Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_56.237598.271ON86186142260.0
KLTH0G13486g8.271ON90289029690.0
SAKL0H16830g8.271ON86286326030.0
KNAG0G020708.271ON89989124980.0
Skud_12.1608.271ON89388224950.0
KLLA0F19338g8.271ON89187124930.0
Suva_10.1768.271ON89388524840.0
Smik_12.1518.271ON89387924830.0
YLR092W (SUL2)8.271ON89388424740.0
NCAS0B050508.271ON92389424400.0
KAFR0B027508.271ON83487724250.0
NDAI0B020208.271ON90588924180.0
TDEL0F039808.271ON86788623840.0
Skud_2.424na 1ON86389423680.0
Suva_4.554na 1ON85088723650.0
CAGL0L12342g8.271ON89190623630.0
Kpol_543.438.271ON86680123620.0
YBR294W (SUL1)na 1ON85988423590.0
Smik_2.435na 1ON86381523490.0
ZYRO0C01452g8.271ON90689123020.0
AGR077C8.271ON84886522650.0
TPHA0J008008.271ON91790822680.0
Ecym_42998.271ON87487722080.0
TPHA0A017608.271ON89382721940.0
TBLA0F030508.271ON89750112471e-157
KNAG0D023908.99ON7164943308e-31
NCAS0B048008.99ON7244903281e-30
Kpol_467.118.99ON7444763164e-29
YPR003C8.99ON7544883075e-28
NDAI0B022108.99ON7065343031e-27
KLLA0E14059g8.99ON7064963013e-27
Suva_16.3228.99ON7424763013e-27
TPHA0H007208.99ON7874862942e-26
Skud_16.2868.99ON7454742899e-26
SAKL0B03124g8.99ON7444812826e-25
Smik_16.2418.99ON7444762782e-24
TDEL0C012808.99ON7274912772e-24
ZYRO0F04796g8.99ON7354952754e-24
KLTH0G16764g8.99ON7104752711e-23
CAGL0L09207g8.99ON7254742682e-23
Kwal_27.110398.99ON7264972622e-22
Ecym_7084na 2ON6894862612e-22
AGR213Cna 2ON6894942415e-20
SAKL0H08800gna 2ON6204432003e-15
TBLA0C052708.99ON7761611559e-10
NCAS0C033008.318ON55977752.4
NCAS0D003402.61ON333174724.5
YER132C (PMD1)8.157ON175375734.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_56.23759
         (861 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_56.23759 s56 complement(693180..695765) [2586 bp, 861 aa] {...  1632   0.0  
KLTH0G13486g Chr7 complement(1156678..1159386) [2709 bp, 902 aa]...  1148   0.0  
SAKL0H16830g Chr8 complement(1479446..1482034) [2589 bp, 862 aa]...  1007   0.0  
KNAG0G02070 Chr7 (469623..472322) [2700 bp, 899 aa] {ON} Anc_8.2...   966   0.0  
Skud_12.160 Chr12 (306715..309396) [2682 bp, 893 aa] {ON} YLR092...   965   0.0  
KLLA0F19338g Chr6 (1789536..1792211) [2676 bp, 891 aa] {ON} simi...   964   0.0  
Suva_10.176 Chr10 (328373..331054) [2682 bp, 893 aa] {ON} YLR092...   961   0.0  
Smik_12.151 Chr12 (303440..306121) [2682 bp, 893 aa] {ON} YLR092...   961   0.0  
YLR092W Chr12 (323544..326225) [2682 bp, 893 aa] {ON}  SUL2High ...   957   0.0  
NCAS0B05050 Chr2 (937285..940056) [2772 bp, 923 aa] {ON} Anc_8.271    944   0.0  
KAFR0B02750 Chr2 (562981..565485) [2505 bp, 834 aa] {ON} Anc_8.2...   938   0.0  
NDAI0B02020 Chr2 (501062..503779) [2718 bp, 905 aa] {ON} Anc_8.271    936   0.0  
TDEL0F03980 Chr6 (737605..740208) [2604 bp, 867 aa] {ON} Anc_8.2...   922   0.0  
Skud_2.424 Chr2 (758785..761376) [2592 bp, 863 aa] {ON} YBR294W ...   916   0.0  
Suva_4.554 Chr4 (962125..964677) [2553 bp, 850 aa] {ON} YBR294W ...   915   0.0  
CAGL0L12342g Chr12 (1333884..1336559) [2676 bp, 891 aa] {ON} sim...   914   0.0  
Kpol_543.43 s543 (93697..96297) [2601 bp, 866 aa] {ON} (93697..9...   914   0.0  
YBR294W Chr2 (789235..791814) [2580 bp, 859 aa] {ON}  SUL1High a...   913   0.0  
Smik_2.435 Chr2 (775289..777880) [2592 bp, 863 aa] {ON} YLR092W ...   909   0.0  
ZYRO0C01452g Chr3 complement(103175..105895) [2721 bp, 906 aa] {...   891   0.0  
AGR077C Chr7 complement(874110..876656) [2547 bp, 848 aa] {ON} S...   877   0.0  
TPHA0J00800 Chr10 (186144..188897) [2754 bp, 917 aa] {ON} Anc_8....   878   0.0  
Ecym_4299 Chr4 complement(639078..641702) [2625 bp, 874 aa] {ON}...   855   0.0  
TPHA0A01760 Chr1 complement(356771..359452) [2682 bp, 893 aa] {O...   849   0.0  
TBLA0F03050 Chr6 complement(738517..741210) [2694 bp, 897 aa] {O...   484   e-157
KNAG0D02390 Chr4 (420952..423102) [2151 bp, 716 aa] {ON} Anc_8.9...   131   8e-31
NCAS0B04800 Chr2 complement(873061..875235) [2175 bp, 724 aa] {O...   130   1e-30
Kpol_467.11 s467 (26194..28428) [2235 bp, 744 aa] {ON} (26194..2...   126   4e-29
YPR003C Chr16 complement(561504..563768) [2265 bp, 754 aa] {ON} ...   122   5e-28
NDAI0B02210 Chr2 complement(546721..548841) [2121 bp, 706 aa] {O...   121   1e-27
KLLA0E14059g Chr5 (1245694..1247814) [2121 bp, 706 aa] {ON} simi...   120   3e-27
Suva_16.322 Chr16 complement(565605..567833) [2229 bp, 742 aa] {...   120   3e-27
TPHA0H00720 Chr8 complement(143103..145466) [2364 bp, 787 aa] {O...   117   2e-26
Skud_16.286 Chr16 complement(525800..528037) [2238 bp, 745 aa] {...   115   9e-26
SAKL0B03124g Chr2 complement(288006..290240) [2235 bp, 744 aa] {...   113   6e-25
Smik_16.241 Chr16 complement(438048..440282) [2235 bp, 744 aa] {...   111   2e-24
TDEL0C01280 Chr3 complement(218824..221007) [2184 bp, 727 aa] {O...   111   2e-24
ZYRO0F04796g Chr6 (399222..401429) [2208 bp, 735 aa] {ON} simila...   110   4e-24
KLTH0G16764g Chr7 complement(1454815..1456947) [2133 bp, 710 aa]...   108   1e-23
CAGL0L09207g Chr12 complement(999571..1001748) [2178 bp, 725 aa]...   107   2e-23
Kwal_27.11039 s27 complement(614861..617041) [2181 bp, 726 aa] {...   105   2e-22
Ecym_7084 Chr7 complement(167032..169101) [2070 bp, 689 aa] {ON}...   105   2e-22
AGR213C Chr7 complement(1156110..1158179) [2070 bp, 689 aa] {ON}...    97   5e-20
SAKL0H08800g Chr8 (753145..755007) [1863 bp, 620 aa] {ON} simila...    82   3e-15
TBLA0C05270 Chr3 complement(1273901..1276231) [2331 bp, 776 aa] ...    64   9e-10
NCAS0C03300 Chr3 (647716..649395) [1680 bp, 559 aa] {ON}               33   2.4  
NCAS0D00340 Chr4 (50708..51709) [1002 bp, 333 aa] {ON} Anc_2.61        32   4.5  
YER132C Chr5 complement(425188..430449) [5262 bp, 1753 aa] {ON} ...    33   4.9  

>Kwal_56.23759 s56 complement(693180..695765) [2586 bp, 861 aa] {ON}
           YBR294W (SUL1) - Probable sulfate transport protein
           [contig 173] FULL
          Length = 861

 Score = 1632 bits (4226), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 821/861 (95%), Positives = 821/861 (95%)

Query: 1   MSNLERQTSLDLDDLDAEYGHFKNTEHSEIGGGPSSNPGAAVGVGASTKLGQDQNGDKSG 60
           MSNLERQTSLDLDDLDAEYGHFKNTEHSEIGGGPSSNPGAAVGVGASTKLGQDQNGDKSG
Sbjct: 1   MSNLERQTSLDLDDLDAEYGHFKNTEHSEIGGGPSSNPGAAVGVGASTKLGQDQNGDKSG 60

Query: 61  ATGGGNGANEPLALYDSPEAYYEDKVTFREYYDTTIRPSLTASNVRQYLRDLLPVINWLP 120
           ATGGGNGANEPLALYDSPEAYYEDKVTFREYYDTTIRPSLTASNVRQYLRDLLPVINWLP
Sbjct: 61  ATGGGNGANEPLALYDSPEAYYEDKVTFREYYDTTIRPSLTASNVRQYLRDLLPVINWLP 120

Query: 121 HYNGRWFYQDMVAGITVGCVLVPQSMSYAVIATLPPQFGLYSSFVGAMIYSFFATSKDVC 180
           HYNGRWFYQDMVAGITVGCVLVPQSMSYAVIATLPPQFGLYSSFVGAMIYSFFATSKDVC
Sbjct: 121 HYNGRWFYQDMVAGITVGCVLVPQSMSYAVIATLPPQFGLYSSFVGAMIYSFFATSKDVC 180

Query: 181 IGPVAVMSLQTAKAVSKVMAELPADTDITAPVVATALAFLCGLISXXXXXXXXXXXXXXI 240
           IGPVAVMSLQTAKAVSKVMAELPADTDITAPVVATALAFLCGLIS              I
Sbjct: 181 IGPVAVMSLQTAKAVSKVMAELPADTDITAPVVATALAFLCGLISLGLGVLRLGFLVELI 240

Query: 241 SSTAVAGFMTGSALNIISGQLPALMGYNKLVNTRTSTYKVIIETLKHLPDTKLDAVFGLI 300
           SSTAVAGFMTGSALNIISGQLPALMGYNKLVNTRTSTYKVIIETLKHLPDTKLDAVFGLI
Sbjct: 241 SSTAVAGFMTGSALNIISGQLPALMGYNKLVNTRTSTYKVIIETLKHLPDTKLDAVFGLI 300

Query: 301 PLVMLYTWKWLCNSGGPRLVERYTVRGSRKQRIWSATLFYTQALRNAVIIIVFTAIAWSI 360
           PLVMLYTWKWLCNSGGPRLVERYTVRGSRKQRIWSATLFYTQALRNAVIIIVFTAIAWSI
Sbjct: 301 PLVMLYTWKWLCNSGGPRLVERYTVRGSRKQRIWSATLFYTQALRNAVIIIVFTAIAWSI 360

Query: 361 SHHKKKAPISLLGPVPSGLKDVGVMKLPDGLAAKIAPELPASVIVLLLEHIAIAKAFGRV 420
           SHHKKKAPISLLGPVPSGLKDVGVMKLPDGLAAKIAPELPASVIVLLLEHIAIAKAFGRV
Sbjct: 361 SHHKKKAPISLLGPVPSGLKDVGVMKLPDGLAAKIAPELPASVIVLLLEHIAIAKAFGRV 420

Query: 421 NDYRVVPDQELIAIGATNLLGTFFNAYPATGSFSRSALKAKCNVSTPLSGVFSGACVLLA 480
           NDYRVVPDQELIAIGATNLLGTFFNAYPATGSFSRSALKAKCNVSTPLSGVFSGACVLLA
Sbjct: 421 NDYRVVPDQELIAIGATNLLGTFFNAYPATGSFSRSALKAKCNVSTPLSGVFSGACVLLA 480

Query: 481 IYCLTSAFQYIPKATLSAVIIHAVSDLIASYKTTWSIWRLNPLDLVCFLATVFIAVFSSI 540
           IYCLTSAFQYIPKATLSAVIIHAVSDLIASYKTTWSIWRLNPLDLVCFLATVFIAVFSSI
Sbjct: 481 IYCLTSAFQYIPKATLSAVIIHAVSDLIASYKTTWSIWRLNPLDLVCFLATVFIAVFSSI 540

Query: 541 ENGIYFAMCWSVAVLLFKVAFPRAQFLGRVEIAELATNEGVSAGSEFAPLSKDFEXXXXX 600
           ENGIYFAMCWSVAVLLFKVAFPRAQFLGRVEIAELATNEGVSAGSEFAPLSKDFE     
Sbjct: 541 ENGIYFAMCWSVAVLLFKVAFPRAQFLGRVEIAELATNEGVSAGSEFAPLSKDFEKGKGV 600

Query: 601 XXXXXXXXXXXFNAKKQGIEGGSQFVGGASNAAGAGFHTKWVPFEPYTRELNXXXXXXXX 660
                      FNAKKQGIEGGSQFVGGASNAAGAGFHTKWVPFEPYTRELN        
Sbjct: 601 SYASGSVSSESFNAKKQGIEGGSQFVGGASNAAGAGFHTKWVPFEPYTRELNPQVPVAQP 660

Query: 661 XXGVIVFRPSESWTYVNCARQYNAIFDEVVRTTRRGKVQVTSKSGRPWNDPGEWHPPKFL 720
             GVIVFRPSESWTYVNCARQYNAIFDEVVRTTRRGKVQVTSKSGRPWNDPGEWHPPKFL
Sbjct: 661 PPGVIVFRPSESWTYVNCARQYNAIFDEVVRTTRRGKVQVTSKSGRPWNDPGEWHPPKFL 720

Query: 721 RKWFGKKYSESLEQGVVSDDRPVLRVIAMDWSQVAQVDSTGLQTLHDLRKAVSKYADRQV 780
           RKWFGKKYSESLEQGVVSDDRPVLRVIAMDWSQVAQVDSTGLQTLHDLRKAVSKYADRQV
Sbjct: 721 RKWFGKKYSESLEQGVVSDDRPVLRVIAMDWSQVAQVDSTGLQTLHDLRKAVSKYADRQV 780

Query: 781 EFHFSGIISPWIKRGLLNTGFGTVNEEHADESLLVGHKTYQVARGGATGDEEALLPQPAT 840
           EFHFSGIISPWIKRGLLNTGFGTVNEEHADESLLVGHKTYQVARGGATGDEEALLPQPAT
Sbjct: 781 EFHFSGIISPWIKRGLLNTGFGTVNEEHADESLLVGHKTYQVARGGATGDEEALLPQPAT 840

Query: 841 GVNMPFFHAEMPDFSKWDFSD 861
           GVNMPFFHAEMPDFSKWDFSD
Sbjct: 841 GVNMPFFHAEMPDFSKWDFSD 861

>KLTH0G13486g Chr7 complement(1156678..1159386) [2709 bp, 902 aa]
           {ON} similar to uniprot|Q12325 Saccharomyces cerevisiae
           YLR092W SUL2 High affinity sulfate permease sulfate
           uptake is mediated by specific sulfate transporters
           Sul1p and Sul2p which control the concentration of
           endogenous activated sulfate intermediates and
           uniprot|P38359 Saccharomyces cerevisiae YBR294W SUL1
          Length = 902

 Score = 1148 bits (2969), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 589/890 (66%), Positives = 667/890 (74%), Gaps = 39/890 (4%)

Query: 3   NLERQTSLDLDDLDAEYGHFKNTEHSEIGGGP--SSNPGAAVGV----GASTKLGQDQNG 56
            L     +DLDDLDAEYG FKN EHS+   G   +S  GA           +  G     
Sbjct: 21  ELSNDAPIDLDDLDAEYGQFKNAEHSDATAGRDLTSEYGAQFAAEFGGEPGSGSGSGSGF 80

Query: 57  DKSGATGGGNGANEPLALYDSPEAYYEDKVTFREYYDTTIRPSLTASNVRQYLRDLLPVI 116
            ++         N P ALY+    ++E  VT  E+Y   +R + T +    YLR LLP++
Sbjct: 81  PEAKPVAPAAPGNVPSALYE----FHERPVTVGEFYSQNLRSTFTLATFTNYLRSLLPIM 136

Query: 117 NWLPHYNGRWFYQDMVAGITVGCVLVPQSMSYAVIATLPPQFGLYSSFVGAMIYSFFATS 176
            WLPHYN RW YQD+VAGITVGCVLVPQSMSYA IATL PQ+GLYSSFVGA IYSFFATS
Sbjct: 137 RWLPHYNARWLYQDLVAGITVGCVLVPQSMSYAQIATLSPQYGLYSSFVGAFIYSFFATS 196

Query: 177 KDVCIGPVAVMSLQTAKAVSKVMAELPADTDITAPVVATALAFLCGLISXXXXXXXXXXX 236
           KDVCIGPVAVMSLQTAKA+S V++ LP DT+IT+P++ATALA LCG+IS           
Sbjct: 197 KDVCIGPVAVMSLQTAKAISHVVSSLPEDTEITSPMIATALALLCGIISLGLGVLRLGFL 256

Query: 237 XXXISSTAVAGFMTGSALNIISGQLPALMGYNKLVNTRTSTYKVIIETLKHLPDTKLDAV 296
              ISSTAVAGFMTGSALNII+GQ+PALMGYNKLVNTRTSTYKVII +L+HLPDTKLDAV
Sbjct: 257 VELISSTAVAGFMTGSALNIIAGQVPALMGYNKLVNTRTSTYKVIINSLRHLPDTKLDAV 316

Query: 297 FGLIPLVMLYTWKWLCNSGGPRLVERYTVRGSRKQRIWSATLFYTQALRNAVIIIVFTAI 356
           FGL+PLV+LY WKW C++GGPRLV+RY   GSR+ R+W     YTQALRNAV+I+VFTAI
Sbjct: 317 FGLVPLVILYVWKWGCSTGGPRLVQRY---GSRRSRMWDNVFLYTQALRNAVVIVVFTAI 373

Query: 357 AWSISHHKKK----APISLLGPVPSGLKDVGVMKLPDGLAAKIAPELPASVIVLLLEHIA 412
           AW +SH   K    A ISLLG VPSGLKDVGVMK+P GL +KIAPELPASVIVL+LEHIA
Sbjct: 374 AWGMSHRALKEGGSARISLLGTVPSGLKDVGVMKVPSGLLSKIAPELPASVIVLVLEHIA 433

Query: 413 IAKAFGRVNDYRVVPDQELIAIGATNLLGTFFNAYPATGSFSRSALKAKCNVSTPLSGVF 472
           I+KAFGRVNDYRVVPDQELIAIGATNL+GTFFNAYPATGSFSRSALKAKCNVSTPLSG+F
Sbjct: 434 ISKAFGRVNDYRVVPDQELIAIGATNLIGTFFNAYPATGSFSRSALKAKCNVSTPLSGLF 493

Query: 473 SGACVLLAIYCLTSAFQYIPKATLSAVIIHAVSDLIASYKTTWSIWRLNPLDLVCFLATV 532
           SGACVLLAIYCLTSAF++IPKATLSAVIIHAVSDLIASYKTTWS WRL+P DLVCFL TV
Sbjct: 494 SGACVLLAIYCLTSAFKFIPKATLSAVIIHAVSDLIASYKTTWSFWRLSPPDLVCFLVTV 553

Query: 533 FIAVFSSIENGIYFAMCWSVAVLLFKVAFPRAQFLGRVEIAEL-ATNEGVSAG------- 584
            I VFSSIENGIYFAMCWSVAVLLF+ AFP  +FLGRV+IAE   TN G  AG       
Sbjct: 554 VITVFSSIENGIYFAMCWSVAVLLFRTAFPAGKFLGRVQIAEARVTNSGAGAGVGMSSGN 613

Query: 585 SEFAPLSKDFEXXXXXXXXXXXXXXXXFNA---KKQGIEGGSQFVGGASNAAGAG----- 636
           S    ++++ E                  A    K     G+  +G        G     
Sbjct: 614 SAGTAVNREKERETTFTAVSVSSESLSHTAPGKAKAANSAGTDKLGKVEGHVTDGGSPRA 673

Query: 637 --FHTKWVPFEPYTRELNXXXXXXXXXXGVIVFRPSESWTYVNCARQYNAIFDEVVRTTR 694
             FHTKWVPF+ YTRELN          GVIVFRPSESWTYVNC+RQY+AIFDEVVR TR
Sbjct: 674 PRFHTKWVPFDRYTRELNPEVFVAPPPPGVIVFRPSESWTYVNCSRQYDAIFDEVVRLTR 733

Query: 695 RGKVQVTSKSG-RPWNDPGEWHPPKFLRKWFGKKYSESLE-QGVVSDDRPVLRVIAMDWS 752
           RG+ Q+ +KS  RPWNDPGEWHPPKFLRK F K  SE LE + V  D+RPVLRVIAMDWS
Sbjct: 734 RGRPQIVAKSSSRPWNDPGEWHPPKFLRKLF-KSSSEDLENRAVARDERPVLRVIAMDWS 792

Query: 753 QVAQVDSTGLQTLHDLRKAVSKYADRQVEFHFSGIISPWIKRGLLNTGFGTVNEEHADES 812
           QVAQVDSTGLQTL DLRKAV+KYADRQVEFHF+GII PW+KRGL+N+GFGTVN+E ADES
Sbjct: 793 QVAQVDSTGLQTLQDLRKAVNKYADRQVEFHFAGIIEPWVKRGLINSGFGTVNDEFADES 852

Query: 813 LLVGHKTYQVARGGA-TGDEEALLPQPATGVNMPFFHAEMPDFSKWDFSD 861
           LLVGHK+  +AR    T DEE+ L  PATG N+PFFH E+PDFS+WD+SD
Sbjct: 853 LLVGHKSCHIARSAEPTEDEESRLAHPATGTNLPFFHLELPDFSEWDYSD 902

>SAKL0H16830g Chr8 complement(1479446..1482034) [2589 bp, 862 aa]
           {ON} similar to uniprot|Q12325 Saccharomyces cerevisiae
           YLR092W SUL2 High affinity sulfate permease sulfate
           uptake is mediated by specific sulfate transporters
           Sul1p and Sul2p which control the concentration of
           endogenous activated sulfate intermediates and
           uniprot|P38359 Saccharomyces cerevisiae YBR294W SUL1
          Length = 862

 Score = 1007 bits (2603), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 511/863 (59%), Positives = 620/863 (71%), Gaps = 44/863 (5%)

Query: 11  DLDDLDAEYGHFKNTEHSEIGGGPSSNPGAAVGVGASTKLGQDQNGDKSGATGGGNGANE 70
           +LDDL+AEY ++KN E          NP     V  +      QN     A G  N    
Sbjct: 26  NLDDLEAEYDNYKNAEQ---------NPREKSDVVETLPPTTHQND----AKGLKNDGQT 72

Query: 71  PLALYDSPEA------YYEDKVTFREYYDTTIRPSLTASNVRQYLRDLLPVINWLPHYNG 124
            + LY +  +      Y+ED V F++YYD ++  +++ S+ R+YL  L PVI W+PHYN 
Sbjct: 73  TVELYGTTSSGGVIPGYHEDTVNFKDYYDQSLSSNISFSSFREYLISLFPVIRWIPHYNF 132

Query: 125 RWFYQDMVAGITVGCVLVPQSMSYAVIATLPPQFGLYSSFVGAMIYSFFATSKDVCIGPV 184
            W Y D+VAG+TVGCVLVPQSMSYA IA+LP Q+GLYSSF+GA IYSFFATSKDVCIGPV
Sbjct: 133 AWMYGDVVAGVTVGCVLVPQSMSYAQIASLPAQYGLYSSFIGAFIYSFFATSKDVCIGPV 192

Query: 185 AVMSLQTAKAVSKVMAELPADTDITAPVVATALAFLCGLISXXXXXXXXXXXXXXISSTA 244
           AVMSL+TAK +++V   LP DT+IT P++ATAL+ LCG I+              IS  A
Sbjct: 193 AVMSLETAKVIARVTEHLPDDTEITGPIIATALSLLCGAITLGIGVLRLGFLVELISLNA 252

Query: 245 VAGFMTGSALNIISGQLPALMGYNKLVNTRTSTYKVIIETLKHLPDTKLDAVFGLIPLVM 304
           VAGFMTGSA +II+GQLPALMGYN+ VNTR +TYKV+I TLKHLPDTKLDAVFGLIPL++
Sbjct: 253 VAGFMTGSAFSIITGQLPALMGYNEKVNTRDTTYKVVINTLKHLPDTKLDAVFGLIPLLI 312

Query: 305 LYTWKWLCNSGGPRLVERYTVRGSRKQRIWSATLFYTQALRNAVIIIVFTAIAWSISHHK 364
           LY WK+ CN+ GP  V+R     S + + W +  FY QALRNA +I++FT IAW I+ HK
Sbjct: 313 LYLWKYGCNTIGPNWVDRRMNPHSPRAKFWKSFFFYAQALRNAFVIVLFTLIAWGITRHK 372

Query: 365 KKAPISLLGPVPSGLKDVGVMKLPDGLAAKIAPELPASVIVLLLEHIAIAKAFGRVNDYR 424
           KK PISLL  VPSGLK+VGVMK PD LA  +APELPA+ I+LLLEHIAIAKAFGR+NDY+
Sbjct: 373 KKHPISLLNTVPSGLKNVGVMKFPDHLATNLAPELPAAAIILLLEHIAIAKAFGRINDYK 432

Query: 425 VVPDQELIAIGATNLLGTFFNAYPATGSFSRSALKAKCNVSTPLSGVFSGACVLLAIYCL 484
           VVPDQELIAIG TNL+GTFFNAYPATGSFSRSALKAKCNV TPLSGVF+GACVLLA+YCL
Sbjct: 433 VVPDQELIAIGVTNLVGTFFNAYPATGSFSRSALKAKCNVRTPLSGVFTGACVLLALYCL 492

Query: 485 TSAFQYIPKATLSAVIIHAVSDLIASYKTTWSIWRLNPLDLVCFLATVFIAVFSSIENGI 544
           T AF YIPKATLSAVIIHAVSDLIASY+TTW+ W++NPLD +CFL TVFI +FSSIENGI
Sbjct: 493 TEAFYYIPKATLSAVIIHAVSDLIASYETTWNFWKMNPLDCLCFLVTVFITIFSSIENGI 552

Query: 545 YFAMCWSVAVLLFKVAFPRAQFLGRVEIAELATNEGVSAGSEFAPLSKDFEXXXXXXXXX 604
           YFA+CWS A+LLFK+AFP  +FLGRVE++E+  N  V    E   + +DF+         
Sbjct: 553 YFAICWSCAILLFKIAFPSGKFLGRVEVSEV-INPTV---REDLGVVEDFDSENINVASS 608

Query: 605 XXXXXXXFNAKKQGIEGGSQFVGGASNAAGAGFHTKWVPFE-PYTRELNXXXXXXXXXXG 663
                      K G+   +  +  ++  +   FHTKW+P E  Y RE N          G
Sbjct: 609 --------TKPKLGLSADNSSI--STGPSRVRFHTKWIPLENNYGREYNSGIVVQPPPPG 658

Query: 664 VIVFRPSESWTYVNCARQYNAIFDEVVRTTRRGKVQV-TSKSGRPWNDPGEWHPPKFLRK 722
           VIV+RPSESWTY+NC+RQY+ IFDEV R TRRG V   T KS RPWNDPG+W PP FL+K
Sbjct: 659 VIVYRPSESWTYINCSRQYDIIFDEVKRLTRRGIVLAHTKKSDRPWNDPGQWEPPLFLKK 718

Query: 723 WF--GKKYSESLEQGVVSDDRPVLRVIAMDWSQVAQVDSTGLQTLHDLRKAVSKYADRQV 780
            F  GK+  + L   +  D+RPVL+++AMDWSQV Q+D+TG+Q L DLRKA++KYADRQV
Sbjct: 719 LFKRGKRLEQELSPELGRDERPVLKILAMDWSQVTQIDATGVQNLVDLRKAINKYADRQV 778

Query: 781 EFHFSGIISPWIKRGLLNTGFGTVNEEHADESLLVGHKTYQVARGGATGDEEALLPQ--- 837
           EFHFSGIISPWIKR L+  GFGTVN+E ADESL++GH +Y + +     DEE  + Q   
Sbjct: 779 EFHFSGIISPWIKRALVAVGFGTVNDEFADESLILGHSSYHIVKTRPQ-DEENHIGQGRY 837

Query: 838 ---PATGVNMPFFHAEMPDFSKW 857
               A+G NMPFFH EMPDFSKW
Sbjct: 838 NISAASGTNMPFFHVEMPDFSKW 860

>KNAG0G02070 Chr7 (469623..472322) [2700 bp, 899 aa] {ON} Anc_8.271
           YLR092W
          Length = 899

 Score =  966 bits (2498), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 499/891 (56%), Positives = 616/891 (69%), Gaps = 59/891 (6%)

Query: 5   ERQTSLDLDDLDAEYGHFKNTE-HSE---IGGGPSSNPGAAVGVGASTKLGQDQNGDKSG 60
           E  ++ DLD+L+ EY  +K  E H +   +     ++      V    +  +D N   + 
Sbjct: 30  EVSSTPDLDNLELEYDQYKADELHPQRTILSNQADTDREKIANVFVEEQSVRDSNIPSAS 89

Query: 61  ATGGGNGANEPLALYDSPEAYYEDKVTFREYYDTTIRPSLTASNVRQYLRDLLPVINWLP 120
                  A+E       P +Y E  VT  E+++ ++R   T +  + Y+  + P+I+WLP
Sbjct: 90  IEELQYFAHESDGAKVIP-SYVEGNVTELEFFNHSLRSKFTLNAAKNYILSIFPIIHWLP 148

Query: 121 HYNGRWFYQDMVAGITVGCVLVPQSMSYAVIATLPPQFGLYSSFVGAMIYSFFATSKDVC 180
           HYN  WF QD++AGITVGCVLVPQSMSYA IATLPPQ+GLYSSF+GA IYS FATSKDVC
Sbjct: 149 HYNVYWFIQDLIAGITVGCVLVPQSMSYAQIATLPPQYGLYSSFIGAFIYSLFATSKDVC 208

Query: 181 IGPVAVMSLQTAKAVSKVMAELPADTDITAPVVATALAFLCGLISXXXXXXXXXXXXXXI 240
           IGPVAVMSL+TAK +++VM   P D D+  P++AT  A LCG I+              I
Sbjct: 209 IGPVAVMSLETAKIIARVMKRFPNDPDVQGPIIATTTALLCGGIAAGVGFLRLGFLVELI 268

Query: 241 SSTAVAGFMTGSALNIISGQLPALMGYNKLVNTRTSTYKVIIETLKHLPDTKLDAVFGLI 300
           S  AVAGFMTGSALNIISGQ+PALMGY KLVNTRT+TYKVI+ TLKHLPDTKLDAVFGLI
Sbjct: 269 SLNAVAGFMTGSALNIISGQVPALMGYGKLVNTRTATYKVIVNTLKHLPDTKLDAVFGLI 328

Query: 301 PLVMLYTWKWLCNSGGPRLVERYTVRGSRKQRIWSATLFYTQALRNAVIIIVFTAIAWSI 360
           PL +LY W+W CN  GP+L +RY  +GSR   +W    FY QA R+ +IIIVFTAI+WSI
Sbjct: 329 PLFILYFWRWWCNGYGPKLTDRYYPKGSRGNFLWKKFYFYAQASRSGIIIIVFTAISWSI 388

Query: 361 SHH--KKKAPISLLGPVPSGLKDVGVMKLPDGLAAKIAPELPASVIVLLLEHIAIAKAFG 418
           + H   K+  IS+LG VP GLKDVG +K+P  L AKIAPELPA+VIVLLLEHIAI+K+FG
Sbjct: 389 TRHVPSKERRISILGTVPKGLKDVGAIKVPPELPAKIAPELPAAVIVLLLEHIAISKSFG 448

Query: 419 RVNDYRVVPDQELIAIGATNLLGTFFNAYPATGSFSRSALKAKCNVSTPLSGVFSGACVL 478
           R+NDY+VVPDQELIAIG TNL+GTFF+AYP TGSFSRSALKAKCNV TPLSG+F+G+CVL
Sbjct: 449 RINDYKVVPDQELIAIGVTNLIGTFFHAYPTTGSFSRSALKAKCNVKTPLSGLFTGSCVL 508

Query: 479 LAIYCLTSAFQYIPKATLSAVIIHAVSDLIASYKTTWSIWRLNPLDLVCFLATVFIAVFS 538
           LA+YCLT AF YIPKATLSAVIIH+VSDL+ASY TTW+ +++NPLD VCFL T+ I VFS
Sbjct: 509 LALYCLTGAFFYIPKATLSAVIIHSVSDLVASYHTTWNFYKMNPLDFVCFLTTIIITVFS 568

Query: 539 SIENGIYFAMCWSVAVLLFKVAFPRAQFLGRVEIAELATNEGVSAG----------SEFA 588
           SIENGIYFA+CWS A+LLFKVAFP  +FLGRVEIAE+   E ++            SEF 
Sbjct: 569 SIENGIYFAICWSCALLLFKVAFPAGKFLGRVEIAEVVDGEIINDNSVVMTTDDCVSEFG 628

Query: 589 PLSKDFEXXXXXXXXXXXXXXXXFNAKKQGIEGGSQFV------GGASNAAGA----GFH 638
             +K+F                     K  + G S F+        AS+++ A     ++
Sbjct: 629 G-NKEFS--------------------KDKLNGKSDFIVKDKLDSTASSSSIAENKLKYY 667

Query: 639 TKWVPFE-PYTRELNXXXXXXXXXXGVIVFRPSESWTYVNCARQYNAIFDEVVRTTRRGK 697
           TKWVPF+  YTRELN          GVIV+R S+S+TY+N +  Y+ I DE+ R TRRG+
Sbjct: 668 TKWVPFDHAYTRELNPDVTIQPPPPGVIVYRMSDSYTYINASNHYDIIIDEIKRVTRRGQ 727

Query: 698 -VQVTSKSGRPWNDPGEWHPPKFLRK---WFGKKYS------ESLEQGVVSDDRPVLRVI 747
            +Q   KS RPWNDPGEW PPKFL     W   K        ESLE G+V D+RPVL+V+
Sbjct: 728 LLQHRKKSDRPWNDPGEWKPPKFLSNVLHWRKNKKKNQTADVESLETGIVRDERPVLKVL 787

Query: 748 AMDWSQVAQVDSTGLQTLHDLRKAVSKYADRQVEFHFSGIISPWIKRGLLNTGFGTVNEE 807
            +D+SQVAQVDST LQ+L DLRKAV+ YADRQVEFHF+GIISPWIKRGL+  GFGTVNEE
Sbjct: 788 CLDFSQVAQVDSTSLQSLVDLRKAVNAYADRQVEFHFAGIISPWIKRGLVKIGFGTVNEE 847

Query: 808 HADESLLVGHKTYQVARGGATGDEEALLPQPATGVNMPFFHAEMPDFSKWD 858
            +DES++ GH +Y + +      E     + ATG N+PFFH ++PDF KWD
Sbjct: 848 FSDESIIAGHSSYHLVKNTIGDIENGYQVKTATGTNLPFFHIDIPDFKKWD 898

>Skud_12.160 Chr12 (306715..309396) [2682 bp, 893 aa] {ON} YLR092W
           (REAL)
          Length = 893

 Score =  965 bits (2495), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 496/882 (56%), Positives = 623/882 (70%), Gaps = 49/882 (5%)

Query: 11  DLDDLDAEYGHFKNTEHSEIGGGPSSNPGAAVGVGASTKLGQDQNGDKSGATGGGNGANE 70
           +LDDL+ EY  +KN E++   G  S N      + +++   ++   D  G  G      +
Sbjct: 26  NLDDLELEYDQYKNNENN---GVFSDN-----DLESNSVANRNAVNDAKGVKGSKIEYFD 77

Query: 71  P--LALYDSPEAYYEDK-VTFREYYDTTIRPSLTASNVRQYLRDLLPVINWLPHYNGRWF 127
           P  ++LYD+  + +E+  V+ +EYY+ +IR  LT      YL+ + P+INWLPHYN  WF
Sbjct: 78  PSDVSLYDNSVSQFEESAVSLKEYYNHSIRSHLTLKGAGDYLKSVFPIINWLPHYNFNWF 137

Query: 128 YQDMVAGITVGCVLVPQSMSYAVIATLPPQFGLYSSFVGAMIYSFFATSKDVCIGPVAVM 187
             D++AGIT+GCVLVPQSMSYA +ATLP Q+GLYSSF+GA  YSFFATSKDVCIGPVAVM
Sbjct: 138 IADLIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYAYSFFATSKDVCIGPVAVM 197

Query: 188 SLQTAKAVSKVMAELP-ADTDITAPVVATALAFLCGLISXXXXXXXXXXXXXXISSTAVA 246
           SLQTAK +++V A+ P  DT IT PV+AT LA LCG+IS              IS  AVA
Sbjct: 198 SLQTAKVIAEVQAKYPDGDTTITGPVIATTLALLCGIISAAVGFLRLGFLVELISLNAVA 257

Query: 247 GFMTGSALNIISGQLPALMGYNKLVNTRTSTYKVIIETLKHLPDTKLDAVFGLIPLVMLY 306
           GFMTGSA NI+ GQ+PALMGYNKLVNTR +TYKV+IETLKHLPDTKLDAVFGLIPL +LY
Sbjct: 258 GFMTGSAFNILWGQVPALMGYNKLVNTRAATYKVVIETLKHLPDTKLDAVFGLIPLFLLY 317

Query: 307 TWKWLCNSGGPRLVERYTVRGSRKQRIWSATLFYTQALRNAVIIIVFTAIAWSISHHKKK 366
            WKW C + GPRL +RY  + +R  +I   T FY QA RN +IIIVFT I W+I+  K  
Sbjct: 318 VWKWWCGTYGPRLNDRYNSKNARLHKIVKWTYFYAQASRNGIIIIVFTCIGWAITRGKSS 377

Query: 367 A--PISLLGPVPSGLKDVGVMKLPDGLAAKIAPELPASVIVLLLEHIAIAKAFGRVNDYR 424
           +  PIS+LG VPSGLK+VGV  +P GL +K+ P LP+S+IVLLLEHIAI+K+FGR+NDY+
Sbjct: 378 SERPISILGSVPSGLKEVGVFHVPSGLMSKLGPSLPSSIIVLLLEHIAISKSFGRINDYK 437

Query: 425 VVPDQELIAIGATNLLGTFFNAYPATGSFSRSALKAKCNVSTPLSGVFSGACVLLAIYCL 484
           VVPDQELIAIG +NLLGTFFNAYPATGSFSRSALKAKCNV TPLSG+FSG+CVLLA+YCL
Sbjct: 438 VVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCL 497

Query: 485 TSAFQYIPKATLSAVIIHAVSDLIASYKTTWSIWRLNPLDLVCFLATVFIAVFSSIENGI 544
           T AF YIPKATLSAVIIHAVSDL+ASY+TTW+ W++NPLD +CF+ TV I VF+SIE+GI
Sbjct: 498 TGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFIVTVLITVFASIEDGI 557

Query: 545 YFAMCWSVAVLLFKVAFPRAQFLGRVEIAEL------ATNEGVSAGSE----FAPLSKDF 594
           YFAMCWS A+LL KVAFP  +FLGRVEIAE+      A ++ VS  SE     + L ++ 
Sbjct: 558 YFAMCWSCAMLLLKVAFPAGKFLGRVEIAEVTDAYVKADSDAVSYVSENNNRISTLEENG 617

Query: 595 EXXXXXXXXXXXXXXXXFNAKKQGIEGGSQFVGGASNAAGAG-----FHTKWVPFE-PYT 648
           E                 N+ K+ IE   Q  G AS ++  G     +HTKW+PF+  YT
Sbjct: 618 EDEKEISAKYIT------NSSKK-IETNVQTKGFASPSSSIGQPRIKYHTKWLPFDHKYT 670

Query: 649 RELNXXXXXXXXXXGVIVFRPSESWTYVNCARQYNAIFDEVVRTTRRGK-VQVTSKSGRP 707
           RELN           V+V+R SES+TY+NC+R YN I DEV R TRRG+ ++   KS RP
Sbjct: 671 RELNPDVHILPPPESVLVYRLSESYTYLNCSRHYNIIIDEVKRATRRGQIIRHRKKSDRP 730

Query: 708 WNDPGEWHPPKFLRKW-FGKKYSESLE---------QGVVSDDRPVLRVIAMDWSQVAQV 757
           WNDPG W  P FL+   F KK    LE              D+RP+L+++ +D+SQVAQ 
Sbjct: 731 WNDPGPWEAPAFLKNLKFWKKKESDLEFTQNAPNNSIDAERDERPLLKILCLDFSQVAQT 790

Query: 758 DSTGLQTLHDLRKAVSKYADRQVEFHFSGIISPWIKRGLLNTGFGTVNEEHADESLLVGH 817
           D+T LQ+L DLRKA+++YADRQVEFHF GIISPW+KRGL++ GFGT+NEE++DES++ GH
Sbjct: 791 DATALQSLVDLRKAINQYADRQVEFHFVGIISPWVKRGLISRGFGTINEEYSDESIVAGH 850

Query: 818 KTYQVARGGATGDE-EALLPQPATGVNMPFFHAEMPDFSKWD 858
            +Y VAR     +  +      A+G N+PFFH ++PDF+KWD
Sbjct: 851 TSYHVARVPRNKENPDKYSVYTASGTNLPFFHIDIPDFAKWD 892

>KLLA0F19338g Chr6 (1789536..1792211) [2676 bp, 891 aa] {ON} similar
           to uniprot|P38359 Saccharomyces cerevisiae YBR294W SUL1
           High affinity sulfate permease sulfate uptake is
           mediated by specific sulfate transporters Sul1p and
           Sul2p which control the concentration of endogenous
           activated sulfate intermediates and uniprot|Q12325
           Saccharomyces cerevisiae YLR092W SUL2
          Length = 891

 Score =  964 bits (2493), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 497/871 (57%), Positives = 607/871 (69%), Gaps = 35/871 (4%)

Query: 11  DLDDLDAEYGHFKNTE----HSEIGGGPSSNPGAA---VGVGASTKLGQDQNGDKSGATG 63
           D D L+ EY   K +E    H   G   SS+P            + +  + +G K    G
Sbjct: 30  DFDQLEQEYDDLKTSEIIAPHISNGHSISSSPRHHHLYEDRHLDSIIDTNTHGFKKHDNG 89

Query: 64  GGNGAN---EPLALYDSPEA--YYEDKVTFREYYDTTIRPSLTASNVRQYLRDLLPVINW 118
            G  A+   E +  YDS     Y E  V  ++ YD  +RP LT S + +YL  L P++ W
Sbjct: 90  NGKFADVNIEQIYNYDSLRVPNYEETVVDAKQLYDEKLRPYLTFSAIVEYLTSLFPLLKW 149

Query: 119 LPHYNGRWFYQDMVAGITVGCVLVPQSMSYAVIATLPPQFGLYSSFVGAMIYSFFATSKD 178
           + HYN  W Y D+VAGITVGCVLVPQSMSYA IATLP Q+GLYSSFVGA IYSFFATSKD
Sbjct: 150 VHHYNFNWLYNDLVAGITVGCVLVPQSMSYAQIATLPAQYGLYSSFVGAFIYSFFATSKD 209

Query: 179 VCIGPVAVMSLQTAKAVSKVMAELPADT-DITAPVVATALAFLCGLISXXXXXXXXXXXX 237
           VCIGPVAVMSL+TAK +++V+ ++  D  +ITAP++AT L+ +CG ++            
Sbjct: 210 VCIGPVAVMSLETAKVIARVLEKVGEDNPEITAPIIATTLSLICGGVALGVGLLRLGFLV 269

Query: 238 XXISSTAVAGFMTGSALNIISGQLPALMGYNKLVNTRTSTYKVIIETLKHLPDTKLDAVF 297
             IS  AVAGFMTGSA+NI+SGQ+P LMGY+K VNTR STYKVII TLKHLPDTKLDAVF
Sbjct: 270 EFISLNAVAGFMTGSAINIMSGQVPGLMGYSKNVNTRDSTYKVIINTLKHLPDTKLDAVF 329

Query: 298 GLIPLVMLYTWKWLCNSGGPRLVERYTVRGS-RKQRIWSATLFYTQALRNAVIIIVFTAI 356
           GLIPL +LY+WK+ C + GP+LV+RY  R   ++   +   LFY QALRNA +II+FT I
Sbjct: 330 GLIPLFILYSWKYFCGTLGPKLVDRYVARSDVKRAAAYKYILFYLQALRNAFVIIIFTLI 389

Query: 357 AWSISHHKKKA--PISLLGPVPSGLKDVGVMKLPDGLAAKIAPELPASVIVLLLEHIAIA 414
           +W I+ HK K   PISLLG VPSGLK+VGVMKLPDGL + +A ELP+++I+L+LEHIAI+
Sbjct: 390 SWGITRHKAKEDLPISLLGTVPSGLKNVGVMKLPDGLVSNLASELPSAIIILVLEHIAIS 449

Query: 415 KAFGRVNDYRVVPDQELIAIGATNLLGTFFNAYPATGSFSRSALKAKCNVSTPLSGVFSG 474
           KAFGRVN Y+VVPDQELIAIG TNL+ TFFNAYPATGSFSRSALKAKCNV TPLSG+F+G
Sbjct: 450 KAFGRVNGYKVVPDQELIAIGVTNLISTFFNAYPATGSFSRSALKAKCNVKTPLSGIFTG 509

Query: 475 ACVLLAIYCLTSAFQYIPKATLSAVIIHAVSDLIASYKTTWSIWRLNPLDLVCFLATVFI 534
           ACVLL++YCLT AF +IPKA LSA+IIHAVSDL+ASYKTTW+ W +NPLD VCF+ TV I
Sbjct: 510 ACVLLSLYCLTDAFYFIPKAALSAIIIHAVSDLVASYKTTWNFWLMNPLDFVCFIVTVII 569

Query: 535 AVFSSIENGIYFAMCWSVAVLLFKVAFPRAQFLGRVEIAELATNEGVSAGSEFAPLSKDF 594
            +FSSIENGIYFA+CWS A+LL KV FP  QFLG VEI +++  E V    +   LS+D 
Sbjct: 570 TIFSSIENGIYFAVCWSCALLLLKVVFPTGQFLGYVEICQVSNAE-VDENIDRIVLSEDS 628

Query: 595 EXXXXXXXXXXXXXXXXFNAKKQGIEGGSQFVGGASNAAGAGFHTKWVPF-EPYTRELNX 653
           +                  A K G+     F  G S      +HTKW+P    Y RELN 
Sbjct: 629 QPKTIEDNVTKNN-----TAVKVGVVANESF--GHSQLQ---YHTKWLPLNNHYQRELNP 678

Query: 654 XXXXXXXXXGVIVFRPSESWTYVNCARQYNAIFDEVVRTTRRGK-VQVTSKSGRPWNDPG 712
                    GVIV+RPSESWTYVNC+RQY+ IFD V   TR GK ++  SK  + WNDPG
Sbjct: 679 DVVVQAPPPGVIVYRPSESWTYVNCSRQYDTIFDRVKELTRPGKLLKHVSKHDKMWNDPG 738

Query: 713 EWHPPKFLRKWFGKKYSESLEQGVVSDDRPVLRVIAMDWSQVAQVDSTGLQTLHDLRKAV 772
           EW PP  ++K F       LE G V D+RPVL+++AMDWSQV Q+DSTG+Q L DLRKA+
Sbjct: 739 EWEPPFLVKKLFKLGNKHDLEGGEVIDERPVLKILAMDWSQVTQIDSTGVQNLVDLRKAI 798

Query: 773 SKYADRQVEFHFSGIISPWIKRGLLNTGFGTVNEEHADESLLVGHKTYQVARGGAT-GDE 831
           +KYA+RQVEFHFSGIISPWIKR L+N GFGTVNEE +DES++VGH +Y + +      D 
Sbjct: 799 NKYANRQVEFHFSGIISPWIKRSLINAGFGTVNEEFSDESIIVGHTSYSLVKNRPDLQDP 858

Query: 832 EALLPQP-----ATGVNMPFFHAEMPDFSKW 857
           EA LP+P     A GVN+PFFH EMP+F KW
Sbjct: 859 EAALPEPIALHTALGVNLPFFHLEMPEFHKW 889

>Suva_10.176 Chr10 (328373..331054) [2682 bp, 893 aa] {ON} YLR092W
           (REAL)
          Length = 893

 Score =  961 bits (2484), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 496/885 (56%), Positives = 618/885 (69%), Gaps = 43/885 (4%)

Query: 5   ERQTSLDLDDLDAEYGHFKNTEHSEIGGGPSSNPGAAVGVGASTKLGQDQNGDKSGATGG 64
           +  T  DLDDL+ EY  +KN E++    G  ++         +     +  G K      
Sbjct: 20  DSTTVPDLDDLELEYDQYKNNENN----GAFNDNDLESNSLTNHNTASEAKGVKGSKVEY 75

Query: 65  GNGANEPLALYD-SPEAYYEDKVTFREYYDTTIRPSLTASNVRQYLRDLLPVINWLPHYN 123
            N ++  ++LYD S   + E  V+F+EYYD +IR  LT      YL+ + P+I WLPHYN
Sbjct: 76  FNTSD--ISLYDNSVSQFDEPTVSFKEYYDHSIRSHLTLKAAGNYLKSVFPIIYWLPHYN 133

Query: 124 GRWFYQDMVAGITVGCVLVPQSMSYAVIATLPPQFGLYSSFVGAMIYSFFATSKDVCIGP 183
             WF  D++AGIT+GCVLVPQSMSYA +ATLP Q+GLYSSF+GA  YSFFATSKDVCIGP
Sbjct: 134 VNWFIADLIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYAYSFFATSKDVCIGP 193

Query: 184 VAVMSLQTAKAVSKVMAELP-ADTDITAPVVATALAFLCGLISXXXXXXXXXXXXXXISS 242
           VAVMSLQTAK ++ V A  P  DT IT P++AT LA LCG+IS              IS 
Sbjct: 194 VAVMSLQTAKVIADVTARYPDGDTTITGPIIATTLALLCGIISAAVGFLRLGFLVELISL 253

Query: 243 TAVAGFMTGSALNIISGQLPALMGYNKLVNTRTSTYKVIIETLKHLPDTKLDAVFGLIPL 302
            AVAGFMTGSA NI+ GQ+PALMGYNKLVNTR +TYK++I++LKHLPDT LDA FGLIPL
Sbjct: 254 NAVAGFMTGSAFNILWGQVPALMGYNKLVNTRVATYKIVIDSLKHLPDTTLDAAFGLIPL 313

Query: 303 VMLYTWKWLCNSGGPRLVERYTVRGSRKQRIWSATLFYTQALRNAVIIIVFTAIAWSISH 362
            +LYTWKW C + GPRL +R+  +  R  +I   T FY QA RN +IIIVFT IAW+I+ 
Sbjct: 314 FILYTWKWWCGTYGPRLNDRFNSKKPRLHKIVKWTCFYAQASRNGIIIIVFTCIAWAITR 373

Query: 363 HKKKA--PISLLGPVPSGLKDVGVMKLPDGLAAKIAPELPASVIVLLLEHIAIAKAFGRV 420
            K  A  PIS+LG VPSGLK+VGV  +P GL +K+ P LPAS+IVLLLEHIAI+K+FGRV
Sbjct: 374 GKSSADRPISILGSVPSGLKEVGVFHVPPGLMSKLGPNLPASIIVLLLEHIAISKSFGRV 433

Query: 421 NDYRVVPDQELIAIGATNLLGTFFNAYPATGSFSRSALKAKCNVSTPLSGVFSGACVLLA 480
           NDY+VVPDQELIAIG +NLLGTFFNAYPATGSFSRSALKAKCNV TPLSG+FSG+CVLLA
Sbjct: 434 NDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLA 493

Query: 481 IYCLTSAFQYIPKATLSAVIIHAVSDLIASYKTTWSIWRLNPLDLVCFLATVFIAVFSSI 540
           +YCLT AF YIPKATLSAVIIHAVSDL+ASY+TTW+ W++NPLD +CF+ TV I VFSSI
Sbjct: 494 LYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFIVTVLITVFSSI 553

Query: 541 ENGIYFAMCWSVAVLLFKVAFPRAQFLGRVEIAEL------ATNEGVSAGSE----FAPL 590
           ENGIYFAMCWS A+ + KVAFP  +FLGRVEIAE+      A ++ VS  SE     + L
Sbjct: 554 ENGIYFAMCWSCAIFILKVAFPAGKFLGRVEIAEVTDAYVRADSDSVSFTSENNNRISTL 613

Query: 591 SKDFEXXXXXXXXXXXXXXXXFNAKKQ--GIEGGSQFVGGASNAAGAGFHTKWVPFE-PY 647
            +D                     K Q  G E  S  +G         +HTKW+PF+  Y
Sbjct: 614 EEDGVGEKEGPTNYIINSFKKLETKVQTKGFESPSASIGQPR----IKYHTKWLPFDHKY 669

Query: 648 TRELNXXXXXXXXXXGVIVFRPSESWTYVNCARQYNAIFDEVVRTTRRGK-VQVTSKSGR 706
           T+ELN          GV+V+R SES+TY+NC+R YN I DE+ + TRRG+ ++   KS R
Sbjct: 670 TKELNPDVNILPPPEGVLVYRLSESYTYINCSRHYNVITDEIKKVTRRGQLIRHRKKSDR 729

Query: 707 PWNDPGEWHPPKFLR--KWFGKKYS--ESLEQGV------VSDDRPVLRVIAMDWSQVAQ 756
           PWNDPG W PP F +  K++ KK +  ES E  V      V DDRP+L+++ +D+SQVAQ
Sbjct: 730 PWNDPGPWEPPTFFKNLKFWKKKETDIESSENAVNNPTDAVRDDRPLLKILCLDFSQVAQ 789

Query: 757 VDSTGLQTLHDLRKAVSKYADRQVEFHFSGIISPWIKRGLLNTGFGTVNEEHADESLLVG 816
            D+T LQ+L DLRKA+++YADRQVEFHF GIISPW+KRGL++ GFGT+NEE++DES++ G
Sbjct: 790 TDATALQSLVDLRKAINQYADRQVEFHFVGIISPWVKRGLISRGFGTLNEEYSDESIVAG 849

Query: 817 HKTYQVAR---GGATGDEEALLPQPATGVNMPFFHAEMPDFSKWD 858
           H +Y VAR      T D+ ++    A+G N+PFFH ++PDF+KWD
Sbjct: 850 HTSYHVARVPQNEETPDKYSVY--TASGTNLPFFHIDIPDFAKWD 892

>Smik_12.151 Chr12 (303440..306121) [2682 bp, 893 aa] {ON} YLR092W
           (REAL)
          Length = 893

 Score =  961 bits (2483), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 492/879 (55%), Positives = 616/879 (70%), Gaps = 43/879 (4%)

Query: 11  DLDDLDAEYGHFKNTEHSEIGGGPSSNPGAAVGVGASTKLGQDQNGDKSGATGGGNGANE 70
           DLDDL+ EY  +KN E+++       N   +  V     +G   NG   GA G       
Sbjct: 26  DLDDLELEYDQYKNNENND---AFKDNDLESNSVAKPNAVG---NG--KGAKGSKIEYFN 77

Query: 71  P--LALYDSPEAYYEDK-VTFREYYDTTIRPSLTASNVRQYLRDLLPVINWLPHYNGRWF 127
           P  ++LYD+  + +E+  V+ +EYYD +IR  LT    R YL+ + P+INWLPHYN  WF
Sbjct: 78  PSDVSLYDNSVSQFEESTVSLKEYYDHSIRSHLTLKGARDYLKSVFPIINWLPHYNFNWF 137

Query: 128 YQDMVAGITVGCVLVPQSMSYAVIATLPPQFGLYSSFVGAMIYSFFATSKDVCIGPVAVM 187
             D++AGIT+GCVLVPQSMSYA +ATLP Q+GLYSSF+GA  YSFFATSKDVCIGPVAVM
Sbjct: 138 TADLIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYSYSFFATSKDVCIGPVAVM 197

Query: 188 SLQTAKAVSKVMAELP-ADTDITAPVVATALAFLCGLISXXXXXXXXXXXXXXISSTAVA 246
           SLQTAK ++ V A+ P  D  IT PV+AT LA LCG+IS              IS  AVA
Sbjct: 198 SLQTAKVIADVTAKYPDGDPAITGPVIATTLALLCGIISAAIGFLRLGFLVELISLNAVA 257

Query: 247 GFMTGSALNIISGQLPALMGYNKLVNTRTSTYKVIIETLKHLPDTKLDAVFGLIPLVMLY 306
           GFMTGSA NI+ GQ+PALMGYN LVNTR +TYKV+IETLKHLPDTKLDAVFGLIPL +LY
Sbjct: 258 GFMTGSAFNILWGQVPALMGYNSLVNTRAATYKVVIETLKHLPDTKLDAVFGLIPLFLLY 317

Query: 307 TWKWLCNSGGPRLVERYTVRGSRKQRIWSATLFYTQALRNAVIIIVFTAIAWSISHHKKK 366
            WKW C + GP L +RY  +  R  +I   T FY QA RN VII+VFT I W+I+  K K
Sbjct: 318 VWKWWCGTYGPILNDRYNSKNPRLHKILKWTYFYAQASRNGVIIVVFTCIGWAITRGKSK 377

Query: 367 A--PISLLGPVPSGLKDVGVMKLPDGLAAKIAPELPASVIVLLLEHIAIAKAFGRVNDYR 424
           +  PIS+LG VPSGLK+VGV  +P GL +K+ P LPAS+IVLLLEHIAI+K+FGR+NDY+
Sbjct: 378 SERPISILGSVPSGLKEVGVFHVPSGLMSKLGPNLPASIIVLLLEHIAISKSFGRINDYK 437

Query: 425 VVPDQELIAIGATNLLGTFFNAYPATGSFSRSALKAKCNVSTPLSGVFSGACVLLAIYCL 484
           VVPDQELIAIG +NLLGTFFNAYPATGSFSRSALKAKCNV TPLSG+FSG+CVLLA+YCL
Sbjct: 438 VVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCL 497

Query: 485 TSAFQYIPKATLSAVIIHAVSDLIASYKTTWSIWRLNPLDLVCFLATVFIAVFSSIENGI 544
           T AF YIPKATLSAVIIHAVSDL+ASY+TTW+ W++NPLD +CF+ TV I VF+SIE+GI
Sbjct: 498 TGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFIVTVLITVFASIEDGI 557

Query: 545 YFAMCWSVAVLLFKVAFPRAQFLGRVEIAEL------ATNEGVSAGSE------FAPLSK 592
           YFAMCWS A+LL K+AFP  +FLGRVEIAE+      A ++ VS  SE       +    
Sbjct: 558 YFAMCWSCAMLLLKMAFPAGKFLGRVEIAEVTDAYIKANSDAVSYTSENNNGIRTSEEGD 617

Query: 593 DFEXXXXXXXXXXXXXXXXFNAKKQGIEGGSQFVGGASNAAGAGFHTKWVPFE-PYTREL 651
           ++E                 N + +  +  S  +          +HTKWVPF+  YTREL
Sbjct: 618 EYEKDSSTKYITNSSKKIETNVQTKSFDSPSSLI----TQPRMKYHTKWVPFDHKYTREL 673

Query: 652 NXXXXXXXXXXGVIVFRPSESWTYVNCARQYNAIFDEVVRTTRRGK-VQVTSKSGRPWND 710
           N          GV+V+R SES+TY+NC+R YN I ++V   TRRG+ ++   KS RPWND
Sbjct: 674 NPDIQILPPPEGVLVYRLSESYTYLNCSRHYNIITEKVKEVTRRGQLIRHRKKSDRPWND 733

Query: 711 PGEWHPPKFLR--KWFGKKYSES--LEQ------GVVSDDRPVLRVIAMDWSQVAQVDST 760
           PG W  P FL+  K++ K+ S+S  LE       G   DDRP+L+++ +D+SQVAQ D+T
Sbjct: 734 PGPWEAPAFLKNLKFWKKRESDSEFLENAPDNSIGTERDDRPLLKILCLDFSQVAQTDAT 793

Query: 761 GLQTLHDLRKAVSKYADRQVEFHFSGIISPWIKRGLLNTGFGTVNEEHADESLLVGHKTY 820
            LQ+L DLRK +++YADRQVEFHF GIISPW+KRGL++ GFGT+NEE++DES++ GH +Y
Sbjct: 794 ALQSLVDLRKVINQYADRQVEFHFVGIISPWVKRGLVSRGFGTLNEEYSDESIVAGHTSY 853

Query: 821 QVAR-GGATGDEEALLPQPATGVNMPFFHAEMPDFSKWD 858
            VAR   +  + +      A+G N+PFFH ++PDF+KWD
Sbjct: 854 HVARVPQSKENSDKYSVYTASGTNLPFFHIDIPDFAKWD 892

>YLR092W Chr12 (323544..326225) [2682 bp, 893 aa] {ON}  SUL2High
           affinity sulfate permease; sulfate uptake is mediated by
           specific sulfate transporters Sul1p and Sul2p, which
           control the concentration of endogenous activated
           sulfate intermediates
          Length = 893

 Score =  957 bits (2474), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 492/884 (55%), Positives = 618/884 (69%), Gaps = 53/884 (5%)

Query: 11  DLDDLDAEYGHFKNTEHSEIGGGP--SSNPGAAVGVGASTKLGQDQNGDKSGATGGGNGA 68
           DLDDL+ EY  +KN E+++        SN  A      S+K      G K       N +
Sbjct: 26  DLDDLELEYDQYKNNENNDTFNDKDLESNSVAKHNAVNSSK------GVKGSKIDYFNPS 79

Query: 69  NEPLALYDSPEAYYEDK-VTFREYYDTTIRPSLTASNVRQYLRDLLPVINWLPHYNGRWF 127
           +  ++LYD+  + +E+  V+ +EYYD +IR  LT      YL+ + P+INWLPHYN  WF
Sbjct: 80  D--VSLYDNSVSQFEETTVSLKEYYDHSIRSHLTVKGACSYLKSVFPIINWLPHYNFSWF 137

Query: 128 YQDMVAGITVGCVLVPQSMSYAVIATLPPQFGLYSSFVGAMIYSFFATSKDVCIGPVAVM 187
             D++AGIT+GCVLVPQSMSYA +ATLP Q+GLYSSF+GA  YSFFATSKDVCIGPVAVM
Sbjct: 138 TADLIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYSYSFFATSKDVCIGPVAVM 197

Query: 188 SLQTAKAVSKVMAELP-ADTDITAPVVATALAFLCGLISXXXXXXXXXXXXXXISSTAVA 246
           SLQTAK ++ V A+ P  D+ IT PV+AT LA LCG+IS              IS  AVA
Sbjct: 198 SLQTAKVIADVTAKYPDGDSAITGPVIATTLALLCGIISAAVGFLRLGFLVELISLNAVA 257

Query: 247 GFMTGSALNIISGQLPALMGYNKLVNTRTSTYKVIIETLKHLPDTKLDAVFGLIPLVMLY 306
           GFMTGSA NI+ GQ+PALMGYN LVNTR +TYKV+IETLKHLPDTKLDAVFGLIPL +LY
Sbjct: 258 GFMTGSAFNILWGQVPALMGYNSLVNTRAATYKVVIETLKHLPDTKLDAVFGLIPLFLLY 317

Query: 307 TWKWLCNSGGPRLVERYTVRGSRKQRIWSATLFYTQALRNAVIIIVFTAIAWSISHHKKK 366
            WKW C + GPRL +RY  +  R  +I   T FY QA RN +IIIVFT I W+I+  K K
Sbjct: 318 VWKWWCGTYGPRLNDRYNSKNPRLHKIIKWTYFYAQASRNGIIIIVFTCIGWAITRGKSK 377

Query: 367 A--PISLLGPVPSGLKDVGVMKLPDGLAAKIAPELPASVIVLLLEHIAIAKAFGRVNDYR 424
           +  PIS+LG VPSGLK+VGV  +P GL +K+ P LPAS+IVLLLEHIAI+K+FGR+NDY+
Sbjct: 378 SERPISILGSVPSGLKEVGVFHVPPGLMSKLGPNLPASIIVLLLEHIAISKSFGRINDYK 437

Query: 425 VVPDQELIAIGATNLLGTFFNAYPATGSFSRSALKAKCNVSTPLSGVFSGACVLLAIYCL 484
           VVPDQELIAIG +NLLGTFFNAYPATGSFSRSALKAKCNV TPLSG+FSG+CVLLA+YCL
Sbjct: 438 VVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCL 497

Query: 485 TSAFQYIPKATLSAVIIHAVSDLIASYKTTWSIWRLNPLDLVCFLATVFIAVFSSIENGI 544
           T AF YIPKATLSAVIIHAVSDL+ASY+TTW+ W++NPLD +CF+ TV I VF+SIE+GI
Sbjct: 498 TGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFIVTVLITVFASIEDGI 557

Query: 545 YFAMCWSVAVLLFKVAFPRAQFLGRVEIAELA----------------TNEGVSAGSEFA 588
           YFAMCWS A+L+ KVAFP  +FLGRVE+AE+                  N G+S   +  
Sbjct: 558 YFAMCWSCAMLILKVAFPAGKFLGRVEVAEVTDAYVRPDSDVVSYVSENNNGISTLEDGG 617

Query: 589 PLSKDFEXXXXXXXXXXXXXXXXFNAKKQGIEGGSQFVGGASNAAGAGFHTKWVPFE-PY 647
              K+                   N + +G +  S  +    +     +HTKW+PF+  Y
Sbjct: 618 EDDKE----SSTKYVTNSSKKIETNVQTKGFDSPSSSI----SQPRIKYHTKWIPFDHKY 669

Query: 648 TRELNXXXXXXXXXXGVIVFRPSESWTYVNCARQYNAIFDEVVRTTRRGK-VQVTSKSGR 706
           TRELN          GV+V+R SES+TY+NC+R YN I +EV + TRRG+ ++   KS R
Sbjct: 670 TRELNPDVQILPPPDGVLVYRLSESYTYLNCSRHYNIITEEVKKVTRRGQLIRHRKKSDR 729

Query: 707 PWNDPGEWHPPKFLR--KWFGKKYS--ESLEQG------VVSDDRPVLRVIAMDWSQVAQ 756
           PWNDPG W  P FL+  K++ K+ +  ES+E        V  DDRP+L+++ +D+SQVAQ
Sbjct: 730 PWNDPGPWEAPAFLKNLKFWKKRENDPESMENAPSTSVDVERDDRPLLKILCLDFSQVAQ 789

Query: 757 VDSTGLQTLHDLRKAVSKYADRQVEFHFSGIISPWIKRGLLNTGFGTVNEEHADESLLVG 816
            D+T LQ+L DLRKA+++YADRQVEFHF GIISPW+KRGL++ GFGT+NEE++DES++ G
Sbjct: 790 TDATALQSLVDLRKAINQYADRQVEFHFVGIISPWVKRGLISRGFGTLNEEYSDESIVAG 849

Query: 817 HKTYQVARGGATGDE--EALLPQPATGVNMPFFHAEMPDFSKWD 858
           H +Y VAR    G+E  E      A+G N+PFFH ++PDF+KWD
Sbjct: 850 HTSYHVAR-VPQGEENPEKYSVYTASGTNLPFFHIDIPDFAKWD 892

>NCAS0B05050 Chr2 (937285..940056) [2772 bp, 923 aa] {ON} Anc_8.271
          Length = 923

 Score =  944 bits (2440), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 483/894 (54%), Positives = 614/894 (68%), Gaps = 48/894 (5%)

Query: 7   QTSLDLDDLDAEYGHFKNTEHSEIGGGPSSNPGAAVGVGASTKLGQDQNGDKSGATGGGN 66
            ++ +LDDL+ EY  +K +E +      ++N           +L   QN D   +    N
Sbjct: 37  NSTQNLDDLELEYDQYKVSETNNNDDVINNNNNNNNNNNNIPELETQQNLDVQFSNTTNN 96

Query: 67  GANE--------PLALYDSPEAYYEDKVTFREYYDTTIRPSLTASNVRQYLRDLLPVINW 118
             N+        P+ + +    Y E  V+ ++YYD +IR ++T   VR Y   + P+  W
Sbjct: 97  KENQYRIVSTVNPVIIPN----YDEKTVSIKDYYDHSIRENVTLVGVRDYFLSIFPITRW 152

Query: 119 LPHYNGRWFYQDMVAGITVGCVLVPQSMSYAVIATLPPQFGLYSSFVGAMIYSFFATSKD 178
           LPHYN  WF  D++AGITVGCVLVPQSMSYA IATLP Q+GLYSSF+GA  YS FATSKD
Sbjct: 153 LPHYNLTWFTSDLIAGITVGCVLVPQSMSYAQIATLPAQYGLYSSFIGAFCYSLFATSKD 212

Query: 179 VCIGPVAVMSLQTAKAVSKVMAELP-ADTDITAPVVATALAFLCGLISXXXXXXXXXXXX 237
           VCIGPVAVMSL+TAK V+KV+A+ P  D  ITAP+VATAL+ LCG+++            
Sbjct: 213 VCIGPVAVMSLETAKVVTKVLAKYPDNDPTITAPIVATALSLLCGIVTAGVGVLRLGFLV 272

Query: 238 XXISSTAVAGFMTGSALNIISGQLPALMGYNKLVNTRTSTYKVIIETLKHLPDTKLDAVF 297
             IS  AV GFMTGSALNI+ GQ+P LMGYN  VNTRT+ YKVIIETLKHLPDTKLDAVF
Sbjct: 273 ELISLNAVTGFMTGSALNILWGQVPGLMGYNSKVNTRTANYKVIIETLKHLPDTKLDAVF 332

Query: 298 GLIPLVMLYTWKWLCNSGGPRLVERY--TVRGSRKQRIWSATLFYTQALRNAVIIIVFTA 355
           GLIPL +LY WKW C++ GP+LV+++    +  R    +    FY QA +NA+IIIVFTA
Sbjct: 333 GLIPLFLLYLWKWWCDNMGPKLVDKWFPKNKNERANFYFKKFYFYAQAAKNAIIIIVFTA 392

Query: 356 IAWSISHHKKKA--PISLLGPVPSGLKDVGVMKLPDGLAAKIAPELPASVIVLLLEHIAI 413
           I+WSI+  K KA  PIS+LG VP GLK+VGVMKLPDGL +K+APELPASVIVLLLEHIAI
Sbjct: 393 ISWSITRGKAKADRPISILGTVPKGLKEVGVMKLPDGLLSKLAPELPASVIVLLLEHIAI 452

Query: 414 AKAFGRVNDYRVVPDQELIAIGATNLLGTFFNAYPATGSFSRSALKAKCNVSTPLSGVFS 473
           AK+FGR+NDY+VVPDQELIAIG TNL+GTFFNAYPATGSFSRSALKAKC V TPLSG+F+
Sbjct: 453 AKSFGRINDYKVVPDQELIAIGVTNLIGTFFNAYPATGSFSRSALKAKCKVRTPLSGIFT 512

Query: 474 GACVLLAIYCLTSAFQYIPKATLSAVIIHAVSDLIASYKTTWSIWRLNPLDLVCFLATVF 533
           GACVLLA+YCLT AF YIPKATLSAVII AVSDLIASYK TW+ W++NPLD +CFL TVF
Sbjct: 513 GACVLLALYCLTGAFFYIPKATLSAVIIQAVSDLIASYKITWNFWKMNPLDCLCFLVTVF 572

Query: 534 IAVFSSIENGIYFAMCWSVAVLLFKVAFPRAQFLGRVEIAEL----ATNEGVSAGS-EFA 588
           I VFSSIENGIYFA+CWS A+LL KV FP  +FLGR+E+AE+      N   SA + E++
Sbjct: 573 ITVFSSIENGIYFAVCWSCAILLLKVCFPAGKFLGRIEVAEVIDGYVDNSIESATTAEYS 632

Query: 589 PLSKDFEXXXXXXXXXXXXXXXXFNAKKQGIEGGSQFVGGASNAAGAGFHTKWVPFE-PY 647
             S                    F    + +   +  V          ++TKWVPF+  Y
Sbjct: 633 SASSPSSDNETDTKKIQKTSSISFGKDAKAVAVSTSPVDCNPKVR---YYTKWVPFDHAY 689

Query: 648 TRELNXXXXXXXXXXGVIVFRPSESWTYVNCARQYNAIFDEVVRTTRRGK-VQVTSKSGR 706
           TRELN          GVIV+R ++S+TY+NC+R Y+ IFDEV R TRRG+ ++   K+ R
Sbjct: 690 TRELNPSVNILPPPPGVIVYRLTDSFTYINCSRHYDVIFDEVKRQTRRGQLLRHRKKADR 749

Query: 707 PWNDPGEWHPPKFLRKWFGKKYSESLEQ---------GVVSDDRPVLRVIAMDWSQVAQV 757
           PWNDPGEW  P+FL+  F +K   S ++           + D+RP+L+++ +D+SQVAQ+
Sbjct: 750 PWNDPGEWEAPQFLKNLFHRKKKNSTDEESAVDVSDNSSIRDNRPLLKIVCLDFSQVAQI 809

Query: 758 DSTGLQTLHDLRKAVSKYADRQVEFHFSGIISPWIKRGLLNTGFGTVNEEHADESLLVGH 817
           D++ +Q+L DLRK++++YADRQVEFHF+GI+SPW+KRGL+N GFGT+N+E +D S++ GH
Sbjct: 810 DASAIQSLVDLRKSINRYADRQVEFHFAGIVSPWVKRGLINRGFGTINDEFSDASIIAGH 869

Query: 818 KTYQVARG--GATGDEEALLPQ----------PATGVNMPFFHAEMPDFSKWDF 859
            +Y + R    +  D E+               ATG N+PFFH ++PDFSKWD 
Sbjct: 870 SSYHLTRTLPDSDFDLESNFRDTYSRSQYHVFAATGTNLPFFHIDIPDFSKWDL 923

>KAFR0B02750 Chr2 (562981..565485) [2505 bp, 834 aa] {ON} Anc_8.271
           YLR092W
          Length = 834

 Score =  938 bits (2425), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 474/877 (54%), Positives = 611/877 (69%), Gaps = 63/877 (7%)

Query: 1   MSNLERQTSL----DLDDLDAEYGHFKNTEHSEIGGGPSSNPGAAVGVGASTKLGQDQNG 56
           MSN +  T L    +LDDL+ E+  +K  E +                 +ST+  ++ + 
Sbjct: 1   MSN-QHDTELTDFSNLDDLEQEFNQYKKIELTI----------------SSTRQNEEVDS 43

Query: 57  DKSGATGGGNGANEPLALYDSPE-----AYYEDKVTFREYYDTTIRPSLTASNVRQYLRD 111
            + G +     ++   +++   +      Y E+ +T  +YY  ++RP  T   +  Y++ 
Sbjct: 44  KRQGKSDKNVKSSSFDSIFSLTQQQQVPTYEENSITIADYYTYSLRPYFTFKTITDYIKS 103

Query: 112 LLPVINWLPHYNGRWFYQDMVAGITVGCVLVPQSMSYAVIATLPPQFGLYSSFVGAMIYS 171
           L P+ +WLPHYN  WF  D++AGITVGCVLVPQSMSYA IATL PQFGLYSSF+GA  YS
Sbjct: 104 LFPIFHWLPHYNLTWFISDLIAGITVGCVLVPQSMSYAQIATLSPQFGLYSSFIGAFSYS 163

Query: 172 FFATSKDVCIGPVAVMSLQTAKAVSKVMAELPADTDITAPVVATALAFLCGLISXXXXXX 231
            FATSKDVCIGPVAVMSLQTAK +++V  +LP+DTDITA  +AT LA LCG+I+      
Sbjct: 164 LFATSKDVCIGPVAVMSLQTAKVIARVQDKLPSDTDITASEIATTLALLCGIIATGVGLL 223

Query: 232 XXXXXXXXISSTAVAGFMTGSALNIISGQLPALMGYNKLVNTRTSTYKVIIETLKHLPDT 291
                   IS  AVAGFMTGSALNIISGQ+P LMGYN  VNTRTSTYKVII+TLKHLPDT
Sbjct: 224 RLGFLVELISLNAVAGFMTGSALNIISGQVPGLMGYNSEVNTRTSTYKVIIDTLKHLPDT 283

Query: 292 KLDAVFGLIPLVMLYTWKWLCNSGGPRLVERYTVRGS--RKQRIWSATLFYTQALRNAVI 349
           KLDAVFGLIPL +L+ WKW+C+  GPRL ER+   G   R  RI     FY Q  +NA+I
Sbjct: 284 KLDAVFGLIPLFLLFAWKWVCDVLGPRLNERHFGNGKNPRAHRIMKNFYFYAQTTKNAII 343

Query: 350 IIVFTAIAWSISHHK--KKAPISLLGPVPSGLKDVGVMKLPDGLAAKIAPELPASVIVLL 407
           IIVFT I+W+I+  K  +  PIS+LG VP GLKDV    +P GL AK+APELPAS+IVLL
Sbjct: 344 IIVFTCISWAITRGKTSETRPISVLGSVPKGLKDVETFTVPSGLMAKLAPELPASIIVLL 403

Query: 408 LEHIAIAKAFGRVNDYRVVPDQELIAIGATNLLGTFFNAYPATGSFSRSALKAKCNVSTP 467
           LEHIAIAK+FGR+NDY++VPDQE++AIG TNLLGTFF+AYPATGSFSRSALKAKCNV TP
Sbjct: 404 LEHIAIAKSFGRINDYKIVPDQEIVAIGITNLLGTFFHAYPATGSFSRSALKAKCNVRTP 463

Query: 468 LSGVFSGACVLLAIYCLTSAFQYIPKATLSAVIIHAVSDLIASYKTTWSIWRLNPLDLVC 527
           LSG+FSGACVLLA+YCLT AF YIPKATL AVIIHAVS+LIASYK T + W++NPLD  C
Sbjct: 464 LSGLFSGACVLLALYCLTGAFFYIPKATLCAVIIHAVSNLIASYKATMNFWKMNPLDCFC 523

Query: 528 FLATVFIAVFSSIENGIYFAMCWSVAVLLFKVAFPRAQFLGRVEIAELATNEGVSAGSEF 587
           FL TV I VF+SIE+GIYFAMCWSVAVLLFKVAFP  +FLG++EI E+   + V   S  
Sbjct: 524 FLVTVIITVFASIEDGIYFAMCWSVAVLLFKVAFPPGKFLGQIEITEVLDGKLVGDSSVL 583

Query: 588 APLSKDFEXXXXXXXXXXXXXXXXFNAKKQGIEGGSQFVGGASNAAGAGFHTKWVPFE-P 646
               ++ E                        + G      +++     ++TKWVPF+  
Sbjct: 584 TSSDENSEILPTT-------------------KAGYSVEVVSNHNENTNYYTKWVPFDFS 624

Query: 647 YTRELNXXXXXXXXXXGVIVFRPSESWTYVNCARQYNAIFDEVVRTTRRGKV-QVTSKSG 705
           YT+ELN          GVIV+R ++S+TY+NC+R ++ +FDE+ R+T+RGK+ Q+  KS 
Sbjct: 625 YTKELNPDAHIKPPPPGVIVYRMADSFTYMNCSRHFDILFDEIKRSTKRGKLTQIMRKSD 684

Query: 706 RPWNDPGEWHPPKFLRKWFGKK-YSE---SLEQGVVSDDRPVLRVIAMDWSQVAQVDSTG 761
           RPWNDPG+W P  F++K+  ++ Y E    +E  V+ DDRP L++I +D+SQV+Q+D+T 
Sbjct: 685 RPWNDPGKWEPRVFIKKYLRRENYDEDNVDIEDRVI-DDRPFLKIICLDFSQVSQIDATA 743

Query: 762 LQTLHDLRKAVSKYADRQVEFHFSGIISPWIKRGLLNTGFGTVNEEHADESLLVGHKTYQ 821
           +Q L+DLRK+V+KYADRQVEFHF GIISPWIK+ L N GFGT+N E++DES+++GH +Y 
Sbjct: 744 IQCLYDLRKSVNKYADRQVEFHFVGIISPWIKKSLRNFGFGTINNEYSDESIIMGHSSYH 803

Query: 822 VARGGATGDEEALLPQPATGVNMPFFHAEMPDFSKWD 858
           +     T D + +  + ATG N+PFFH ++P+F+KWD
Sbjct: 804 L-----TKDVDGI--KAATGTNLPFFHIDIPNFNKWD 833

>NDAI0B02020 Chr2 (501062..503779) [2718 bp, 905 aa] {ON} Anc_8.271
          Length = 905

 Score =  936 bits (2418), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 482/889 (54%), Positives = 609/889 (68%), Gaps = 54/889 (6%)

Query: 8   TSLDLDDLDAEYGHFKNTE-HSEIGGGPS-SNPGAAVGVGASTKLGQDQNGDKSGATGGG 65
           +S +L DL+ EY  +K +E +++   GP        V    +   G  +N  K+      
Sbjct: 32  SSQNLADLELEYDQYKASETNNKSNHGPDLETNNLDVQFSNTYNTGDKKNSIKNHQIQIN 91

Query: 66  NGANEPLALYDSPEAYYEDKVTFREYYDTTIRPSLTASNVRQYLRDLLPVINWLPHYNGR 125
               + + +     ++ E  ++F++YY  +++ + +  +V++Y   + P+I WLPHYN  
Sbjct: 92  TFNADSVII----PSFEEHAISFKDYYRHSLKENFSLKSVKEYALSIFPIIRWLPHYNLA 147

Query: 126 WFYQDMVAGITVGCVLVPQSMSYAVIATLPPQFGLYSSFVGAMIYSFFATSKDVCIGPVA 185
           WF  D++AGITVGCVLVPQSMSYA IATLPPQ+GLYSSF+GA  YS FATSKDVCIGPVA
Sbjct: 148 WFSSDLIAGITVGCVLVPQSMSYAQIATLPPQYGLYSSFIGAFTYSLFATSKDVCIGPVA 207

Query: 186 VMSLQTAKAVSKVMAELP-ADTDITAPVVATALAFLCGLISXXXXXXXXXXXXXXISSTA 244
           VMSL+T K ++KV+A+ P AD +ITAPV+AT LAFLCG+I+              IS  A
Sbjct: 208 VMSLETGKVITKVLAKYPEADPNITAPVIATVLAFLCGVITAGIGFLRLGFLVELISLNA 267

Query: 245 VAGFMTGSALNIISGQLPALMGYNKLVNTRTSTYKVIIETLKHLPDTKLDAVFGLIPLVM 304
           V GFMTGSALNI+ GQ+PALMGY   VNTRTSTYKVIIE+LKHLPDTKLDAVFGLIPL +
Sbjct: 268 VTGFMTGSALNIMWGQIPALMGYGSKVNTRTSTYKVIIESLKHLPDTKLDAVFGLIPLFI 327

Query: 305 LYTWKWLCNSGGPRLVERYTVRGSRKQRIWSATLFYTQALRNAVIIIVFTAIAWSISHHK 364
           LY WKW C + GPR+ +++     +         FY QA +NAVIIIVFTAIAWSI+  K
Sbjct: 328 LYLWKWWCGNMGPRMADKWFANNEKGNFYLKKFYFYAQAAKNAVIIIVFTAIAWSITKGK 387

Query: 365 KK--APISLLGPVPSGLKDVGVMKLPDGLAAKIAPELPASVIVLLLEHIAIAKAFGRVND 422
            K   PIS+LG VP GLK+VGVMKLPDGLA+KIAPELPASVIVLLLEHIAIAK+FGR+ND
Sbjct: 388 TKDERPISILGSVPKGLKEVGVMKLPDGLASKIAPELPASVIVLLLEHIAIAKSFGRIND 447

Query: 423 YRVVPDQELIAIGATNLLGTFFNAYPATGSFSRSALKAKCNVSTPLSGVFSGACVLLAIY 482
           Y+VVPDQELIAIG TNL+GTFFNAYPATGSFSRSALKAKC V TPLSG+F+G+CVLLA+Y
Sbjct: 448 YKVVPDQELIAIGVTNLIGTFFNAYPATGSFSRSALKAKCEVRTPLSGLFTGSCVLLALY 507

Query: 483 CLTSAFQYIPKATLSAVIIHAVSDLIASYKTTWSIWRLNPLDLVCFLATVFIAVFSSIEN 542
           CLT  F YIPKATLSAVIIHAVSDLIASY TTW+ W++NPLD   F+ TVFI VFSSIEN
Sbjct: 508 CLTGVFLYIPKATLSAVIIHAVSDLIASYHTTWNFWKMNPLDCFSFIVTVFITVFSSIEN 567

Query: 543 GIYFAMCWSVAVLLFKVAFPRAQFLGRVEIAELATNEGVSAGSEFAPLSKDFEXXXXXXX 602
           GIYFAMCWS A+L+ KVAFP  +FLGRVEIAE+              +   FE       
Sbjct: 568 GIYFAMCWSCAILVLKVAFPAGKFLGRVEIAEVVN----------GCVDDSFEVTDYSSN 617

Query: 603 XXXXXXXXXFNAKKQ--------GIEGGSQFVGGASNAAGAG---FHTKWVPFE-PYTRE 650
                     N  K+              Q     S+  G     ++TKW+PF+  YT+E
Sbjct: 618 SNLSLSADTINHNKKLKILHIPLLKTLKDQLFSDISSIQGKSKIRYYTKWLPFDHAYTKE 677

Query: 651 LNXXXXXXXXXXGVIVFRPSESWTYVNCARQYNAIFDEVVRTTRRGK-VQVTSKSGRPWN 709
           LN          GVIV+R ++S+TY+NC++ Y+ IF+E+ + T+RG+ ++   KS RPWN
Sbjct: 678 LNPNVIILPPPPGVIVYRLTDSFTYMNCSKHYDVIFEEIKKQTKRGQLIRHRKKSDRPWN 737

Query: 710 DPGEWHPPKFLRKW------FGKKYSESLEQGVVS------DDRPVLRVIAMDWSQVAQV 757
           DPGEW  P F + W        K  +++ E  +        DDRP+L+V+ +D+SQVAQV
Sbjct: 738 DPGEWEAPNFSKLWKKLSFRRNKNNNDNEETHIPDVPVSKRDDRPLLKVLCLDFSQVAQV 797

Query: 758 DSTGLQTLHDLRKAVSKYADRQVEFHFSGIISPWIKRGLLNTGFGTVNEEHADESLLVGH 817
           D+T LQ+L DLRKA++KYADRQVEFHF+GI+SPWIK+GL+N GFGT+NEE++DES++ GH
Sbjct: 798 DATALQSLVDLRKAINKYADRQVEFHFAGIVSPWIKKGLINIGFGTINEEYSDESIIAGH 857

Query: 818 KTYQVARGGATGDEEALLPQ--------PATGVNMPFFHAEMPDFSKWD 858
            +Y +AR    GD+  L            ATG N+PFFH ++PDF +WD
Sbjct: 858 TSYHLAR--IPGDDLELPTMRGGNYKVYTATGTNLPFFHIDIPDFYQWD 904

>TDEL0F03980 Chr6 (737605..740208) [2604 bp, 867 aa] {ON} Anc_8.271
           YLR092W
          Length = 867

 Score =  922 bits (2384), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 483/886 (54%), Positives = 600/886 (67%), Gaps = 63/886 (7%)

Query: 7   QTSLDLDDLDAEYGHFKNTEHSEIGGGPSSNPGAAVGVGASTKLGQDQNGDKSGATGGGN 66
            ++  LDDL+AEY  +K  E  E            V V  S    +D  G+K G      
Sbjct: 12  DSAFKLDDLEAEYDLYKANEQLE---------DNEVTVNGS----EDDYGNKKGIDLVKE 58

Query: 67  ------GANEPLALYDSPEAYYEDKVTFREYYDTTIRPSLTASNVRQYLRDLLPVINWLP 120
                 G+  P A+  +   + E  V+ ++YY+  IR  LT ++   Y+  L P++ W P
Sbjct: 59  TEVRYYGSPGPEAIGGNIPGFEESTVSVKDYYNQFIREKLTLNSAGSYVYSLFPIVKWFP 118

Query: 121 HYNGRWFYQDMVAGITVGCVLVPQSMSYAVIATLPPQFGLYSSFVGAMIYSFFATSKDVC 180
           HYN  W Y D+VAGITVGCVLVPQSMSYA IA+LPPQ+GLYSSF+GA IYS FATSKDVC
Sbjct: 119 HYNLTWGYADLVAGITVGCVLVPQSMSYAQIASLPPQYGLYSSFIGAFIYSLFATSKDVC 178

Query: 181 IGPVAVMSLQTAKAVSKVMAELPA-DTDITAPVVATALAFLCGLISXXXXXXXXXXXXXX 239
           IGPVAVMSLQTAK +++V A+ P  D  +TAPV+ATAL+ LCG+++              
Sbjct: 179 IGPVAVMSLQTAKVIAQVSAKYPENDPIVTAPVIATALSLLCGIVAIGVGLLRLGFLVEL 238

Query: 240 ISSTAVAGFMTGSALNIISGQLPALMGYNKLVNTRTSTYKVIIETLKHLPDTKLDAVFGL 299
           IS  AVAGFMTGSA NI+ GQ+PALMGY+  VNTR STYKV+I++LKHLPDTKLDAVFGL
Sbjct: 239 ISLNAVAGFMTGSAFNILWGQVPALMGYSSKVNTRASTYKVVIDSLKHLPDTKLDAVFGL 298

Query: 300 IPLVMLYTWKWLCNSGGPRLVERYTVRGSRKQRIWSATLFYTQALRNAVIIIVFTAIAWS 359
           +PL +LY WKW C + GP+L +R      +KQRI     FY+ A+RNAVIIIVFTAI+W 
Sbjct: 299 VPLCLLYLWKWWCGTYGPKLADRQLAHSPKKQRILKRFYFYSNAMRNAVIIIVFTAISWR 358

Query: 360 ISHHKKKA--PISLLGPVPSGLKDVGVMKLPDGLAAKIAPELPASVIVLLLEHIAIAKAF 417
           I+ +K K   PI +LG VPSGL+DVGV K+P+GL AK+AP++PAS+IVLLLEHIAI+K+F
Sbjct: 359 ITKNKDKEHRPIKVLGTVPSGLEDVGVAKIPEGLLAKMAPDIPASIIVLLLEHIAISKSF 418

Query: 418 GRVNDYRVVPDQELIAIGATNLLGTFFNAYPATGSFSRSALKAKCNVSTPLSGVFSGACV 477
           GR+NDY+VVPDQELIAIGATNL+GTFFNAYPATGSFSRSALKAKC V TP SGVF+G CV
Sbjct: 419 GRINDYKVVPDQELIAIGATNLIGTFFNAYPATGSFSRSALKAKCEVRTPFSGVFTGCCV 478

Query: 478 LLAIYCLTSAFQYIPKATLSAVIIHAVSDLIASYKTTWSIWRLNPLDLVCFLATVFIAVF 537
           L+AIYCLT AF +IP ATLSAVIIHAVSDL+ASYKTTW+ W++NPLD   F+ TV I VF
Sbjct: 479 LVAIYCLTDAFFFIPSATLSAVIIHAVSDLLASYKTTWNFWKMNPLDCCAFIVTVLITVF 538

Query: 538 SSIENGIYFAMCWSVAVLLFKVAFPRAQFLGRVEIAELATNEGVSAGSEFAPLSKDFEXX 597
           SSIENGIYFAMCWS A+LL K AFP  QFLGRVE+AE+  N  V    E   ++   E  
Sbjct: 539 SSIENGIYFAMCWSCAMLLLKHAFPAGQFLGRVEVAEV-INPTVVEDVEAISINDQIE-- 595

Query: 598 XXXXXXXXXXXXXXFNAKKQGIEGGSQFVGGASNAAGAGFHTKWVPFE-PYTRELNXXXX 656
                           A K  I         AS+ +   FH+KWV  +  Y RELN    
Sbjct: 596 ------GSVGKSKSLKADKGAI--------SASSGSNYKFHSKWVAEQYAYNRELNPDVK 641

Query: 657 XXXXXXGVIVFRPSESWTYVNCARQYNAIFDEVVRTTRRGK-VQVTSKSGRPWNDPGEWH 715
                 GV+V+R S+S+TY+NC+R Y+ IFD + + TRRG+ + +  KS RPWNDPGEW 
Sbjct: 642 ILPPPPGVVVYRMSDSFTYINCSRHYDTIFDHIKKHTRRGQLLHLRKKSDRPWNDPGEWE 701

Query: 716 PPKFLRKWF--GKKYS---ESLEQGV----VSDDRPVLRVIAMDWSQVAQVDSTGLQTLH 766
               ++K+F  GKK     ES ++ V      D+RP+L++I +D+SQV QVDST +Q+L 
Sbjct: 702 ISPSIKKFFKLGKKNQNDIESQDEDVAIDNTRDERPLLKIICLDFSQVVQVDSTAIQSLV 761

Query: 767 DLRKAVSKYADRQVEFHFSGIISPWIKRGLLNTGFGTVNEEHADESLLVGHKTYQVARGG 826
           DLRKAV KYADRQVEFHF+GIIS W+KR LL+ GFGTVN  ++DES++ GH +Y +A+  
Sbjct: 762 DLRKAVHKYADRQVEFHFTGIISSWVKRSLLSMGFGTVNASYSDESIIAGHSSYHIAKTT 821

Query: 827 A------TGDEEALLPQ-------PATGVNMPFFHAEMPDFSKWDF 859
                  T D               ATG NMPFFH ++PDFSKWD 
Sbjct: 822 KPLADDFTTDSSGSSQLQQSQEIYAATGTNMPFFHLDIPDFSKWDL 867

>Skud_2.424 Chr2 (758785..761376) [2592 bp, 863 aa] {ON} YBR294W
           (REAL)
          Length = 863

 Score =  916 bits (2368), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 472/894 (52%), Positives = 592/894 (66%), Gaps = 85/894 (9%)

Query: 4   LERQTSLDLDDLDAEYGHFKNTEHSEIGGGPSSNPGAAVGVGASTKLGQDQNGDKSGATG 63
           L+ Q   D++  ++EY  ++ +E +E                        QNGD      
Sbjct: 15  LDNQEDTDIEVFESEYRTYRESEAAE-------------------NRDNFQNGDDQSWKI 55

Query: 64  GGNGANEPL------ALYDSPEAYYEDKVTFREYYDTTIRPSLTASNVRQYLRDLLPVIN 117
            G    E          YDS  AY E  VT +EYYD +I+ SLT  +   YL  L P+I 
Sbjct: 56  NGKQKYEVTKSEVSDVAYDSIPAYEESTVTLKEYYDHSIKSSLTVKSAGDYLYSLFPIIK 115

Query: 118 WLPHYNGRWFYQDMVAGITVGCVLVPQSMSYAVIATLPPQFGLYSSFVGAMIYSFFATSK 177
           WLPHYN  W Y D+VAGITVGCVLVPQSMSYA IA+L P++GLYSSF+GA IYS FATSK
Sbjct: 116 WLPHYNFTWGYADLVAGITVGCVLVPQSMSYAQIASLSPEYGLYSSFIGAFIYSLFATSK 175

Query: 178 DVCIGPVAVMSLQTAKAVSKVMAELP-ADTDITAPVVATALAFLCGLISXXXXXXXXXXX 236
           DVCIGPVAVMSLQTAK +++V+ + P   T++T P++ATAL FLCG++S           
Sbjct: 176 DVCIGPVAVMSLQTAKVIAEVLKKYPEGQTEVTGPIIATALCFLCGVVSTALGVLRLGFL 235

Query: 237 XXXISSTAVAGFMTGSALNIISGQLPALMGYNKLVNTRTSTYKVIIETLKHLPDTKLDAV 296
              IS  AVAGFMTGSA +II GQ+PALMGYN LVNTR +TYKV+I TLKHLP+TKLDAV
Sbjct: 236 VELISLNAVAGFMTGSAFSIIWGQIPALMGYNSLVNTREATYKVVINTLKHLPNTKLDAV 295

Query: 297 FGLIPLVMLYTWKWLCNSGGPRLVERYTVRGSRKQRIWSATLFYTQALRNAVIIIVFTAI 356
           FGLIPLV+LY WKW C + G  L +RY     +      +  FY QA+RNAV+IIVFTAI
Sbjct: 296 FGLIPLVILYVWKWWCGTFGITLADRYYRNQPKIANRLKSFYFYAQAMRNAVVIIVFTAI 355

Query: 357 AWSISHHK--KKAPISLLGPVPSGLKDVGVMKLPDGLAAKIAPELPASVIVLLLEHIAIA 414
           +W I+ +K  K+ PIS+LG VPSGL +VGVMK+P+GL + ++ ELPAS+IVL+LEHIAI+
Sbjct: 356 SWRITRNKSSKERPISILGTVPSGLNEVGVMKIPEGLLSNMSSELPASIIVLVLEHIAIS 415

Query: 415 KAFGRVNDYRVVPDQELIAIGATNLLGTFFNAYPATGSFSRSALKAKCNVSTPLSGVFSG 474
           K+FGR+NDY+V+PDQELIAIG TNL+GTFF++YPATGSFSRSALKAKCNV TP SG+F+G
Sbjct: 416 KSFGRINDYKVIPDQELIAIGVTNLIGTFFHSYPATGSFSRSALKAKCNVRTPFSGIFTG 475

Query: 475 ACVLLAIYCLTSAFQYIPKATLSAVIIHAVSDLIASYKTTWSIWRLNPLDLVCFLATVFI 534
           ACVLLA+YCLTSAF +IPKATLSAVIIHAVSDL+ SYKTTW  W+ NPLD + F+ATVFI
Sbjct: 476 ACVLLALYCLTSAFFFIPKATLSAVIIHAVSDLLTSYKTTWIFWKTNPLDCISFIATVFI 535

Query: 535 AVFSSIENGIYFAMCWSVAVLLFKVAFPRAQFLGRVEIAEL---ATNEGVSAGSEFAPLS 591
            VFSSIENGIYFAMCWS A+LL K AFP  +FLGRVE+AE+      EG++A +    L 
Sbjct: 536 TVFSSIENGIYFAMCWSCAMLLLKQAFPAGKFLGRVEVAEVLNPTVQEGINAVTSSNELP 595

Query: 592 KDFEXXXXXXXXXXXXXXXXFNAKKQGIEGGSQFVGGASNAAGAGFHTKWVPFE-PYTRE 650
            +                                      A    F  KW+PF+  Y+RE
Sbjct: 596 NELSKQVKSTVDVLP-------------------------APEYKFSVKWIPFDHDYSRE 630

Query: 651 LNXXXXXXXXXXGVIVFRPSESWTYVNCARQYNAIFDEVVRTTRRGK-VQVTSKSGRPWN 709
           LN          GVIV+R ++S+TYVNC+R Y+ IFD +   TRRG+ + +  KS RPWN
Sbjct: 631 LNRYTKVRPPPPGVIVYRLADSFTYVNCSRHYDIIFDRIKEETRRGQLISLRKKSDRPWN 690

Query: 710 DPGEWHPPKFLRKWFGKKYSESLEQGVV----------SDDRPVLRVIAMDWSQVAQVDS 759
           DPGEW  P   +  F  K   +     +          S ++P+L+V+ +D+SQVAQVDS
Sbjct: 691 DPGEWKMPNSFKALFKFKRKSATTDNELPVSSGRNNQESYEKPLLKVVCLDFSQVAQVDS 750

Query: 760 TGLQTLHDLRKAVSKYADRQVEFHFSGIISPWIKRGLLNTGFGTVNEEHADESLLVGHKT 819
           T +Q+L DLRKAV+KYADRQVEFHF+GIISPWIKR LL+  FGT NEE++D+S++ GH +
Sbjct: 751 TAVQSLVDLRKAVNKYADRQVEFHFAGIISPWIKRSLLSVKFGTTNEEYSDDSIIAGHSS 810

Query: 820 YQVAR---------------GGATGDEEALLPQPATGVNMPFFHAEMPDFSKWD 858
           + VA+                 +  + E L    ATG N+PFFH ++PDFSKWD
Sbjct: 811 FHVAKVLKDDVDYTEEDSRISTSYSNYETLC--AATGTNLPFFHIDIPDFSKWD 862

>Suva_4.554 Chr4 (962125..964677) [2553 bp, 850 aa] {ON} YBR294W
           (REAL)
          Length = 850

 Score =  915 bits (2365), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 475/887 (53%), Positives = 600/887 (67%), Gaps = 76/887 (8%)

Query: 4   LERQTSLDLDDLDAEYGHFKNTEHSEIGGGPSSNPGAAVGVGASTKLGQDQNGDKSGATG 63
           L+ Q +L+++  D++Y  ++ +E             AA    +  +     NG++     
Sbjct: 7   LDNQENLNIEIFDSKYSSYRESE------------AAANRDDSHNEQSWKVNGNRKFEHT 54

Query: 64  GGNGANEPLALYDSPEAYYEDKVTFREYYDTTIRPSLTASNVRQYLRDLLPVINWLPHYN 123
               ++     YDS   Y E  VT +EYY  +I+ SLTA +   Y+  L P++ WLPHYN
Sbjct: 55  KTESSD---VSYDSIPRYEESTVTLKEYYGHSIKNSLTAKSAGNYVSSLFPIVKWLPHYN 111

Query: 124 GRWFYQDMVAGITVGCVLVPQSMSYAVIATLPPQFGLYSSFVGAMIYSFFATSKDVCIGP 183
             W Y D+VAGITVGCVLVPQSMSYA IA+L P++GLYSSFVGA IYS FATSKDVCIGP
Sbjct: 112 FTWCYADLVAGITVGCVLVPQSMSYAQIASLSPEYGLYSSFVGAFIYSLFATSKDVCIGP 171

Query: 184 VAVMSLQTAKAVSKVMAELPAD-TDITAPVVATALAFLCGLISXXXXXXXXXXXXXXISS 242
           VAVMSLQTAK +++V+ + P D T++T P++ATAL  LCG+++              IS 
Sbjct: 172 VAVMSLQTAKVIAEVLKKYPQDQTEVTGPIIATALCLLCGIVTTALGVLRLGFLVELISL 231

Query: 243 TAVAGFMTGSALNIISGQLPALMGYNKLVNTRTSTYKVIIETLKHLPDTKLDAVFGLIPL 302
            AVAGFMTGSA +II GQ+PALMGYNKLVNTR STYKV+I TLKHLP+TKLDAVFGLIPL
Sbjct: 232 NAVAGFMTGSAFSIIWGQVPALMGYNKLVNTRESTYKVVINTLKHLPETKLDAVFGLIPL 291

Query: 303 VMLYTWKWLCNSGGPRLVERYTVRGSRKQRIWSATLFYTQALRNAVIIIVFTAIAWSISH 362
           V+LY WKW C + G  L  R+     +      +  FY QA+RNAV+I+VFTAI+WSI+ 
Sbjct: 292 VILYVWKWWCGTYGITLANRHYQNHPKIANNLKSFYFYAQAMRNAVVIVVFTAISWSITR 351

Query: 363 HK--KKAPISLLGPVPSGLKDVGVMKLPDGLAAKIAPELPASVIVLLLEHIAIAKAFGRV 420
           +K  +  PIS+LG VPSGL +VGVMK+P+GL + ++ ELPAS+IVL+LEHIAI+K+FGR+
Sbjct: 352 NKASEDRPISILGTVPSGLNEVGVMKIPEGLLSNMSSELPASIIVLVLEHIAISKSFGRI 411

Query: 421 NDYRVVPDQELIAIGATNLLGTFFNAYPATGSFSRSALKAKCNVSTPLSGVFSGACVLLA 480
           NDY+VVPDQELIAIG TNL+GTFF++YPATGSFSRSALKAKCNV TP SG+F+G CVLLA
Sbjct: 412 NDYKVVPDQELIAIGVTNLVGTFFHSYPATGSFSRSALKAKCNVRTPFSGLFTGGCVLLA 471

Query: 481 IYCLTSAFQYIPKATLSAVIIHAVSDLIASYKTTWSIWRLNPLDLVCFLATVFIAVFSSI 540
           +YCLT AF +IPKATLSAVIIHAVSDL+ SY+TTW+ W+ NPLD V F+ TVFI VFSSI
Sbjct: 472 LYCLTDAFFFIPKATLSAVIIHAVSDLLTSYETTWTFWKTNPLDCVSFIVTVFITVFSSI 531

Query: 541 ENGIYFAMCWSVAVLLFKVAFPRAQFLGRVEIAELAT---NEGVSAGSEFAPLSKDFEXX 597
           ENGIYFAMCWS A+LL K AFP  +FLGRVE+AE+        VSA              
Sbjct: 532 ENGIYFAMCWSCAILLLKQAFPAGRFLGRVEVAEILNPTLQNNVSA-------------- 577

Query: 598 XXXXXXXXXXXXXXFNAKKQGIEGGSQFVGGASNAAGAGFHTKWVPFE-PYTRELNXXXX 656
                          N   + ++     +     ++   F TKWVPF+  Y+RELN    
Sbjct: 578 -----------VVSLNESNKQVKTTVDVL----RSSEYRFTTKWVPFDHEYSRELNRCAK 622

Query: 657 XXXXXXGVIVFRPSESWTYVNCARQYNAIFDEVVRTTRRGK-VQVTSKSGRPWNDPGEWH 715
                 GVIV+R S+S+TYVNC+R Y+ IFD V   TRRG+ V +  KS RPWNDPGEW 
Sbjct: 623 ICPPPPGVIVYRLSDSFTYVNCSRHYDIIFDHVKEETRRGQLVNLRKKSDRPWNDPGEWK 682

Query: 716 PPKFLRKWF---GKKYSESLEQGVV-------SDDRPVLRVIAMDWSQVAQVDSTGLQTL 765
            P  L+  F    K  +E+ E  V        S ++P+L+VI +D+SQVAQVDST +Q+L
Sbjct: 683 MPTSLKTLFRFKRKSVTENEEPSVSNGSTNRGSYEKPLLKVICLDFSQVAQVDSTAIQSL 742

Query: 766 HDLRKAVSKYADRQVEFHFSGIISPWIKRGLLNTGFGTVNEEHADESLLVGHKTYQVARG 825
            DLRKAV+KYADRQVEFHF+GIISPWIKR L +  FGTVNEE++DES++ GH +  V + 
Sbjct: 743 VDLRKAVNKYADRQVEFHFAGIISPWIKRSLSSVDFGTVNEEYSDESVIAGHSSVHVTKF 802

Query: 826 GATG-----DEEALLPQP---------ATGVNMPFFHAEMPDFSKWD 858
            +       DEE+ +  P         ATG N+PFFH ++PDFSKWD
Sbjct: 803 SSDDDADYTDEESHISAPYSNYGTLCAATGTNLPFFHIDIPDFSKWD 849

>CAGL0L12342g Chr12 (1333884..1336559) [2676 bp, 891 aa] {ON}
           similar to uniprot|Q12325 Saccharomyces cerevisiae
           YLR092w SEL2 sulfate transporter or uniprot|P38359
           Saccharomyces cerevisiae YBR294w SUL1
          Length = 891

 Score =  914 bits (2363), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 480/906 (52%), Positives = 609/906 (67%), Gaps = 76/906 (8%)

Query: 11  DLDDLDAEYGHFKNTEHSEIGGGPSSNPGAAVGVGASTKLGQDQNGDKSGATGGGNGANE 70
           +LD+L+ EY  FKN E        ++N GA +  G  TK   +++   +   G  +    
Sbjct: 3   ELDNLELEYNQFKNNERPS-----NTNAGADIEKGLDTKKYFERSITDNSTYGKKS---- 53

Query: 71  PLALYDSPEAYYEDKVTFREYYDTTIRPSLTASNVRQYLRDLLPVINWLPHYNGRWFYQD 130
               Y  P +Y ED +T ++YYDT +R   T ++V  Y+R L PV+NWLP YN +WF  D
Sbjct: 54  ----YSIP-SYEEDTITLKDYYDTNLRDYFTWASVVDYIRSLFPVVNWLPFYNPKWFLSD 108

Query: 131 MVAGITVGCVLVPQSMSYAVIATLPPQFGLYSSFVGAMIYSFFATSKDVCIGPVAVMSLQ 190
           ++AGITVG VLVPQSMSYA IATLPP++GLYSSF+GA++YSFFATSKDVCIGPVAVMSLQ
Sbjct: 109 LIAGITVGTVLVPQSMSYAQIATLPPEYGLYSSFIGALVYSFFATSKDVCIGPVAVMSLQ 168

Query: 191 TAKAVSKVMAELP-ADTDITAPVVATALAFLCGLISXXXXXXXXXXXXXXISSTAVAGFM 249
           TAK +++V  + P  D  IT P++AT LAF+CG+I+              IS  AVAGFM
Sbjct: 169 TAKVIARVKEKHPDLDPSITGPIIATVLAFICGIIATGVGLLRLGFLVELISLNAVAGFM 228

Query: 250 TGSALNIISGQLPALMGYNKLVNTRTSTYKVIIETLKHLPDTKLDAVFGLIPLVMLYTWK 309
           TGSA NII GQ+P LMGY+K VNTR STY V+I++LKHLPDTKLDA FGLIPL  L+ WK
Sbjct: 229 TGSAFNIIWGQIPGLMGYSKKVNTRRSTYHVVIDSLKHLPDTKLDAAFGLIPLFTLFFWK 288

Query: 310 WLCNSGGPRLVERYTVRGSRKQ--RIWSATLFYTQALRNAVIIIVFTAIAWSISH--HKK 365
           W CNS GP+L +RY    SR +  + W A  FY QA RN +III+FTA+++ I+    K 
Sbjct: 289 WWCNSMGPKLTDRYFPANSRPRANKYWKAFYFYLQASRNGIIIILFTAVSYGITKGVAKD 348

Query: 366 KAPISLLGPVPSGLKDVGVMKLPDGLAAKIAPELPASVIVLLLEHIAIAKAFGRVNDYRV 425
           K  IS+LG VP GL+  GVMKLP G+   IA E+P+S+IVLLLEHIAI+K+FGRVNDY++
Sbjct: 349 KRRISVLGTVPKGLRHTGVMKLPHGILNNIAAEIPSSIIVLLLEHIAISKSFGRVNDYKI 408

Query: 426 VPDQELIAIGATNLLGTFFNAYPATGSFSRSALKAKCNVSTPLSGVFSGACVLLAIYCLT 485
            P+QE+IAIG +NLLGTFFNAYPATGSFSRSALKAKCNV TPLSG+FS ACVLLAIYCLT
Sbjct: 409 NPNQEIIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVMTPLSGIFSAACVLLAIYCLT 468

Query: 486 SAFQYIPKATLSAVIIHAVSDLIASYKTTWSIWRLNPLDLVCFLATVFIAVFSSIENGIY 545
            AF YIPKATLSAVIIHAV DLIASY TTWS+W++N  D + F+ TVFI VFSSIENGIY
Sbjct: 469 GAFFYIPKATLSAVIIHAVFDLIASYHTTWSLWKMNVFDFIGFITTVFITVFSSIENGIY 528

Query: 546 FAMCWSVAVLLFKVAFPRAQFLGRVEIAELATNEGVSAGS-EFAPLSKDFE--------X 596
           FA+CWS A+LL+  AFP  +FLGR+EIAE+   + V      F   ++ F+         
Sbjct: 529 FAVCWSCAILLYNNAFPAGKFLGRIEIAEVVNPKIVDDDDFSFENSNESFDDEGIYFDNS 588

Query: 597 XXXXXXXXXXXXXXXFNA--KKQGIEGGSQFVGGASNAAGAGFHTKWVPFE-PYTRELNX 653
                          FNA  K + I G  + V G + ++   ++TKWVPF+  Y++ELN 
Sbjct: 589 VAEDKLGTSSNDLKKFNAGVKTRSING--ELVNGQT-SSDIRYYTKWVPFDHAYSKELNP 645

Query: 654 XXXXXXXXXGVIVFRPSESWTYVNCARQYNAIFDEVVRTTRRGK-VQVTSKSGRPWNDPG 712
                    GVIV+R S+S+TY+NC+R Y+ IFDE+ R TRRG+ +Q   K  RPWNDPG
Sbjct: 646 SVRITPPPPGVIVYRLSDSYTYINCSRHYDLIFDEIKRVTRRGQLIQHRHKWDRPWNDPG 705

Query: 713 EWHPPKFLRKWFG-KKYSESLEQGVVS------------------------DDRPVLRVI 747
           EW  P  L+K+F  KK+    ++ V                          D+RP+LRV+
Sbjct: 706 EWEAPD-LKKFFNVKKFVSVFKRKVTDVDTFENENEIEHIHDGEHYKKNDKDERPLLRVV 764

Query: 748 AMDWSQVAQVDSTGLQTLHDLRKAVSKYADRQVEFHFSGIISPWIKRGLLNTGFGTVNEE 807
            +D+SQVA  D+T LQ+L DLRKAV+KYADRQVEFHF GI SPWIKRGL N GFGT NEE
Sbjct: 765 CLDFSQVANTDATALQSLADLRKAVNKYADRQVEFHFVGIYSPWIKRGLRNLGFGTTNEE 824

Query: 808 HADESLLVGHKTYQVARGGATGDE-----EALLPQ----------PATGVNMPFFHAEMP 852
           ++DES++ GH +Y ++R   +  +     ++L  Q           A+G N+PFFH ++P
Sbjct: 825 YSDESIIAGHSSYHLSRFRESEQDGFNELDSLESQRNIGSKTKVLAASGTNLPFFHVDIP 884

Query: 853 DFSKWD 858
           DFSKWD
Sbjct: 885 DFSKWD 890

>Kpol_543.43 s543 (93697..96297) [2601 bp, 866 aa] {ON}
           (93697..96297) [2601 nt, 867 aa]
          Length = 866

 Score =  914 bits (2362), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 461/801 (57%), Positives = 571/801 (71%), Gaps = 39/801 (4%)

Query: 81  YYEDKVTFREYYDTTIRPSLTASNVRQYLRDLLPVINWLPHYNGRWFYQDMVAGITVGCV 140
           Y E+ VT +EYY+ +IR  LT  +   YL  + P+I WLP YN +W   D++AGIT+GCV
Sbjct: 81  YIEETVTLKEYYNHSIRHYLTFKSFGNYLISIFPIIKWLPFYNYKWLISDLIAGITIGCV 140

Query: 141 LVPQSMSYAVIATLPPQFGLYSSFVGAMIYSFFATSKDVCIGPVAVMSLQTAKAVSKVMA 200
           LVPQSMSYA IATLPPQ+GLYSSFVGA  YS FATSKDVCIGPVAVMSLQTAK +  V +
Sbjct: 141 LVPQSMSYAQIATLPPQYGLYSSFVGAYTYSLFATSKDVCIGPVAVMSLQTAKVIQHVNS 200

Query: 201 ELPAD--TDITAPVVATALAFLCGLISXXXXXXXXXXXXXXISSTAVAGFMTGSALNIIS 258
            L  +  T ITAP++AT LA LCG+IS              IS  AV GFMTGSALNIIS
Sbjct: 201 SLTEEQKTYITAPLIATTLALLCGIISAGVGLLRLGFLVELISLNAVTGFMTGSALNIIS 260

Query: 259 GQLPALMGYNKLVNTRTSTYKVIIETLKHLPDTKLDAVFGLIPLVMLYTWKWLCNSGGPR 318
           GQ+PALMGY   VNTR +TYKVII TLKHLPDTK+DA+FGLIPLV+LY WKW  +S GP+
Sbjct: 261 GQVPALMGYASEVNTREATYKVIINTLKHLPDTKIDAIFGLIPLVILYFWKWWFSSMGPK 320

Query: 319 LVERYTVRGSRKQRIWSATLFYTQALRNAVIIIVFTAIAWSISHHKKKA--PISLLGPVP 376
           LV+RY      K+ I  A  FY  A+R+ +IIIV T+I+WS++  K K+  PIS+LG VP
Sbjct: 321 LVDRYYPNSKYKKYI-KAFYFYGNAMRSGIIIIVMTSISWSVTRGKSKSERPISILGTVP 379

Query: 377 SGLKDVGVMKLPDGLAAKIAPELPASVIVLLLEHIAIAKAFGRVNDYRVVPDQELIAIGA 436
           SGL++VGV   P+GL AK+APELP+S+IVLLLEHIAIAK+FGRVNDY+VVPDQELIAIG 
Sbjct: 380 SGLQEVGVFTPPNGLLAKVAPELPSSIIVLLLEHIAIAKSFGRVNDYKVVPDQELIAIGI 439

Query: 437 TNLLGTFFNAYPATGSFSRSALKAKCNVSTPLSGVFSGACVLLAIYCLTSAFQYIPKATL 496
           +NL+GTFFN+YP TGSFSRSALKAKCNV TPLSG+F+G+CVLLA+YCLT AF YIPKATL
Sbjct: 440 SNLIGTFFNSYPVTGSFSRSALKAKCNVKTPLSGIFTGSCVLLALYCLTGAFFYIPKATL 499

Query: 497 SAVIIHAVSDLIASYKTTWSIWRLNPLDLVCFLATVFIAVFSSIENGIYFAMCWSVAVLL 556
           SAVIIHAVSDL+ASYKTTWS W++NPLD +CF+ TVFI VF+SIE+GIYF MCWS A+LL
Sbjct: 500 SAVIIHAVSDLVASYKTTWSFWKMNPLDFICFITTVFITVFASIEDGIYFTMCWSAAILL 559

Query: 557 FKVAFPRAQFLGRVEIAELATNEGVSAGSEFAPLSKDFEXXXXXXXXXXXXXXXXFNAKK 616
           FKVAFP  +FLG V+IAE+   E V           D +                 N +K
Sbjct: 560 FKVAFPAGKFLGYVKIAEIVNPEIV-----------DSDYLVEKAETSVQYSTVLMNPEK 608

Query: 617 QGIEGGSQFVGGASNAAGAGFHTKWVPFE-PYTRELNXXXXXXXXXXGVIVFRPSESWTY 675
               G   ++   S+ +   +H KW+P++  YT+E+N          GVIV+R +ES+TY
Sbjct: 609 ----GELSYLSSKSSESQLKYHIKWIPYDHAYTKEMNPNVEVTPPPDGVIVYRLTESFTY 664

Query: 676 VNCARQYNAIFDEVVRTTRRGKVQV-TSKSGRPWNDPGEWHPPKFL------RKWFGKKY 728
           +NC+R Y  ++D+V   TR G++     KS RPWNDPG+W PPKFL      RK   K  
Sbjct: 665 INCSRNYETLYDKVKELTRPGQLMTHIKKSDRPWNDPGDWKPPKFLKNIINWRKNKNKDD 724

Query: 729 SESLEQGVVSDDRPVLRVIAMDWSQVAQVDSTGLQTLHDLRKAVSKYADRQVEFHFSGII 788
             +     V D RP+L++I +D+SQVAQ DST LQ+L DLR+A++KYADRQVEFHFSGI+
Sbjct: 725 EPTTFDNKVVDTRPILKIICLDFSQVAQTDSTALQSLLDLRRAINKYADRQVEFHFSGIL 784

Query: 789 SPWIKRGLLNTGFGTVNEEHADESLLVGHKTYQVAR------GGATGDEE-----ALLPQ 837
           SPW+K+GL+N GFGTVN+E++DES+++GH +Y V +         T  EE     +    
Sbjct: 785 SPWVKKGLVNLGFGTVNKEYSDESIIIGHTSYHVVKTEDLENNPMTTVEEPNQNSSYYIH 844

Query: 838 PATGVNMPFFHAEMPDFSKWD 858
             TG N PFFH E+PDFSKW+
Sbjct: 845 AGTGTNFPFFHIEIPDFSKWN 865

>YBR294W Chr2 (789235..791814) [2580 bp, 859 aa] {ON}  SUL1High
           affinity sulfate permease of the SulP anion transporter
           family; sulfate uptake is mediated by specific sulfate
           transporters Sul1p and Sul2p, which control the
           concentration of endogenous activated sulfate
           intermediates
          Length = 859

 Score =  913 bits (2359), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 472/884 (53%), Positives = 602/884 (68%), Gaps = 64/884 (7%)

Query: 4   LERQTSLDLDDLDAEYGHFKNTEHSEIGGGPSSNPGAAVGVGAST-KLGQDQNGDKSGAT 62
           +  Q   D++  ++EY  ++ +E +E   G  +       V +S  K G  +N       
Sbjct: 10  VHNQEDADIEVFESEYRTYRESEAAENRDGLHNGDEENWKVNSSKQKFGVTKNELSD--- 66

Query: 63  GGGNGANEPLALYDSPEAYYEDKVTFREYYDTTIRPSLTASNVRQYLRDLLPVINWLPHY 122
                      LYDS  AY E  VT +EYYD +I+ +LTA +   YL  L P+I W PHY
Sbjct: 67  ----------VLYDSIPAYEESTVTLKEYYDHSIKNNLTAKSAGSYLVSLFPIIKWFPHY 116

Query: 123 NGRWFYQDMVAGITVGCVLVPQSMSYAVIATLPPQFGLYSSFVGAMIYSFFATSKDVCIG 182
           N  W Y D+VAGITVGCVLVPQSMSYA IA+L P++GLYSSF+GA IYS FATSKDVCIG
Sbjct: 117 NFTWGYADLVAGITVGCVLVPQSMSYAQIASLSPEYGLYSSFIGAFIYSLFATSKDVCIG 176

Query: 183 PVAVMSLQTAKAVSKVMAELPAD-TDITAPVVATALAFLCGLISXXXXXXXXXXXXXXIS 241
           PVAVMSLQTAK +++V+ + P D T++TAP++AT L  LCG+++              IS
Sbjct: 177 PVAVMSLQTAKVIAEVLKKYPEDQTEVTAPIIATTLCLLCGIVATGLGILRLGFLVELIS 236

Query: 242 STAVAGFMTGSALNIISGQLPALMGYNKLVNTRTSTYKVIIETLKHLPDTKLDAVFGLIP 301
             AVAGFMTGSA NII GQ+PALMGYN LVNTR +TYKV+I TLKHLP+TKLDAVFGLIP
Sbjct: 237 LNAVAGFMTGSAFNIIWGQIPALMGYNSLVNTREATYKVVINTLKHLPNTKLDAVFGLIP 296

Query: 302 LVMLYTWKWLCNSGGPRLVERYTVRGSRKQRIWSATLFYTQALRNAVIIIVFTAIAWSIS 361
           LV+LY WKW C + G  L +RY     +      +  FY QA+RNAV+I+VFTAI+WSI+
Sbjct: 297 LVILYVWKWWCGTFGITLADRYYRNQPKVANRLKSFYFYAQAMRNAVVIVVFTAISWSIT 356

Query: 362 HHK--KKAPISLLGPVPSGLKDVGVMKLPDGLAAKIAPELPASVIVLLLEHIAIAKAFGR 419
            +K  K  PIS+LG VPSGL +VGVMK+PDGL + ++ E+PAS+IVL+LEHIAI+K+FGR
Sbjct: 357 RNKSSKDRPISILGTVPSGLNEVGVMKIPDGLLSNMSSEIPASIIVLVLEHIAISKSFGR 416

Query: 420 VNDYRVVPDQELIAIGATNLLGTFFNAYPATGSFSRSALKAKCNVSTPLSGVFSGACVLL 479
           +NDY+VVPDQELIAIG TNL+GTFF++YPATGSFSRSALKAKCNV TP SGVF+G CVLL
Sbjct: 417 INDYKVVPDQELIAIGVTNLIGTFFHSYPATGSFSRSALKAKCNVRTPFSGVFTGGCVLL 476

Query: 480 AIYCLTSAFQYIPKATLSAVIIHAVSDLIASYKTTWSIWRLNPLDLVCFLATVFIAVFSS 539
           A+YCLT AF +IPKATLSAVIIHAVSDL+ SYKTTW+ W+ NPLD + F+ TVFI VFSS
Sbjct: 477 ALYCLTDAFFFIPKATLSAVIIHAVSDLLTSYKTTWTFWKTNPLDCISFIVTVFITVFSS 536

Query: 540 IENGIYFAMCWSVAVLLFKVAFPRAQFLGRVEIAELATNEGVSAGSEFAPLSKDFEXXXX 599
           IENGIYFAMCWS A+LL K AFP  +FLGRVE+AE+  N  V    +    S +      
Sbjct: 537 IENGIYFAMCWSCAMLLLKQAFPAGKFLGRVEVAEVL-NPTVQEDIDAVISSNELP---- 591

Query: 600 XXXXXXXXXXXXFNAKKQGIEGGSQFVGGASNAAGAGFHTKWVPFEP-YTRELNXXXXXX 658
                        N   + ++   + +     A    F  KWVPF+  Y+RELN      
Sbjct: 592 -------------NELNKQVKSTVEVLP----APEYKFSVKWVPFDHGYSRELNINTTVR 634

Query: 659 XXXXGVIVFRPSESWTYVNCARQYNAIFDEVVRTTRRGK-VQVTSKSGRPWNDPGEWHPP 717
               GVIV+R  +S+TYVNC+R Y+ IFD +   TRRG+ + +  KS RPWNDPGEW  P
Sbjct: 635 PPPPGVIVYRLGDSFTYVNCSRHYDIIFDRIKEETRRGQLITLRKKSDRPWNDPGEWKMP 694

Query: 718 KFLRKWFG-KKYSESLEQGV-VSD--------DRPVLRVIAMDWSQVAQVDSTGLQTLHD 767
             L+  F  K++S +    + +S+        ++P+L+V+ +D+SQVAQVDST +Q+L D
Sbjct: 695 DSLKSLFKFKRHSATTNSDLPISNGSSNGETYEKPLLKVVCLDFSQVAQVDSTAVQSLVD 754

Query: 768 LRKAVSKYADRQVEFHFSGIISPWIKRGLLNTGFGTVNEEHADESLLVGHKTYQVAR--- 824
           LRKAV++YADRQVEFHF+GIISPWIKR LL+  FGT NEE++D+S++ GH ++ VA+   
Sbjct: 755 LRKAVNRYADRQVEFHFAGIISPWIKRSLLSVKFGTTNEEYSDDSIIAGHSSFHVAKVLK 814

Query: 825 -GGATGDEEALLPQP---------ATGVNMPFFHAEMPDFSKWD 858
                 DE++ +            ATG N+PFFH ++PDFSKWD
Sbjct: 815 DDVDYTDEDSRISTSYSNYETLCAATGTNLPFFHIDIPDFSKWD 858

>Smik_2.435 Chr2 (775289..777880) [2592 bp, 863 aa] {ON} YLR092W
           (REAL)
          Length = 863

 Score =  909 bits (2349), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 464/815 (56%), Positives = 579/815 (71%), Gaps = 54/815 (6%)

Query: 74  LYDSPEAYYEDKVTFREYYDTTIRPSLTASNVRQYLRDLLPVINWLPHYNGRWFYQDMVA 133
            YDS  AY E+ VT ++YYD TI+ +LT  +   YL  L P+I WLPHYN  W Y D+VA
Sbjct: 72  FYDSIPAYEENTVTLKDYYDHTIKDNLTLKSAGSYLYSLFPIIKWLPHYNFTWGYADLVA 131

Query: 134 GITVGCVLVPQSMSYAVIATLPPQFGLYSSFVGAMIYSFFATSKDVCIGPVAVMSLQTAK 193
           GITVGCVLVPQSMSYA IA+L P++GLYSSF+GA IYS FATSKDVCIGPVAVMSLQTAK
Sbjct: 132 GITVGCVLVPQSMSYAQIASLSPEYGLYSSFIGAFIYSLFATSKDVCIGPVAVMSLQTAK 191

Query: 194 AVSKVMAELPAD-TDITAPVVATALAFLCGLISXXXXXXXXXXXXXXISSTAVAGFMTGS 252
            +++V+ + P D  ++T P++AT L  LCGL++              IS  AVAGFMTGS
Sbjct: 192 VIAEVLKKYPEDQVEVTGPIIATTLCLLCGLVATGLGVLRLGFLVELISLNAVAGFMTGS 251

Query: 253 ALNIISGQLPALMGYNKLVNTRTSTYKVIIETLKHLPDTKLDAVFGLIPLVMLYTWKWLC 312
           A +II GQ+PALMGYNKLVNTR +TYKV+I TLKHLP+TKLDAVFGLIPLV+LY WKW C
Sbjct: 252 AFSIIWGQIPALMGYNKLVNTREATYKVVINTLKHLPNTKLDAVFGLIPLVILYLWKWWC 311

Query: 313 NSGGPRLVERYTVRGSRKQRIWSATLFYTQALRNAVIIIVFTAIAWSISHHK--KKAPIS 370
            S G +LV+R+     +      +  FY QA+RNAV+IIVFTAI++ I+ +K  +K PIS
Sbjct: 312 GSFGIKLVDRHYSNQPKTANRIKSFYFYAQAMRNAVVIIVFTAISFRITRNKSKEKRPIS 371

Query: 371 LLGPVPSGLKDVGVMKLPDGLAAKIAPELPASVIVLLLEHIAIAKAFGRVNDYRVVPDQE 430
           +LG VPSGL +VGVMK+PDGL + ++ ELPAS+IVL+LEHIAI+K+FGR+NDY+V+PDQE
Sbjct: 372 ILGTVPSGLNEVGVMKIPDGLLSNMSSELPASIIVLVLEHIAISKSFGRINDYKVIPDQE 431

Query: 431 LIAIGATNLLGTFFNAYPATGSFSRSALKAKCNVSTPLSGVFSGACVLLAIYCLTSAFQY 490
           LIAIG TNL+GTFF++YPATGSFSRSALKAKCNV TP SGVF+GACVLLA+YCLTSAF Y
Sbjct: 432 LIAIGVTNLIGTFFHSYPATGSFSRSALKAKCNVRTPFSGVFTGACVLLALYCLTSAFFY 491

Query: 491 IPKATLSAVIIHAVSDLIASYKTTWSIWRLNPLDLVCFLATVFIAVFSSIENGIYFAMCW 550
           IPKATLSAVIIHAVSDL+ASY+TTW+ W++NPLD + F+ TV I VFSSIENGIYFAMCW
Sbjct: 492 IPKATLSAVIIHAVSDLLASYETTWNFWKMNPLDCISFIVTVLITVFSSIENGIYFAMCW 551

Query: 551 SVAVLLFKVAFPRAQFLGRVEIAEL--ATNEGVSAGSEFAPLSKDFEXXXXXXXXXXXXX 608
           S A+LL K AFP  +FLGRVE+AE+   T +G    S  +P                   
Sbjct: 552 SCAMLLLKQAFPAGKFLGRVEVAEVLNPTIQG-HIDSIVSP------------------- 591

Query: 609 XXXFNAKKQGIEGGSQFVGGASNAAGAGFHTKWVPFE-PYTRELNXXXXXXXXXXGVIVF 667
               N          +    A  ++   F  KWVPF+  YTRELN          GVIV+
Sbjct: 592 ----NESPNEFSKQVKSSVDALPSSEYKFSVKWVPFDHAYTRELNSYTRVRPPPPGVIVY 647

Query: 668 RPSESWTYVNCARQYNAIFDEVVRTTRRGK-VQVTSKSGRPWNDPGEWHPPKFLRKWFGK 726
           R S+S+TYVNC+R Y+ IFD +   TRRG+ V +  KS RPWNDPGEW  P   +  F  
Sbjct: 648 RFSDSFTYVNCSRHYDVIFDRIKEETRRGQLVSLRKKSDRPWNDPGEWKLPNSFKNIFRV 707

Query: 727 KY---SESLEQGVVSD-------DRPVLRVIAMDWSQVAQVDSTGLQTLHDLRKAVSKYA 776
           K    +++ E   V+D       ++P+L+V+ +D+SQVAQVDST +Q+L DLRKAV+KYA
Sbjct: 708 KRGLATKNSELPAVNDNTNSESYEKPLLKVVCLDFSQVAQVDSTAVQSLVDLRKAVNKYA 767

Query: 777 DRQVEFHFSGIISPWIKRGLLNTGFGTVNEEHADESLLVGHKTYQVARGGAT----GDEE 832
           DRQVEFHF+GIISPWIKR LL+  FGT+NEE +D S++ GH ++ +A+         DE+
Sbjct: 768 DRQVEFHFAGIISPWIKRSLLSVKFGTINEEFSDTSIITGHSSFHIAKVLKDEVDYTDED 827

Query: 833 ALLPQ---------PATGVNMPFFHAEMPDFSKWD 858
           + +            ATG N+PFFH ++PDFSKWD
Sbjct: 828 SPISVTCSNYDTLCAATGTNLPFFHIDIPDFSKWD 862

>ZYRO0C01452g Chr3 complement(103175..105895) [2721 bp, 906 aa] {ON}
           similar to uniprot|P38359 Saccharomyces cerevisiae
           YBR294W SUL1 High affinity sulfate permease sulfate
           uptake is mediated by specific sulfate transporters
           Sul1p and Sul2p which control the concentration of
           endogenous activated sulfate intermediates and
           uniprot|Q12325 Saccharomyces cerevisiae YLR092W SUL2
          Length = 906

 Score =  891 bits (2302), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 460/891 (51%), Positives = 592/891 (66%), Gaps = 43/891 (4%)

Query: 2   SNLERQTSLDLDDLDAEYGHFKNTEHSE--IGGGPSSNPGAAVGVGASTKLGQ-DQNGDK 58
           S +E     +LDDL+ EY  +K  E  E  +G G               + G+ D    +
Sbjct: 26  SEVELSEVSNLDDLEQEYDQYKAAEDRERVVGRGDDE-------YDDDLRKGKVDYKETE 78

Query: 59  SGATGGGNGANEPLALYDSPEAYYEDKVTFREYYDTTIRPSLTASNVRQYLRDLLPVINW 118
                  NG    LA   +  +Y E +V   + +   ++  +T   V+ Y     P+I W
Sbjct: 79  LEYWNSTNGTTNLLAPKATVPSYEEGQVGPFDIFYHDLKDRMTLGAVKHYFESAFPIIKW 138

Query: 119 LPHYNGRWFYQDMVAGITVGCVLVPQSMSYAVIATLPPQFGLYSSFVGAMIYSFFATSKD 178
           LP YN +W Y D+VAGITVGCVLVPQSMSYA IATLPPQ+GLYSSFVGA IYSFFATSKD
Sbjct: 139 LPFYNWKWGYADLVAGITVGCVLVPQSMSYAQIATLPPQYGLYSSFVGAFIYSFFATSKD 198

Query: 179 VCIGPVAVMSLQTAKAVSKVMAELPA-DTDITAPVVATALAFLCGLISXXXXXXXXXXXX 237
           VCIGPVAVMSL+TAK + + + + P  D ++T P++ATALA LCG+++            
Sbjct: 199 VCIGPVAVMSLETAKVIQETLEKFPKEDHEVTGPLIATALALLCGIVAMGAGVLRLGFLV 258

Query: 238 XXISSTAVAGFMTGSALNIISGQLPALMGYNKLVNTRTSTYKVIIETLKHLPDTKLDAVF 297
             IS  AVAGFMTGS+LNIISGQ+PALMG+ K V+TR STYK+II +LK+L  T+LDAVF
Sbjct: 259 ELISLNAVAGFMTGSSLNIISGQVPALMGFKKYVHTRDSTYKIIINSLKNLKHTQLDAVF 318

Query: 298 GLIPLVMLYTWKWLCNSGGPRLVERYTVRGSRKQRIWSATLFYTQALRNAVIIIVFTAIA 357
           GLIPLV+LYTWKW C+S GP+L +R+     +K+ I     FY QA+R+AVIIIVFTAI+
Sbjct: 319 GLIPLVLLYTWKWWCSSYGPKLADRHFKNNPKKRDILKTFYFYAQAMRSAVIIIVFTAIS 378

Query: 358 WSISHHKKKAPISLLGPVPSGLKDVGVMKLPDGLAAKIAPELPASVIVLLLEHIAIAKAF 417
           + I+  +K   IS+LG VP GLKDV VM++P+GL +K+   +P+++I+LLLEHI+IAK+F
Sbjct: 379 YGITKGRKTPRISVLGKVPKGLKDVHVMRIPEGLLSKMGSSIPSAIIILLLEHISIAKSF 438

Query: 418 GRVNDYRVVPDQELIAIGATNLLGTFFNAYPATGSFSRSALKAKCNVSTPLSGVFSGACV 477
           GRVN+Y+VVPDQELIAIGATNL+GTFFNAYPATGSFSRSALKAKCNV TPLSGVFSGACV
Sbjct: 439 GRVNNYKVVPDQELIAIGATNLIGTFFNAYPATGSFSRSALKAKCNVRTPLSGVFSGACV 498

Query: 478 LLAIYCLTSAFQYIPKATLSAVIIHAVSDLIASYKTTWSIWRLNPLDLVCFLATVFIAVF 537
           LLA+YCLT  F YIP ATLSAVIIHAVSDL ASYKT+W+ +++NP D + F+ TVFI VF
Sbjct: 499 LLALYCLTQTFYYIPSATLSAVIIHAVSDLCASYKTSWNFYKMNPGDFIAFIVTVFITVF 558

Query: 538 SSIENGIYFAMCWSVAVLLFKVAFPRAQFLGRVEIAELATNE--------GVSAGSEFAP 589
           SSI+ GIYFAMCWS A+ L K  F   +FLGRVE+AE+   +          SAGS    
Sbjct: 559 SSIDYGIYFAMCWSAAMFLLKNMFAPGRFLGRVEVAEVVNAQVDPNVESVSESAGSHLDG 618

Query: 590 LSKDFEXXXXXXXXXXXXXXXXFNAKKQGIEGGSQFVGGASNAAGAG--FHTKWVPFE-P 646
                                  +    G + GS      +N  G    +HTKW+ ++  
Sbjct: 619 FQAQSSIESSSKKLDPLDKSAVHSNYLNGGDDGSD--NNINNQIGQKLVYHTKWISYDRS 676

Query: 647 YTRELNXXXXXXXXXXGVIVFRPSESWTYVNCARQYNAIFDEVVRTTRRGK-VQVTSKSG 705
           Y+RE N          GVIV+R  +S+TY+NC+R Y+ I+DEV RTTRRG+ +    K  
Sbjct: 677 YSREFNPEVPIQPPPPGVIVYRFGDSYTYLNCSRHYDIIYDEVRRTTRRGQMISAVKKVD 736

Query: 706 RPWNDPGEWHPPKFLRKWFGKKY------------SESLEQGVVSDDRPVLRVIAMDWSQ 753
           RPWNDPGEW  P++ +K   KK             S++ EQ  + D+RP+L++I +D+SQ
Sbjct: 737 RPWNDPGEWEAPRWFKKLTSKKKTAEEWAETEAQESKAAEQK-LQDNRPLLKIICLDFSQ 795

Query: 754 VAQVDSTGLQTLHDLRKAVSKYADRQVEFHFSGIISPWIKRGLLNTGFGTVNEEHADESL 813
            +Q D+T +Q L DLRK V++YADRQVEFH  G+ +PW+KR L+N GFGTVNEE++DESL
Sbjct: 796 CSQTDATAIQNLTDLRKQVNRYADRQVEFHICGLYAPWVKRALVNFGFGTVNEEYSDESL 855

Query: 814 LVGHKTYQVARGGATGDEEALLPQ-----PATGVNMPFFHAEMPDFSKWDF 859
           L GH++Y VAR   + ++    P      PA+G N+PFFH E+PDFSKWD 
Sbjct: 856 LAGHRSYHVARAPTSLEDGLGSPAQYSVYPASGTNLPFFHVEIPDFSKWDL 906

>AGR077C Chr7 complement(874110..876656) [2547 bp, 848 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR092W
           (SUL2)
          Length = 848

 Score =  877 bits (2265), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 468/865 (54%), Positives = 579/865 (66%), Gaps = 68/865 (7%)

Query: 11  DLDDLDAEYGHFKNTE-HSEIG---GGPSSNPGAAVGVGASTKLGQDQNGDKSGATGGGN 66
           D++ L AEY   K  E HS  G   G   S   +  G  A+  LG + N  ++       
Sbjct: 30  DIEALQAEYDQLKAGEVHSAQGATHGDIGSRQYSGSGKPAAQYLGLNVNSREA------- 82

Query: 67  GANEPLALYDSPEAYYEDKVTFREYYDTTIRPSLTASNVRQYLRDLLPVINWLPHYNGRW 126
                      PE Y E  V+ ++YY+  +R  ++ +  R Y   + P+  W+ HYN  W
Sbjct: 83  ----------VPE-YEETVVSVKDYYNYKLRGFISLNTARDYALSVFPLHRWIHHYNVAW 131

Query: 127 FYQDMVAGITVGCVLVPQSMSYAVIATLPPQFGLYSSFVGAMIYSFFATSKDVCIGPVAV 186
            Y DMVAGITVGCVLVPQSMSYA +A+L PQ+GLYSSFVGA IYSFFATSKDVCIGPVAV
Sbjct: 132 MYADMVAGITVGCVLVPQSMSYAQLASLSPQYGLYSSFVGAFIYSFFATSKDVCIGPVAV 191

Query: 187 MSLQTAKAVSKVMAELPADTDITAPVVATALAFLCGLISXXXXXXXXXXXXXXISSTAVA 246
           MSL+TAK +++V   LP DT+IT P++ATAL  LCG I+              IS TAV 
Sbjct: 192 MSLETAKVIARVTENLPEDTNITGPIIATALTLLCGAIAMVIGILRLGFLVEFISITAVT 251

Query: 247 GFMTGSALNIISGQLPALMGYNKLVNTRTSTYKVIIETLKHLPDTKLDAVFGLIPLVMLY 306
           GFMTGSAL+IISGQ+P+LMGY+K VNTR +TYKVIIE+LKHL DT ++A FGL+PLV+L+
Sbjct: 252 GFMTGSALSIISGQVPSLMGYSKKVNTRATTYKVIIESLKHLKDTNMNAAFGLVPLVLLF 311

Query: 307 TWKWLCNSGGPRLVERY-TVRGSRKQRIWSATLFYTQALRNAVIIIVFTAIAWSISHHK- 364
            WKW+C S GPRLV+RY   + SR  R W+A  FY QALRNAVII+VFTAI+W IS HK 
Sbjct: 312 LWKWICGSLGPRLVDRYLQFKPSRASR-WNAAFFYLQALRNAVIIVVFTAISWGISRHKL 370

Query: 365 KKAPISLLGPVPSGLKDVGVMKLPDGLAAKIAPELPASVIVLLLEHIAIAKAFGRVNDYR 424
           +K PISLLG VPSGLK+VG ++LP+GL  K+ PELPA+ I+LLLEHIAIAK+FGR+N+Y+
Sbjct: 371 EKPPISLLGKVPSGLKNVGPLELPEGLVEKLLPELPAATIILLLEHIAIAKSFGRINNYK 430

Query: 425 VVPDQELIAIGATNLLGTFFNAYPATGSFSRSALKAKCNVSTPLSGVFSGACVLLAIYCL 484
           VVPDQELIAIG TNL  TFFNAYPATGSFSRSALKAKCNV TPLSG+F+GACVLLA+YCL
Sbjct: 431 VVPDQELIAIGVTNLFATFFNAYPATGSFSRSALKAKCNVKTPLSGLFTGACVLLALYCL 490

Query: 485 TSAFQYIPKATLSAVIIHAVSDLIASYKTTWSIWRLNPLDLVCFLATVFIAVFSSIENGI 544
           T AF +IPKATLSAVIIHAV+DLIASYK TW  WR NPLD   F+ TV I VFSSIE+GI
Sbjct: 491 TEAFYFIPKATLSAVIIHAVADLIASYKVTWMFWRTNPLDFFAFIVTVIITVFSSIEHGI 550

Query: 545 YFAMCWSVAVLLFKVAFPRAQFLGRVEIAELATNEG---VSAGSEFAPLSKDFEXXXXXX 601
           YF++ WS AVLL KVAFP  +FLG +++AE+    G   +++ ++ A +           
Sbjct: 551 YFSISWSCAVLLCKVAFPDGKFLGYIDVAEVIEPAGPPSINSEADLASIDN--------- 601

Query: 602 XXXXXXXXXXFNAKKQGIE---GGSQFVGGASNAAGAGFHTKWVPFE-PYTRELNXXXXX 657
                      +A  Q I+   G    V          FH +W+P +  Y+RELN     
Sbjct: 602 -----------SATFQQIDKDGGKLNTVESVLPDPHTRFHRRWIPLDHAYSRELNPEAVV 650

Query: 658 XXXXXGVIVFRPSESWTYVNCARQYNAIFDEVVRTTRRGK-VQVTSKSGRPWNDPGEWHP 716
                GVIV+RP++SWTY+NC+R ++ I D V   TR G+ V   S   R W DPG W P
Sbjct: 651 NPPPPGVIVYRPTDSWTYLNCSRHFDIILDHVKEHTRPGQLVNHLSNKERLWCDPGPWRP 710

Query: 717 PKFLRKWFGKKYSESLEQGVVSDDRPVLRVIAMDWSQVAQVDSTGLQTLHDLRKAVSKYA 776
           P+  R++   K + S     V+D RPVLRV+AMDWSQV+QVDSTG+Q L DLR A++KYA
Sbjct: 711 PRIFRRFIADKRTGS----AVADARPVLRVLAMDWSQVSQVDSTGIQNLVDLRNALNKYA 766

Query: 777 DRQVEFHFSGIISPWIKRGLLNTGFGTVNEEHADESLLVGHKTYQVARGGATGDEEALLP 836
           DR VEFHF+GI+SPWIKR L+NTGFG      AD  L+    +Y + R  A  D   ++ 
Sbjct: 767 DRPVEFHFAGIVSPWIKRALVNTGFGI-----ADPPLISSRVSYHLVRLPA--DPPHIVH 819

Query: 837 QP----ATGVNMPFFHAEMPDFSKW 857
                 A G N PFFH +MPDF  W
Sbjct: 820 GHSVVFALGTNTPFFHLDMPDFETW 844

>TPHA0J00800 Chr10 (186144..188897) [2754 bp, 917 aa] {ON} Anc_8.271
           YLR092W
          Length = 917

 Score =  878 bits (2268), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 459/908 (50%), Positives = 586/908 (64%), Gaps = 62/908 (6%)

Query: 1   MSNLERQTSLDLDDLDAEYGHFKNTEHSEI--GGGPSSNPGAAVGVGASTKLGQDQNGDK 58
           +S+     ++DL+ L+ EY  +K  E  E   G   +S+P   + V ++ K  ++    K
Sbjct: 21  LSSYSNSNTVDLEALEEEYDQYKKEEEIEYISGNYLNSSPTQNINVTSNPKY-EEYKKLK 79

Query: 59  SGATGGGNGANEPLALYDSPEAYYEDKVTFREYYDTTIRPSLTASNVRQYLRDLLPVINW 118
                    + E L       A+ E+ +TF+EYY+ +++   T +  + Y   + P+I+W
Sbjct: 80  HLDQSYNYVSTEYLDTDYLIPAHNENIITFKEYYNHSLKEYFTFNAAKNYALSIFPIIHW 139

Query: 119 LPHYNGRWFYQDMVAGITVGCVLVPQSMSYAVIATLPPQFGLYSSFVGAMIYSFFATSKD 178
           LP YN  WF  D++AGIT+GCVLVPQSMSYA IATL PQ+GLYSSF+GA +Y+ FATSKD
Sbjct: 140 LPFYNFNWFISDLIAGITIGCVLVPQSMSYAQIATLDPQYGLYSSFIGAFVYALFATSKD 199

Query: 179 VCIGPVAVMSLQTAKAVSKVMAELPADTDITAPVVATALAFLCGLISXXXXXXXXXXXXX 238
           VCIGPVAVMSL+TAK ++ V +    D D+T P++AT LA LCG I+             
Sbjct: 200 VCIGPVAVMSLETAKVIADVSSHFQNDPDVTGPIIATTLALLCGGIAAAVGFLRLGFLVE 259

Query: 239 XISSTAVAGFMTGSALNIISGQLPALMGYNKLVNTRTSTYKVIIETLKHLPDTKLDAVFG 298
            IS  AV GFMTGSA NI+ GQ+P LMGY+KLVNTR +TYKV+I+TLKHLPDTKLDAVFG
Sbjct: 260 LISLNAVTGFMTGSAFNILWGQVPGLMGYSKLVNTRQATYKVVIDTLKHLPDTKLDAVFG 319

Query: 299 LIPLVMLYTWKWLCNSGGPRLVERYTVRGSRKQRIWSATLFYTQALRNAVIIIVFTAIAW 358
           LIPL +LY  KW C + G +L E+      R +       FYT A+RNAV+II+FTAI+W
Sbjct: 320 LIPLFILYVVKWWCTNYGLQLAEKQFSSNERYRFYLKKFYFYTNAMRNAVVIIIFTAISW 379

Query: 359 SISHHKKKA--PISLLGPVPSGLKDVGVMKLPDGLAAKIAPELPASVIVLLLEHIAIAKA 416
           SI+ +K  +  PI++LG VPSGLKD+GV K    +  KI P+LPAS+IVLLLEHIAIAK+
Sbjct: 380 SITRNKSSSERPITVLGTVPSGLKDIGVFKPQTKIVQKIGPQLPASIIVLLLEHIAIAKS 439

Query: 417 FGRVNDYRVVPDQELIAIGATNLLGTFFNAYPATGSFSRSALKAKCNVSTPLSGVFSGAC 476
           FGR+NDY++VPDQELIAIG +NL+GTFF+AYPATGSFSRSAL AKCNV TPLSG+F+G C
Sbjct: 440 FGRINDYKIVPDQELIAIGISNLVGTFFSAYPATGSFSRSALNAKCNVKTPLSGIFTGGC 499

Query: 477 VLLAIYCLTSAFQYIPKATLSAVIIHAVSDLIASYKTTWSIWRLNPLDLVCFLATVFIAV 536
           VLLA+YCLT AF YIPKATLSAVIIHAVSDLIASY+TT S W +NPLD +CFL TV I V
Sbjct: 500 VLLALYCLTGAFFYIPKATLSAVIIHAVSDLIASYQTTLSFWNMNPLDTLCFLVTVLITV 559

Query: 537 FSSIENGIYFAMCWSVAVLLFKVAFPRAQFLGRVEIAEL--ATNEGVSAGSEFAPLSKDF 594
           FSSIENGIYFAMC+S A+ +F+ AFP  +FLGR+EIAE+  AT +       F      F
Sbjct: 560 FSSIENGIYFAMCYSCALFIFRSAFPAGKFLGRIEIAEVINATPKDDFQMDNF----NGF 615

Query: 595 EXXXXXXXXXXXXXXXXFNAKKQGIEGGSQFVGGASNAAGAGFHTKWVPFE-PYTRELNX 653
           E                  A K   +  S             F+TKWVPF+  YT+ELN 
Sbjct: 616 ETSEYNNFPADQSYGKFDIANKNTHKYNSP-------HCSKNFYTKWVPFDHTYTKELNK 668

Query: 654 XXXXXXXXXGVIVFRPSESWTYVNCARQYNAIFDEVVRTTRRGK-VQVTSKSGRPWNDPG 712
                    GVIV+R S+S+ Y+NC+R ++ IFDEV R T+RGK +    KS RPWNDPG
Sbjct: 669 DVEILEPPPGVIVYRLSDSFIYLNCSRHFDTIFDEVKRKTKRGKFIGNIKKSQRPWNDPG 728

Query: 713 EWHPPKFLRKWFG-----KKYSE----------------SLEQGVVSDDRPVLRVIAMDW 751
           EW  P ++ K F      K+  E                S  + +  D RPVL+VI +D+
Sbjct: 729 EWEAPTWMTKKFSIRNLFKRKQEAESNVPNEDASTDLDISNNKDIDMDHRPVLQVICLDF 788

Query: 752 SQVAQVDSTGLQTLHDLRKAVSKYADRQVEFHFSGIISPWIKRGLLNTGFGTVNEEHADE 811
           SQV+Q D+T LQ+L DLRK+V+ YADRQVEFHF GIISPW+KRGL+  GFGTVNE ++D 
Sbjct: 789 SQVSQTDNTALQSLFDLRKSVNSYADRQVEFHFCGIISPWVKRGLIKLGFGTVNEAYSDA 848

Query: 812 SLLVGHKTYQVARGGA---------------------TGDEEALLPQPATGVNMPFFHAE 850
           S +VGH +Y + +                          D      + A+G N PFFH +
Sbjct: 849 STIVGHVSYHIVKNPTFRNKSFSSHTSEDTISDMNIEAKDYNNYSIEAASGTNYPFFHID 908

Query: 851 MPDFSKWD 858
           +P+FSKWD
Sbjct: 909 IPNFSKWD 916

>Ecym_4299 Chr4 complement(639078..641702) [2625 bp, 874 aa] {ON}
           similar to Ashbya gossypii AGR077C
          Length = 874

 Score =  855 bits (2208), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 448/877 (51%), Positives = 578/877 (65%), Gaps = 53/877 (6%)

Query: 2   SNLERQTSLDLDDLDAEYGHFKNTEHSEIGGGPSSNPGAAV----GVGASTKLGQDQNGD 57
           +N   Q +  LD+L+ +Y  FK  E S  G   + N  + +     VG+S +        
Sbjct: 30  NNRGLQDTSGLDELETDYTRFKTNEDSA-GYSGAENERSRIDKFDSVGSSLQF------- 81

Query: 58  KSGATGGGNGANEPLALYDSPEAYYEDKVTFREYYDTTIRPSLTASNVRQYLRDLLPVIN 117
              A   GN     L  + +P  YYE  VTF EYYD TIR  +  S  R Y   L P+I 
Sbjct: 82  ---AKYDGNA----LPDFKAP-PYYETTVTFMEYYDRTIRSRVGRSFFRSYFLSLFPIIK 133

Query: 118 WLPHYNGRWFYQDMVAGITVGCVLVPQSMSYAVIATLPPQFGLYSSFVGAMIYSFFATSK 177
           W+ HYN  W Y D +AGITVGCVLVPQSMSYA +A L P++GLYSSF+GA IYSFFATSK
Sbjct: 134 WIHHYNFAWMYSDFIAGITVGCVLVPQSMSYAQLAGLKPEYGLYSSFIGAFIYSFFATSK 193

Query: 178 DVCIGPVAVMSLQTAKAVSKVMAELPADTDITAPVVATALAFLCGLISXXXXXXXXXXXX 237
           DVCIGPVAVMS+Q +K +S V+ +LP  T ITAP+VA+ALA    ++             
Sbjct: 194 DVCIGPVAVMSVQVSKVISHVIDQLPEGTPITAPMVASALALFSSILVIPIGLLRLGFIL 253

Query: 238 XXISSTAVAGFMTGSALNIISGQLPALMGYNKLVNTRTSTYKVIIETLKHLPDTKLDAVF 297
             IS TAVAGFMTGSAL+I++ QLP+L+G  K +NTR  TY+V+I TLKHL  + ++A F
Sbjct: 254 ELISVTAVAGFMTGSALSILASQLPSLLGIQK-INTRVETYRVLISTLKHLNGSDINAAF 312

Query: 298 GLIPLVMLYTWKWLCNSGGPRLVERYTVRGSRKQRIWSATLFYTQALRNAVIIIVFTAIA 357
           GLI L +L+ WKW C   GP+L+ +Y    S+K RIW +  FY QALRNA ++ + T ++
Sbjct: 313 GLICLALLFFWKWTCGYLGPKLISKYLRPNSKKARIWQSFFFYAQALRNAFVLFLATFVS 372

Query: 358 W-SISHHKKKAPISLLGPVPSGLKDVGVMKLPDGLAAKIAPELPASVIVLLLEHIAIAKA 416
           W  I  HKKK  IS+LG VPSGLK VGV  +P GL  K+ P+LP +VI+LLLEHI IAK+
Sbjct: 373 WLVIGRHKKKTSISVLGTVPSGLKHVGVPTIPSGLVHKLMPQLPPAVIILLLEHITIAKS 432

Query: 417 FGRVNDYRVVPDQELIAIGATNLLGTFFNAYPATGSFSRSALKAKCNVSTPLSGVFSGAC 476
           FGR+N+Y++VPDQELIAIG TNL+G+FFNAYPATGSFSRSALKAKCNV TPLSG+FSGAC
Sbjct: 433 FGRINNYKIVPDQELIAIGVTNLIGSFFNAYPATGSFSRSALKAKCNVKTPLSGLFSGAC 492

Query: 477 VLLAIYCLTSAFQYIPKATLSAVIIHAVSDLIASYKTTWSIWRLNPLDLVCFLATVFIAV 536
           VLLA+Y LTSAF YIPKA LSAVIIHAV DLIASYK ++ +W  NP DL+ FLAT+ + +
Sbjct: 493 VLLALYYLTSAFYYIPKAALSAVIIHAVVDLIASYKLSFYLWNTNPFDLISFLATILLTI 552

Query: 537 FSSIENGIYFAMCWSVAVLLFKVAFPRAQFLGRVEIAELAT----NEGVSAGSEFAPLSK 592
           FSSIENGIYFA+ +S+A LL K AFP  +FLG V+I E++      +  S G+    L +
Sbjct: 553 FSSIENGIYFAVAFSMATLLMKNAFPSGKFLGYVKITEVSNLNVFEDLDSIGNNDPELPQ 612

Query: 593 DFEXXXXXXXXXXXXXXXXFNAKKQGIEGGSQFVGGASNAAGAGFHTKWVPFEP-YTREL 651
           +                    AK   +   +  +    +     FHTKWVP +  Y+REL
Sbjct: 613 EISKDSKL-------------AKDPDVHASANLMASKLDVR---FHTKWVPLDNGYSREL 656

Query: 652 NXXXXXXXXXXGVIVFRPSESWTYVNCARQYNAIFDEVVRTTRRGK-VQVTSKSGRPWND 710
           N          GVIV+RP+ESW Y+NC+RQ++ I D V   TR GK V    KS + W +
Sbjct: 657 NPEIAVHMPPPGVIVYRPTESWHYLNCSRQFDIIVDRVKTLTRPGKLVNHLRKSEQLWCE 716

Query: 711 PGEWHPPKFLRKWFGKKYSESLEQGVVS--DDRPVLRVIAMDWSQVAQVDSTGLQTLHDL 768
           PG+W PP FLRK+F K   ++ +  VV   D+RPVL+++AMDW+QV  VDST +Q+L DL
Sbjct: 717 PGDWVPPLFLRKFFKKYRHKAAKPEVVEQVDNRPVLKILAMDWTQVTHVDSTSIQSLIDL 776

Query: 769 RKAVSKYADRQVEFHFSGIISPWIKRGLLNTGFGTVNEEHADESLLVGHKTYQVARGGAT 828
           RK +++YADRQV FHFSGI+SPWIKR L++ GFGT+NE ++++ LL+ + TY V +   +
Sbjct: 777 RKTINRYADRQVGFHFSGIVSPWIKRALVHAGFGTINENYSNDPLLLKYSTYHVVQNVLS 836

Query: 829 GDEE-------ALLPQPATGVNMPFFHAEMPDFSKWD 858
            DEE       +     A+G N PFFH +MPDF+KWD
Sbjct: 837 ADEENQQNSEISASLDVASGTNFPFFHIDMPDFTKWD 873

>TPHA0A01760 Chr1 complement(356771..359452) [2682 bp, 893 aa] {ON}
           Anc_8.271 YLR092W
          Length = 893

 Score =  849 bits (2194), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 437/827 (52%), Positives = 564/827 (68%), Gaps = 48/827 (5%)

Query: 81  YYEDKVTFREYYDTTIRPSLTASNVRQYLRDLLPVINWLPHYNGRWFYQDMVAGITVGCV 140
           Y E  VT +++Y   I    +   + QYL  L P++ WLPHYN  W  QD++AGITVGCV
Sbjct: 67  YNEKPVTIKDFYYEKINDYFSIGEIVQYLTSLFPLLKWLPHYNLDWLIQDLIAGITVGCV 126

Query: 141 LVPQSMSYAVIATLPPQFGLYSSFVGAMIYSFFATSKDVCIGPVAVMSLQTAKAVSKVMA 200
           LVPQSMSYA IATL PQ+GLYSSF+GA IYSFFATSKDVCIGPVAVMSLQTAK + +V +
Sbjct: 127 LVPQSMSYAQIATLAPQYGLYSSFIGAFIYSFFATSKDVCIGPVAVMSLQTAKVIERVTS 186

Query: 201 ELPAD--TDITAPVVATALAFLCGLISXXXXXXXXXXXXXXISSTAVAGFMTGSALNIIS 258
            L AD  T  TAP++ATALA LCG+IS              IS  AVAGFMTGSA NII 
Sbjct: 187 GLTADEQTIYTAPIIATALALLCGIISTGIGFLRLGFLIEFISLNAVAGFMTGSAFNIIC 246

Query: 259 GQLPALMGYNKLVNTRTSTYKVIIETLKHLPDTKLDAVFGLIPLVMLYTWKWLCNSGGPR 318
           GQ+PALMGYNK VNTR STY+V+I TLKHLPDTKLDAVFGLIPL +LY  KW  +S GP+
Sbjct: 247 GQVPALMGYNKKVNTRASTYEVVINTLKHLPDTKLDAVFGLIPLSILYLCKWFFSSLGPQ 306

Query: 319 LVERYTVRGS---RKQRI---WSATLFYTQALRNAVIIIVFTAIAWSISHHKKKA--PIS 370
            + + + R +   R+++I        FY+ A+RN V+IIVFTAI+W+I+  K     PIS
Sbjct: 307 YLNKLSNRRNLTERQRKIIKYLGNYFFYSNAMRNGVVIIVFTAISWAITRGKSSTSVPIS 366

Query: 371 LLGPVPSGLKDVGVMKLPDGLAAKIAPELPASVIVLLLEHIAIAKAFGRVNDYRVVPDQE 430
           +LG VP GLK+V V K+P GL  K+AP+LP+S+I+LLLEHIAI+K+FGRVNDY++VPDQE
Sbjct: 367 ILGTVPKGLKEVAVFKVPGGLFEKLAPDLPSSIIILLLEHIAISKSFGRVNDYKIVPDQE 426

Query: 431 LIAIGATNLLGTFFNAYPATGSFSRSALKAKCNVSTPLSGVFSGACVLLAIYCLTSAFQY 490
           LIAIG TNL+GTFF AYPATGSFSRSALKAKC+V TPLSG+FSGACVLLA+YCLT AF Y
Sbjct: 427 LIAIGVTNLIGTFFMAYPATGSFSRSALKAKCDVKTPLSGLFSGACVLLALYCLTGAFYY 486

Query: 491 IPKATLSAVIIHAVSDLIASYKTTWSIWRLNPLDLVCFLATVFIAVFSSIENGIYFAMCW 550
           IPKATLSAVIIHAVSDL+ASYKTT + +++NPLD VCF+ TVFI VFSSIE GIYFA+C+
Sbjct: 487 IPKATLSAVIIHAVSDLLASYKTTLNFYKMNPLDFVCFITTVFITVFSSIEYGIYFAICF 546

Query: 551 SVAVLLFKVAFPRAQFLGRVEIAE-----LATNEGVSAGSEFAPLSKDFEXXXXXXXXXX 605
           S A L+FK  FP   FLG ++IAE     L+TN+      + + +  +            
Sbjct: 547 SCAQLIFKNMFPVGSFLGYIKIAEVLNPTLSTNDYTILLDDSSSVLGEENTKDDSVKNRL 606

Query: 606 XXXXXXFNAKKQGIEGGSQFVGGASNAAGAGFHTKWVPFE-PYTRELNXXXXXXXXXXGV 664
                  +++K+  E  S  +   S      ++ +WVP +  Y RE+N          G+
Sbjct: 607 DQNENPKSSEKEYSEFKSYEMSSNSKTTNLSYYVRWVPMKNDYHREVNPLIKITPPPPGI 666

Query: 665 IVFRPSESWTYVNCARQYNAIFDEVVRTTRRGKVQV-TSKSGRPWNDPGEWHPPKFLRKW 723
           IV+R  +S+TY+NC+R Y+ I+DEV + TR+G   V   K  RPWND GEW  PK L+  
Sbjct: 667 IVYRFGDSFTYLNCSRHYDIIYDEVKKNTRKGISNVYKRKQDRPWNDVGEWECPKSLKNL 726

Query: 724 F----------------GKKYSESLEQGVVSDDRPVLRVIAMDWSQVAQVDSTGLQTLHD 767
           F                G +  ES  +   +D++P L++I  D+SQV Q D+T +Q+L+D
Sbjct: 727 FNKFKKKTDIGGDEDKDGNEAIESNSKANNTDNKPELKIICFDFSQVVQTDATAIQSLND 786

Query: 768 LRKAVSKYADRQVEFHFSGIISPWIKRGLLNTGFGTVNEEHADESLLVGHKTYQVARGGA 827
           LRKAV++Y+++Q+E+HFSGIIS W+K+ L+  GFGTVN+ ++D+S+++GH++Y V++   
Sbjct: 787 LRKAVNRYSNKQIEYHFSGIISAWVKKSLIEMGFGTVNDNYSDKSIIIGHQSYHVSKINN 846

Query: 828 TGD-------EEALLP--------QPATGVNMPFFHAEMPDFSKWDF 859
             D       E+ L P        Q  TG N PFFH ++PDFS W+ 
Sbjct: 847 QEDGLENQINEKYLQPDGSYIYHIQTVTGTNYPFFHIDIPDFSNWEL 893

>TBLA0F03050 Chr6 complement(738517..741210) [2694 bp, 897 aa] {ON}
           Anc_8.271 YLR092W
          Length = 897

 Score =  484 bits (1247), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 250/501 (49%), Positives = 336/501 (67%), Gaps = 20/501 (3%)

Query: 80  AYYEDKVTFREYYDTTIRPSLTASNVRQYLRDLLPVINWLPHYNGRWFYQDMVAGITVGC 139
            Y E +VT  E ++  +  + T  +++ YL  LLP+  W+ HYN +WF  D++AGITVGC
Sbjct: 2   VYREKQVTLIETFNHRVPRAFTWQSIKTYLLSLLPITKWIAHYNLQWFISDVIAGITVGC 61

Query: 140 VLVPQSMSYAVIATLPPQFGLYSSFVGAMIYSFFATSKDVCIGPVAVMSLQTAKAVSKVM 199
           VLVPQSMSYA IATL PQ+GLYSS +G  IY+ FATSKD+CIGPVA+MSLQTAKA++ V 
Sbjct: 62  VLVPQSMSYAQIATLDPQYGLYSSIMGCFIYTVFATSKDICIGPVAIMSLQTAKAIAHVH 121

Query: 200 AELPADTDITAPVVATALAFLCGLISXXXXXXXXXXXXXXISSTAVAGFMTGSALNIISG 259
            + P   DI A ++A+ +A +CG I+              I  TAV GF +GSA NI+ G
Sbjct: 122 QKHP---DIPAHIIASTIAVICGAITMGIGVLRLGFFIDLIPVTAVFGFTSGSAFNILWG 178

Query: 260 QLPALMGYNKLVNTRTSTYKVIIETLKHLPDTKLDAVFGLIPLVMLYTWKWLCNSGGPRL 319
           Q+P LMGY+K VNTR  TYKV+++TLK LP T ++AV GLIPL  L+ WK+ C+      
Sbjct: 179 QIPGLMGYSKDVNTRQDTYKVVVDTLKKLPKTNINAVMGLIPLFCLFVWKYGCD------ 232

Query: 320 VERYTVRGSRKQRIWSATLFYTQALRNAVIIIVFTAIAWSISHHKKKAPISLLGPVPSGL 379
              Y +R    +      +FY  +LR  ++II+ +A A+      K   + +LG +P G 
Sbjct: 233 ---YALRRGNLKPWPKRIVFYLLSLRVTIVIIICSAAAYG----AKNPSLKVLGKIPKGF 285

Query: 380 ---KDVGVMKLPDGLAAKIAPELPASVIVLLLEHIAIAKAFGRVNDYRVVPDQELIAIGA 436
               D  +  +P  L + I  E+PASVIVL+LEH++IAK+F RVN+YRV  DQEL AIG 
Sbjct: 286 AAASDNRLKSIPSDLVSDIWSEIPASVIVLVLEHVSIAKSFARVNNYRVSADQELTAIGV 345

Query: 437 TNLLG-TFFNAYPATGSFSRSALKAKCNVSTPLSGVFSGACVLLAIYCLTSAFQYIPKAT 495
           +N++G     AYP TGSFSR+ALKA+C V TPL  +FSG CV++AI  LTSA  +IPKAT
Sbjct: 346 SNVMGACCLGAYPVTGSFSRTALKARCEVRTPLGSIFSGLCVVVAITSLTSALAWIPKAT 405

Query: 496 LSAVIIHAVSDLIASYKTTWSIWRLNPLDLVCFLATVFIAVFSSIENGIYFAMCWSVAVL 555
           LSAVIIHAVS LI+SYK T  ++++ PLD + FL T+FI VFS IE G+YFA+CW+  +L
Sbjct: 406 LSAVIIHAVSGLISSYKVTIRLYKMGPLDCLGFLVTIFITVFSEIEIGVYFAVCWACFLL 465

Query: 556 LFKVAFPRAQFLGRVEIAELA 576
           + ++AFP   FLG V + E++
Sbjct: 466 MIRIAFPYGAFLGYVRVREIS 486

 Score =  155 bits (393), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 84/210 (40%), Positives = 121/210 (57%), Gaps = 13/210 (6%)

Query: 641 WVPF-EPYTRELNXXXXXXXXXXGVIVFRPSESWTYVNCARQYNAIFDEVVRTTRRGKVQ 699
           W+P+   +TRELN          GV+V+R S+S TY+NC+R Y+ I D +   T+ G++ 
Sbjct: 688 WIPYSHRFTRELNPHVKIHPPPPGVVVYRFSDSLTYINCSRNYDNIIDYIKDNTKPGEID 747

Query: 700 VTSKS--GRPWNDPGEWHPPKFLRKWFGKKYSESLEQGVVSDDRPVLRVIAMDWSQVAQV 757
           V S +   +PWN+PG W  PK   K++     E   +  ++D RP LR++ +D+SQVAQ+
Sbjct: 748 VLSDALYVKPWNNPGPWEKPKL--KFWEHADPEIARKKRMADKRPTLRILCLDFSQVAQI 805

Query: 758 DSTGLQTLHDLRKAVSKYADRQVEFHFSGIISPWIKRGLLNTGFGTVNEEHADESLLVGH 817
           DST LQ L DLR  V+ Y    VE+HF GIISPW++R L+  GFG +N+E   +  +   
Sbjct: 806 DSTALQALIDLRHEVNAYTCSLVEWHFCGIISPWVRRNLIEIGFGKINKEFFPK--VNDS 863

Query: 818 KTYQVARGGATGDEEALLPQPATGVNMPFF 847
            T +V        E AL      G N+PFF
Sbjct: 864 STVEVISDLEYNGELAL------GENVPFF 887

>KNAG0D02390 Chr4 (420952..423102) [2151 bp, 716 aa] {ON} Anc_8.99
           YPR003C
          Length = 716

 Score =  131 bits (330), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 128/494 (25%), Positives = 213/494 (43%), Gaps = 49/494 (9%)

Query: 96  IRPSLTASNVRQYLRDLLPVINWLPHYNGRWFYQDMVAGITVGCVLVPQSMSYAV-IATL 154
           I PS ++ +V  Y    LP + W+P+YN + F  D +AG+++    +P  +S+A  +A +
Sbjct: 58  IAPSHSSWDVLPYY---LPCLIWIPNYNWKKFGCDFIAGLSLASFQIPLGLSFATSLAHV 114

Query: 155 PPQFGLYSSFVGAMIYSFFATSKDVCIGPVAVMSLQTAKAVSKVMAELPADTDITAPVVA 214
            P  GLYS  V   IY+ F +   + +GP + +SL   +AV  + +    D  +    +A
Sbjct: 115 EPLCGLYSLAVTPFIYALFGSVPHMIVGPESAISLVVGQAVETLTSH---DLSLETVDIA 171

Query: 215 TALAFLCGLISXXXXXXXXXXXXXXISSTAVAGFMTGSALNIISGQLPALMGYNKLVNTR 274
           T ++F+ GL                +S   + GF++     +I   L   +  NKL+ T 
Sbjct: 172 TMISFMSGLTLLFGGIFRLGFLGNILSKALLRGFISSIGFVMIVNSLITELKLNKLMLTI 231

Query: 275 TSTYKVIIETL----------KHLPDTKLD-AVFGLIPLVMLYTWKWLCNSGGPRLVERY 323
              Y    E +           HLP + L  AVF  +  + ++  K +            
Sbjct: 232 PEHYHTPFEKILFLVRYGPSNYHLPTSFLSLAVFTTLMTIRIFKKKMM------------ 279

Query: 324 TVRGSRKQRI-WSATLFYTQALRNAVIIIVFTAIAWSISHHKKKAPISLLGPVPS-GLKD 381
                  +RI W   +F  + L     +++F+ +   +   KKK  IS++G   + G  D
Sbjct: 280 -------RRIKW--IVFIPEILS----VVIFSIVLSYMCDLKKKYDISVIGDFNTDGFDD 326

Query: 382 VG--VMKLPDGLAAKIAPELPASVIVLLLEHIAIAKAFGRVNDYRVVPDQELIAIGATNL 439
               + K   GL   +      S ++  LE I  +K+ G   +     ++EL+A+G  N 
Sbjct: 327 FRNPLSKCNRGLIPALRDVSLVSALLGFLESITASKSLGGYGNTVASSNRELVALGLMNT 386

Query: 440 LGTFFNAYPATGSFSRSALKAKCNVSTPLSGVFSGACVLLAIYCLTSAFQYIPKATLSAV 499
           +G+ F   PA G + RS + A     T ++GVF G+  L  I  L     YIP   LS +
Sbjct: 387 IGSAFGIIPAFGGYGRSKINAFSGAQTVMAGVFMGSVTLFTIKFLLPVIHYIPTCVLSVI 446

Query: 500 IIHAVSDLI--ASYKTTWSIWRLNPLDLVCFLATVFIAVFSSIENGIYFAMCWSVAVLLF 557
                  L+  A +   + I      +L+ F+ T     F SIE GI     +S+  ++ 
Sbjct: 447 TTFVGVSLLEEAPHDIKFHIRCKGYDELIMFVLTFLCTCFYSIEFGILAGCTYSLISIVK 506

Query: 558 KVAFPRAQFLGRVE 571
             A  R Q L RVE
Sbjct: 507 HSAQSRIQILARVE 520

>NCAS0B04800 Chr2 complement(873061..875235) [2175 bp, 724 aa] {ON}
           Anc_8.99
          Length = 724

 Score =  130 bits (328), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 127/490 (25%), Positives = 213/490 (43%), Gaps = 48/490 (9%)

Query: 109 LRDLLPVINWLPHYNGRWFYQDMVAGITVGCVLVPQSMSYAV-IATLPPQFGLYSSFVGA 167
           L+  LP  +WLP Y  + F  DM+AGIT+    +P ++SYA  +A + P  GLYS  +  
Sbjct: 77  LKYYLPCFSWLPDYTLKKFGGDMIAGITLASFQIPLALSYATSLAHVEPLCGLYSLAITP 136

Query: 168 MIYSFFATSKDVCIGPVAVMSLQTAKAVSKVMAELPADTDITAPVVATALAFLCGLISXX 227
            +Y  F +   + +GP + +SL   +AV K++        I   VV T   FL G I   
Sbjct: 137 FVYCVFGSVPQMIVGPESAISLVVGQAVEKLVTHNEKVGTINISVVVT---FLSGAILLI 193

Query: 228 XXXXXXXXXXXXISSTAVAGFMTGSALNIISGQLPALMGYNKLVNTRTSTYKVIIETLKH 287
                       +S   + GF++   L ++   L   +   KL+ T    Y    E ++ 
Sbjct: 194 FGITRLGFLGNILSRALLRGFISSVGLVMVINSLITELKLTKLLATVPEHYHTPFEKVQF 253

Query: 288 L----PDT--KLDAVFGLIPLVMLYTWKWLCNSGGPRLVERYTVRGSRKQRIWSATLFYT 341
           L    P+   K  A+  L   ++L T ++L      +L++RY            + +F+ 
Sbjct: 254 LFKYGPENLHKPTAILSLCSFIILMTLRFL----KKKLMKRY-----------KSVIFFP 298

Query: 342 QALRNAVIIIVFTAIAWSISHH-KKKAPISLLGPVPSGLKDVGVMKLPDGLAA---KIAP 397
           +     +++IV +++  S++ + KK   IS+LG   +     G  KL + L      +  
Sbjct: 299 E-----ILLIVISSLIISVNFNLKKDFDISMLGDFSTS----GFDKLNNPLGKDNRSLCH 349

Query: 398 ELPA----SVIVLLLEHIAIAKAFGRVNDYRVVPDQELIAIGATNLLGTFFNAYPATGSF 453
           EL +      I+   E    +K+ G + D  +  ++EL+A+G+ NL+G+ F A P+ G +
Sbjct: 350 ELLSVGLMCAILGFFESTTASKSLGTIYDLTISSNRELVALGSMNLVGSLFGALPSFGGY 409

Query: 454 SRSALKAKCNVSTPLSGVFSGACVLLAIYCLTSAFQYIPKATLSAVIIHAVSDLI--ASY 511
            RS + A     T +SG   G   L  I  L     Y P   LS +       L+  A  
Sbjct: 410 GRSKINALSGAQTVMSGACMGLITLFTIKFLLPVIHYTPLCILSVITTVVGLSLLEEAPS 469

Query: 512 KTTWSIWRLNPLDLVCFLATVFIAVFSSIENGIYFAMCWSVAVLLFKVAFPRAQFLGRVE 571
              + I      +L+ F       +  S+E GI     +S+  ++   A  R Q L RV 
Sbjct: 470 DIRFHIRCHGYNELIIFTLIFVTTIIHSVEAGISVGCIYSIGSIIKHSAQSRIQILTRV- 528

Query: 572 IAELATNEGV 581
              + TN+ V
Sbjct: 529 ---IGTNQFV 535

>Kpol_467.11 s467 (26194..28428) [2235 bp, 744 aa] {ON}
           (26194..28428) [2235 nt, 745 aa]
          Length = 744

 Score =  126 bits (316), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 129/476 (27%), Positives = 215/476 (45%), Gaps = 44/476 (9%)

Query: 113 LPVINWLPHYNGRWFYQDMVAGITVGCVLVPQSMSYAV-IATLPPQFGLYSSFVGAMIYS 171
           LP  +W+P Y       D +AGI++    +P ++SYA  IA + P  GLYS  +   IY+
Sbjct: 89  LPCFSWIPQYTWFKLISDFLAGISLASFQIPLALSYATSIAHVEPLCGLYSLAITPFIYA 148

Query: 172 FFATSKDVCIGPVAVMSLQTAKAVSKVMAELPADTDITAPVVATALAFLCGLISXXXXXX 231
            F +   + +GP + +SL   ++V  + +    D+ +    ++  L F+ G         
Sbjct: 149 VFGSVPQMIVGPESAISLVVGQSVELLKSH---DSALEIINISVVLTFISGAALLILGIL 205

Query: 232 XXXXXXXXISSTAVAGFMTGSALNIISGQLPALMGYNKL-----VNTRTSTYKVIIETLK 286
                   +S + + GF++   L +I   L   +  NKL     V+  TS  KV    +K
Sbjct: 206 RLGFLGNVLSRSLLRGFISSIGLVMIIDSLITELKLNKLLAGLKVHCHTSFEKVQF-LIK 264

Query: 287 HLPDT--KLDAVFGLIPLVMLYTWKWLCNSGGPRLVERYTVRGSRKQRIWSATLFYTQAL 344
           + P    K  A+   I  V L++          RL+++   R   K R W A   +   +
Sbjct: 265 YAPTNYHKPTALLSAIAFVTLFSI---------RLLKK---RWMAKHR-WLA---FIPEI 308

Query: 345 RNAVIIIVFTAIAWSISHHKKKAPISLLGPVPSGLKDVGVMKLPDGLAA---KIAPELPA 401
              VII ++ +  W     KK+  I ++G   +   D    KL + ++    KI P+L  
Sbjct: 309 LMVVIISIYLSATW---EFKKQYGILIVGDFNTHAID----KLKNPISKENRKIMPQLLN 361

Query: 402 S-VIVLLL---EHIAIAKAFGRVNDYRVVPDQELIAIGATNLLGTFFNAYPATGSFSRSA 457
           + V++ LL   E +  +K+ G   D  +  ++EL+A+G+ N++ + F A P+ G + RS 
Sbjct: 362 TGVLISLLGFFESMTASKSLGTTYDLAISSNRELVALGSMNVIASLFGALPSFGGYGRSK 421

Query: 458 LKAKCNVSTPLSGVFSGACVLLAIYCLTSAFQYIPKATLSAVI-IHAVSDLIASYKTTWS 516
           + A     T +SGVF G+  L+ I  L     YIP   LS +  I  +S L  +      
Sbjct: 422 INAFSGSKTVMSGVFMGSVTLITIRYLLPLIHYIPLCILSVITSIVGISLLEEAPSELKF 481

Query: 517 IWRLNPLD-LVCFLATVFIAVFSSIENGIYFAMCWSVAVLLFKVAFPRAQFLGRVE 571
            +R    D L  F  TV   +  S+E GI     +S+  ++   A  R Q LGRV+
Sbjct: 482 HFRCKGYDELFVFAITVLATLLYSVEMGICIGCGYSIISIVKHSAKSRIQILGRVQ 537

>YPR003C Chr16 complement(561504..563768) [2265 bp, 754 aa] {ON}
           Putative sulfate permease; physically interacts with
           Hsp82p; green fluorescent protein (GFP)-fusion protein
           localizes to the ER; YPR003C is not an essential gene
          Length = 754

 Score =  122 bits (307), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 119/488 (24%), Positives = 213/488 (43%), Gaps = 42/488 (8%)

Query: 99  SLTASNVRQYLRDLLPVINWLPHYNGRWFYQDMVAGITVGCVLVPQSMSYAV-IATLPPQ 157
           S+  + V + L   LP  +WLP Y     + D++AGI+V    +P ++SY   IA +PP 
Sbjct: 91  SVDENTVFETLPYYLPCFSWLPEYTFNKLWGDVIAGISVASFQIPLALSYTTSIAHVPPL 150

Query: 158 FGLYSSFVGAMIYSFFATSKDVCIGPVAVMSLQTAKAVSKVMAELPADTDITAPVVATAL 217
            GLYS  +   +Y    +   + +GP + +SL   +AV  +        +++   ++T +
Sbjct: 151 CGLYSLAISPFVYGILGSVPQMIVGPESAISLVVGQAVESITLH---KENVSLIDISTVI 207

Query: 218 AFLCGLISXXXXXXXXXXXXXXISSTAVAGFMTGSALNIISGQLPALMGYNKLVNTRTST 277
            F+ G I               +S   + GF++   L +I   L + +  +K + +    
Sbjct: 208 TFVSGTILLFSGISRFGFLGNVLSKALLRGFISSVGLVMIINSLISELKLDKFLVSLPQH 267

Query: 278 YKVIIETLKHLPDTKL------DAVFGLIPLVMLYTWKWLCNSGGPRLVERYTVRGSRKQ 331
           Y    E +  L D          A+F    L++L+           RL++R      +  
Sbjct: 268 YHTPFEKILFLIDYAPAQYHIPTAIFSGCCLIVLFL---------TRLLKR------KLM 312

Query: 332 RIWSATLFYTQALRNAVIIIVFTAIAWSISHHKKKAPISLLGPVPSGLKDVGVMKLP-DG 390
           +   + +F+   L   VI+ +  ++ +++ H   +  IS++G     + +   +K P   
Sbjct: 313 KYHKSAIFFPDILL-VVIVTILISMKFNLKH---RYGISIIGDF--SMDNFDELKNPLTR 366

Query: 391 LAAKIAPEL-PASVIVLLL---EHIAIAKAFGRVNDYRVVPDQELIAIGATNLLGTFFNA 446
              K+ P+L  AS+IV +L   E    +K+ G   +  V  ++EL+A+G  N++ + F A
Sbjct: 367 PRRKLIPDLFSASLIVAMLGFFESTTASKSLGTTYNLTVSSNRELVALGFMNIVISLFGA 426

Query: 447 YPATGSFSRSALKAKCNVSTPLSGVFSGACVLLAIYCLTSAFQYIPKATLSAVI----IH 502
            PA G + RS + A     + +SGVF G   L+ +  L     YIP   LS +     I 
Sbjct: 427 LPAFGGYGRSKINALSGAQSVMSGVFMGVITLITMNLLLQFVHYIPNCVLSVITTIIGIS 486

Query: 503 AVSDLIASYKTTWSIWRLNPLDLVCFLATVFIAVFSSIENGIYFAMCWSVAVLLFKVAFP 562
            + ++    K        +  +L  F  T    +F SIE GI     +S+  ++   A  
Sbjct: 487 LLEEVPGDIKFHLRCGGFS--ELFVFAVTFCTTIFYSIEAGICIGCVYSIINIIKHSAKS 544

Query: 563 RAQFLGRV 570
           R Q L RV
Sbjct: 545 RIQILARV 552

>NDAI0B02210 Chr2 complement(546721..548841) [2121 bp, 706 aa] {ON}
           Anc_8.99
          Length = 706

 Score =  121 bits (303), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 127/534 (23%), Positives = 218/534 (40%), Gaps = 53/534 (9%)

Query: 53  DQNGDKSGATGGGNGANEPLALYDSPEAYYEDKVTFREYYDTTIRPSLTASNVRQYLRDL 112
           D NG    A       NE   +Y+  +   +D++          R  LT SN+  YL   
Sbjct: 9   DTNGSSDSAEAISQ-HNEDGLVYNQEDV--QDRIAINN------RSILTTSNIWDYLAYY 59

Query: 113 LPVINWLPHYNGRWFYQDMVAGITVGCVLVPQSMSYAV-IATLPPQFGLYSSFVGAMIYS 171
            P  +W+P+Y    F  D+ AG++V    +P ++SYA  +A + P  GLYS  +   IY+
Sbjct: 60  FPCFSWMPNYTLTKFLGDLTAGLSVASFQIPLALSYATSLAHVEPLSGLYSLAITPFIYA 119

Query: 172 FFATSKDVCIGPVAVMSLQTAKAVSKVMAELPADTDITAPVVATALAFLCGLISXXXXXX 231
            F +   + +GP + +SL   +AV  ++     D  I+   ++  + F+ G         
Sbjct: 120 IFGSVPQMIVGPESAISLVVGQAVEPMVNH---DERISTISISIVVTFISGSFLLFLGIF 176

Query: 232 XXXXXXXXISSTAVAGFMTGSALNIISGQLPALMGYNKLVNTRTSTYKVIIETL------ 285
                   +S   + GF+      +I   L + +  +K++ T    Y    E +      
Sbjct: 177 RLGFLGNILSRALLRGFICSVGFVMIINSLISELKLDKVLATSPEHYHTPFEKILFLIKY 236

Query: 286 ----KHLPDTKLDAVFGLIPLVMLYTWKWLCNSGGPRLVERYTVRGSRKQRIWSATLFYT 341
                H P T + +++  I L+++   K        RL++R+          W   +F  
Sbjct: 237 GQHNYHAP-TAILSLYSFIILMLMKVMK-------KRLMKRFK---------W--VIFVP 277

Query: 342 QALRNAVIIIVFTAIAWSISHH-KKKAPISLLGPVPSGLKDVGVMKLPDGLAAKIAPELP 400
           +     ++I++   I +S     K K  IS++G       D     L       + P L 
Sbjct: 278 E-----ILIVIVGTIMFSFHFDIKHKFDISIIGDFKVNGFDSLHNPLDKTNRLLLKPLLD 332

Query: 401 ASVIVLLL---EHIAIAKAFGRVNDYRVVPDQELIAIGATNLLGTFFNAYPATGSFSRSA 457
           A ++  +L   E    +KA G   D  V  ++EL+A+G+ N++G+ F A PA G + RS 
Sbjct: 333 AGIVCAVLGFFESTTASKALGTTYDLTVSSNRELVALGSMNIVGSLFGALPAFGGYGRSK 392

Query: 458 LKAKCNVSTPLSGVFSGACVLLAIYCLTSAFQYIPKATLSAVIIHAVSDLIASYKTTWSI 517
           + A     T +SGV  G+  L  I          P   LS V       L+    T    
Sbjct: 393 INALSGGQTVMSGVCLGSVTLFTIKFFLPVVHNTPTCVLSVVTSVVGLTLLEEAPTDLKF 452

Query: 518 WRLNP--LDLVCFLATVFIAVFSSIENGIYFAMCWSVAVLLFKVAFPRAQFLGR 569
           +  +    +L+    T    +F S+E GI    C+S+  ++   A  R Q L +
Sbjct: 453 YFQSHGYNELIVLGLTFITTIFYSVEVGICVGCCYSIISIIKHSAQSRIQILAK 506

>KLLA0E14059g Chr5 (1245694..1247814) [2121 bp, 706 aa] {ON} similar
           to uniprot|P53394 Saccharomyces cerevisiae YPR003C
           Hypothetical ORF
          Length = 706

 Score =  120 bits (301), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 116/496 (23%), Positives = 202/496 (40%), Gaps = 48/496 (9%)

Query: 104 NVRQYLRD----LLPVINWLPHYNGRWFYQDMVAGITVGCVLVPQSMSYAV-IATLPPQF 158
           N R  L+D     LP  +W+P Y+ +    D +AG+++    +P +MSYA  +A +PP  
Sbjct: 61  NERVTLKDTIPYYLPCFSWIPTYSVKKCMGDFIAGLSLASFQIPLAMSYATSVAHVPPLC 120

Query: 159 GLYSSFVGAMIYSFFATSKDVCIGPVAVMSLQTAKAVSKVMAELPADTDITAPVVATALA 218
           GLYS      +Y+   +   + +GP + +SL   +A+    A L  D  + A  +   + 
Sbjct: 121 GLYSLVFSPAVYTVLGSVPQMIVGPESAISLILGQAIE---ARLSEDPKLKAINICLVIT 177

Query: 219 FLCGLISXXXXXXXXXXXXXXISSTAVAGFMTGSALNIISGQLPALMGYNKLVNTRT--- 275
           F+ GL+               +S   + GF++G  + ++   L   +  N +  TR    
Sbjct: 178 FISGLVLLTGGLLRLGFLENVLSRALLRGFISGVGVIMVITSLVVELKLNHVTPTRQEHY 237

Query: 276 -STYKVIIETLKHLPDT--KLDAVFGLIPLVMLYTWKWLCNSGGPRLVERYTVRGSRKQR 332
            S ++ ++  +K+ P+   K  A+  L+  V+L + +      G             K+ 
Sbjct: 238 HSPFEKVLFIMKYGPENYHKPTAILSLVAFVILMSLRIFKKRYG-------------KKF 284

Query: 333 IWSATLFYTQALRNAVIIIVFTAIAWSISHHKKKAPISLLGPVPSG--------LKDVGV 384
            W         L + ++++  +       H K +  I ++  +P            +V V
Sbjct: 285 KWLV------LLPDILVVVALSIFVSYKMHLKSRYGIEIINDIPKDSMKHLKNPFSNVNV 338

Query: 385 MKLPDGLAAKIAPELPASVIVLLLEHIAIAKAFGRVNDYRVVPDQELIAIGATNLLGTFF 444
               D  +      +         E    +K+ G   +  +  ++ELIA+G+ N++G+ F
Sbjct: 339 ATFKDLFSTGFMVAMLG-----FFESATASKSLGTSYNLAISSNRELIALGSMNVVGSMF 393

Query: 445 NAYPATGSFSRSALKAKCNVSTPLSGVFSGACVLLAIYCLTSAFQYIPKATLSAVIIHAV 504
              PA G + RS + A     T +SG F G   L  I  L    +YIP   LS +     
Sbjct: 394 AILPAFGGYGRSKINAYSGAQTTMSGFFMGLVTLFTIQFLLPIIRYIPVCILSVITTVVG 453

Query: 505 SDLIASYKTTWSI-WRLNPL-DLVCFLATVFIAVFSSIENGIYFAMCWSVAVLLFKVAFP 562
             L+          WR     +L  F  T+   +F S+E GIY     S+  ++   A  
Sbjct: 454 LTLLEEAPHDLKFHWRCKGYSELTVFTVTLLATLFYSLEAGIYIGCACSIINVIKHSAKS 513

Query: 563 RAQFLGRVEIAELATN 578
           R Q LGRV   E   N
Sbjct: 514 RIQILGRVPGTETFIN 529

>Suva_16.322 Chr16 complement(565605..567833) [2229 bp, 742 aa] {ON}
           YPR003C (REAL)
          Length = 742

 Score =  120 bits (301), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 118/476 (24%), Positives = 210/476 (44%), Gaps = 46/476 (9%)

Query: 113 LPVINWLPHYNGRWFYQDMVAGITVGCVLVPQSMSYAV-IATLPPQFGLYSSFVGAMIYS 171
           LP  +WLP Y     + D++AGI++    +P ++SY   IA +PP  GLYS  +   +Y 
Sbjct: 95  LPCFSWLPEYTFNKLWGDIIAGISLASFQIPLALSYTTSIAHVPPLCGLYSLAISPFVYG 154

Query: 172 FFATSKDVCIGPVAVMSLQTAKAVSKVMAELPADTDITAPVVATALAFLCGLISXXXXXX 231
              +   + +GP + +SL   +AV  +   L  D +++   ++  + F+ G I       
Sbjct: 155 ILGSVPQMIVGPESAISLVVGQAVESI--TLHKD-NVSLIDISIVITFVSGAILLFSGIS 211

Query: 232 XXXXXXXXISSTAVAGFMTGSALNIISGQLPALMGYNKLVNTRTSTYKVIIETLKHLPD- 290
                   +S   + GF++   L +I   L + +  +K + +    Y    E +  L D 
Sbjct: 212 RFGFLGNVLSKALLRGFISSVGLVMIINSLVSELKLDKFLVSLPQHYHTPFEKVLFLIDY 271

Query: 291 -----TKLDAVFGLIPLVMLYTWKWLCNSGGPRLVERYTVRGSRKQRIWSATLFYTQALR 345
                 K  A+F     ++L   + L      +L++R+            + +F+   L 
Sbjct: 272 APAQYHKPTAIFSGCCFIILIVMRLL----KKKLMKRH-----------KSAVFFPDIL- 315

Query: 346 NAVIIIVFTAIAWSISHHKKKAPISLLGPVPSGLKDVGVMKLPDGLA---AKIAPEL-PA 401
             +++IV   I+  +S  K++  IS++G       D    KL + L     K+ P+L  A
Sbjct: 316 --LVVIVTILISMKLSL-KQRYGISIVGDFSMDNFD----KLKNPLTHSRRKLMPDLFSA 368

Query: 402 SVIVLLL---EHIAIAKAFGRVNDYRVVPDQELIAIGATNLLGTFFNAYPATGSFSRSAL 458
           S+IV +L   E    +K+ G   +  V  ++EL+A+G  N+  + F A P+ G + RS +
Sbjct: 369 SLIVAMLGFFESTTASKSLGTTYNLTVSSNRELVALGCINMFISLFGALPSFGGYGRSKI 428

Query: 459 KAKCNVSTPLSGVFSGACVLLAIYCLTSAFQYIPKATLSAVI----IHAVSDLIASYKTT 514
            A     + +SGVF G   L+ +  L     YIP   LS +     I  + ++    K  
Sbjct: 429 NALSGAQSVMSGVFVGIITLITMKLLLQFVHYIPNCVLSVITTVIGISLLEEVPGDIKFH 488

Query: 515 WSIWRLNPLDLVCFLATVFIAVFSSIENGIYFAMCWSVAVLLFKVAFPRAQFLGRV 570
                 +  +L  F  T  + +F SIE+GI     +S+  ++   A  R Q L R+
Sbjct: 489 LQCGGYS--ELFVFAVTFGVTIFYSIESGICIGCVYSILNIIKHSAKSRIQILARI 542

>TPHA0H00720 Chr8 complement(143103..145466) [2364 bp, 787 aa] {ON}
           Anc_8.99 YPR003C
          Length = 787

 Score =  117 bits (294), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 114/486 (23%), Positives = 207/486 (42%), Gaps = 43/486 (8%)

Query: 107 QYLRDLLPVINWLPHYNGRWFYQDMVAGITVGCVLVPQSMSYAV-IATLPPQFGLYSSFV 165
           Q ++  LP + WLP YN   F+ D ++GI++    +P ++SYA  IA + P  GLYS  +
Sbjct: 108 QLIQYYLPCLRWLPIYNCSDFFSDCISGISLASFQIPLALSYATSIAHVKPLCGLYSLAI 167

Query: 166 GAMIYSFFATSKDVCIGPVAVMSLQTAKAVSKVMAEL----PADTDITAPVVATALAFLC 221
             +IY    +   + +GP   +SL   +AV K+          D  I+   ++  + FL 
Sbjct: 168 TPVIYGILGSVPPMIVGPEGAISLVVGQAVDKLHGSYNLSSQEDDHISRMNISVTITFLS 227

Query: 222 GLISXXXXXXXXXXXXXXISSTAVAGFMTGSALNIISGQLPALMGYNKLV--NTRT--ST 277
           GL+               +S   +  F++     ++   L   M  N ++  N R   + 
Sbjct: 228 GLVLFICGLLRLGFLGSVLSKPLLRSFISSVGGVMVIDALITEMKLNCILIDNDRHYHTA 287

Query: 278 YKVIIETLKHLPDT--KLDAVFGLIPLVMLYTWKWLCNSGGPRLVERYTVRGSRKQRIWS 335
           ++ I+  +K+ P+   K   V  ++   +LY  ++ C        ++Y ++   K  I+ 
Sbjct: 288 FEKIMFIIKYAPNNFHKPTTVLSVVCFSILYFVRY-CK-------KKYIIK--HKSLIF- 336

Query: 336 ATLFYTQALRNAVIIIVFTAIAWSISHHKKKAPISLLGPVPSGLKDVGVMKLPDGLAAKI 395
                   L   +I+++ T I  +  + K    IS++G V S   ++    L + L++  
Sbjct: 337 --------LPEILIVVISTGILSASYNFKDNYGISIIGDVNSNNSNLIAGNLQNPLSSSN 388

Query: 396 APELP-------ASVIVLLLEHIAIAKAFGRVNDYRVVPDQELIAIGATNLLGTFFNAYP 448
               P       A   +   E    +K+ G   +  +  ++EL+A+G  NL  +     P
Sbjct: 389 KELFPILMNTGFAIAALGFFESTTASKSLGTKFELSISSNRELVALGVMNLTASLLGGLP 448

Query: 449 ATGSFSRSALKAKCNVSTPLSGVFSGACVLLAIYCLTSAFQYIPKATLSAVI----IHAV 504
           + G + RS + A     T +SGV  G   +L I  L +   +IP   LS +     +  +
Sbjct: 449 SFGGYGRSKINAFSGAKTVMSGVVMGGITVLTIKFLLNYIHFIPTCVLSVITTIVGLSLI 508

Query: 505 SDLIASYKTTWSIWRLNPLDLVCFLATVFIAVFSSIENGIYFAMCWSVAVLLFKVAFPRA 564
            +     K  W     N  +L+ F  T    +F S+E GI     +S+  ++   A  R 
Sbjct: 509 EEAPGEVKFHWRCKGYN--ELIIFFMTACGTIFFSVEVGIIIGCSYSIISIIKFSAKSRI 566

Query: 565 QFLGRV 570
           Q LGR+
Sbjct: 567 QILGRI 572

>Skud_16.286 Chr16 complement(525800..528037) [2238 bp, 745 aa] {ON}
           YPR003C (REAL)
          Length = 745

 Score =  115 bits (289), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 111/474 (23%), Positives = 206/474 (43%), Gaps = 42/474 (8%)

Query: 113 LPVINWLPHYNGRWFYQDMVAGITVGCVLVPQSMSYAV-IATLPPQFGLYSSFVGAMIYS 171
           LP  +WLP Y     + D++AGI++    +P ++SY   IA +PP  GLYS  +   +Y 
Sbjct: 95  LPCFSWLPEYTFNKLWGDIIAGISLASFQIPLALSYTTSIAHVPPLCGLYSLAISPFVYG 154

Query: 172 FFATSKDVCIGPVAVMSLQTAKAVSKVMAELPADTDITAPVVATALAFLCGLISXXXXXX 231
              +   + +GP + +SL   +AV  +        +++   ++  + F+ G I       
Sbjct: 155 ILGSVPQMIVGPESAISLVVGQAVESITLH---KDNVSLIDISVVITFVSGAILLFSGIS 211

Query: 232 XXXXXXXXISSTAVAGFMTGSALNIISGQLPALMGYNKLVNTRTSTYKVIIETLKHLPD- 290
                   +S   + GF++   L +I   L + +  +K + +    Y    E +  L D 
Sbjct: 212 RFGFLGNVLSKALLRGFISSVGLVMIINALISELKLDKFLLSLPQHYHTPFEKVLFLIDY 271

Query: 291 -----TKLDAVFGLIPLVMLYTWKWLCNSGGPRLVERYTVRGSRKQRIWSATLFYTQALR 345
                 K  A+F    L++L++ +                   +  +   + +F+   L 
Sbjct: 272 APAQYHKPTAIFSGCCLIVLFSMRL---------------LKKKLVKHHKSAIFFPDILL 316

Query: 346 NAVIIIVFTAIAWSISHHKKKAPISLLGPVPSGLKDVGVMKLPDGLAA-KIAPEL-PASV 403
             VI+ +F ++ +S+ H   +  I+++G     + +   +K P   +  K+ P+L  AS+
Sbjct: 317 -VVIVAIFISMKFSLKH---RYGITIIGDF--SMDNFDKLKNPFTHSRRKLIPDLFSASL 370

Query: 404 IVLLL---EHIAIAKAFGRVNDYRVVPDQELIAIGATNLLGTFFNAYPATGSFSRSALKA 460
           IV +L   E    +K+ G   +  V  ++EL+A+G  N++ + F A P+ G + RS + A
Sbjct: 371 IVAMLGFFESTTASKSLGTTYNLTVSSNRELVALGFMNIVISLFGALPSFGGYGRSKINA 430

Query: 461 KCNVSTPLSGVFSGACVLLAIYCLTSAFQYIPKATLSAVI----IHAVSDLIASYKTTWS 516
                + +SGVF G   L+ +  L     YIP   LS +     I  + ++    K    
Sbjct: 431 LSGAQSVMSGVFVGIITLITMNLLLQFVHYIPNCVLSVITTVIGISLLEEVPGDIKFHLR 490

Query: 517 IWRLNPLDLVCFLATVFIAVFSSIENGIYFAMCWSVAVLLFKVAFPRAQFLGRV 570
               +  +L  F  T  + +  SIE GI     +S+  ++   A  R Q L RV
Sbjct: 491 CGGYS--ELFVFAVTFGVTILCSIEAGICIGCVYSILNIIKHSAKSRIQILARV 542

>SAKL0B03124g Chr2 complement(288006..290240) [2235 bp, 744 aa] {ON}
           similar to uniprot|P53394 Saccharomyces cerevisiae
           YPR003C Hypothetical ORF
          Length = 744

 Score =  113 bits (282), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 113/481 (23%), Positives = 211/481 (43%), Gaps = 34/481 (7%)

Query: 113 LPVINWLPHYNGRWFYQDMVAGITVGCVLVPQSMSYAV-IATLPPQFGLYSSFVGAMIYS 171
           LP  +WLP Y+ R F+ D +AG+++    +P +MSYA  IA + P  GLY+       Y+
Sbjct: 97  LPCFSWLPSYDLRKFFGDFIAGVSLASFQIPLAMSYATSIAHVEPLCGLYALAFTPFFYA 156

Query: 172 FFATSKDVCIGPVAVMSLQTAKAVSKVMAELPADTDITAPVVATALAFLCGLISXXXXXX 231
            F +   + +GP + +SL   +A+  ++   P+ + +   V+ T   F+ G++       
Sbjct: 157 IFGSVPQMIVGPESAISLVVGQAIEPMIRHDPSLSSLDLCVIIT---FISGVVLFTFGVF 213

Query: 232 XXXXXXXXISSTAVAGFMTGSALNIISGQLPALMGYNKLVNTRTSTYKVIIETLKHLPDT 291
                   +S   + GF++   + ++   L   +   K+ +   S Y    E +  L   
Sbjct: 214 RFGFLDNVLSRAFLRGFISAVGVIMVINSLIVELKLKKVFDDAPSHYHSPFEKVLFL--I 271

Query: 292 KLDAVFGLIPLVMLYTWKWLCNSGGPRLVERYTVRGSRKQRIWSATLFYTQALRNAVIII 351
           K       +P  +L    +L       ++    +   +  + + + +F+ + L   V+ +
Sbjct: 272 KYAPANYHLPTSLLSLCCFL-------ILMSLRLIKKKLLKRFRSLVFFPEILL-VVVTV 323

Query: 352 VFTAIAWSISHHKKKAPISLLGPVPSGLKDVGVMKLPDGLAAKIAP----ELPASVIVLL 407
           +F +  + + H   +  I ++G + + + D    KL + L+    P       A  +V +
Sbjct: 324 IFFSYNFDLKH---RYNIEVVGDIEASVFD----KLRNPLSKNKRPFYGDLFSAGFMVAM 376

Query: 408 L---EHIAIAKAFGRVNDYRVVPDQELIAIGATNLLGTFFNAYPATGSFSRSALKAKCNV 464
           L   E    +K+ G   D  V  ++EL+A+G+ NL+G+ F A P+ G + RS + A    
Sbjct: 377 LGFFESTTASKSLGTAYDLAVSSNRELVALGSLNLIGSLFGALPSFGGYGRSKINAYSGA 436

Query: 465 STPLSGVFSGACVLLAIYCLTSAFQYIPKATLSAVIIHAVSDLI--ASYKTTWSIWRLNP 522
            T +SG   G   +  I  L    +YIP   LS +       L+  A     + I     
Sbjct: 437 QTVVSGACMGTITMFTIKFLLKFIRYIPVCVLSVITTVVGLSLLEEAPADLRFHIRCRGY 496

Query: 523 LDLVCFLATVFIAVFSSIENGIYFAMCWSVAVLLFKVAFPRAQFLGRVEIAELATNEGVS 582
            +L+ F+ TV    F S+E GI     +S+  ++      R Q LG++      TN+ V+
Sbjct: 497 NELISFIITVLTTFFYSVEAGITVGCGYSIIRVIKHSTKSRIQILGKLA----GTNKFVN 552

Query: 583 A 583
           A
Sbjct: 553 A 553

>Smik_16.241 Chr16 complement(438048..440282) [2235 bp, 744 aa] {ON}
           YPR003C (REAL)
          Length = 744

 Score =  111 bits (278), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 112/476 (23%), Positives = 202/476 (42%), Gaps = 46/476 (9%)

Query: 113 LPVINWLPHYNGRWFYQDMVAGITVGCVLVPQSMSYAV-IATLPPQFGLYSSFVGAMIYS 171
           LP   WLP Y     + D++AGI++    +P ++SY   IA +PP  GLYS  +   +Y 
Sbjct: 95  LPCFAWLPEYTFSKLWGDIIAGISLASFQIPLALSYTTSIAHVPPLCGLYSLAISPFVYG 154

Query: 172 FFATSKDVCIGPVAVMSLQTAKAVSKVMAELPADTDITAPVVATALAFLCGLISXXXXXX 231
            F +   + +GP + +SL   +AV  +        +++   ++  + F+ G I       
Sbjct: 155 VFGSVPQMIVGPESAISLVVGQAVESITLH---KDNVSLIDISIVITFVSGAILLFSGIS 211

Query: 232 XXXXXXXXISSTAVAGFMTGSALNIISGQLPALMGYNKLVNTRTSTYKVIIETLKHLPD- 290
                   +S   + GF++   L +I   L + +  +K + +    Y    E +  L D 
Sbjct: 212 RFGFLGNVLSKALLRGFISSVGLVMIINSLISELKLDKFLVSLPQHYHTPFEKILFLIDY 271

Query: 291 -----TKLDAVFGLIPLVMLYTWKWLCNSGGPRLVERYTVRGSRKQRIWSATLFYTQALR 345
                    A+F    L++L+                  +   +  +     +F+   L 
Sbjct: 272 APAQYHMPTAIFSGCCLIILFLM---------------RLLKRKLLKYHKGAIFFPDILL 316

Query: 346 NAVIIIVFTAIAWSISHHKKKAPISLLGPVPSGLKDVGVMKLPDGLAA---KIAPEL-PA 401
             VI+ +  ++ + + H   +  I+++G       D    KL + L     K+ P+L  A
Sbjct: 317 -VVIVTILISMKFDLKH---RYGITIVGDFSMDNFD----KLKNPLTRSRRKLIPDLFSA 368

Query: 402 SVIVLLL---EHIAIAKAFGRVNDYRVVPDQELIAIGATNLLGTFFNAYPATGSFSRSAL 458
           S+IV +L   E    +K+ G   +  V  ++EL+A+G  N++ + F A P+ G + RS +
Sbjct: 369 SLIVAMLGFFESTTASKSLGTTYNLTVSSNRELVALGFMNIVISLFGALPSFGGYGRSKI 428

Query: 459 KAKCNVSTPLSGVFSGACVLLAIYCLTSAFQYIPKATLSAVI----IHAVSDLIASYKTT 514
            A     + +SGVF G   L+ +  L     YIP   LS +     I  + ++ +  K  
Sbjct: 429 NALSGAQSVISGVFVGVITLITMNLLLQFVHYIPNCVLSVITTVIGISLLEEVPSDIKFH 488

Query: 515 WSIWRLNPLDLVCFLATVFIAVFSSIENGIYFAMCWSVAVLLFKVAFPRAQFLGRV 570
                 +  +L  F  T  + +F SIE GI     +S+  ++   A  R Q L RV
Sbjct: 489 LRCGGYS--ELFVFAVTFGVTIFYSIEAGICIGCVYSILNIIKHSAKSRIQILARV 542

>TDEL0C01280 Chr3 complement(218824..221007) [2184 bp, 727 aa] {ON}
           Anc_8.99 YPR003C
          Length = 727

 Score =  111 bits (277), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 122/491 (24%), Positives = 214/491 (43%), Gaps = 60/491 (12%)

Query: 106 RQYLRDLLPVINWLPHYNGRWFYQDMVAGITVGCVLVPQSMSYAV-IATLPPQFGLYSSF 164
           R  L   LP  +W+P Y    F  D+VAGIT+    +P ++SYA  +A + P  GLYS  
Sbjct: 75  RDVLPYYLPCFSWIPEYTWSKFMGDLVAGITLASFQIPLALSYATSLAHVEPLCGLYSLA 134

Query: 165 VGAMIYSFFATSKDVCIGPVAVMSLQTAKAVSKVMAELPADTDITAPVVATALAFLCGLI 224
               IY+ F +   + +GP + +SL   +AV K+ A    + +I+   ++  + F+ G+ 
Sbjct: 135 FTPFIYAIFGSVPQMIVGPESAISLVVGQAVEKLRAH---NHEISTMSISVLVTFISGMF 191

Query: 225 SXXXXXXXXXXXXXXISSTAVAGFMTGSALNIISGQLPALMGYNKLVNTRTSTYKVIIET 284
                          +S   + GF++   + +I   L + +  +KL+      +    + 
Sbjct: 192 LFVFGICRFGFLGNVLSRALLRGFISSVGVVMIVNSLISELKLHKLLLETKGHFHTPFQK 251

Query: 285 LK----------HLPDTKLDAVFGLIPLVMLYTWKWLCNSGGPRLVERYTVRGSRKQRIW 334
           ++          H+P     AV  L   ++L T          R++++  +R    +R W
Sbjct: 252 IRFIIKYAPANYHIPT----AVLSLTCFIILVT---------ARVIKKKLMR----RRRW 294

Query: 335 SATLFYTQALRNAVIIIVFTAIAWSISHH---KKKAPISLLGPVPSGLKDVGVMKLPDGL 391
              +F  + L               +SH    KK   IS++G   +     G++   + +
Sbjct: 295 P--VFVPEILILI-------ITTIILSHKFKFKKHYEISIVGDFDTD----GLVNFYNPI 341

Query: 392 AA---KIAPEL-PASVIVLLL---EHIAIAKAFGRVNDYRVVPDQELIAIGATNLLGTFF 444
           +    ++AP L  A  IV +L   E    AK+ G   ++ +  ++EL+A+G+ NL  +  
Sbjct: 342 SKSNRELAPNLMNAGFIVAILGFFESTTAAKSLGSAYEFAISSNRELVALGSMNLCASVL 401

Query: 445 NAYPATGSFSRSALKAKCNVSTPLSGVFSGACVLLAIYCLTSAFQYIPKATLSAVI---- 500
            A PA G + RS + +     T +SGV  G  VLL +    S  +YIP   LS +     
Sbjct: 402 GALPAFGGYGRSKINSFSGAQTVMSGVCMGVIVLLTVKFFLSQIRYIPVCILSVITTIVG 461

Query: 501 IHAVSDLIASYKTTWSIWRLNPLDLVCFLATVFIAVFSSIENGIYFAMCWSVAVLLFKVA 560
           I  + +  A  +  ++    +  +L+ F  TV    F S+E G+     +SV  ++   A
Sbjct: 462 ISLLEEAPADLRFHFNSRGYD--ELLVFAVTVLTTFFYSLEMGVCIGCGYSVISIIKHSA 519

Query: 561 FPRAQFLGRVE 571
             R Q L RVE
Sbjct: 520 KSRIQILARVE 530

>ZYRO0F04796g Chr6 (399222..401429) [2208 bp, 735 aa] {ON} similar
           to uniprot|P53394 Saccharomyces cerevisiae YPR003C
           Hypothetical ORF
          Length = 735

 Score =  110 bits (275), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 120/495 (24%), Positives = 213/495 (43%), Gaps = 47/495 (9%)

Query: 93  DTTIRPSLTASNVRQYLRDLLPVINWLPHYNGRWFYQDMVAGITVGCVLVPQSMSYAV-I 151
           +  IRPS     +   L   LP  +WLP+YN      D++AG+++    +P ++S+A  +
Sbjct: 75  EIEIRPS-----IWDVLPYYLPFFSWLPNYNISKCIGDLIAGVSLASFQIPLALSFATSV 129

Query: 152 ATLPPQFGLYSSFVGAMIYSFFATSKDVCIGPVAVMSLQTAKAVSKVMAELPADTDITAP 211
           A + P  GLYS      IY+   +   + +GP + +SL   +AV K+++  P   D+   
Sbjct: 130 AHVEPLCGLYSLAFTPFIYAILGSVPQMIVGPESAISLVVGQAVEKMISHNP---DLHTL 186

Query: 212 VVATALAFLCGLISXXXXXXXXXXXXXXISSTAVAGFMTGSALNIISGQLPALMGYNKLV 271
            ++  + F+ G                 +S   + GF++   L +I   + +    +K++
Sbjct: 187 QLSAVITFISGGFLFFFGLCRLGFLGNVLSRALLRGFISSVGLVMIINSMISEFKLDKIL 246

Query: 272 NTRTSTYKVIIETLKHLPDTKLDAVFGLIPLVMLYTWKWLCNSGGPRLVERYTVRGSRKQ 331
                 Y    E +  L     +   G    + L  +  L  +   +++++  +   R  
Sbjct: 247 KDLPVHYHTPFEKILFLVTYAPNNYHGPTTALSLSCFFILIMT---KIIKKKLMPRCR-- 301

Query: 332 RIWSATLFYTQALRNAVIIIVFTAIAWSISHHKKKAPISLLGPVPSGLKDVGVMKLPDGL 391
             W   + +   +   +I  +F +I +   H+     IS +G         G+ KL + L
Sbjct: 302 --W---IVFVPDILLLIIGTIFLSIKYRFKHNYS---ISTVG----DFNTKGLDKLLNPL 349

Query: 392 AAK---IAPEL-PASVIVLLL---EHIAIAKAFGRVNDYRVVPDQELIAIGATNLLGTFF 444
           +A+   + P+L  A  I  +L   E    +K+ G   D  +  ++EL+A+G+ NL  +  
Sbjct: 350 SAENRGLIPQLLSAGFITAMLGFFESTTASKSLGSSYDLAISSNRELVALGSMNLFSSIL 409

Query: 445 NAYPATGSFSRSALKAKCNVSTPLSGVFSGACVLLAIYCLTSAFQYIPKATLSAV----- 499
            + PA G + RS + A     T +SG F G  VLL I  L     YIP   LS V     
Sbjct: 410 GSLPAFGGYGRSKINAFSGAQTVMSGAFMGLLVLLTIKFLLPMIHYIPICVLSVVTTMVG 469

Query: 500 ---IIHAVSDLIASYKTTWSIWRLNPLDLVCFLATVFIAVFSSIENGIYFAMCWSVAVLL 556
              +  A +DL+  ++           +L+ F  TV   +F S+E GI     +SV  ++
Sbjct: 470 ISLLEEAPADLMFHFRC------FGYDELLVFTLTVLTTMFYSVEVGICIGCGYSVISII 523

Query: 557 FKVAFPRAQFLGRVE 571
              A  R Q L RV+
Sbjct: 524 KHSAKSRIQILARVQ 538

>KLTH0G16764g Chr7 complement(1454815..1456947) [2133 bp, 710 aa]
           {ON} similar to uniprot|P53394 Saccharomyces cerevisiae
           YPR003C Hypothetical ORF
          Length = 710

 Score =  108 bits (271), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 115/475 (24%), Positives = 198/475 (41%), Gaps = 44/475 (9%)

Query: 113 LPVINWLPHYNGRWFYQDMVAGITVGCVLVPQSMSYAV-IATLPPQFGLYSSFVGAMIYS 171
           LP  +WLP Y+     +D +AG ++    +P +MSY+  +A +PP  GL +      +Y+
Sbjct: 70  LPCFSWLPTYDTSKLLRDFIAGASLASFQIPLAMSYSTSVAHVPPICGLNALAFTPFVYA 129

Query: 172 FFATSKDVCIGPVAVMSLQTAKAVSKVMAELPADTDITAPVVATALAFLCGLISXXXXXX 231
            F +   + +GP + +SL   +A+ K M     D  +    +   L F+ G I       
Sbjct: 130 VFGSVPHMIVGPESAISLVVGQAIEKQMKH---DKSLDVVNLCLILTFISGAILFCFGIM 186

Query: 232 XXXXXXXXISSTAVAGFMTGSALNIISGQLPALMGYNKLVNTRTSTYKVIIETLKHLPDT 291
                   +S   + GF++   L ++   L   +   K+ N     Y        H P  
Sbjct: 187 RFGYLDSVLSRALLRGFISAVGLVMVLNSLITELKLKKVFNDAPGHY--------HAPFQ 238

Query: 292 KLDAVFGLIP-----LVMLYTWKWLCNSGGPRLVERYTVRGSRKQRIWSATLFYTQALRN 346
           KL  +F   P        L +          RLV++      R  R++   +F  + L  
Sbjct: 239 KLIFLFHYAPGNYHVPTALLSLSSFSILMSLRLVKK------RLSRVYKKVIFVPEIL-- 290

Query: 347 AVIIIVFTAIAWSISHHKKKAPISLLGPVPSGLKDVGVMKLPDGLAAK----IAPELPAS 402
            +++ + T  ++  S  K +  I ++G +  G       K  + L+ K     +    A 
Sbjct: 291 -IVVALVTLGSYHFSF-KLRYNIDIVGDIEVG----DTSKFRNPLSKKNLSLFSELFHAG 344

Query: 403 VIVLLL---EHIAIAKAFGRVNDYRVVPDQELIAIGATNLLGTFFNAYPATGSFSRSALK 459
            +V LL   E    +K+ G   +  V  ++EL+A+G+ NL+G+ F A P+ G + RS + 
Sbjct: 345 FMVALLGFFESTTASKSLGSSYELSVSSNRELVALGSLNLVGSIFGALPSFGGYGRSKIN 404

Query: 460 AKCNVSTPLSGVFSGACVLLAIYCLTSAFQYIPKATLSAVI----IHAVSDLIASYKTTW 515
           A    +T +SGVF G    +    L +A  +IP   LS +     I    +  A  +  +
Sbjct: 405 AYSGAATVMSGVFMGLITCVTSMFLLNAIHHIPVCVLSVITTMVGITLFEEAPADLRYHF 464

Query: 516 SIWRLNPLDLVCFLATVFIAVFSSIENGIYFAMCWSVAVLLFKVAFPRAQFLGRV 570
                N  +L+ F  TV    F S+E GI     +SV  ++      + Q L RV
Sbjct: 465 RCRGYN--ELLIFALTVLTTFFYSVEAGITLGCGYSVIRVIKNSTKSKIQILRRV 517

>CAGL0L09207g Chr12 complement(999571..1001748) [2178 bp, 725 aa]
           {ON} some similarities with uniprot|P53394 Saccharomyces
           cerevisiae YPR003c
          Length = 725

 Score =  107 bits (268), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 111/474 (23%), Positives = 200/474 (42%), Gaps = 40/474 (8%)

Query: 113 LPVINWLPHYNGRWFYQDMVAGITVGCVLVPQSMSYAV-IATLPPQFGLYSSFVGAMIYS 171
           LP ++W+PHY+   F+ D+VAGI++    +P ++SYA  IA + P  GLYS  +  +IY+
Sbjct: 74  LPCMSWIPHYSWEIFFGDLVAGISLASFQIPLALSYATSIAHVEPLCGLYSLAITPLIYA 133

Query: 172 FFATSKDVCIGPVAVMSLQTAKAVSKVMAELPADTDITAPVVATALAFLCGLISXXXXXX 231
            F +   + +GP + +SL   +A  K  A    D++I+   +   + F+ G++       
Sbjct: 134 IFGSVPQMIVGPESAISLVVGQATEKFSAH---DSEISTVTITMMITFISGVVLFFLGSV 190

Query: 232 XXXXXXXXISSTAVAGFMTGSALNIISGQLPALMGYNKLVNTRTSTYKVIIETLKHLPD- 290
                   +S   + GF++   L +I   L   +  N  +      Y   +  +  L   
Sbjct: 191 RLGFLGNILSKALLRGFISSVGLVMIINSLIIELKLNHKLADVAGHYHTPVGKIMFLFRY 250

Query: 291 -----TKLDAVFGLIPLVMLYTWKWLCNSGGPRLVERYTVRGSRKQRIWSATLFYTQALR 345
                 K  A+  LI  ++L + +        +L+ RY              L +   + 
Sbjct: 251 ASEYYHKPTAILSLICFLVLISTRI----AKKKLMNRYRF------------LIFVPEIL 294

Query: 346 NAVIIIVFTAIAWSISHHKKKAPISLLGPVPS-GLKDVG--VMKLPDGLAAKIAPELPAS 402
             V + +  ++ +   H      IS +G   + G   +G  +      L + +  E  A 
Sbjct: 295 LVVSVTILLSLKYDFKH---SYGISTIGEFNADGFGSIGNPLSNENRALYSSLWNEGLAV 351

Query: 403 VIVLLLEHIAIAKAFGRVNDYRVVPDQELIAIGATNLLGTFFNAYPATGSFSRSALKAKC 462
            ++   E    +K+ G   +     ++ELIA+G  N++G+ F A P+ G + RS +    
Sbjct: 352 AMLGFFESTTASKSLGSDYNLTYSSNRELIALGFMNIVGSLFGALPSFGGYGRSKVNVFS 411

Query: 463 NVSTPLSGVFSGACVLLAIYCLTSAFQYIPKATLSAVI----IHAVSDLIASYKTTWSIW 518
              T +SG   G   LL    L     Y P   LS +     I  + ++ +  K  + I 
Sbjct: 412 GGKTVMSGAMVGLITLLTAKLLLPMIHYTPTCVLSVITTVIGISLLEEVPSDIK--FHIH 469

Query: 519 RLNPLDLVCFLATVFIAVFS-SIENGIYFAMCWSVAVLLFKVAFPRAQFLGRVE 571
                +L  F  T FIA  S S+E G+     +S+ +++   A  R Q L ++E
Sbjct: 470 CSGYSELTVFTLT-FIATLSQSVELGVTVGCIYSLILIVKHSALSRIQILAKLE 522

>Kwal_27.11039 s27 complement(614861..617041) [2181 bp, 726 aa] {ON}
           YPR003C - Hypothetical ORF [contig 31] FULL
          Length = 726

 Score =  105 bits (262), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 119/497 (23%), Positives = 213/497 (42%), Gaps = 42/497 (8%)

Query: 113 LPVINWLPHYNGRWFYQDMVAGITVGCVLVPQSMSYAV-IATLPPQFGLYSSFVGAMIYS 171
           LP  +WLP Y+   F  D++AG ++    +P +MSY+  +A +PP  GL +     ++Y+
Sbjct: 85  LPCFSWLPTYDATKFIGDLIAGASLASFQIPLAMSYSTSVAHVPPICGLNALAFTPLVYA 144

Query: 172 FFATSKDVCIGPVAVMSLQTAKAVSKVMAELPADTDITAPVVATALAFLCGLISXXXXXX 231
            F +   + +GP + +SL   +A+ K+      D  +    +   L F+ G I       
Sbjct: 145 VFGSVPHMIVGPESAISLVVGQAIEKLTKH---DASLNVTNLCVVLTFISGSILFSFGLM 201

Query: 232 XXXXXXXXISSTAVAGFMTGSALNIISGQLPALMGYNKLVNTRTSTYKVIIETLKHLPDT 291
                   +S   + GF++   L ++             +N+  S  K + +T K+ P  
Sbjct: 202 RFGFLDSVLSRALLRGFISAVGLIMV-------------INSLISELK-LKDTFKNAPGH 247

Query: 292 KLDAVFGLIPLVMLYTWKWLCNSGGPRLVERYTVRGSRKQRIWSATLFYTQAL--RNAVI 349
                  ++ LV      +   +    LV  +   G+ K         + + +   + ++
Sbjct: 248 YHAPFQKVVFLVHYAPANYHLPTALVSLV-CFAALGALKVIKKKLVKRFKKVIFFPDILV 306

Query: 350 IIVFTAIAWSISHHKKKAPISLLGPVPSGLKDVGVMKLP---DGLAAKIAPEL-PASVIV 405
           ++ F  +       K +  I ++G + +G  +   +K P   D L  K+  +L  A  +V
Sbjct: 307 VVAFATLVSYCYDFKVRYNIDIVGDIETGSSNT--IKNPISKDNL--KLFNDLFHAGFLV 362

Query: 406 LLL---EHIAIAKAFGRVNDYRVVPDQELIAIGATNLLGTFFNAYPATGSFSRSALKAKC 462
            LL   E    +K+ G   D  +  ++EL+A+G+ NL+G+ F A P+ G + RS + A  
Sbjct: 363 ALLGFFESTTASKSLGTNYDLAISSNRELVALGSLNLVGSLFGALPSFGGYGRSKINAYS 422

Query: 463 NVSTPLSGVFSGACVLLAIYCLTSAFQYIPKATLSAVI----IHAVSDLIASYKTTWSIW 518
             +T +SGVF G   L+    L +A ++IP   LS +     I    +  A  K  +   
Sbjct: 423 GAATVMSGVFMGLITLITSKFLLNAIRHIPICVLSVITTMVGISLFEEAPADLKFHFRCR 482

Query: 519 RLNPLDLVCFLATVFIAVFSSIENGIYFAMCWSVAVLLFKVAFPRAQFLGRVEIAELATN 578
             N  +L+ F  TV    F S+E GI     +S+   +        Q LGR+      TN
Sbjct: 483 GYN--ELLTFAITVLTTFFYSVEAGITLGCGYSIIRAIKNSTQSGIQILGRIS----GTN 536

Query: 579 EGVSAGSEFAPLSKDFE 595
             V+A   ++  S D E
Sbjct: 537 RFVNADEFYSASSLDSE 553

>Ecym_7084 Chr7 complement(167032..169101) [2070 bp, 689 aa] {ON}
           similar to Ashbya gossypii AGR213C
          Length = 689

 Score =  105 bits (261), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 115/486 (23%), Positives = 206/486 (42%), Gaps = 51/486 (10%)

Query: 104 NVRQYLRDLLPVINWLPHYNGRWFYQDMVAGITVGCVLVPQSMSYAVIATLPPQFGLYSS 163
           N + Y+   LP++ W P Y+ +   +D++AGI++    +P ++S + +A + P  GL+S 
Sbjct: 39  NTKSYISYYLPILKWFPEYDRKKLGKDLLAGISLTAFQIPFAISLSTMAHVSPYAGLFSL 98

Query: 164 FVGAMIYSFFATSKDVCIGPVAVMSLQTAKAVSKVMAELPADTDITAPVVATALAFLCGL 223
            +  +IY+ F +   + +GP  V+SL   ++  +  +    D+ +T  V+A       G 
Sbjct: 99  VIPPLIYAVFGSVPTMVVGPQTVVSLVVGQS-CEAWSHKSVDSLVTVAVIACT----SGF 153

Query: 224 ISXXXXXXXXXXXXXXISSTAVAGFMTGSA-LNIISGQLPALMG---YNKLV---NTRTS 276
           I               IS   + GF+   A + +I+  LP L     Y   V   N  T+
Sbjct: 154 ILLSMGLFRMGFIDNAISKAFLRGFIFALAIMMLITELLPELQLEDLYRDEVAQGNAGTT 213

Query: 277 TYKVIIETLKHLPD------TKLDAVFGLIPLVMLYTWKWLCNSGGPRLVERYTVRGSRK 330
           T+      LK+ P+       KL  +   I +V  Y  K+               RGS+ 
Sbjct: 214 TWDKFNFILKYGPEHADSFSMKLSFIAFSILMVCKYVKKYFTEK-----------RGSKL 262

Query: 331 QRIWSATLFYTQALRNAVIIIVFTAIAWSISHHKKKAPISLLGPVPSGLKDVGVMKLPDG 390
            R +   L     L  A  I +     WS +   +     ++G +P         K+P  
Sbjct: 263 CRFFPDLL-----LVVAGFIYLSYYNDWSSTMGTR-----IIGNLPPNKNH---FKVPIT 309

Query: 391 LAAKIAPELPASVIVLLLEHIAIAKAF---GRVNDYRVVPDQELIAIGATNLLGTFFNAY 447
              +       S +V +L     A AF   G   D  +  ++EL+++G  N++ + F+A 
Sbjct: 310 SFKEFKELFDISFLVAILGLFDSATAFKAIGEKFDIDISSNRELVSLGLINVVSSVFSAL 369

Query: 448 PATGSFSRSALKAKCNVSTPLSGVFSGACVLLAIYCLTSAFQYIPKATLSAVIIHAVSDL 507
           PA G + RS L   C+  TP++G+      +  +  +  AF Y+P   L+ +I +   +L
Sbjct: 370 PAFGGYGRSKLNILCSAQTPMAGIVVSVAAIFCMNYMMGAFHYLPLCVLAVIISYIAYNL 429

Query: 508 IASYKTT----WSIWRLNPLDLVCFLATVFIAVFSSIENGIYFAMCWSVAVLLFKVAFPR 563
           +    +     WS+      +L+ F+A V   +  S + G+   +  ++  LL      R
Sbjct: 430 LEEIPSDLFFYWSVGGYQ--ELLTFVAVVVTTLVWSPQFGVSIGVGLTMIRLLKHTTQSR 487

Query: 564 AQFLGR 569
            Q LGR
Sbjct: 488 VQILGR 493

>AGR213C Chr7 complement(1156110..1158179) [2070 bp, 689 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YPR003C
          Length = 689

 Score = 97.4 bits (241), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 115/494 (23%), Positives = 207/494 (41%), Gaps = 49/494 (9%)

Query: 104 NVRQYLRDLLPVINWLPHYNGRWFYQDMVAGITVGCVLVPQSMSYAVIATLPPQFGLYSS 163
           + + Y+   LP++ WLP Y+     +DM+AG+T+    +P ++S   +A + P  GLY+ 
Sbjct: 39  DTKSYVSYYLPILRWLPEYSWGKMAKDMLAGLTLTSFQIPLAISLTTMAHVSPYAGLYAL 98

Query: 164 FVGAMIYSFFATSKDVCIGPVAVMSL---QTAKAVSKVMAELPADTDITAPVVATALAFL 220
            +  +IY+ F +   + +GP  V SL   Q+  A +    E P  T      ++  L F 
Sbjct: 99  VIPPLIYAVFGSVPTMVVGPQTVASLVVGQSCDAWAHKSLE-PLMTVAVIGCISGVLVFA 157

Query: 221 CGLISXXXXXXXXXXXXXXISSTAVAGFMTGSAL-NIISGQLPALMGYNKLVNTRTSTYK 279
            G+                IS   + GF +  A+  +I+  LP L      ++ R   YK
Sbjct: 158 MGIFRLGFIDNA-------ISKAFLKGFTSALAVVMLITELLPQLQ-----IDDR---YK 202

Query: 280 VIIETLKHLPDTKLDAVFGLI-------PLVMLYTWKWLCNSGGPRLVERYTVRGSRKQR 332
             ++  K         VF L        P    ++ K    +    L+ +Y  +    + 
Sbjct: 203 QALKEGKVGSAAWDKLVFALENAREYSNP----FSVKLSVAAFSILLLSKYLKKYLTAKY 258

Query: 333 IWSATLFYTQALRNAVIIIVFTAIAWSISHH-KKKAPISLLGPVPSGLKDVGVMKLPDGL 391
            W+   F+   L     ++V  +I  S  +    K  + ++G +P     +   K+P   
Sbjct: 259 GWTKLTFFPDLL-----LVVLGSILLSFYYDWDNKYNLPIVGDLPPNKDHI---KVPIQS 310

Query: 392 AAKIAPELPASVIVLLLEHIAIAKAFGRVN---DYRVVPDQELIAIGATNLLGTFFNAYP 448
             +      AS +V +L     A AF  ++   D  V  ++EL+++G  N++G+ F++ P
Sbjct: 311 FQEFKDLFDASFLVAILGLFESATAFKSISATFDIDVSSNRELVSLGLINIVGSVFSSLP 370

Query: 449 ATGSFSRSALKAKCNVSTPLSGVFSGACVLLAIYCLTSAFQYIPKATLSAVIIHAVSDLI 508
           A G + RS L   C   TP++G+F     +  +  L   F Y+P   L+ +I     +L+
Sbjct: 371 AFGGYGRSKLNIFCGAQTPMAGIFVSLSAIFCMRFLMGVFHYLPLCILAVIISFIAYNLL 430

Query: 509 ASYKTT----WSIWRLNPLDLVCFLATVFIAVFSSIENGIYFAMCWSVAVLLFKVAFPRA 564
                     WS+      +L+ F A V   +  S + G+   +  ++  LL      R 
Sbjct: 431 EEVPGDMFFYWSVSGYQ--ELITFSAVVLSTLIWSPQFGLVMGLGLTMIRLLKHTTQSRI 488

Query: 565 QFLGRVEIAELATN 578
           Q LG+  I +   N
Sbjct: 489 QILGKDPITKKFRN 502

>SAKL0H08800g Chr8 (753145..755007) [1863 bp, 620 aa] {ON} similar
           to uniprot|Q74ZI9 Ashbya gossypii AGR213C AGR213Cp and
           weakly similar to YPR003C uniprot|P53394 Saccharomyces
           cerevisiae YPR003C Hypothetical ORF
          Length = 620

 Score = 81.6 bits (200), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 105/443 (23%), Positives = 179/443 (40%), Gaps = 45/443 (10%)

Query: 144 QSMSYAVIATLPPQFGLYSSFVGAMIYSFFATSKDVCIGPVAVMSL---QTAKAVSKVMA 200
            S+S + +A LPP  GLYS  +  +IY    T     +GP  V+SL   Q+ +  S    
Sbjct: 1   MSISLSTLAHLPPSTGLYSLVIPPLIYCILGTVPTTVVGPQTVVSLVVGQSCEWWSHRSL 60

Query: 201 ELPADTDITAPVVATALAFLCGL--ISXXXXXXXXXXXXXXISSTAVAGFMTGSALNIIS 258
           E P  T      V+  + F  G+  +               +SS A+   +T     +  
Sbjct: 61  E-PLSTVAVIGCVSGGILFAMGVFRMGFIDNALSKAFLRGFVSSLALVMLITELLPELKL 119

Query: 259 GQLPALMGYNKLVNTRT-STYKVIIETLKHLPDTKLDAVFGLIPLVMLYTWKWLCNSGGP 317
            +L A       + T T   ++ I+E      DT              +TW     +   
Sbjct: 120 EELYAHYVAQGYIGTTTWEKFRFILEKAPENSDT--------------FTWNLSLFTFIL 165

Query: 318 RLVERYTVRGSRKQRIWSATLFYTQALRNAVIIIVFTAIAWSISHH-KKKAPISLLGPVP 376
            +  RY  R   ++  W   +F+ +     ++I+V  +I  S +    +   I ++G +P
Sbjct: 166 LMTIRYLKRHLAEKCGWKKCIFFPE-----ILIVVVGSITLSNTQKWSELKGIKIIGDIP 220

Query: 377 SGLKDVGVMKLPDGLAAKIAPELPASVIVLLL---EHIAIAKAFGRVNDYRVVPDQELIA 433
                +   K+P    ++       S ++ +L   E   + K+    ++     ++EL++
Sbjct: 221 PNSDHI---KVPVQTFSEFKELFGTSALIAMLGLFESTIVFKSVCSNSNVDASSNRELVS 277

Query: 434 IGATNLLGTFFNAYPATGSFSRSALKAKCNVSTPLSGVFSGACVLLAIYC---LTSAFQY 490
           +G  NL+ + F+A PA G + RS +   C   T  SGVF     LLAI C   L +AF +
Sbjct: 278 LGVVNLVSSIFSALPAFGGYGRSKMNISCGAQTQFSGVFVS---LLAIICMNFLMNAFHH 334

Query: 491 IPKATLSAVIIHAVSDLI----ASYKTTWSIWRLNPLDLVCFLATVFIAVFSSIENGIYF 546
           +P   L+ +I      L+    A     WS+      +L  F+  V   +  S + G+  
Sbjct: 335 LPICILAVIISTVAFSLLEEAPADLMFYWSVGGYQ--ELFIFIIIVVTTLVWSPQFGVTM 392

Query: 547 AMCWSVAVLLFKVAFPRAQFLGR 569
            MC ++  LL      R Q LGR
Sbjct: 393 GMCLTMIRLLKHSTRSRVQILGR 415

>TBLA0C05270 Chr3 complement(1273901..1276231) [2331 bp, 776 aa]
           {ON} Anc_8.99 YPR003C
          Length = 776

 Score = 64.3 bits (155), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 46/161 (28%), Positives = 73/161 (45%), Gaps = 2/161 (1%)

Query: 407 LLEHIAIAKAFGRVNDYRVVPDQELIAIGATNLLGTFFNAYPATGSFSRSALKAKCNVST 466
             E    +KA G  ++  V  ++EL+A+G +N++ +   A P+ G + RS + A     T
Sbjct: 392 FFESTTASKALGASSERSVSSNRELVALGLSNIVISTLGALPSFGGYGRSKINALSGGKT 451

Query: 467 PLSGVFSGACVLLAIYCLTSAFQYIPKATLSAVIIHAVSDLIASYKTTWSI-WRLNPL-D 524
            LSGVF G   +LAI  L     YIP   LS +       L+       S  WR     +
Sbjct: 452 LLSGVFMGLTTILAILFLMPVIHYIPVCILSVITTVIGFTLLEEIPKEVSFHWRCRGYNE 511

Query: 525 LVCFLATVFIAVFSSIENGIYFAMCWSVAVLLFKVAFPRAQ 565
           L   + T   ++F S+E  +Y    +S+  ++   A  R Q
Sbjct: 512 LFLIVLTFMTSIFYSVETSMYIGCVYSILNIIKHSAKSRIQ 552

 Score = 61.6 bits (148), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 59/119 (49%), Gaps = 4/119 (3%)

Query: 107 QYLRDLLPVINWLPHYNGRWFYQDMVAGITVGCVLVPQSMSYAV-IATLPPQFGLYSSFV 165
           + +R  LP + WLP+Y       D++AGIT+    +P ++SYA  IA + P  GLY+  V
Sbjct: 104 ELIRYYLPCLYWLPNYTRTILVGDLMAGITIASFQIPLALSYATSIAHVDPLSGLYALAV 163

Query: 166 GAMIYSFFATSKDVCIGPVAVMSLQTAKAVSKVMAELPADTDITAPVVATALAFLCGLI 224
               Y+ F ++  + +GP   +SL   + V       P   D+   ++  A+  + G I
Sbjct: 164 SPFFYAIFGSTPQMIVGPEGAISLVIGQCVQSCKKHNP---DLDPILIVIAVTLISGTI 219

>NCAS0C03300 Chr3 (647716..649395) [1680 bp, 559 aa] {ON} 
          Length = 559

 Score = 33.5 bits (75), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 18/77 (23%), Positives = 32/77 (41%)

Query: 716 PPKFLRKWFGKKYSESLEQGVVSDDRPVLRVIAMDWSQVAQVDSTGLQTLHDLRKAVSKY 775
           P KF+   F KKY +  +       +P L ++  D S   +V+ T  Q+ + +   V   
Sbjct: 30  PNKFVNLRFNKKYGDHYDTASTDSRKPKLELVKRDGSDYEEVELTNQQSFYSVEVDVGTP 89

Query: 776 ADRQVEFHFSGIISPWI 792
           + R      +G    W+
Sbjct: 90  SQRVTVLLDTGSSDFWV 106

>NCAS0D00340 Chr4 (50708..51709) [1002 bp, 333 aa] {ON} Anc_2.61
          Length = 333

 Score = 32.3 bits (72), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 44/174 (25%), Positives = 67/174 (38%), Gaps = 27/174 (15%)

Query: 331 QRIWSATLFYTQALR---NAVIIIVFTAIAWSI----SHHKKKAPISLLGPVPSGLKDVG 383
           +R W+  ++ T  LR    A  ++VF  ++++I     H   K    L   V S    + 
Sbjct: 58  RRSWTEAMWCTTTLRILEFASSVLVFALLSFAIHDYHDHGNHKTNFGLAVGVISTFYLLA 117

Query: 384 VMKLPDGLAAKIAPELPASVIVLLLE----------HIAIAKAFGR---VNDYRVVPDQE 430
           VM     L    AP+   + ++L+ E           I IAK+ G     N    V D E
Sbjct: 118 VM-----LGTLFAPQFVFAGVLLIAEGIVCLLWLCAFIVIAKSIGEHGCSNKTVAVYDPE 172

Query: 431 LIAIGATNLLGTFFNAYPATGSFSRSALKAKCNVSTPLSGVFSGACVLLAIYCL 484
             ++      G  +N  P TG ++ S     CN S         A VL  I C+
Sbjct: 173 FGSVPQFVSTGGEYN--PFTGRYTTSNFHRACNTSKTAIAFAGFAFVLFVISCI 224

>YER132C Chr5 complement(425188..430449) [5262 bp, 1753 aa] {ON}
           PMD1Protein with an N-terminal kelch-like domain,
           putative negative regulator of early meiotic gene
           expression; required, with Mds3p, for growth under
           alkaline conditions
          Length = 1753

 Score = 32.7 bits (73), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 33/75 (44%), Gaps = 11/75 (14%)

Query: 256 IISGQLPALMGYNKLVNTR----------TSTYKVIIETLKHLPDTKLDAVFGLIPLVML 305
           I+S  LP L GYNKLVNT+          +    V +    HLP +    +    P  + 
Sbjct: 469 ILSFSLPMLNGYNKLVNTKHTRTNNGIANSHNLNVNLSLYDHLPYSNSSTIEHTNPYTVT 528

Query: 306 YTWKWLCNSGGPRLV 320
             +  L +SG PRL 
Sbjct: 529 QGYS-LDDSGIPRLT 542

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.135    0.411 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 84,057,348
Number of extensions: 3446236
Number of successful extensions: 10534
Number of sequences better than 10.0: 65
Number of HSP's gapped: 10518
Number of HSP's successfully gapped: 105
Length of query: 861
Length of database: 53,481,399
Length adjustment: 118
Effective length of query: 743
Effective length of database: 39,950,811
Effective search space: 29683452573
Effective search space used: 29683452573
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 70 (31.6 bits)