Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_56.237668.270ON74074036380.0
KLTH0G13508g8.270ON64557816960.0
SAKL0H16852g8.270ON6445088631e-105
Suva_2.2778.270ON6494714782e-50
Smik_4.3628.270ON6484224703e-49
ZYRO0C01474g8.270ON5994154542e-47
Kpol_392.18.270ON4244214362e-46
TDEL0F039708.270ON6194144445e-46
AGR078C8.270ON7155224468e-46
Skud_4.3788.270ON6524464351e-44
YDR118W (APC4)8.270ON6524314332e-44
Ecym_43008.270ON7155084272e-43
KAFR0B054608.270ON6104153668e-36
TBLA0C045708.270ON6084103623e-35
NCAS0B037908.270ON6124183524e-34
TPHA0J007908.270ON6854293421e-32
KNAG0H031908.270ON6224153134e-29
CAGL0B01859g8.270ON6224173002e-27
NDAI0J012708.270ON7354672895e-26
KLLA0F19316g8.270ON6713511673e-11
Ecym_74022.470ON60661830.24
Suva_7.443.528ON805189780.99
KAFR0H012203.310ON46854771.2
KLLA0A01430g3.535ON382102761.5
TDEL0A013308.231ON160461771.5
YML068W (ITT1)4.332ON46464752.3
KLLA0A08822g4.122ON58258733.6
TBLA0B043908.585ON33677723.8
ZYRO0A08690g2.401ON51680725.3
TPHA0C014807.180ON439120717.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_56.23766
         (740 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_56.23766 s56 complement(695943..698165) [2223 bp, 740 aa] {...  1405   0.0  
KLTH0G13508g Chr7 complement(1159671..1161608) [1938 bp, 645 aa]...   657   0.0  
SAKL0H16852g Chr8 complement(1482321..1484255) [1935 bp, 644 aa]...   337   e-105
Suva_2.277 Chr2 (480574..481624,481684..482579) [1947 bp, 649 aa...   188   2e-50
Smik_4.362 Chr4 (647135..649081) [1947 bp, 648 aa] {ON} YDR118W ...   185   3e-49
ZYRO0C01474g Chr3 complement(106209..108008) [1800 bp, 599 aa] {...   179   2e-47
Kpol_392.1 s392 complement(1..1272) [1272 bp, 424 aa] {ON} compl...   172   2e-46
TDEL0F03970 Chr6 (735393..737252) [1860 bp, 619 aa] {ON} Anc_8.2...   175   5e-46
AGR078C Chr7 complement(877135..879282) [2148 bp, 715 aa] {ON} S...   176   8e-46
Skud_4.378 Chr4 (657502..659460) [1959 bp, 652 aa] {ON} YDR118W ...   172   1e-44
YDR118W Chr4 (685882..687840) [1959 bp, 652 aa] {ON}  APC4Subuni...   171   2e-44
Ecym_4300 Chr4 complement(642023..644170) [2148 bp, 715 aa] {ON}...   169   2e-43
KAFR0B05460 Chr2 complement(1118755..1120587) [1833 bp, 610 aa] ...   145   8e-36
TBLA0C04570 Chr3 (1107010..1108836) [1827 bp, 608 aa] {ON} Anc_8...   144   3e-35
NCAS0B03790 Chr2 complement(676973..678811) [1839 bp, 612 aa] {O...   140   4e-34
TPHA0J00790 Chr10 (182991..185048) [2058 bp, 685 aa] {ON} Anc_8....   136   1e-32
KNAG0H03190 Chr8 complement(597550..599418) [1869 bp, 622 aa] {O...   125   4e-29
CAGL0B01859g Chr2 (168976..170844) [1869 bp, 622 aa] {ON} weakly...   120   2e-27
NDAI0J01270 Chr10 (297256..299463) [2208 bp, 735 aa] {ON} Anc_8....   115   5e-26
KLLA0F19316g Chr6 (1786659..1788674) [2016 bp, 671 aa] {ON} cons...    69   3e-11
Ecym_7402 Chr7 complement(827224..829044) [1821 bp, 606 aa] {ON}...    37   0.24 
Suva_7.44 Chr7 (79883..82300) [2418 bp, 805 aa] {ON} YGL216W (REAL)    35   0.99 
KAFR0H01220 Chr8 complement(224097..225503) [1407 bp, 468 aa] {O...    34   1.2  
KLLA0A01430g Chr1 complement(128139..129287) [1149 bp, 382 aa] {...    34   1.5  
TDEL0A01330 Chr1 complement(233436..238250) [4815 bp, 1604 aa] {...    34   1.5  
YML068W Chr13 (137550..138944) [1395 bp, 464 aa] {ON}  ITT1Prote...    33   2.3  
KLLA0A08822g Chr1 (772565..774313) [1749 bp, 582 aa] {ON} simila...    33   3.6  
TBLA0B04390 Chr2 (1014987..1015997) [1011 bp, 336 aa] {ON} Anc_8...    32   3.8  
ZYRO0A08690g Chr1 (691253..692803) [1551 bp, 516 aa] {ON} highly...    32   5.3  
TPHA0C01480 Chr3 complement(338034..339353) [1320 bp, 439 aa] {O...    32   7.0  

>Kwal_56.23766 s56 complement(695943..698165) [2223 bp, 740 aa] {ON}
           YDR118W (APC4) - subunit of the anaphase promoting
           complex (APC) [contig 173] FULL
          Length = 740

 Score = 1405 bits (3638), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 688/740 (92%), Positives = 688/740 (92%)

Query: 1   MTSNWKLKGVVTLPKGHKVVWNPRLSLYLVLTDKKIAVNRVIDGQQIAAVNLRDEHEIVG 60
           MTSNWKLKGVVTLPKGHKVVWNPRLSLYLVLTDKKIAVNRVIDGQQIAAVNLRDEHEIVG
Sbjct: 1   MTSNWKLKGVVTLPKGHKVVWNPRLSLYLVLTDKKIAVNRVIDGQQIAAVNLRDEHEIVG 60

Query: 61  IQWEKNESKLFAVFQSNGVVRIYDCSIGGSLREMVNLVEEGQAAEVKVDAVVWMTVEWAK 120
           IQWEKNESKLFAVFQSNGVVRIYDCSIGGSLREMVNLVEEGQAAEVKVDAVVWMTVEWAK
Sbjct: 61  IQWEKNESKLFAVFQSNGVVRIYDCSIGGSLREMVNLVEEGQAAEVKVDAVVWMTVEWAK 120

Query: 121 FPESYRGLDFDITTLMPGMVRLVRDSKQLSLAPLDLGKLSWLDGKYGDAAIFLAHDCEST 180
           FPESYRGLDFDITTLMPGMVRLVRDSKQLSLAPLDLGKLSWLDGKYGDAAIFLAHDCEST
Sbjct: 121 FPESYRGLDFDITTLMPGMVRLVRDSKQLSLAPLDLGKLSWLDGKYGDAAIFLAHDCEST 180

Query: 181 EYMVAIDGQLSLRFPSGIRNVHKILPQGGSGSFLAVGKDGTLQWVTLKFLECALMRELVK 240
           EYMVAIDGQLSLRFPSGIRNVHKILPQGGSGSFLAVGKDGTLQWVTLKFLECALMRELVK
Sbjct: 181 EYMVAIDGQLSLRFPSGIRNVHKILPQGGSGSFLAVGKDGTLQWVTLKFLECALMRELVK 240

Query: 241 SSGQIRFLCRYLAENVSLCHTELIEPYRVFLTRLMGAYEGDDLATRLRDILLTGYIPDDL 300
           SSGQIRFLCRYLAENVSLCHTELIEPYRVFLTRLMGAYEGDDLATRLRDILLTGYIPDDL
Sbjct: 241 SSGQIRFLCRYLAENVSLCHTELIEPYRVFLTRLMGAYEGDDLATRLRDILLTGYIPDDL 300

Query: 301 EEWLCNSVGDKNYKRWKQLSTRMYGDLNNVLTLAVVPACERLILAAERMQGIHKSLKLQR 360
           EEWLCNSVGDKNYKRWKQLSTRMYGDLNNVLTLAVVPACERLILAAERMQGIHKSLKLQR
Sbjct: 301 EEWLCNSVGDKNYKRWKQLSTRMYGDLNNVLTLAVVPACERLILAAERMQGIHKSLKLQR 360

Query: 361 FCKDYAGELTTVELQTLISECQTLLEFTLNLITELNRDAALHQVFAEWFYDVVMETVDED 420
           FCKDYAGELTTVELQTLISECQTLLEFTLNLITELNRDAALHQVFAEWFYDVVMETVDED
Sbjct: 361 FCKDYAGELTTVELQTLISECQTLLEFTLNLITELNRDAALHQVFAEWFYDVVMETVDED 420

Query: 421 YKRPSRDGIPLDSYGLDQYLSYCWQSSETIQRFETSLPELAARPGVSAALLDRKYTREWL 480
           YKRPSRDGIPLDSYGLDQYLSYCWQSSETIQRFETSLPELAARPGVSAALLDRKYTREWL
Sbjct: 421 YKRPSRDGIPLDSYGLDQYLSYCWQSSETIQRFETSLPELAARPGVSAALLDRKYTREWL 480

Query: 481 LADIHVTETVHVDNDIRAGFDEVLDAVASDFRAAIAYRTTTPQQPSAAECLTIASVEPPR 540
           LADIHVTETVHVDNDIRAGFDEVLDAVASDFRAAIAYRTTTPQQPSAAECLTIASVEPPR
Sbjct: 481 LADIHVTETVHVDNDIRAGFDEVLDAVASDFRAAIAYRTTTPQQPSAAECLTIASVEPPR 540

Query: 541 DGFSCSPASQPVLPTITHARLEQPHHVTGTLIFLHEGPCACDEHLPFPPASTVKSXXXXX 600
           DGFSCSPASQPVLPTITHARLEQPHHVTGTLIFLHEGPCACDEHLPFPPASTVKS     
Sbjct: 541 DGFSCSPASQPVLPTITHARLEQPHHVTGTLIFLHEGPCACDEHLPFPPASTVKSPAAEP 600

Query: 601 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNSGLPLSCTVLLLHSTPSQLSSTDISHGL 660
                                          NSGLPLSCTVLLLHSTPSQLSSTDISHGL
Sbjct: 601 TPEVTTTTTTTVTATATATATATVTPIPATTNSGLPLSCTVLLLHSTPSQLSSTDISHGL 660

Query: 661 HPTTVSPVTIPINXXXXXXXXXXXXXXXXGTTRVAARCSSHGTTTTHIASVHSDSTMSVF 720
           HPTTVSPVTIPIN                GTTRVAARCSSHGTTTTHIASVHSDSTMSVF
Sbjct: 661 HPTTVSPVTIPINLPAQSSPPPPPLQSLSGTTRVAARCSSHGTTTTHIASVHSDSTMSVF 720

Query: 721 EMSRETSLPHPNLGVSSYPM 740
           EMSRETSLPHPNLGVSSYPM
Sbjct: 721 EMSRETSLPHPNLGVSSYPM 740

>KLTH0G13508g Chr7 complement(1159671..1161608) [1938 bp, 645 aa]
           {ON} some similarities with uniprot|Q04601 Saccharomyces
           cerevisiae YDR118W APC4 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C)
          Length = 645

 Score =  657 bits (1696), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/578 (56%), Positives = 412/578 (71%), Gaps = 22/578 (3%)

Query: 1   MTSNWKLKGVVTLPKGHKVVWNPRLSLYLVLTDKKIAVNRVIDGQQIAAVNLRDEHEIVG 60
           M   W+ K ++ LPK   VVWNPRLSLYLVL DK ++VNR IDGQ+IAAVNLR + +++G
Sbjct: 1   MFDKWQFKRLIKLPKHRGVVWNPRLSLYLVLGDKTVSVNRAIDGQRIAAVNLRGDGQLIG 60

Query: 61  IQWEKNESKLFAVFQSNGVVRIYDCSIGGSLREMVNLVEEGQAAEVKVDAVVWMTVEWAK 120
            QWE  E KLFA+F  NG VRIYDC+ GGSLRE+V+LV+EGQ+A+V VD  VW   +WA+
Sbjct: 61  AQWELAEGKLFALFFGNGAVRIYDCATGGSLREVVDLVDEGQSADVTVDTAVWSGAQWAQ 120

Query: 121 FPESYRGLDFDITTLMPGMVRLVRDSKQLSLAPLDLGKLSWLDGKYGDAAIFLAHDCEST 180
           F + Y+GL+ +IT  +PGMVRLVRD+KQLS+ PL+ GKL WL     DAAIFL HD +S 
Sbjct: 121 FRQEYKGLNIEITKQLPGMVRLVRDAKQLSVVPLETGKLRWLADPGKDAAIFLGHDEKSG 180

Query: 181 EYMVAIDGQLSLRFPSGIRNVHKILPQGGSGSFLAVGKDGTLQWVTLKFLECALMRELVK 240
           +Y++ +DG LS+R PSGI+ +HKIL QG  G+F+ VG DGT+QWV L+FL  ALMREL++
Sbjct: 181 DYLMTVDGLLSVRVPSGIKKMHKILRQGEDGTFVGVGADGTVQWVVLRFLNSALMRELIR 240

Query: 241 SSGQIRFLCRYLAENVSLCHTELIEPYRVFLTRLMGAYEGDDLATRLRDILLTGYIPDDL 300
            SGQIRFLC YL EN+++C T+LIEPYR FLTR+  AYEG +LA+R RDI+L+GYIP+DL
Sbjct: 241 YSGQIRFLCSYLTENINMCKTDLIEPYRQFLTRIADAYEGGELASRFRDIILSGYIPEDL 300

Query: 301 EEWLCNSVGDKNYKRWKQLSTRMYGDLNNVLTLAVVPACERLILAAERMQGIHKSLKLQR 360
           E+WLCNS+GDKNYKRWKQLSTRMYGDLNNVL LAV+PACERLILAAE++QGIHK LKLQ 
Sbjct: 301 EDWLCNSIGDKNYKRWKQLSTRMYGDLNNVLALAVIPACERLILAAEQLQGIHKGLKLQE 360

Query: 361 FCKDYAGELTTVELQTLISECQTLLEFTLNLITELNRDAALHQVFAEWFYDVVMETVDED 420
           F      E  + E+  LI+ CQ LL  +L L+ +LNRD  LH +FA+WFYDVVMETVDED
Sbjct: 361 FGLASPQEFESAEVTELITGCQALLHASLELVVDLNRDTRLHAIFADWFYDVVMETVDED 420

Query: 421 YKRPSRDGIPLDSYG-----LDQYLSYCWQSSETIQRFETSLPELAARPGVSAALLDRKY 475
           YKRP       D YG     LDQY+S+CW++SE   RFE  LP+LAA   +SA  LD  Y
Sbjct: 421 YKRPQNRDSHQDCYGDRALALDQYISHCWENSEVWTRFERLLPQLAADADISATKLDHIY 480

Query: 476 TREWLLADIHVTETVHVDNDIRAGFDEVLDAVASDFRAAIAYRTTTPQQPSAAECLTIAS 535
           TR W+L  +HVT  V    D+ +   EVLD  A + +  +  R  T +   A    T+ +
Sbjct: 481 TRAWVLEQVHVTSPVRA-CDVDSV--EVLDVQACN-KVIMVCRVQTKEGSGA----TVVT 532

Query: 536 VEPPRDGFSCSPASQPVLPTITHARLEQPHHVTGTLIF 573
           VEPP         ++PVL ++   +L   H +   L+ 
Sbjct: 533 VEPP------IADAEPVLQSM---KLGMDHVIKAALVL 561

>SAKL0H16852g Chr8 complement(1482321..1484255) [1935 bp, 644 aa]
           {ON} some similarities with uniprot|Q04601 Saccharomyces
           cerevisiae YDR118W APC4 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 644

 Score =  337 bits (863), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 190/508 (37%), Positives = 286/508 (56%), Gaps = 36/508 (7%)

Query: 5   WKLKGVVTLPKGHKVVWNPRLSLYLVLTDKKIAVNRVIDGQQIAAVNLRDEHEIVGIQWE 64
           W++  V T P   ++VWNP LSL+LV T K IAVNR +DGQ+IA V+++D   IV  QWE
Sbjct: 4   WEVHSVKTFPGEQRIVWNPVLSLFLVPTVKGIAVNRPVDGQRIATVSVKDHGTIVDYQWE 63

Query: 65  KNESKLFAVFQSNGVVRIYDCSIGGSLREMVNLVEEGQAAEVKVDAVVWMTVEWAKFPES 124
           ++E ++FAV  SNG++R+YD S+ G     V L +    ++  V    W    W    + 
Sbjct: 64  QSEGRIFAVCHSNGIIRLYDSSLAGKSVGSVILGD----SDCDVLKFCWSQDSWTFGSKF 119

Query: 125 YRGLDFDITTLMPGMVRLVRDSKQLSLAPLDLG----KLSWLDGKYGDAAIFLAHDCEST 180
               D +IT+LMP +V+ V+DS+QL++ P D+G    + S LDG    + IFL +D +  
Sbjct: 120 SNVFDHEITSLMPRLVKFVKDSRQLTMLPTDVGDGVPRWSKLDG--NKSFIFLGYDSKRQ 177

Query: 181 EYMVAIDGQLSLRF------------------PSGIRNVHKILPQGGSGSFLAVGKDGTL 222
           + ++AIDG   L F                  P+ +R++ K      +G +L +  D  +
Sbjct: 178 KILMAIDGAFKLSFSVAALVAAGERLDEGDSVPNNVRDILKY----DNGEYLVITDDWYI 233

Query: 223 QWVTLKFLECALMRELVKSSGQIRFLCRYLAENVSLCHTELIEPYRVFLTRLMGAYEGDD 282
           Q +   FL C L RE++    +IR L + L E+VSL  TEL+EPY  F+ R++GAYEG D
Sbjct: 234 QKIKFDFLNCNLTREMISCCNRIRSLHKQLHESVSLVKTELVEPYTQFIERVLGAYEG-D 292

Query: 283 LATRLRDILLTGYIPDDLEEWLCNSVGDKNYKRWKQLSTRMYGDLNNVLTLAVVPACERL 342
           L   L ++L TG +P +LE+WL N++GDKN +RWK+LS+ MY +   ++ L +VP CERL
Sbjct: 293 LIGDLTELLFTGSVPPELEDWLSNTIGDKNLRRWKKLSSVMYENAVKIMVLTMVPVCERL 352

Query: 343 ILAAERMQGIHKSLKLQRFCKDYAGELTTVELQTLISECQTLLEFTLNLITELNRDAALH 402
           IL  ER+ GI K LKL    K+    L  +E Q L+   Q  LE  +  I ++N D+ LH
Sbjct: 353 ILCGERLHGIIKGLKLIGL-KELEDNLEVLEAQKLVCLSQEALENIIVSIKQINVDSNLH 411

Query: 403 QVFAEWFYDVVMETVDEDYKRPSRDGIPLDSYGLDQYLSYCWQSSETIQRFETSLPELAA 462
           + F +WF+D+VME VDEDYKR +      D   + Q++S       T +  + S P +  
Sbjct: 412 EAFIDWFHDMVMEAVDEDYKRKT--SYNCDPLKIQQFMSGSLTGVHTYEWCQYSFPAVTN 469

Query: 463 RPGVSAALLDRKYTREWLLADIHVTETV 490
           R G     +++ Y   W++  +   E +
Sbjct: 470 RLGKQFETVEQLYVANWVVQRVKFGEPI 497

>Suva_2.277 Chr2 (480574..481624,481684..482579) [1947 bp, 649 aa]
           {ON} YDR118W (REAL)
          Length = 649

 Score =  188 bits (478), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 132/471 (28%), Positives = 229/471 (48%), Gaps = 36/471 (7%)

Query: 21  WNPRLSLYLVLTDKKIAVNRVIDGQQIAAVNLRDEHEIVGIQWEKNESKLFAVFQSNGVV 80
           +NPR  ++ +   K +A++RV D  ++A + +R+   +    W+ +  K  ++F  +G +
Sbjct: 8   YNPRFPIFAIRVVKGLAIHRVSDHARLAVIPVRNIALVANYNWDVSTGKFLSIFFKDGTI 67

Query: 81  RIYDCSIGGSLREMVNLVEEGQAAEVKVDAVVWMTVEWAKFPESYRGLDFDITTLMPGMV 140
           RI+D    G L   + +         K+   +W  +   K+  S R    ++  ++P ++
Sbjct: 68  RIHDIFKDGRLVSFLRI------PRTKISRGIWDRIP-LKYESSNRNFANNVIDVLPKLI 120

Query: 141 RLVRDSKQLSLAPLDLGKLSWLDGKYGDAA------IFLAHDCESTEYMVAIDGQLSLRF 194
           R V+DSK++++AP       W      D        I +  +  + +  V  +G  ++  
Sbjct: 121 RFVKDSKRVTIAPYTPPNSLWRGPDEDDPENCENLDIHVIFNEGNDKITVFFNGDYAILL 180

Query: 195 P-SGIRN--VHKILPQGGSGSFLAVGKDGTLQWVTL-KFLECALMRELVKSSGQIRFLCR 250
           P S I N  + K + +  +G +     DGT+    L + L+     +L++    I+ L  
Sbjct: 181 PVSDIENEKILKSVVKVQNGFYHCFYNDGTVSTFNLERLLQSEPSVDLLRYMMVIKELIG 240

Query: 251 YLAENVSLCHTELIEPYRVFLTRLMG-AYEGDDLATRLRDILLTGYIPDDLEEWLCNSVG 309
           YL  ++   + EL  PY  F+ R+   AY    L + L+ + L G +P DL++WLCN+VG
Sbjct: 241 YLLAHIEFINRELTTPYMDFVKRICDEAYGYSKLKSELKCLFLLGEVPSDLDDWLCNAVG 300

Query: 310 DKNYKRWKQLSTRMYGDLNNVLTLAVVPACERLILAAERMQGIHKSLKLQRFCKDYAGEL 369
           +KN+KRWK L    Y     V TLA VP CER+I+  ++++GI ++  +Q        +L
Sbjct: 301 EKNFKRWKVLGCEAYQKTVQVFTLAFVPTCERIIIFVQKLKGILEAFSIQX-XXXXXXDL 359

Query: 370 TTVELQTLISECQTLLEFTLNLITELNRDAALHQVFAEWFYDVVMETVDEDYKRPSRDGI 429
           T VEL  L+ + Q LL  TL  I +L +D  L + F  WF D + E +DEDYK       
Sbjct: 360 TAVEL--LLKQSQELLNITLKSIIDLGKDETLFEKFLMWFNDRIHEVLDEDYK------- 410

Query: 430 PLDSYGLDQYLSYCWQSSETIQRFETSLPELAARPGVSAALLDRKYTREWL 480
           P   +  D Y  Y     + +  FE  L +   R   S++++D K  R+ +
Sbjct: 411 PKFEFEDDPYFGY-----DLLNFFEKFLSD---RNTESSSVIDMKLYRDLI 453

>Smik_4.362 Chr4 (647135..649081) [1947 bp, 648 aa] {ON} YDR118W
           (REAL)
          Length = 648

 Score =  185 bits (470), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 128/422 (30%), Positives = 206/422 (48%), Gaps = 39/422 (9%)

Query: 21  WNPRLSLYLVLTDKKIAVNRVIDGQQIAAVNLRDEHEIVGIQWEKNESKLFAVFQSNGVV 80
           +NPR  ++   T K +A+NRV D  ++AA+ +R+ + +    W+    K  ++F  +G +
Sbjct: 12  YNPRFPIFATRTAKGLAINRVSDHARLAAIPIRNINLVANYNWDTVTGKFLSIFFKDGTI 71

Query: 81  RIYDCSIGGSLREMVNLVEEGQAAEVKVDAVVWMTVEWAKFPESYRG-LDFDITTLMPGM 139
           RI+D    G L   + +         K+    W  +      ES  G L ++I   +P +
Sbjct: 72  RIHDIFKDGRLVSFLRI------PSTKISKGTWDRIPLES--ESGNGNLAYNIIDYLPKL 123

Query: 140 VRLVRDSKQLSLAPLDLGKLSWL--------DGKYGDAAIFL--AHDCESTEYMVAIDGQ 189
           +R V+DSK++++ P       W         + +  D  I     HD    +  V  +G 
Sbjct: 124 IRYVKDSKRINIVPYTPPNSLWRGPDEDEPENNEKLDIHIIFNEGHD----KITVFFNGD 179

Query: 190 LSLRFPSG-------IRNVHKILPQGGSGSFLAVGKDGTLQWVTL-KFLECALMRELVKS 241
            ++  P G       ++++ KI      G +     DGT++ + L   L       ++K 
Sbjct: 180 YAIFVPVGADENERFVKSIVKI----QDGFYHCFYDDGTVRTLNLGPLLRSEPSMNILKY 235

Query: 242 SGQIRFLCRYLAENVSLCHTELIEPYRVFLTRLMG-AYEGDDLATRLRDILLTGYIPDDL 300
              I+ L  YL  ++   + EL+ PY  F+ RL   AY  D L + L  + L G +  DL
Sbjct: 236 IMAIKELIGYLLNHIEFINRELVTPYLEFVNRLCDEAYGYDKLISELECLFLLGEVSCDL 295

Query: 301 EEWLCNSVGDKNYKRWKQLSTRMYGDLNNVLTLAVVPACERLILAAERMQGIHKSLKLQR 360
           E+WLCNSVG+KN+KRWK L    Y     +LTL  VPACER+I+  E+++GI ++  +Q 
Sbjct: 296 EDWLCNSVGEKNFKRWKCLGCEAYQKTTQILTLIFVPACERIIIFVEKLRGILEAFSIQN 355

Query: 361 FCKDYAGELTTVELQTLISECQTLLEFTLNLITELNRDAALHQVFAEWFYDVVMETVDED 420
              D + +LT V+  TL+   Q LL  TL  I +L +D  L + F  W  D + E +DED
Sbjct: 356 KFND-SSDLTAVD--TLLKNSQELLTITLKSIVDLGKDETLFETFFIWLNDRIHEVLDED 412

Query: 421 YK 422
           YK
Sbjct: 413 YK 414

>ZYRO0C01474g Chr3 complement(106209..108008) [1800 bp, 599 aa] {ON}
           weakly similar to uniprot|Q04601 Saccharomyces
           cerevisiae YDR118W APC4 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 599

 Score =  179 bits (454), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 129/415 (31%), Positives = 197/415 (47%), Gaps = 31/415 (7%)

Query: 19  VVWNPRLSLYLVLTDKKIAVNRVIDGQQIAAVNLRDEHEIVGIQWEKNESKLFAVFQSNG 78
           V +NP   LY+    +  +V+R+ D  +IA + +RD  ++ G QW+    K  ++F  +G
Sbjct: 6   VDYNPVYPLYVKQFTRGFSVHRMADDARIATIIVRDMSQVAGYQWDPITGKFLSIFYKDG 65

Query: 79  VVRIYDCSIGGSLREMVNLVEEGQAAEVKVDAVVWMTVEWAKFPESYR--GLDFDITTLM 136
            VRIYD    G L  ++     G  + +      W  +E     E+ +   +D D+T +M
Sbjct: 66  TVRIYDGFRSGRLVSLLRASSNGAVSGI------WDRIELLHSEENIKDWSIDHDVTEMM 119

Query: 137 PGMVRLVRDSKQLSLAPLDLGKLSWL------DGKYGDAAIFLAHDCESTEYMVAIDGQL 190
           P MV+  RDS+QL + P  L    W            DA +   HD  S    V  DG+ 
Sbjct: 120 PKMVKFARDSRQLCVVPYTLPSDVWRPQAADDTNALLDAHVIRCHDSLS----VMFDGEF 175

Query: 191 SLRFPSGIRNVHKILPQGGSGSFLAVGKDGTLQWVTL-KFLECALMRELVKSSGQIRFLC 249
           ++           +        +LA  +DG+++   L   ++      L+K+   +R L 
Sbjct: 176 TISIQLAAIPSPLVKFVSAQHQYLAFYQDGSVERFDLANLVKDPFSLRLLKNVITMRQLH 235

Query: 250 RYLAENVSLCHTELIEPYRVFLTRL-MGAYEGDDL-ATRLRDILLTGYIPDDLEEWLCNS 307
           RYL +++ L   +L++PY  FL R   GA+ G DL   +L D++L G +  +LE+WL NS
Sbjct: 236 RYLQDHIELIQRDLLQPYDEFLERCCQGAFGGYDLLREQLIDLMLVGDVTPELEDWLVNS 295

Query: 308 VGDKNYKRWKQLSTRMYGDLNNVLTLAVVPACERLILAAERMQGIHKSLKLQRFCKDYAG 367
           +G+KN KRW++L T  Y     VLTLA +PACERLI   +R  G   S            
Sbjct: 296 MGEKNLKRWRKLGTDAYHKTLQVLTLACLPACERLISLGQRCTGNLLS----------RQ 345

Query: 368 ELTTVELQTLISECQTLLEFTLNLITELNRDAALHQVFAEWFYDVVMETVDEDYK 422
               + L   I   Q  L+  L  I  L+    L   F +WF D V E++DEDYK
Sbjct: 346 LTLQLPLLPPIDCLQFFLKNVLEAIASLSSQQRLLGSFLDWFDDRVRESIDEDYK 400

>Kpol_392.1 s392 complement(1..1272) [1272 bp, 424 aa] {ON}
           complement(1..1272) [1272 nt, 424 aa]
          Length = 424

 Score =  172 bits (436), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 109/421 (25%), Positives = 208/421 (49%), Gaps = 33/421 (7%)

Query: 21  WNPRLSLYLVLTDKKIAVNRVIDGQQIAAVNLRDEHEIVGIQWEKNESKLFAVFQSNGVV 80
           +NP   LY+  +D+ +AV R+ D  Q+A + ++D   + G +W+    +  +VF ++G +
Sbjct: 14  YNPCFQLYVTRSDQGLAVYRIKDSSQLAHIFIKDFDTVAGYEWDNYSGRFISVFLTDGTI 73

Query: 81  RIYDCSIGGSLREMVNLVEEGQAAEVKVDAVVWMTVEWAKFPESYRGLDFDITTLMPGMV 140
           RIYD    G L   +       +++  VD+ +W   E++  P   +  D +I   +P ++
Sbjct: 74  RIYDIFKNGRLVSYIR-----SSSQKNVDSCLWDRAEFS-IPSKLQLFDSNIIECLPTLI 127

Query: 141 RLVRDSKQLSLAPLDLGKLSW--LDGKYGDAA----------IFLAHDCESTEYMVAIDG 188
           + V+DS+ +++        SW  +D +  D            + + H+     + + ++G
Sbjct: 128 KFVKDSRNINIIDYYPPNHSWRHVDKESQDTDKEIDFRNLLDVHIQHNPNEDNFTIILNG 187

Query: 189 QLSLR---FPSGIRNVHKILPQGGSGSFLAVGKDGTLQWVTLK-FLECALMRELVKSSGQ 244
              +     P   ++    L +  +G +++  K+G  + +     L C +   L+ +  +
Sbjct: 188 VYEINGIVMPDISKSEVYQLLKLHNGEYMSFYKNGHYRKINFNNLLSCNVSNGLLSNILE 247

Query: 245 IRFLCRYLAENVSLCHTELIEPYRVFLTRL-MGAYEGD--DLATRLRDILLTGYIPDDLE 301
           IR L RY+ +++ L   ELI PY  F+ ++ + AY G    L   L  +LLTG I ++ +
Sbjct: 248 IRNLNRYVNDHLDLIKRELIIPYSDFVKKICIDAYAGGMTKLNDELESLLLTGEINNEFK 307

Query: 302 EWLCNSVGDKNYKRWKQLSTRMYGDLNNVLTLAVVPACERLILAAERMQGIHKSLKLQRF 361
           +WL N +GD+N K+W++L   M+  +  +LTLA++P+CER ++  ER  G      L  +
Sbjct: 308 DWLVNIIGDRNGKKWRKLGMDMFEKIVKILTLAIIPSCERFMIYLERTDGY-----LNGY 362

Query: 362 CKDYAGELTTVELQTLISECQTLLEFTLNLITELNRDAALHQVFAEWFYDVVMETVDEDY 421
            K        + L+   S+   L+  ++ +I  LN      ++F+EW  D + E  DEDY
Sbjct: 363 MKTDTDFYDIISLREYFSK---LIRNSITIINSLNNQLKYFEIFSEWINDKINEITDEDY 419

Query: 422 K 422
           K
Sbjct: 420 K 420

>TDEL0F03970 Chr6 (735393..737252) [1860 bp, 619 aa] {ON} Anc_8.270
           YDR118W
          Length = 619

 Score =  175 bits (444), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 123/414 (29%), Positives = 209/414 (50%), Gaps = 22/414 (5%)

Query: 21  WNPRLSLYLVLTDKKIAVNRVIDGQQIAAVNLRDEHEIVGIQWEKNESKLFAVFQSNGVV 80
           +NP  SLY    +K +++ RV D  +IA V +RD + +   QW+    K   VF  +G  
Sbjct: 11  YNPLYSLYAKKFNKGLSICRVADNAKIATVAVRDLNVLAQFQWDPITGKRMTVFYKDGNA 70

Query: 81  RIYDCSIGGSLREMVNLVEEGQAAEVKVDAVVWMTVEWAKFPESYRGLDFDITTLMPGMV 140
           RIYD    G L  ++ +      ++ +VD  +W  +E ++   +++  D  +   MP M+
Sbjct: 71  RIYDAFQAGKLLALLRI------SKTRVDGAIWDRIELSRQEVTFK-FDHFVLNSMPKMI 123

Query: 141 RLVRDSKQLSLAPLDLGKLSWL------DGKYGDAAIFLAH--DCESTEYMVAIDGQLSL 192
           R  RD++Q+ + P +    +W       DG   +  I   H    E    ++ +DG   L
Sbjct: 124 RFARDTRQIFILPYEPPNKTWRLATEEEDGVKREKEILDVHLVHQEDNGLVLMLDGDFIL 183

Query: 193 RFPSGIRN-VHKILPQGGSGSFLAVGKDGTLQWVTL-KFLECALMRELVKSSGQIRFLCR 250
           R  +G      K +     G +    +D T++ ++L + ++C    +L++    I+ L  
Sbjct: 184 RLAAGPSGPALKDIVVADRGLYHCFYEDATVESLSLDQLIQCDATIQLIQHFIAIKQLNH 243

Query: 251 YLAENVSLCHTELIEPYRVFLTRLMGAYEG-DDLATRLRDILLTGYIPDDLEEWLCNSVG 309
           YL +++ L   +L+ PY  FLT++  A  G + L   L  +LL G +  +LE W C +VG
Sbjct: 244 YLQDHLDLIKRDLVAPYTEFLTKICDAAFGYEILHEELESLLLGGGLSVELENWFCYTVG 303

Query: 310 DKNYKRWKQLSTRMYGDLNNVLTLAVVPACERLILAAERMQGIHKSLKLQRFCKDYAGEL 369
           +KN+K+WK++   MY     +LTL+ +PACER+IL +ER +   K+L+L     + +   
Sbjct: 304 EKNFKKWKKMGLEMYQKTIQILTLSFIPACERVILLSERCRACLKALQL----IESSTTT 359

Query: 370 TTVELQTLISECQTLLEFTLNLITELNRDAALHQVFAEWFYDVVMETVDEDYKR 423
            + E   L S  QT L  T+  I  ++    L Q F +WF D + E +DEDYK+
Sbjct: 360 DSSEFANLTSLSQTYLRSTVETIQGVSAQEVLFQTFLQWFDDRLHEALDEDYKQ 413

>AGR078C Chr7 complement(877135..879282) [2148 bp, 715 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR118W
           (APC4)
          Length = 715

 Score =  176 bits (446), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 139/522 (26%), Positives = 240/522 (45%), Gaps = 47/522 (9%)

Query: 3   SNWKLKGVVTLPKGHKVVWNPRLSLYLVLTDKKIAVNRVIDGQQIAAV--NLRDEHEIVG 60
           + WK+K         +  WN RLSL+ VL  + +++ R IDG+++ A+   LR   E++ 
Sbjct: 2   TQWKVKLTKQWDGKLEPFWNDRLSLWGVLEKEVLSIFRYIDGRRVGAIPLRLRQNEELLR 61

Query: 61  IQWEKNESKLFAVFQSNGVVRIY------DCSIGGSLREMVNLVEEGQAAEVKVDAVVWM 114
            QWE ++ +LFAV   +G V+IY      + + G    E+V  V  G+    +++  VW 
Sbjct: 62  CQWEPDDGELFAVALRSGSVKIYRGRLDPEGTEGSEGAELVGTVVLGRGDAFQMEQFVWN 121

Query: 115 TVEWAKFPESYRG-LDFDITTLMPGMVRL-VRDSKQLSLAPLDLGKLSWLDGKYGDAA-I 171
            ++W +  E + G  D  +   +P +  + +    +L   PL      W  G   D + +
Sbjct: 122 RIKW-RVREPFCGEFDSPLVQWLPRLTEMSISAQGKLLCTPLGYEGPEWNAGLAADESNM 180

Query: 172 FLAHDCESTEYMVAIDGQLSLRFPSGIR---NVHKILPQGGSGSFLAVGKDGTLQWVTLK 228
           FL  D  + + +++IDG  + R+    +    V  ILP   +       +D  LQ + L+
Sbjct: 181 FLTFDNNTRKVVLSIDGTFNFRYGEKSKFPTKVTSILPGNENHYVFINDEDWQLQVIRLE 240

Query: 229 FLECALMRELVKSSGQIRFLCRYLAENVSLCHTELIEPYRVFLTRLMGAYEGDDLATRLR 288
           F E   + EL+K    I+FL +Y+ +N  L  T+L+EP+  F   L    +       L+
Sbjct: 241 FTEYHQVHELMKCCSHIQFLLKYIRDNHRLIGTKLMEPHATFTGSLFPEEQFTKFMKGLK 300

Query: 289 DILLTGYIPDD-LEEWLCNSVGDKNYKRWKQLSTRMYGDLNNVLTLAVVPACERLILAAE 347
           D+   GY  D  +E W    +G      WKQ +   +     VL   ++PACERLI++A+
Sbjct: 301 DVFYLGYSDDKTVENWFTLKLGRHGTAIWKQRNHLFWSSSQGVLVTCMIPACERLIVSAK 360

Query: 348 RMQGIHKSLKLQRFCKDYAGELTTVELQTLISECQTLLEFTLNLITELNRDAALHQ---V 404
           R+ G+ KSLKL  F  D   ELT VE+Q L+     LL+  +  + + +    + +    
Sbjct: 361 RLLGLVKSLKLNVFGLDDDNELTAVEVQDLLQMSLGLLKGLVEQVEQFHVGENVSKDGLA 420

Query: 405 FAEWFYDVVMETVDED-YKRPSRDGI-----------PLDSYGLDQYLS--------YCW 444
           + E+  D ++   DED +    +DG+           P + Y +  +L+        Y W
Sbjct: 421 WIEYMMDSLLHNEDEDAHNLNGQDGLFSSDLDPHEVYPKEHYSVQLFLNEYIIPKKPYSW 480

Query: 445 QSSETIQRFETSLPELAARPGVSAALLDRKYTREWLLADIHV 486
             S+   + E  + +          L+ + YT +W+   I V
Sbjct: 481 IKSDFPSQLEVLMRQF--------DLVQKNYTAKWIKKLIKV 514

>Skud_4.378 Chr4 (657502..659460) [1959 bp, 652 aa] {ON} YDR118W
           (REAL)
          Length = 652

 Score =  172 bits (435), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 126/446 (28%), Positives = 215/446 (48%), Gaps = 26/446 (5%)

Query: 21  WNPRLSLYLVLTDKKIAVNRVIDGQQIAAVNLRDEHEIVGIQWEKNESKLFAVFQSNGVV 80
           +NPR  ++     K +A++RV D  +IA + +R+   +    W++   K  ++F  +G V
Sbjct: 12  YNPRFPIFATRITKGLAIHRVSDHARIAIIPVRNIALVANYSWDRTSGKFLSIFFKDGTV 71

Query: 81  RIYDCSIGGSLREMVNLVEEGQAAEVKVDAVVWMTVEWAKFPESYRGLDFDITTLMPGMV 140
           RI+D    G L   +      +    K+   +W  +   +  +S     +++  ++P ++
Sbjct: 72  RIHDIFKDGRLVSFL------RVPSTKISRGIWDRIPLKREYDS-ETFAYNVIDILPKLI 124

Query: 141 RLVRDSKQLSLAPLDLGKLSWL-----DGKYGDAA-IFLAHDCESTEYMVAIDGQLSLRF 194
           R V+DSK++S+ P       W      D + G+   + +  +  + +  +  +G  ++  
Sbjct: 125 RFVKDSKRVSIVPYTPPNGLWRGPDEDDPESGEILDVHVIFNEGNDKITIFFNGDYTILL 184

Query: 195 PSGIRNVHKILP---QGGSGSFLAVGKDGTLQWVTLK-FLECALMRELVKSSGQIRFLCR 250
           P       +IL    +   G +     DG+++ + L+  L      +L+     I+ L  
Sbjct: 185 PMDDIENERILESVVKVQDGFYHCFYNDGSVRTLNLQPLLRSKPSVDLLHYIMVIKELIG 244

Query: 251 YLAENVSLCHTELIEPYRVFLTRLMG-AYEGDDLATRLRDILLTGYIPDDLEEWLCNSVG 309
           YL  +V L + ELI PY  F+ R+   AY  + L + L  + L G +  DLE+WLCNSVG
Sbjct: 245 YLLAHVELINRELITPYLDFVKRICDEAYGYNKLKSELECLFLLGEVSCDLEDWLCNSVG 304

Query: 310 DKNYKRWKQLSTRMYGDLNNVLTLAVVPACERLILAAERMQGIHKSLKLQRFCKDYAGEL 369
           +KN K+WK L    Y     +LTL  VP CER+I+  E+++G  ++  +Q    +   +L
Sbjct: 305 EKNLKKWKFLGCEAYQKTTQILTLVFVPTCERIIIFVEKLRGTLEAFSVQNKSNN-TSDL 363

Query: 370 TTVELQTLISECQTLLEFTLNLITELNRDAALHQVFAEWFYDVVMETVDEDYK-RPSRDG 428
           T VEL  L+   Q LL  TL  I  L R+  L + F  WF D + E +DEDYK +   + 
Sbjct: 364 TAVEL--LLKNSQELLNNTLKSIIALGRNETLFEKFFIWFNDRIHEGLDEDYKLKFEFED 421

Query: 429 IPLDSYGL----DQYLSYCWQSSETI 450
            P   Y L    D+ LSY    S ++
Sbjct: 422 DPYFGYDLLTYFDKILSYRSTESSSV 447

>YDR118W Chr4 (685882..687840) [1959 bp, 652 aa] {ON}  APC4Subunit
           of the Anaphase-Promoting Complex/Cyclosome (APC/C),
           which is a ubiquitin-protein ligase required for
           degradation of anaphase inhibitors, including mitotic
           cyclins, during the metaphase/anaphase transition;
           component of the platform domain of the APC/C, based on
           structural analysis
          Length = 652

 Score =  171 bits (433), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 126/431 (29%), Positives = 195/431 (45%), Gaps = 57/431 (13%)

Query: 21  WNPRLSLYLVLTDKKIAVNRVIDGQQIAAVNLRDEHEIVGIQWEKNESKLFAVFQSNGVV 80
           +NP   ++     K +A+ RV D  ++A + +R+ + +    W+    K  ++F  +G +
Sbjct: 12  YNPLFPIFATRIAKGLAIYRVSDHARLAVIPIRNINLVANYDWDTTTGKFLSIFFKDGTI 71

Query: 81  RIYDCSIGGSLREMVNLVEEGQAAEVKVDAVVWMTVEWAKFPESYRGLDFDITTLMPGMV 140
           RI+D    G L   + +         K+   +W  +     P + R    +I   +P ++
Sbjct: 72  RIHDIFKDGRLVSFLRI------PSTKISKGIWDRIPLRYEPNN-RDFACNIIDDLPKLI 124

Query: 141 RLVRDSKQLSLAPL-------------DLGKLSWLDGKY--------------GDAAIFL 173
           R V+DSK++++ P              DL     LD                 GD A+FL
Sbjct: 125 RFVKDSKRINIVPYTQPNSLWRGPDEDDLDSNEKLDVHVVFNEGNDKITVFFNGDYAVFL 184

Query: 174 AHDCESTEYMVAIDGQLSLRFPSGIRNVHKILPQGGSGSFLAVGKDGTLQWVTLK-FLEC 232
           + D    E                  N  K + +   G +    +DGT+Q + L   L+ 
Sbjct: 185 SVDNIENE------------------NSLKSIIKVQDGFYQCFYEDGTVQTLNLGPLLQS 226

Query: 233 ALMRELVKSSGQIRFLCRYLAENVSLCHTELIEPYRVFLTRLMG-AYEGDDLATRLRDIL 291
                L+     I+ L  Y+  ++   + EL  PY  F+ RL   AY    L + L  + 
Sbjct: 227 KSSVNLLNYIMVIKELIGYMLTHLEFINRELATPYLDFVKRLCDEAYGYGKLKSELEALF 286

Query: 292 LTGYIPDDLEEWLCNSVGDKNYKRWKQLSTRMYGDLNNVLTLAVVPACERLILAAERMQG 351
           L G I  DLE+WLCNSVG+KN+KRWK L    Y     +LTL  VPACER+I+  E+++ 
Sbjct: 287 LLGEISCDLEDWLCNSVGEKNFKRWKYLGCEAYQKTVQILTLIFVPACERIIIYVEKLRA 346

Query: 352 IHKSLKLQRFCKDYAGELTTVELQTLISECQTLLEFTLNLITELNRDAALHQVFAEWFYD 411
           I ++  +Q     Y  +LT VE+  L+   Q LL  TLN I  L RD  L + F  WF D
Sbjct: 347 ILQAFSIQNKLS-YTSDLTAVEV--LLKSSQKLLTMTLNSIIGLGRDETLFEKFFIWFND 403

Query: 412 VVMETVDEDYK 422
            + E +DEDYK
Sbjct: 404 RLHEALDEDYK 414

>Ecym_4300 Chr4 complement(642023..644170) [2148 bp, 715 aa] {ON}
           similar to Ashbya gossypii AGR078C
          Length = 715

 Score =  169 bits (427), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 135/508 (26%), Positives = 232/508 (45%), Gaps = 53/508 (10%)

Query: 21  WNPRLSLYLVLTDKKIAVNRVIDGQQIAAVNLR--DEHEIVGIQWEKNESKLFAVFQSNG 78
           WN RLSL+ +     + + R IDG+++ ++ LR     EI+  Q E N+  LFAV   +G
Sbjct: 20  WNDRLSLWGIHEKGNVNIFRYIDGRKMGSIPLRLKSNEEILTCQLEPNDGDLFAVVLRSG 79

Query: 79  VVRIY------DCSIGGSLREMVNLVEEGQAAEVKVDAVVWMTVEWAKFPESYRGLDFD- 131
            V++Y      D S      +MV  +  G+     ++  VW  ++W K   +++G DFD 
Sbjct: 80  SVKVYKGRQDVDSSDPTDGADMVGTIVLGRGEWFNMEQFVWNRIKW-KSRGAFKG-DFDT 137

Query: 132 -ITTLMPGMVRL-VRDSKQLSLAPLDLGKLSWLDG-KYGDAAIFLAHDCESTEYMVAIDG 188
            +T  +P +  + V    +L+  PL+     W       ++ +FL +D  + + MV+IDG
Sbjct: 138 VLTQWLPKLTEMNVSPQGKLTCTPLEFEGPEWNASLSENESNMFLTYDNATRKVMVSIDG 197

Query: 189 QLSLR------FPSGIRNVHKILPQGGSGSFLAVGKDGTLQWVTLKFLECALMRELVKSS 242
             + R      FP+ + N   IL    +       +D  LQ + L+F E   M EL+K  
Sbjct: 198 TFNFRYGEKNKFPTKVTN---ILSGNANNYVFLNDEDWQLQIIKLEFTESHQMHELMKCC 254

Query: 243 GQIRFLCRYLAENVSLCHTELIEPYRVFLTRLMGAYEGDDLATRLRDILLTGYIPD-DLE 301
            QI+FL +YL +N  +   +L+EP+  F+  L    +   L   L+D+   GY  + ++E
Sbjct: 255 SQIQFLMKYLRDNHKIIGVKLMEPHATFINSLFPDEQASRLLKGLKDVFYLGYSAEKNIE 314

Query: 302 EWLCNSVGDKNYKRWKQLSTRMYGDLNNVLTLAVVPACERLILAAERMQGIHKSLKLQRF 361
            W    +G      WKQ +   +     +L   ++PACERLI+A +R+QG+ KSLKL  F
Sbjct: 315 NWFTLKLGRHGISIWKQRNHLFWSSSQGILVTCMIPACERLIVAVKRLQGLIKSLKLNIF 374

Query: 362 CKDYAGELTTVELQTLISECQTLLEFTLNLITELNRDAALHQV----------FAEWFYD 411
             D   EL       +  E   LL+  L+ +TE+ +      +          + E+  D
Sbjct: 375 GLDDDEEL-------IAPEVDELLQMGLDTLTEIVKQVEKFHIGENMSIDGLTWIEYMID 427

Query: 412 VVMETVDEDYKRP-------SRDGIPLDSYGLDQYLSYCWQS-----SETIQRFETSLPE 459
            ++   ++D           S D   LD+Y  + Y +  + +     ++T +  +   P 
Sbjct: 428 SLLRGEEDDGNNSNGQDCALSNDVDALDTYPKEHYSTQLFLNNFVLPTQTYKWIKNDFPN 487

Query: 460 LAARPGVSAALLDRKYTREWLLADIHVT 487
                     L+ + YT +W+   I V+
Sbjct: 488 KLESLIRQFDLVQKNYTAKWIKKMIKVS 515

>KAFR0B05460 Chr2 complement(1118755..1120587) [1833 bp, 610 aa]
           {ON} Anc_8.270 YDR118W
          Length = 610

 Score =  145 bits (366), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 107/415 (25%), Positives = 192/415 (46%), Gaps = 22/415 (5%)

Query: 20  VWNPRLSLYLVLTDKKIAVNRVIDGQQIAAVNLRDEHEIVGIQWEKNESKLFAVFQSNGV 79
           V+N +L LY     K + V R  D   IA   ++    + GI W+K   K  ++F  +G 
Sbjct: 13  VYNKKLPLYTEKGPKGLMVYRRSDNTAIAHTIIKKWELVAGIYWDKISGKYLSIFFRDGS 72

Query: 80  VRIYDCSIGGSLREMVNLVEEGQAAEVKVDAVVWMTVEWAKFPESYRGLDFDITTLMPGM 139
           +RI D    G L   +      +     VD   W  +E  +     +  + +I  LMP +
Sbjct: 73  IRIIDVFKDGKLVAFL------RTQFKNVDCTYWDRIE-EQTTNEMKQFNKNIVDLMPSL 125

Query: 140 VRLVRDSKQLSLAPLDLGKLSW--LDGKYGDAAIF---LAHDCESTEYMVAIDGQLSLRF 194
           ++ V  + +LSL P      +W  LD K+    +      H  E+  +++ ++G   L  
Sbjct: 126 IQFVSSANKLSLIPYTPSNANWRELDAKWKKNRVIDMHCLHQSETDSFLMVLNGDYYLTL 185

Query: 195 PSGIRNVHKILP-----QGGSGSFLAVGKDGTLQWV-TLKFLECALMRELVKSSGQIRFL 248
            +   ++ + +P     +  +  +  + KDG+ + + T  FL      +L++    ++ +
Sbjct: 186 KTPETDLSEKVPACSLIKSANSLYQCIYKDGSARKIDTSSFLSSKSCIDLLECILSLKDM 245

Query: 249 CRYLAENVSLCHTELIEPYRVFLTRLM-GAYEGDDLATRLRDILLTGYIPDDLEEWLCNS 307
            +Y   ++ L    +I+PY  FL ++  GA+  + L   L+   L G I D+L++WL  S
Sbjct: 246 SKYTRNHLDLLERVIIKPYLDFLEKICDGAFGREKLINELKITFLLGTISDELQDWLHYS 305

Query: 308 VGDKNYKRWKQLSTRMYGDLNNVLTLAVVPACERLILAAERMQGIHKSLKLQRFCKDYAG 367
           VGDKN  +W+ L    Y     + T+A++ ACER+IL +ER  G+  + + +    D + 
Sbjct: 306 VGDKNVTQWRTLCHDAYQQTTELFTIALMCACERMILLSERCFGLIMAFQFESGADDNS- 364

Query: 368 ELTTVELQTLISECQTLLEFTLNLITELNRDAALHQVFAEWFYDVVMETVDEDYK 422
                EL  L+S  Q +L+  +    E      + ++F  W  D V E +D+DYK
Sbjct: 365 --RLHELNELMSNLQDMLKSIIYTAEESANKFEMLKIFLSWLNDRVHEELDDDYK 417

>TBLA0C04570 Chr3 (1107010..1108836) [1827 bp, 608 aa] {ON}
           Anc_8.270 YDR118W
          Length = 608

 Score =  144 bits (362), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 108/410 (26%), Positives = 189/410 (46%), Gaps = 22/410 (5%)

Query: 22  NPRLSLYLVLTDKKIAVNRVIDGQQIAAVNLRDEHEIVGIQWEKNESKLFAVFQSNGVVR 81
           NP L L L  +D  + V R  D   I    +R++++I+  QWE N     A+F   G V 
Sbjct: 13  NPTLPLTLCKSDSGLKVIRTADKSIIINYKIRNKNDIIYYQWENNIGNYVAIFFQRGTVM 72

Query: 82  IYDCSIGGSLREMVNLVEEGQAAEVKVDAVVWMTVEWAKFPESYRG--LDFDITTLMPGM 139
           IYD      L  M+N        +  VDA +W   +   FP        D DIT  MP +
Sbjct: 73  IYDGIKTSRLLAMLN------GGKPNVDAGIW---DRYYFPNDNEKDIFDSDITLYMPTL 123

Query: 140 VRLVRDSKQLSLAPLDLGKLSW-------LDGKYGDAAIFLAHDCESTEYMVAIDGQLSL 192
           ++++RD +++          +W       L  ++ D  I L H      +   ++G+L L
Sbjct: 124 IQIIRDKEKICPGTYFPPHSTWRAKKEESLKNEFLD--IHLLHHSVDDSFTFILNGELKL 181

Query: 193 RFPSGIRNVHKI-LPQGGSGSFLAVGKDGTLQWVTL-KFLECALMRELVKSSGQIRFLCR 250
            FPS   +   I + +G +  F+   +D T++ +     L+      LV    +I  L +
Sbjct: 182 PFPSNSTSGRAIGIIKGENNCFICFYQDLTVRMIDCHDLLQLKGNEILVDHFIRINHLLK 241

Query: 251 YLAENVSLCHTELIEPYRVFLTRLMGAYEGDDLATRLRDILLTGYIPDDLEEWLCNSVGD 310
           YL E++      +  P+  FLT + G    + +   L  +L++GYI  +LEEW+ N++G 
Sbjct: 242 YLKEHIMFIKDNMSTPFNEFLTSVKGEATQEMMMENLITMLVSGYISTELEEWIRNTIGI 301

Query: 311 KNYKRWKQLSTRMYGDLNNVLTLAVVPACERLILAAERMQGIHKSLKLQRFCKDYAGELT 370
           KN  RW  L    Y    +++TL V+PACER ++   R+QG+ + + ++  C +    L 
Sbjct: 302 KNLTRWATLGGIFYEKGVDIITLMVIPACERFMILVARLQGLIEYVIVRNRCDNRGVNLN 361

Query: 371 TVELQTLISECQTLLEFTLNLITELNRDAALHQVFAEWFYDVVMETVDED 420
           +  ++ +    +  ++  L ++ +L     L + F  WF + V   V ++
Sbjct: 362 SSYIENVKHAAKRFMKEALRMLEQLQLQKQLFEKFLHWFSENVRGVVQDE 411

>NCAS0B03790 Chr2 complement(676973..678811) [1839 bp, 612 aa] {ON}
           Anc_8.270 YDR118W
          Length = 612

 Score =  140 bits (352), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 113/418 (27%), Positives = 194/418 (46%), Gaps = 27/418 (6%)

Query: 19  VVWNPRLSLYLVLTDKKIAVNRVIDGQQIAAVNLRDEHEIVGIQWEKNESKLFAVFQSNG 78
           V +NP     L  T    AV R  D  QI  + +R+   ++   W    S    V  ++G
Sbjct: 9   VSYNPSYPAKLYKTSYGFAVRRTRDDTQIVKIVIRNMDAVIATCWNSFGSNYLTVMFNDG 68

Query: 79  VVRIYDCSIGGSLREMVNLVEEGQAAEVKVDAVVWMTVEWAKFPESYRGLDFDITTLMPG 138
             RI+D    G L  ++ L +  Q     +D  +W  +E  + P      D DI+ LMP 
Sbjct: 69  SARIHDIFREGKLMTLLRLQDGFQKC---MDTGIWSKLEVRQKPNEGE-FDRDISGLMPS 124

Query: 139 MVRLVRDSKQLSLAPLDLGKLSWLDG----KYGDAA-IFLAHDCESTEYMVAIDG--QLS 191
            ++ V ++ QL + P  + +  W +     +  D   I +AH+  + EY++ I+G  +L+
Sbjct: 125 PIKFVNNAGQLEVVPYVVTQTQWRNVDKPLEVNDIIDIHMAHNSNTDEYLLMINGVYKLT 184

Query: 192 LRFPSGIRN----VHKILPQGGSGSFLAVGKD---GTLQWVTLKFLECALMRELVKSSGQ 244
           ++  S   N    +HKI+    +  F    KD    T+   TL  +E      L+    +
Sbjct: 185 IQPNSTDENASNQLHKIIHLEKTAIFHCFYKDRKTSTIDLTTL--MESTPHVSLLNVLTE 242

Query: 245 IRFLCRYLAENVSLCHTELIEPYRVFLTRLMGAYEGDDLATRLRDILLTGYIPDDLEEWL 304
           ++ L RY+ +++ +   +L +P   FL  +       DL+  L+  +L G +   L  WL
Sbjct: 243 MKQLHRYIVDHLDIIDNDLKKPLDDFL-EVTNILNIKDLSKSLKSFILYGLMAKSLNHWL 301

Query: 305 CNSVGDKNYKRWKQLSTRMYGDLNNVLTLAVVPACERLILAAERMQGIHKSLKLQRFCKD 364
           CN VG+KN K+WK+LS   Y  +  +++LAV+PA E+L L + R + +  ++ L      
Sbjct: 302 CNVVGEKNLKKWKRLSETKYQKIIQIISLAVLPALEKLSLLSIRCEALVVAIALPA---- 357

Query: 365 YAGELTTVE-LQTLISECQTLLEFTLNLITELNRDAALHQVFAEWFYDVVMETVDEDY 421
            +G +  +E   +L      L    LN+  + + +     VF  W  D++ E VDEDY
Sbjct: 358 -SGHMQELEYFDSLKRTTAALCNQALNITQKTSEEEKKCSVFILWIQDLIFECVDEDY 414

>TPHA0J00790 Chr10 (182991..185048) [2058 bp, 685 aa] {ON} Anc_8.270
           YDR118W
          Length = 685

 Score =  136 bits (342), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 104/429 (24%), Positives = 196/429 (45%), Gaps = 43/429 (10%)

Query: 22  NPRLSLYLVLTDKKIAVNRVIDGQQIAAVNLRDEHEIVGIQWEKNESKLFAVFQSNGVVR 81
           NP   LY   +DK +A+  + D   +A + ++D   +V   W+    K      ++G +R
Sbjct: 15  NPIYQLYTFKSDKGLAICTISDHSILATIFIKDFSLVVDFFWDSITGKFLLFAFNDGSIR 74

Query: 82  IYDCSIGGSLREMVNLVEEGQAAEVKVDAVVWMTVEWAK-FPESYRGLDFDITTLMPGMV 140
           +YD    G L      V   ++   ++  V W  +   +   +  +  D+D+T  MP +V
Sbjct: 75  VYDIFKLGRL------VSFFRSPLKQIKCVYWDRIIITETLDQQLKIFDYDLTNSMPTLV 128

Query: 141 RLVRDSKQLSLAPLDLGKLSWLDGKYGDAAIFLAHDCESTEYMVAIDGQLSLRF---PSG 197
           + V+D + L L P+     +W   +  D  + L  +   TE  V+ D  L +      SG
Sbjct: 129 KFVKDPQGLQLVPVLKNTQAW---RQIDVDLNLKLENSKTE--VSTDDVLDIHLLYTESG 183

Query: 198 IRNV--------------------HKI--LPQGGSGSFLAVGKDGTLQWVTLK-FLECAL 234
           + N                     +K+  L +   G +L   ++ + + + +  F    +
Sbjct: 184 MDNFAVLVNGVYDLSDIHVPNRSPNKVIKLVKASQGKYLGFYENASYRLIDVTPFSSNDI 243

Query: 235 MRELVKSSGQIRFLCRYLAENVSLCHTELIEPYRVFLTRL-MGAYEG-DDLATRLRDILL 292
              L+ +S  +R     L E + +   ELI P+  F+  + + AYEG D+L   + ++LL
Sbjct: 244 RVNLLNNSIDLRNSVSLLKEQIEIIKKELISPFESFINLVCVDAYEGYDNLYRSMTNLLL 303

Query: 293 TGYIPDDLEEWLCNSVGDKNYKRWKQLSTRMYGDLNNVLTLAVVPACERLILAAERMQGI 352
           TG I ++ E+WL N++G++N ++WK L   +   L  +L+L  +P  E+ I+ AER+Q  
Sbjct: 304 TGEISEEFEDWLINTIGERNLRKWKNLGIELLDKLVQILSLIFIPITEKFIITAERIQNY 363

Query: 353 HKSLKLQRFCKDYAGELTTVELQTLISECQTLLEFTLNLITELNRDAALHQVFAEWFYDV 412
             +++L    K    +    E+  LI     +L+ ++  I  LN D    ++F +W  + 
Sbjct: 364 ITAMRLSDNSKILEND---SEINDLILNLSNILKTSIKQIPILNNDKMAFEIFIDWIRNT 420

Query: 413 VMETVDEDY 421
           +   +DE+Y
Sbjct: 421 IYLIIDENY 429

>KNAG0H03190 Chr8 complement(597550..599418) [1869 bp, 622 aa] {ON}
           Anc_8.270 YDR118W
          Length = 622

 Score =  125 bits (313), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 106/415 (25%), Positives = 189/415 (45%), Gaps = 26/415 (6%)

Query: 22  NPRLSLYLVLTDKKIAVNRVIDGQQIAAVNLRDEHEIVGIQWEKNESKLFAVFQSNGVVR 81
           N  L LY+    K++ VNR  D   IA+  +RD  ++V  QW+    ++ +V   +G +R
Sbjct: 16  NNVLPLYVTRGTKQLVVNRDTDDSTIASTFIRDPSQVVSYQWDTIGGEIISVMFQDGSIR 75

Query: 82  IYDCSIGGSLREMVNLVEEGQAAEVKVDAVVWMTVEWAKFPESYRGLDFD---ITTLMPG 138
           I D      L  ++     G      +D V+W  +   + P   + +++D   IT  +P 
Sbjct: 76  INDVMYDAKLVALLRTQRTG------LDCVLWDRI---RLPSRAQSMEWDPDIITQSLPR 126

Query: 139 MVRLVRDSKQLSLAPLDLGKLSWLDGKYGDAA----IFLAHDCESTEYMVAIDG--QLSL 192
           +V+ +      S++P      SW     G A     +   H       +  ++G  QL L
Sbjct: 127 LVKFMGSDASPSMSPYLPTNHSWRFPNSGAAGGILDVHFLHQKLGDTLVALLNGEYQLQL 186

Query: 193 RFP--SGIRNVHKILPQGGSGS--FLAVGKDGTLQWVTLK-FLECALMRELVKSSGQIRF 247
             P       + KI+ +  S    +    K G ++ V L  F+E     +L++     + 
Sbjct: 187 TGPHQEDQSELRKIIARTDSKRHVYNCYYKTGPVRQVDLTGFVEDKDTIKLLERFLLFQD 246

Query: 248 LCRYLAENVSLCHTELIEPYRVFLTRLM-GAYEGDDLATRLRDILLTGYIPDDLEEWLCN 306
              Y   ++    TE +EPY+ F+ RL   A+  + L   L D  L G + ++L +WL  
Sbjct: 247 YLGYFLAHLEPIQTECVEPYQEFIERLCEDAFGKEKLQESLTDHFLVGSMDEELRDWLVY 306

Query: 307 SVGDKNYKRWKQLSTRMYGDLNNVLTLAVVPACERLILAAERMQGIHKSLKLQRFCKDYA 366
           S+G++N + WK L    Y   + V+ + +VP  ERLI+  E++Q +  + +L       +
Sbjct: 307 SLGERNLEEWKSLMNTAYRRTSQVVLMCLVPVSERLIILCEQLQALVLTAQLSEGMVGDS 366

Query: 367 GELTTVELQTLISECQTLLEFTLNLITELNRDAALHQVFAEWFYDVVMETVDEDY 421
            E++  E   L+  CQ LL+  L  + +L +D    +VF  W  +V+  T+++DY
Sbjct: 367 LEIS--EFTDLLENCQELLQLVLQTVKQLAKDIKDIKVFLLWLENVLKTTINKDY 419

>CAGL0B01859g Chr2 (168976..170844) [1869 bp, 622 aa] {ON} weakly
           similar to uniprot|Q04601 Saccharomyces cerevisiae
           YDR118w APC4 subunit of the anaphase promoting complex
          Length = 622

 Score =  120 bits (300), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 106/417 (25%), Positives = 187/417 (44%), Gaps = 28/417 (6%)

Query: 21  WNPRLSLYLVLTDK-KIAVNRVIDGQQIAAVNLRDEHEIVGIQWEKNESKLFAVFQSNGV 79
           +NP+  L+ +  D   + + R  D   I  +N+R+   ++   W+  + K  A+F  +G 
Sbjct: 13  YNPKYGLFGMNEDNHSLVIRRTSDNVGIVKINVRNIVLLLDYFWDPIDGKYLALFLKDGS 72

Query: 80  VRIYDCSIGGSLREMVNLVEEGQAAEV-KVDAVVWMTVEWAKFPES-YRGLDFDITTLMP 137
           VRIYD   GG L   + ++     +    +D  +W  +   K   S  R  + D+T  MP
Sbjct: 73  VRIYDIFNGGKLISFLRVLPVVLGSNKPSLDCCLWDRIIIPKSGSSELRIPNNDLTESMP 132

Query: 138 GMVRLVRDSKQLSLAP-LDLGKL--SWLDGKYGDAAIFLAHDCESTEYMVAIDGQ-LSLR 193
            +V+ V+D+KQ+ + P   + KL  S  + +     + L + C S +  + I+G+ L  +
Sbjct: 133 TLVKFVQDAKQIDIIPNRSITKLWRSIGNNEKKVVDVHLGYSCSSAQVTILINGEYLIEK 192

Query: 194 FPSGIRNVHKILPQG-GSGSF------LAVGKDGTLQWVTLKFLECALMRELVKSSGQIR 246
             S I  + K +P       F      +       LQ      L      +L+++  ++ 
Sbjct: 193 SVSDINQIQKKIPISLNKKEFCEAIYEIHFDDYSRLQIDLTGILLNDDKLDLIETQIKMT 252

Query: 247 FLCRYLAENVSLCHTELIEPYRVFLTRLMGAYEGDDLATRLRDILLTGYIPDDLEEWLCN 306
                + ++ +L    ++ PY  FL  + G  + D     L  + L G +   L  W   
Sbjct: 253 NHFDLIKDHFNLIEKSVLAPYYEFLESIGGINDLD----VLERLFLIGELDTKLGNWFKE 308

Query: 307 SVGDKNYKRWKQLSTRMYGDLNNVLTLAVVPACERLILAAERMQGIHKSLKLQRFCKDYA 366
           ++ +KN K+W +L    Y +   VL +  VP CERL++   R+ G+ K + LQ      +
Sbjct: 309 TINEKNLKKWSRLGNEFYSNFKQVLIIVFVPICERLMVLTNRINGMIKGIDLQE-----S 363

Query: 367 GELTTVELQTLISECQTLLEFTLNLITELNRDAA-LHQVFAEWFYDVVMETVDEDYK 422
            E + ++    ISE Q+ L   L L+ ELN D     Q F  W  D V E+++ +YK
Sbjct: 364 QETSLLD----ISELQSFLNLVLKLLAELNEDETYFKQDFLPWLTDKVYESINNEYK 416

>NDAI0J01270 Chr10 (297256..299463) [2208 bp, 735 aa] {ON} Anc_8.270
           YDR118W
          Length = 735

 Score =  115 bits (289), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 108/467 (23%), Positives = 209/467 (44%), Gaps = 72/467 (15%)

Query: 22  NPRLSLYLVLTDKKIAVNRVIDGQQIAAVNLRDEHEIVGIQWEKNESKLFAVFQSNGVVR 81
           NP   LYL  T   I   R +DG QI+ + +R+   ++ I W+    K   +   +G  R
Sbjct: 28  NPSFPLYLTKTSNSIIARRTLDGFQISNIIIRNMQNVIAIDWDSKTGKYLTINFDDGTFR 87

Query: 82  IYDCSIGGSLREMV----NLVEEGQAAEVKVDAVVWMTVEWAKFPESYRGLDF--DITTL 135
           IYD    G L  +V    NL++  +  + KVD  +W   +      S + L+F  DIT L
Sbjct: 88  IYDIFQDGKLITLVRPQRNLLDIHR--KTKVDNAIW---DRLIILNSIQELEFNHDITKL 142

Query: 136 MPGMVRLVRDSKQLSLAP----------------------------LDLGKLSWLDGKYG 167
           MP +++ V+DS  + + P                            +D+     ++    
Sbjct: 143 MPTLIKFVKDSTNIYIVPYSHNEKQNIWREFQPVSSYKPISTNMDAIDMTTNQEVEKSMR 202

Query: 168 DAAIFLAHDCESTEYMVAIDGQLSLRFPSGIRN------VHKILPQGGSGSFLAVGKDGT 221
              + + H  +   + +AI+G   +       N      + +IL     G +    ++G+
Sbjct: 203 YLDLHIIHVIDPDCFTIAINGTYQINLVRKTINTTNRNKIVRILKSTVHGVYHCFHENGS 262

Query: 222 LQWVTLK-FLECALMRELVKSSGQIRFLCRYLAENVSLCHTELIEPYRVFLTRLMGAYE- 279
           ++ +    F    L  EL++   +I  + +Y   ++ L +  L++ +  FL   +   + 
Sbjct: 263 IRSLYFSHFTSSTLHVELLEIFMEINEMIKYFQYHLDLINKHLLKTFTDFLYPTIFEEKQ 322

Query: 280 ---GDDLATRLRDILLTGYIPDDLEEWLCNSVGDKNYKRWKQLSTRMYGDLNNVLTLAVV 336
              G+ +  +L+  LL+G + ++L EWL  S+G+KN K+WK+LS  +Y     + +LA++
Sbjct: 323 NGGGNSMLQQLKLSLLSGEMSEELIEWLTLSIGEKNLKKWKRLSEELYSKSIQIFSLALI 382

Query: 337 PACERLILAAERMQGIHKSLKLQRFCKDYA-GELTTVELQTLIS----ECQTLLEFT--- 388
           PACE  +L +++   I  ++++++  +  A  +L+T    T I     + + L EF+   
Sbjct: 383 PACELTLLLSQKCLAILNAIEIEKKARIRAKSKLSTNSTHTNIELNSRQDKILTEFSPSF 442

Query: 389 LNLITELNRDAA-----LHQV---------FAEWFYDVVMETVDEDY 421
           L LI  L +  +     L ++         F +W  +++   +DED+
Sbjct: 443 LELIEILQKFGSRCLQNLRKISYIEKQSSLFLKWLQEMIFHALDEDH 489

>KLLA0F19316g Chr6 (1786659..1788674) [2016 bp, 671 aa] {ON}
           conserved hypothetical protein
          Length = 671

 Score = 68.9 bits (167), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 76/351 (21%), Positives = 158/351 (45%), Gaps = 42/351 (11%)

Query: 20  VWNPRLSLYLVLTDKKIAVNRVIDGQQIAAVNLRDEHEIVGIQWEKNESKLFAVFQSNGV 79
           +WN   ++ +  T+    +NR+ D  Q         H ++ + W  N+  LF  + S G 
Sbjct: 31  LWNVHNNIEIYRTNGGYLINRLNDEIQ--------NHRLIDVVWHGND--LFCCYNS-GT 79

Query: 80  VRIYDCSIGGSLREMVNLVEEGQAAE-VKVDAVVWMTVEWAKFPESYRGLDFDITTLMPG 138
           V IY    G  L + +  + +G   + +  D +V          + Y   D ++   MP 
Sbjct: 80  VSIY--REGRELVKQLTFIPKGAKTKCILCDNLV-------PSDDRYSLSDGNLLNSMPK 130

Query: 139 MVRLVRDSKQLSLAPLDLGKLSWLDGKYGDAAIFLAHDCESTEYMVAIDGQLS------L 192
           + +      +L    +   +L    GK     IF+A D ++ + +++I+G L+      L
Sbjct: 131 LNKWDMIKNELDNELILNSEL----GKKKPIDIFMAIDSKTNKLILSIEGTLNIKVGEKL 186

Query: 193 RFPSGIRNVHKILPQGGSGSFLAVGKDGTLQWVTLKFLECALMRELVKSSGQIRFLCRYL 252
           + P  I+ + K+     SG ++ +GKD + Q + L FL+   + +L+K++ +   L RYL
Sbjct: 187 KLPKDIKRIIKV----SSGKYMCLGKDWSYQVLDLTFLQDPNIYKLIKTTQEYSALLRYL 242

Query: 253 AENVSLCHTELIEPYRVFLTRLMGAYEGDDLATRLRDILLTGYIPDDLEEWLCNSVGDKN 312
            +       +L EPY  F+  L+     ++    L+++   G    ++ E L + V  + 
Sbjct: 243 KQLHRHLRMKLTEPYFEFVETLL----KEEHKNALQELFYIGVTKLEVMEEL-HEVQLQT 297

Query: 313 YK--RWKQLSTRMYGDLNNVLTLAVVPACERLILAAERMQGIHKSLKLQRF 361
           ++  +W  LS  +  +   ++    +P  ER+I+ A  ++ + +++   +F
Sbjct: 298 FRLDKWSALSNDLCSNSIGLMVACTIPLLERMIVLAASIEALCEAITWIKF 348

>Ecym_7402 Chr7 complement(827224..829044) [1821 bp, 606 aa] {ON}
           similar to Ashbya gossypii ABL043W
          Length = 606

 Score = 36.6 bits (83), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 35/61 (57%), Gaps = 8/61 (13%)

Query: 30  VLTDKKIAVNRVIDGQQIAAVNLRDEHEIVG----IQW--EKNESKLFAVFQSNGVVRIY 83
           V +D+KI V   +DGQ I  V   DE+E+ G    + W  E +ES  F    ++GVVR++
Sbjct: 220 VGSDRKIVVYDGVDGQFIKYV--EDENEVCGGFFALAWVDEGSESNKFVTASADGVVRLW 277

Query: 84  D 84
           D
Sbjct: 278 D 278

>Suva_7.44 Chr7 (79883..82300) [2418 bp, 805 aa] {ON} YGL216W (REAL)
          Length = 805

 Score = 34.7 bits (78), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 49/189 (25%), Positives = 81/189 (42%), Gaps = 23/189 (12%)

Query: 321 TRMYGDLNNVLTLAVVPACERLILAAERMQGIHKSLKLQRFCKDYA-GELTTVELQTLIS 379
            R+    + V T  V    + LIL   R   + K L++    + +  G++   E+Q +IS
Sbjct: 501 NRVQQSYSTVETYQVAKILKSLILCKRRFLQMVK-LEVDNLVQLFQQGDIMVAEMQPVIS 559

Query: 380 ECQTLLEFTLNLITEL----NRDAALHQVFAEWFYDVVMETVDEDYKRPSRDGIPLDSYG 435
            CQ + E   N I EL    +   AL  V  +      + ++D +  R   D    ++Y 
Sbjct: 560 NCQMISEQLFNKIHELEVKFDETNALDSVIQQ------VHSIDLNKLREMEDWD--ETYD 611

Query: 436 LDQYLSYCWQSSETIQRFETSL-PELAARPGVSAALLDR--KYTREWLL---ADIH--VT 487
           L  YL  C      +QR E  +   +     +S A L+R  K+  +WL+    DI   + 
Sbjct: 612 L-VYLESCLSQISELQRNEILINSSIMTEKLISDAGLNRRFKFLSKWLMDRTPDIEFIIQ 670

Query: 488 ETVHVDNDI 496
           + VH+D D 
Sbjct: 671 DLVHIDEDF 679

>KAFR0H01220 Chr8 complement(224097..225503) [1407 bp, 468 aa] {ON}
           Anc_3.310 YBR083W
          Length = 468

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 28/54 (51%), Gaps = 2/54 (3%)

Query: 533 IASVEPPRDGFSCSPASQPVLPTITHARLEQPHHVTGTLIFLHEGPCACDEHLP 586
           I S +P     S +P  Q  LP   H    QP ++ G+L+++H+ P   D+H P
Sbjct: 342 IMSPKPVFPQSSITPIQQ--LPPAYHNTQPQPPNLNGSLLYMHKNPQMQDQHQP 393

>KLLA0A01430g Chr1 complement(128139..129287) [1149 bp, 382 aa] {ON}
           weakly similar to uniprot|P53079 Saccharomyces
           cerevisiae YGL223C COG1 Essential component of the
           conserved oligomeric Golgi complex (Cog1p through Cog8p)
           a cytosolic tethering complex that functions in protein
           trafficking to mediate fusion of transport vesicles to
           Golgi compartments
          Length = 382

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 46/102 (45%), Gaps = 2/102 (1%)

Query: 72  AVFQSNGVVRIYDCSIGGSLREMVNLVEE-GQAAEVKVDAVVWMTVEWAKFPESYRGLDF 130
           ++F+   V  + D S+  S R++V L EE G+A +    AVV    +     E+ + LD 
Sbjct: 4   SLFREKSVAEVRDISVQLS-RDVVKLREEFGKALKSNYQAVVDTNEQIHSLYENIQDLDS 62

Query: 131 DITTLMPGMVRLVRDSKQLSLAPLDLGKLSWLDGKYGDAAIF 172
           D+  L  G   L+       L  + + K    DG YG  + F
Sbjct: 63  DLLQLCFGDEDLLPRMNDTELPSMKVAKRRGSDGTYGRESSF 104

>TDEL0A01330 Chr1 complement(233436..238250) [4815 bp, 1604 aa] {ON}
           Anc_8.231 YER166W
          Length = 1604

 Score = 34.3 bits (77), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 33/61 (54%), Gaps = 1/61 (1%)

Query: 215 AVGKDGTLQWVTLKFLECALMRELVKSSGQIR-FLCRYLAENVSLCHTELIEPYRVFLTR 273
           A+G +       L F+    +R+L   SG+++   C +    ++LCH+ L+EP++   +R
Sbjct: 754 ALGNNSQFNPDDLTFISKEFVRDLQGQSGEVQQNCCEHFMLALALCHSVLVEPHKTDPSR 813

Query: 274 L 274
           L
Sbjct: 814 L 814

>YML068W Chr13 (137550..138944) [1395 bp, 464 aa] {ON}  ITT1Protein
           that modulates the efficiency of translation
           termination, interacts with translation release factors
           eRF1 (Sup45p) and eRF3 (Sup35p) in vitro, contains a
           zinc finger domain characteristic of the TRIAD class of
           proteins
          Length = 464

 Score = 33.5 bits (75), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 29/64 (45%), Gaps = 3/64 (4%)

Query: 186 IDGQLSLRFPSGIRNVHKILPQGGSGSFLAVGKDGTLQWVTLKFLECALMRELVKSSGQI 245
           ID    L FP+GIR   K L Q     F  + ++ TLQ V+     C +  E+ K    I
Sbjct: 137 IDDTAILLFPNGIR---KCLTQDQYDLFKQISEEATLQKVSRSNYHCCICMEMEKGVRMI 193

Query: 246 RFLC 249
           +  C
Sbjct: 194 KLPC 197

>KLLA0A08822g Chr1 (772565..774313) [1749 bp, 582 aa] {ON} similar
           to uniprot|P53197 Saccharomyces cerevisiae YGL003C CDH1
           CDC20 homolog 1 protein required for Clb2 and Ase1
           degradation
          Length = 582

 Score = 32.7 bits (73), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 34/58 (58%), Gaps = 8/58 (13%)

Query: 56  HEIVGIQWEKNESKLFAVFQSNGVVRIYDCSIGGSLREMVNLVEEGQAAEVKVDAVVW 113
            E+ G++W  NE+KL A   ++ +V +YD    G+LR+ +  +EE  AA   V A+ W
Sbjct: 402 QEVCGLKWNVNENKL-ASGGNDNMVYVYD----GTLRQPMLSMEEHTAA---VKAMAW 451

>TBLA0B04390 Chr2 (1014987..1015997) [1011 bp, 336 aa] {ON}
           Anc_8.585 YBR175W
          Length = 336

 Score = 32.3 bits (72), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 42/77 (54%), Gaps = 3/77 (3%)

Query: 19  VVWNPRLSLYLVLT-DKKIAVNRVIDGQQIAAVNLRDEHEIVGIQWEKNESKLFAVFQSN 77
           + +N + +L L  + D+ I +  ++ G  +  +N  ++  +V I +  N+S +F+    +
Sbjct: 117 IKYNEKGNLLLSCSVDESIKIWDILHGTNLRTINTHND-PVVTIDF-NNDSSIFSSGSHD 174

Query: 78  GVVRIYDCSIGGSLREM 94
           G+VR+YD   G  LR +
Sbjct: 175 GLVRLYDSGTGNCLRTL 191

>ZYRO0A08690g Chr1 (691253..692803) [1551 bp, 516 aa] {ON} highly
           similar to uniprot|Q04225 Saccharomyces cerevisiae
           YMR131C RRB1 RiboSome Assembly 2
          Length = 516

 Score = 32.3 bits (72), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 35/80 (43%), Gaps = 12/80 (15%)

Query: 15  KGHKVVWNPRLSLYLVLTD---------KKIAVNRVIDGQQIAAVNLRDEHEIVGIQWEK 65
           +G+ + W+P +    +LT          ++     + D Q   A N      +  IQW  
Sbjct: 280 EGYGLDWSPLIKTGALLTGDCSGQIFLTQRHTSKWITDKQPFTAAN---NQSVEDIQWSP 336

Query: 66  NESKLFAVFQSNGVVRIYDC 85
            ES +FA   ++G VRI+D 
Sbjct: 337 TESTVFATSGTDGYVRIWDT 356

>TPHA0C01480 Chr3 complement(338034..339353) [1320 bp, 439 aa] {ON}
           Anc_7.180 YIR012W
          Length = 439

 Score = 32.0 bits (71), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 31/120 (25%), Positives = 55/120 (45%), Gaps = 21/120 (17%)

Query: 64  EKNESKLFAVFQSNGVVRIYDCSIGG--SLREMVNLVEEGQAAEVKVDAVVWMTVEWAKF 121
           +KN + + AV  +NGV+ I +C+ G    L  ++ L E+ +  +  ++++ W T     F
Sbjct: 280 KKNTTPIVAVGSNNGVLAIINCANGSVLHLSTVIELKEDQEELDASIESISWST----DF 335

Query: 122 PESYRGLD------FDIT--------TLMPGMVRLVRDSKQLSLAPLDLGKLSWLDGKYG 167
           P    GL       +DI         TL   + RL  D   L ++ ++ GK+   D + G
Sbjct: 336 PLLAIGLVCGDILLYDINTWRVRRKFTLEDSVTRLTFDKTDLFVSCVN-GKVYQYDARTG 394

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.135    0.408 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 70,029,422
Number of extensions: 2757835
Number of successful extensions: 6729
Number of sequences better than 10.0: 32
Number of HSP's gapped: 6800
Number of HSP's successfully gapped: 35
Length of query: 740
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 623
Effective length of database: 40,065,477
Effective search space: 24960792171
Effective search space used: 24960792171
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 70 (31.6 bits)