHSKII 539

Query: 536 IELLNQLAIPTKWINFVNKLKKSKKR 561
           I+ LN L+IPTKWI+F NKLK  K R
Sbjct: 540 IDHLNSLSIPTKWIDFENKLKPKKIR 565

>KAFR0B05470 Chr2 (1120794..1122482) [1689 bp, 562 aa] {ON}
           Anc_8.269 YDR117C
          Length = 562

 Score =  438 bits (1127), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 238/559 (42%), Positives = 323/559 (57%), Gaps = 12/559 (2%)

Query: 1   MFKKEPQIKALSNLKNSERKKLQSQCREQVQPS-DYSFPSQVIKQXXXXXXXXXXXXXXD 59
           MFKKEP+IKALS LKNS+RKKL    + Q++   D S     I Q              D
Sbjct: 1   MFKKEPRIKALSKLKNSDRKKLVQSLKAQLKSDEDISVAGDSIMQTNFISTTAAGTIYTD 60

Query: 60  DKNIPIWFKEKFSDLLYPTVFSCWSNKDLVPIVLAHEYVVEEKLLKGANLMLPGTVPPFD 119
             +IPI FK K SD LYPT F  WSN  L+  V  H  VVE  +  GA+LM+ GTVPPFD
Sbjct: 61  SNSIPIMFKTKHSDTLYPTSFLLWSNNGLLSTVRTHSVVVENYIFNGADLMIAGTVPPFD 120

Query: 120 ERCVKTKMVGVASTHSPDVVKAIGIVQLNLPQYSRVIGESGVAVEIVHTFDDELCKAFKV 179
                  +  VA+  +PDV  A+GIV+LNLP+Y +V+G++GVAVEI+H F+D L   FK 
Sbjct: 121 STLTIGTICAVATKEAPDVAIAVGIVKLNLPEYQQVLGKTGVAVEILHHFEDALFSTFKA 180

Query: 180 KLQPPEGADGIXXXXXXXXXXXXXXGAIKIEP--KPSAPLQEPIVNIDDAAEQLSQLSVE 237
           KL+ P     I                 + +   +P +  + P    DD AE L +L+VE
Sbjct: 181 KLEIPASVKSILQEETTADVAKESDAEQESQSVTEPPSGSEGP----DDIAEVLDELTVE 236

Query: 238 DVDHFFTRALYYTLTQDSKLEVPCSASNFVSNHILRNLPPLDHTQVNMKKTSWKKTAKFL 297
           DVD+F  RALY+T+ QD+ L +P  AS F+SNHI+RNLP +DH +VN+K+TSWKKTAKFL
Sbjct: 237 DVDYFIRRALYFTMVQDNTLTLPVVASAFMSNHIMRNLPDVDHKKVNIKRTSWKKTAKFL 296

Query: 298 KHXXXXXXXXXXXXXXXXTIVGLDKTKDELKHFVPYRXXXXXXXXXXXXXXXXXM---MK 354
           K+                 IVG++K KDELK+FVPY+                     + 
Sbjct: 297 KYFEKEGFLKLKGKGDDLIIVGMNKDKDELKNFVPYKIGNTAKKAASKSDSTQTQGVSVS 356

Query: 355 ALVIYKPMSSAKPFLCATDLSPNSMFSPQELKGAVDAYIASKGLVSQDNKAAVRLDDLLF 414
           ++ +YKP++  + F+  +++S   M++  E++  ++ YI  K LV + +K  V LDDLLF
Sbjct: 357 SVNLYKPINLGQKFIKESNISGGPMYTSLEIRNCINDYIIKKNLVDEKDKKMVMLDDLLF 416

Query: 415 SLVNRSTKKENAVRTILRAQIMPPILKGNFAEHFLVLKPDGTPLFKHPVKGDIPQIQIVT 474
           ++VNR  +     R I RA I+ P++  NF E+F + K D TPLFK+P+KG  P+I IVT
Sbjct: 417 AMVNRKIQNPIFPRIIPRANILEPLIANNFNEYFQLYKGDNTPLFKNPIKGQTPKIDIVT 476

Query: 475 EMKIGRKVVTKVSNFEKFQVDADELAEALRKKCSXXXXXXXXXXXXXXXXXXXQGPHGPA 534
           EMKIGRKVVT+VSNFE F++  +ELA  LRK CS                   QGPHG  
Sbjct: 477 EMKIGRKVVTRVSNFENFRISPEELAADLRKLCS--GSTTISETPKKVSEVQVQGPHGQL 534

Query: 535 VIELLNQLAIPTKWINFVN 553
           +I+  N+  IP+K+I F N
Sbjct: 535 IIDHFNKSGIPSKFIQFEN 553

>Ecym_4301 Chr4 (644340..646034) [1695 bp, 564 aa] {ON} similar to
           Ashbya gossypii AGR079W
          Length = 564

 Score =  424 bits (1090), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 223/568 (39%), Positives = 336/568 (59%), Gaps = 12/568 (2%)

Query: 1   MFKKEPQIKALSNLKNSERKKLQSQCREQVQPSDYSFPSQVIKQXXXXXXXXXXXXXXDD 60
           MFKK+P IK+ SNLKNSERKKL    R Q    ++ F + ++KQ              D+
Sbjct: 1   MFKKKPTIKSASNLKNSERKKLLGNVRAQCANQEFQFSTTIVKQATFKTPTATGTIFTDE 60

Query: 61  KNIPIWFKEKFSDLLYPTVFSCWSNKDLVPIVLAHEYVVEEKLLKGANLMLPGTVPPFDE 120
            N PI+FKEK S+ L PT+ +CW    L+ +VL H++V++ KL  GA+LMLPGT+PPF +
Sbjct: 61  DNKPIFFKEKHSEFLIPTILTCWQYPGLLHVVLTHKHVLDNKLKNGADLMLPGTIPPFSD 120

Query: 121 RCVKTKMVGVASTHSPDVVKAIGIVQLNLPQYSRVIGESGVAVEIVHTFDDELCKAFKVK 180
            C + K+VGVAS+ +P VV+AIG+ QLNL    +V+GE+GVAV+++HT +D L + FK+ 
Sbjct: 121 NCTRGKLVGVASSETPFVVEAIGVCQLNLAGIVKVVGETGVAVKVLHTINDGLWEVFKMS 180

Query: 181 LQPPEG---ADGIXXXXXXXXXXXXXXGAIKIEPKPSA-----PLQEPIVNIDDAAEQLS 232
           ++PP     +                 G  + E  P+A     PL+EP  ++ + AEQL 
Sbjct: 181 VEPPSQLLVSQKHEVELEALAQADDAGGIQEDEDLPTAKTASGPLEEP-NSLSEVAEQLE 239

Query: 233 QLSVEDVDHFFTRALYYTLTQDSKLEVPCSASNFVSNHILRNLPPLDHTQVNMKKTSWKK 292
           +LS+E VDHF T+A+YYTL  D+ L++P  ASNF++NH+++NLP +  TQV++K++SW +
Sbjct: 240 ELSIETVDHFLTQAVYYTLALDNTLKLPIGASNFIANHVMKNLPRIHKTQVSLKRSSWAR 299

Query: 293 TAKFLKHXXXXXXXXXXXXXXXXTIVGLDKTKDELKHFVPYRXXXXXXXXXXXXXXXXXM 352
            +KFLK+                T+V ++K K E+K F PYR                  
Sbjct: 300 ASKFLKYFENQGFLKLKGKVENLTVVSVNKDKTEIKSFQPYRTIQKSVSTSSKNNDKHD- 358

Query: 353 MKALVIYKPMSSAKPFLCATDLSPNSMFSPQELKGAVDAYIASKGLVSQDNKAAVRLDDL 412
           ++ +V Y+P+++AK  L A   +PN+M   +++K  ++ Y+  K LV+  ++  + LDD 
Sbjct: 359 VEVVVYYQPLNTAKATLHALGNNPNAMLKAKDIKAILNKYVTEKKLVNATDERIILLDDT 418

Query: 413 LFSLVNRSTKKENAVRTILRAQIMPPILKGNFAEHFLVLKPDGTPLFKHPVKGDIPQIQI 472
           LFSL  + +  + + R +LRA++   IL  +F E F + K DG PL   P+K     + +
Sbjct: 419 LFSLAYKKSASD-STRKVLRAKMFDLILSTSFTEVFFIFK-DGKPLSSKPLKSKNRNVSV 476

Query: 473 VTEMKIGRKVVTKVSNFEKFQVDADELAEALRKKCSXXXXXXXXXXXXXXXXXXXQGPHG 532
           +TEMKI RK+VT++SNFE + VD +EL+  LRK+CS                   QGPHG
Sbjct: 477 MTEMKIHRKIVTRISNFEIYGVDPEELSLELRKRCSGSSTVLEPSTLQSTTEVQVQGPHG 536

Query: 533 PAVIELLNQLAIPTKWINFVNKLKKSKK 560
              I +LN+  IP+K+I+F NKL K KK
Sbjct: 537 NTAINILNEHGIPSKYIDFDNKLNKKKK 564

>KLLA0F19294g Chr6 complement(1784664..1786376) [1713 bp, 570 aa]
           {ON} similar to uniprot|Q04600 Saccharomyces cerevisiae
           YDR117C RBF64 Hypothetical ORF
          Length = 570

 Score =  416 bits (1070), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 226/566 (39%), Positives = 322/566 (56%), Gaps = 19/566 (3%)

Query: 1   MFKKEPQIKALSNLKNSERKKLQSQCREQVQPSDYSFPSQVIKQXXXXXXXXXXXXXXDD 60
           MF KEP IK LSNLKNS+RKKLQS  + Q+   +Y+ P+ VIKQ              D+
Sbjct: 1   MFAKEPHIKPLSNLKNSDRKKLQSTIKRQIN-EEYNLPTAVIKQTSFQVANVAGSIYTDE 59

Query: 61  KNIPIWFKEKFSDLLYPTVFSCWS-NKDLVPIVLAHEYVVEEKLLKGANLMLPGTVPPFD 119
            N PIWFK KF D LYPT+FS W+    L+PI+L H++V+E+ +L GA LMLPGTVPPF 
Sbjct: 60  SNKPIWFKTKFEDQLYPTIFSLWNLQMQLLPIILTHDFVIEKHILGGAQLMLPGTVPPFP 119

Query: 120 ERCVKTKMVGVASTHSPDVVKAIGIVQLNLPQYSRVIGESGVAVEIVHTFDDELCKAFKV 179
               +  +VG+AST  P +VKAIGI +++L   S VIG  G+AV +VH  DD L KAFK+
Sbjct: 120 SNVKRGSIVGIASTKDPLLVKAIGIAEMDLCGISHVIGTKGIAVRVVHYLDDGLFKAFKL 179

Query: 180 KLQPPEGADGIXXXXXXXXXXXXXXGAIKIEPKPS----APLQEPIVNIDDAAEQLSQLS 235
           +L+PP                       +++ + +    +  Q P+   ++ A++L ++S
Sbjct: 180 ELEPPAVVYNSEPIETTAIETQTSKYGEQLDEESNHLERSSSQSPV---NEIADELEEMS 236

Query: 236 VEDVDHFFTRALYYTLTQDSKLEVPCSASNFVSNHILRNLPPLDHTQVNMKKTSWKKTAK 295
           +EDVDH   RA+ Y++  D K+ +P  AS F+SNH+++NLP +D   VN+KK+SWKK  K
Sbjct: 237 IEDVDHMLMRAVKYSIKFDDKITLPIVASTFISNHVMKNLPDVDTNMVNIKKSSWKKATK 296

Query: 296 FLKHXXXXXXXXXXXXXXXXTIVGLDKTKDELKHFVPYRXXXXXXXXXXXXXXXXXMMKA 355
            LK+                T++ L+K   +L +   Y+                     
Sbjct: 297 LLKYLEDEGFLKLKGKNDSCTVISLNKNHKDLTNMEAYKTLATIAKKSSGDTTNQSNKNK 356

Query: 356 LV------IYKPMSSAKPFLCA-TDLSPNSMFSPQELKGAVDAYIASKGLVSQDNKAAVR 408
           +       +YKPMS+ + F+   T   P S ++ QELK  +D Y+A+  L+  +NK+ V+
Sbjct: 357 ITAYSGENLYKPMSACQRFITGITADVPQSYYTQQELKKLLDLYVANNNLIDPENKSLVK 416

Query: 409 LDDLLFSLVNRSTKKENAVRTILRAQIMPP-ILKGNFAEHFLVLKPDGTPLFKHPVKGDI 467
            DD L+ + NR+  +   ++ I R  I+ P  L  NF  +  + KP+G PL K P KG I
Sbjct: 417 YDDTLYQMSNRA-PQNGGIQKIARGLIVSPTFLSKNFNTYHQIYKPNGEPLLKVPEKGPI 475

Query: 468 PQIQIVTEMKIGRKVVTKVSNFEKFQVDADELAEALRKKCSXXXXXXXXXXXXXXXXXXX 527
           P ++IVTE KIGRKV+T+V+NFEKF++D++ELA ALRKKCS                   
Sbjct: 476 PTLEIVTEKKIGRKVITRVTNFEKFKIDSEELAAALRKKCS-GSTTIGESKSTKTAEVQV 534

Query: 528 QGPHGPAVIELLNQLAIPTKWINFVN 553
           QGPHG  VI +LN   IPTKWI+F N
Sbjct: 535 QGPHGSIVISILNDYGIPTKWISFEN 560

>TBLA0I03200 Chr9 complement(769960..771651) [1692 bp, 563 aa] {ON}
           Anc_8.269 YDR117C
          Length = 563

 Score =  409 bits (1051), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 215/566 (37%), Positives = 310/566 (54%), Gaps = 9/566 (1%)

Query: 1   MFKKEPQIKALSNLKNSERKKLQSQCREQVQPSDYSFPSQVIKQXXXXXXXXXXXXXXDD 60
           MFKK   I  LSNLKNSE + ++  CR+ +  ++Y FP   +KQ              D 
Sbjct: 1   MFKKNLTITTLSNLKNSESRNIRQTCRDALSNNEYEFPGSQVKQTTFESTVANGVIYTDS 60

Query: 61  KNIPIWFKEKFSDLLYPTVFSCWSNKDLVPIVLAHEYVVEEKLLKGANLMLPGTVPPFDE 120
            N+PIWFK+K+S+ + PTV++ W   + +PI+  H++++E K+  GANLM+PGTV P DE
Sbjct: 61  NNVPIWFKQKYSNTIVPTVYTAWEYPNNIPIIRTHDFIIETKIFNGANLMIPGTVGPHDE 120

Query: 121 RCVKTKMVGVASTHSPDVVKAIGIVQLNLPQYSRVIGESGVAVEIVHTFDDELCKAFKVK 180
           R    K+ G+AST  P  + AIG+   ++      +G++GVAVE++H + DEL   FK+K
Sbjct: 121 RLKPGKICGIASTKVPGTILAIGLCTFDMSTVDTPLGKTGVAVEVLHWYSDELTNIFKIK 180

Query: 181 LQPPEGADGIXXXXXXXXXXXXXXGAI---KIEPKPSAPLQEPIV-NIDDAAEQLSQLSV 236
           L PP   +                  I   + E KP AP  +    N DD AE L QL V
Sbjct: 181 LNPPTIMNTSNLKTLESMTQESMTQEISEAESEVKPDAPFNDTFTSNADDLAETLEQLRV 240

Query: 237 EDVDHFFTRALYYTLTQDSKLEVPCSASNFVSNHILRNLPPLDHTQVNMKKTSWKKTAKF 296
           ED+D+F T++LYYT+TQ++ L++P  +S FVS ++++NLP +DH QVN+KK+SWKKTAKF
Sbjct: 241 EDIDNFLTQSLYYTITQETSLQLPIISSTFVSGYLMKNLPNVDHNQVNIKKSSWKKTAKF 300

Query: 297 LKHXXXXXXXXXXXXXXXXTIVGLDKTKDELKHFVPYRXXX-XXXXXXXXXXXXXXMMKA 355
           LKH                TI G +K K +LK FVPYR                   +K 
Sbjct: 301 LKHFEKEGFLKLKGKGDDLTITGFNKEKPQLKTFVPYRIGKPAGALPSKDKQDNKNFLKV 360

Query: 356 LVIYKPMSSAKPFLCATDLSPNSMFSPQELKGAVDAYIASKGLVSQDNKAAVRLDDLLFS 415
           + +Y P         A  L+  S F+  E+  A+  YIA K L +  +KA + +DD+LF 
Sbjct: 361 VTLYSPKKKNDSCWTALGLTSKSYFTSAEITSAIQGYIAKKNLANPKDKAKISMDDVLFD 420

Query: 416 LVNRSTKKENAVRTILRAQIMPPILKGNFAEHFLVLKPDGTPLFKHPVKGDIPQIQIVTE 475
           LV  +  K NA R I+R+Q++ P+L  NF  +  +   D   L KHP KG  P +++VTE
Sbjct: 421 LV-ITNNKANANRNIMRSQVVEPVLVNNFLLYHQLFTHDNISLSKHPKKGSPPTVKMVTE 479

Query: 476 MKIGRKVVTKVSNFEKFQVDADELAEALRKKCSXXXXXXXXXXXXXXXXXXXQGPHGPAV 535
                KV+T+VSNFE F +DA +++  L+  CS                   QGPHG  V
Sbjct: 480 KVKRGKVITRVSNFEVFNIDAKDMSNELKVLCS---GSTSIEELPNGSEVQVQGPHGDIV 536

Query: 536 IELLNQLAIPTKWINFVNKLKKSKKR 561
           +E   +  IP KW ++ NK+K  K+R
Sbjct: 537 MEYFEKHGIPRKWFDYTNKVKPKKRR 562

>AGR079W Chr7 (879417..881045) [1629 bp, 542 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR117C
          Length = 542

 Score =  384 bits (987), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 207/563 (36%), Positives = 311/563 (55%), Gaps = 23/563 (4%)

Query: 1   MFKKEPQIKALSNLKNSERKKLQSQCREQVQPSDYSFPSQVIKQXXXXXXXXXXXXXXDD 60
           MFKKEP +   SN KNSERK+LQ+  REQ +   Y F S  IK               D 
Sbjct: 1   MFKKEPNLNPTSNTKNSERKRLQASIREQYEYESYQFSSTEIKHGTFKTQSTVGTVYTDP 60

Query: 61  KNIPIWFKEKFSDLLYPTVFSCWSNKDLVPIVLAHEYVVEEKLLKGANLMLPGTVPPFDE 120
            NIP+WF+ K      PTV+SCW + DL+P+V  HE+VVE KL  GA+LMLPGTVPPF  
Sbjct: 61  NNIPLWFRGKHDQTYIPTVYSCWDHPDLLPVVHTHEHVVESKLKGGADLMLPGTVPPFSS 120

Query: 121 RCVKTKMVGVASTHSPDVVKAIGIVQLNLPQYSRVIGESGVAVEIVHTFDDELCKAFKVK 180
              + ++VG+AST +P VVKA+GI +++L   + V   +GVAV ++HT+ D LC+ FKV+
Sbjct: 121 GTRRGRVVGIASTRAPGVVKAVGICEMDLEGVTTVADTTGVAVRVLHTYGDGLCRVFKVQ 180

Query: 181 LQPPEGADGIXXXXXXXXXXXXXXGAIKIEPKPSAPLQEP--IVNIDDAAEQLSQLSVED 238
            + PE ++                 A    P+   P  EP      +  AE+L +L++ED
Sbjct: 181 REAPEASE-----------------AKGASPEAREPEAEPPKTAPGEGLAEELERLTMED 223

Query: 239 VDHFFTRALYYTLTQDSKLEVPCSASNFVSNHILRNLPPLDHTQVNMKKTSWKKTAKFLK 298
           VDH  TRA+YYT+  D +L++P +AS F++ H+L+NLPP+D +QV +K++SW K AK LK
Sbjct: 224 VDHLLTRAVYYTIKADGRLQLPVTASKFIAEHVLKNLPPMDLSQVTVKRSSWGKAAKLLK 283

Query: 299 HXXXXXXXXXXXXXXXXTIVGLDKTKDELKHFVPYRXXXXXXXXXXXXXXXXXMMKALVI 358
           H                T+V ++   + LK F PYR                  ++ +  
Sbjct: 284 HFEAQGLLTLKGKPESFTVVSVNSAHEALKSFEPYRTVSDKASTGSKNSSTTQSLEIVYH 343

Query: 359 YKPMSSAKPFLCATDLSPNSMFSPQELKGAVDAYIASKGLVSQDNKAAVRLDDLLFSLVN 418
           Y P  +  P L    +S     S ++++  ++ Y+A++  V   +K+ +RLDD L  L++
Sbjct: 344 YVPNRTLLPQLNGLGISGGDALSAKDIRDRLEQYVAARKCVDPYDKSMLRLDDTLAQLLH 403

Query: 419 RSTKKENAVRTILRAQIMPPILKGNFAEHFLVLKPDGTPLFKHPVKGDIPQIQIVTEMKI 478
           ++   +   R++ R + +  +L  +F+E+F+V++ D  PL K P KG  P I++  E KI
Sbjct: 404 KNVNADTP-RSLPRPEALAALLSRSFSEYFVVMRGDA-PLSK-PQKGRAPPIKVTNERKI 460

Query: 479 GRKVVTKVSNFEKFQVDADELAEALRKKCSXXXXXXXXXXXXXXXXXXXQGPHGPAVIEL 538
            +KVVTKVSNFE + VD +ELA  LR +CS                   QGPH   ++ +
Sbjct: 461 YKKVVTKVSNFEVYGVDPEELAAELRVRCS-GSTTITDVPNTKAVEVQVQGPHEATIVSI 519

Query: 539 LNQLAIPTKWINFVNKLKKSKKR 561
           LN+  IP+K+I    K++  KK+
Sbjct: 520 LNKHGIPSKYITLDCKVQPKKKK 542

>KNAG0H03200 Chr8 (599611..601296) [1686 bp, 561 aa] {ON} Anc_8.269
           YDR117C
          Length = 561

 Score =  353 bits (905), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 210/564 (37%), Positives = 307/564 (54%), Gaps = 23/564 (4%)

Query: 1   MFKKEPQIKALSNLKNSERKKLQSQCREQVQPSDYSFPSQVIKQXXXXXXXXXXXXXXDD 60
           MFKK P IK LSNLKNSE++KLQ + ++Q    ++ F    +KQ              +D
Sbjct: 1   MFKKTPHIKPLSNLKNSEQRKLQQEVQKQFGVDEFVFSGNTVKQTNFQSTTSVGTIYLND 60

Query: 61  KNIPI--WFKEKF-SDLLYPTVFSCWSNKDLVPIVLAHEYVVEEKLLKGANLMLPGTVPP 117
           + IP+  +FKEK  S  L+P+V++CWS+  L+PI+L H  V+E+ L  GANLM+ GT+PP
Sbjct: 61  EKIPVPLFFKEKHGSGPLWPSVYACWSHPGLLPIILTHSVVIEDHLFNGANLMISGTMPP 120

Query: 118 FD-ERCVKTKMVGVASTHSPDVVKAIGIVQLNLPQYSRVIGESGVAVEI--VHTFDDELC 174
           FD     K +  G+A+  SPDV+ A+G ++++L  ++         V +   H F D L 
Sbjct: 121 FDVAHLHKGRPCGIANYKSPDVIIAVGTLKMDLEPFNTTGVVGHSGVVVEVAHHFADGLA 180

Query: 175 KAFKVKLQPPEGADGIXXXXXXXXXXXXXXGAIKIEPKPSAPLQEPIVNIDDAAEQLSQL 234
            AF++KL  P+  +                    +E KP++P+  P+  +DD AE L  L
Sbjct: 181 DAFRLKLDIPDKLESATTQEVAEEP--------PVEAKPTSPVTNPVA-VDDLAEVLETL 231

Query: 235 SVEDVDHFFTRALYYTLTQDSKLEVPCSASNFVSNHILRNLP-PLDHTQVNMKKTSWKKT 293
           SVEDVD+F TRALYYTLTQ+ KL +P +ASNF+S H+++ LP  +D T+VN+KK+SWKKT
Sbjct: 232 SVEDVDYFMTRALYYTLTQEPKLALPINASNFMSMHLMKCLPKGIDATEVNVKKSSWKKT 291

Query: 294 AKFLKHXXXXXXXXXXXXXXXXTIVGL--DKTKDELKHFVPYRXXXXXXXXXXXXXXXXX 351
           AK+LKH                 +VG    KT   LK FVPY                  
Sbjct: 292 AKYLKHFEKEGLLKLKGKGDDLVVVGSTDSKTHAGLKDFVPYLVGNSIAESGPKSQTTNG 351

Query: 352 -MMKALVIYKPMSSAKPFLCATDLSPNSMFSPQELKGAVDAYIASKGLVSQDNKAAVRLD 410
            +M A+  ++P S+A+    A  L     FS  E++  ++ YI +  L   +N   V L+
Sbjct: 352 PVMFAVTSFQPDSTAQ---TALPLGGQRYFSGPEIREVLNEYITANKLAQPNNPKMVLLN 408

Query: 411 DLLFSLVNRSTK-KENAVRTILRAQIMPPILKGNFAEHFLVLKPDGTPLFKHPVKGDIPQ 469
           D LF +V +  + K+   R + R +I+  ++K +F   + + K   TPL KHP KG+ P+
Sbjct: 409 DTLFGMVTKGNEEKQTTKRIMARPEILERVMKYHFKTLYQLFKDKDTPLTKHPQKGEPPK 468

Query: 470 IQIVTEMKIGRKVVTKVSNFEKFQVDADELAEALRKKCSXXXXXXXXXXXXXXXXXXXQG 529
           + I+TEMKIGRKVVT+V NF+   +   E A  LRK CS                   QG
Sbjct: 469 VHIITEMKIGRKVVTRVYNFDHLNIRDTEFAADLRKLCSASTTIGKTVSTPVVSEIQVQG 528

Query: 530 PHGPAVIELLNQLAIPTKWINFVN 553
            HGP +I+ L +L +P+ W+ F N
Sbjct: 529 AHGPLIIDHLRELGVPSSWVVFEN 552

>Suva_8.265 Chr8 (481783..483054) [1272 bp, 423 aa] {ON} YOR212W
           (REAL)
          Length = 423

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 42/87 (48%), Gaps = 6/87 (6%)

Query: 353 MKALVIYKPMSSAKPFLCATDLSPNSMFSPQELKGAVDAYIASKGLVSQDNKAAVRLDDL 412
           + +  +++      P   A ++  NS  SPQ ++     Y+ ++G+VS D  A+ R   L
Sbjct: 307 IASFSLFRSYEEHSPTYMAANMEYNSTQSPQTVRSTTSGYLDNQGVVSLDFSASGR---L 363

Query: 413 LFSLVNRSTKKENAVRTILRAQIMPPI 439
           ++S     T     V  IL+A+I+  +
Sbjct: 364 MYSCY---TDLGCIVWDILKAEIVGKL 387

>Smik_15.398 Chr15 (692606..693883) [1278 bp, 425 aa] {ON} YOR212W
           (REAL)
          Length = 425

 Score = 32.3 bits (72), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 27/46 (58%)

Query: 364 SAKPFLCATDLSPNSMFSPQELKGAVDAYIASKGLVSQDNKAAVRL 409
           ++ P   A ++  N+  SPQ LK    +Y+ ++G+VS D  A+ RL
Sbjct: 320 TSTPTYLAANMEYNTTQSPQTLKSTSSSYLDNQGVVSLDFSASGRL 365

>YOR212W Chr15 (742910..744181) [1272 bp, 423 aa] {ON}  STE4G
           protein beta subunit, forms a dimer with Ste18p to
           activate the mating signaling pathway, forms a
           heterotrimer with Gpa1p and Ste18p to dampen signaling;
           may recruit Rho1p to the polarized growth site during
           mating; contains WD40 repeats
          Length = 423

 Score = 31.6 bits (70), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 25/43 (58%)

Query: 367 PFLCATDLSPNSMFSPQELKGAVDAYIASKGLVSQDNKAAVRL 409
           P   A ++  N+  SPQ LK    +Y+ ++G+VS D  A+ RL
Sbjct: 321 PTYMAANMEYNTAQSPQTLKSTSSSYLDNQGVVSLDFSASGRL 363

>SAKL0G15620g Chr7 (1342049..1344688) [2640 bp, 879 aa] {ON} some
           similarities with uniprot|P38850 Saccharomyces
           cerevisiae YHR154W RTT107 Regulator of Ty1 Transposition
           Establishes Silent Chromatin involved in silencing
          Length = 879

 Score = 31.6 bits (70), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 16/62 (25%), Positives = 29/62 (46%)

Query: 108 NLMLPGTVPPFDERCVKTKMVGVASTHSPDVVKAIGIVQLNLPQYSRVIGESGVAVEIVH 167
           +L++P   P + E CV T  +  AS  SPD    +   Q+ + + S    E    + +++
Sbjct: 85  DLLIPVVAPTWIESCVSTNRIVRASNFSPDQAHVLKNCQIYISKQSISATECSFYISLIN 144

Query: 168 TF 169
           T 
Sbjct: 145 TL 146

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 51,366,790
Number of extensions: 1937517
Number of successful extensions: 4497
Number of sequences better than 10.0: 33
Number of HSP's gapped: 4469
Number of HSP's successfully gapped: 34
Length of query: 562
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 447
Effective length of database: 40,294,809
Effective search space: 18011779623
Effective search space used: 18011779623
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)