Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_56.237548.272ON58958930520.0
KLTH0G13464g8.272ON59359221570.0
SAKL0H16808g8.272ON65760417570.0
TDEL0F039908.272ON63159016740.0
ZYRO0C01430g8.272ON59060016590.0
AGR076C8.272ON68659716050.0
Kpol_543.448.272ON64359915840.0
KLLA0A04631g8.272ON57960015250.0
TPHA0A017508.272ON63661514320.0
Kwal_26.6669singletonON59058713690.0
TBLA0F030408.272ON90658713461e-176
Ecym_42988.272ON67861011791e-153
KLLA0F17776gna 1ON5535158921e-112
SAKL0C02178gsingletonON5655268501e-106
SAKL0E04246gna 1ON5655258121e-100
Kwal_26.6697singletonON5775125173e-57
TDEL0C00120singletonON5695174804e-52
CAGL0J01375g2.473ON5644804716e-51
Suva_4.553na 2ON5625414717e-51
Smik_4.3638.272ON7654864719e-50
KLTH0E16720gsingletonON5745034631e-49
NCAS0A078102.473ON5684864621e-49
Skud_2.423na 2ON5604824575e-49
Smik_13.2722.473ON5615394523e-48
YMR088C (VBA1)2.473ON5624804523e-48
SAKL0A07480gsingletonON5735004481e-47
TDEL0A024902.473ON5544724401e-46
Suva_13.2652.473ON5614804401e-46
KLTH0H05456gna 3ON5684874364e-46
KNAG0E025602.473ON5784874341e-45
Skud_13.2442.473ON5625384312e-45
NDAI0H022002.473ON5714804304e-45
YDR119W (VBA4)8.272ON7684864356e-45
Skud_4.3798.272ON7594904242e-43
ZYRO0A00330gsingletonON5765254154e-43
KLLA0F13684g2.473ON5715224154e-43
Kwal_14.1585na 3ON5704914092e-42
Suva_2.2798.272ON7754904127e-42
SAKL0E02992g2.473ON5705104022e-41
ZYRO0G03234g2.473ON5624793829e-39
ZYRO0G21868gna 3ON6205273803e-38
YBR293W (VBA2)na 2ON4744543692e-37
KLTH0D05434g2.473ON5765173732e-37
Smik_2.434na 2ON4744493631e-36
Kpol_467.242.473ON3703423464e-35
TPHA0G031502.473ON6005173521e-34
Kwal_26.77552.473ON5594803432e-33
ABL040W2.473ON5675173325e-32
ZYRO0G21890gsingletonON5764413165e-30
Ecym_73992.473ON5634553023e-28
KLTH0B10142gsingletonON5684932989e-28
KLTH0B00132gsingletonON5684952919e-27
NDAI0J012808.272ON6945082761e-24
Kwal_14.728singletonON5684532614e-23
Kwal_26.9616singletonON5623432607e-23
KLTH0C10120gsingletonON6514762562e-22
YKR105C (VBA5)singletonON5824602411e-20
Smik_16.81na 4ON6252202393e-20
KLTH0C10142gsingletonON5733182383e-20
Skud_7.560na 4ON6424622367e-20
TDEL0G03260singletonON6124682359e-20
SAKL0A00726gsingletonON5982722341e-19
YPR198W (SGE1)singletonON5434952294e-19
KNAG0K01020singletonON5994732295e-19
Smik_17.11singletonON5445052268e-19
KLLA0E09879gsingletonON6305182233e-18
Skud_16.503singletonON5435012196e-18
KLTH0D16962gsingletonON5714632171e-17
SAKL0B12716gsingletonON6324922162e-17
CAGL0B02079gna 4ON6241792143e-17
YGR224W (AZR1)na 4ON6131482109e-17
NCAS0C03460na 4ON6301662073e-16
SAKL0C05588gsingletonON6771562037e-16
KLLA0D19941gsingletonON6115182037e-16
SAKL0A08228gsingletonON5691681992e-15
KLTH0B00594gsingletonON6182211992e-15
SAKL0F00198gsingletonON5371871983e-15
Skud_6.14singletonON6364681894e-14
Smik_6.22singletonON6364601876e-14
Suva_10.9singletonON6374561804e-13
Kwal_14.722singletonON6115181733e-12
Skud_18.3singletonON5905101672e-11
Smik_11.368singletonON5804741601e-10
CAGL0E04092gna 5ON6454101582e-10
SAKL0F00792gsingletonON6174091563e-10
KAFR0J016202.242ON5701691537e-10
Suva_26.1singletonON5342751528e-10
YOL158C (ENB1)singletonON6062741511e-09
Suva_8.12na 5ON6334401511e-09
TDEL0H00130singletonON6215111492e-09
Skud_18.6singletonON6105251483e-09
Kpol_1003.112.241ON5811481466e-09
KLTH0D18150gsingletonON6074531394e-08
Smik_21.4singletonON6052741385e-08
TPHA0B00180singletonON6335341386e-08
AFR343C3.84ON5711991376e-08
Skud_8.3na 5ON6314301377e-08
TBLA0F00470singletonON7322731377e-08
KNAG0J02980singletonON6364461342e-07
YCL069W (VBA3)singletonON4583771332e-07
CAGL0J09944g2.242ON5921621332e-07
NDAI0B037702.242ON5711481332e-07
ZYRO0G07414gsingletonON7074371332e-07
Kpol_513.33singletonON6264731322e-07
KLTH0G09372g2.242ON5512471323e-07
YCL073C (GEX1)singletonON6154531314e-07
Skud_13.258.843ON5374181304e-07
KLLA0A10439gsingletonON6344461314e-07
Suva_5.2na 6ON6275301305e-07
YHL040C (ARN1)na 5ON6274341295e-07
YKR106W (GEX2)singletonON6154531288e-07
CAGL0G08624g2.242ON5831521288e-07
TDEL0G05000singletonON1861671228e-07
Kpol_416.6singletonON5974981288e-07
NDAI0H00140na 5ON6324541289e-07
KAFR0J009302.242ON5661721271e-06
Kpol_1053.243.84ON6201181271e-06
NCAS0C047603.84ON6072001271e-06
KAFR0C014803.84ON5771191271e-06
TBLA0E038002.242ON6081521261e-06
Suva_8.435na 7ON5154141261e-06
KLLA0C19272gsingletonON6232831262e-06
KLTH0D00506gsingletonON6164241242e-06
KNAG0E01160singletonON5721691242e-06
NDAI0D010202.242ON5921701233e-06
TDEL0C045802.241ON5571481233e-06
KNAG0I019102.242ON5981481233e-06
YOR378Wna 7ON5154061224e-06
Suva_9.712.241ON5611691224e-06
KLLA0B00352gna 7ON4984131224e-06
TDEL0B005508.843ON5374241224e-06
NCAS0B064802.241ON5871481224e-06
KLLA0C18931gna 8ON5532951215e-06
NCAS0G029902.242ON5811721215e-06
TDEL0H01600singletonON6042741215e-06
Smik_8.1na 5ON6274391216e-06
Kwal_56.22298singletonON6104071216e-06
TPHA0A006203.84ON6341191216e-06
Skud_15.545na 7ON5164141206e-06
TBLA0C01040singletonON6694541207e-06
SAKL0G06600gsingletonON6292821207e-06
TPHA0E032005.180ON6262441207e-06
KNAG0H031808.272ON677881208e-06
Smik_5.22na 6ON6284511208e-06
Kwal_23.48242.242ON5531721198e-06
KNAG0K006303.84ON6181981198e-06
KLLA0C12309g3.84ON5691191199e-06
Suva_10.11singletonON5402221191e-05
Smik_9.482.241ON5912331191e-05
KAFR0D00790singletonON5611351181e-05
YNL065W (AQR1)2.242ON5861721181e-05
ADL258W2.242ON5341981181e-05
YJL219W (HXT9)singletonON5672141181e-05
CAGL0I07447g3.84ON5701201181e-05
KLTH0G09350g2.241ON5631721181e-05
NDAI0A071103.84ON6022061171e-05
KNAG0B06940singletonON5601411172e-05
KAFR0I01560singletonON6324621172e-05
Smik_14.2622.242ON5611721162e-05
KAFR0D00800singletonON5581351162e-05
Skud_14.2672.242ON5621721162e-05
Skud_5.24na 6ON6274511162e-05
Skud_6.16na 9ON5494511162e-05
KLLA0F03311g2.242ON5421721152e-05
Kwal_23.2794singletonON6195191153e-05
Kpol_541.168.843ON5284031153e-05
SAKL0E08778g2.241ON6001501153e-05
SAKL0E06864gna 10ON5731451153e-05
Kpol_1039.192.242ON5731711153e-05
KLTH0C10560gna 7ON5153901153e-05
NCAS0C036002.242ON5721691153e-05
Kwal_33.150205.180ON5971431153e-05
Smik_9.492.242ON5422231143e-05
CAGL0M06281g8.570ON5421891143e-05
NCAS0B037808.272ON5893031143e-05
SAKL0E08756g2.242ON5651741143e-05
YEL065W (SIT1)na 6ON6284511143e-05
YIL120W (QDR1)2.242ON5631481144e-05
SAKL0C09350g3.84ON5781271144e-05
Kwal_23.48142.241ON5291701134e-05
TBLA0B083103.84ON638781135e-05
TBLA0E037902.241ON5501421135e-05
KLTH0G11154gna 10ON5721921135e-05
TBLA0F01600singletonON5671291135e-05
Suva_14.2762.242ON5621691126e-05
TBLA0A03420singletonON5771391126e-05
SAKL0C11066gsingletonON5801181126e-05
Smik_15.560na 7ON5164131127e-05
TBLA0E01970singletonON5781431117e-05
KLTH0C09372g3.84ON6081991118e-05
Suva_4.2singletonON5702001118e-05
KNAG0E01170singletonON5731691119e-05
Suva_15.2915.396ON592851119e-05
Skud_14.406na 11ON5641491119e-05
TPHA0F012902.242ON5621721101e-04
NCAS0I025203.84ON5871391101e-04
TDEL0H04480na 10ON5701441091e-04
Smik_6.24na 9ON5444361091e-04
Skud_9.482.241ON5991481091e-04
KLTH0G18854g8.22ON502711091e-04
TPHA0C031002.241ON6021481091e-04
KLTH0B00110gsingletonON6274091091e-04
Skud_15.513.84ON5871491092e-04
Kpol_416.5singletonON6074391092e-04
TDEL0C045902.242ON5291691082e-04
Suva_13.174na 12ON5411521082e-04
TBLA0G025502.242ON6131501082e-04
Skud_8.1575.395ON592851082e-04
KAFR0G00160singletonON6361081082e-04
TDEL0E022805.396ON587681082e-04
NDAI0D05020singletonON5731111072e-04
KAFR0D00750singletonON557971072e-04
TBLA0A03440singletonON5031451072e-04
TBLA0A033905.394ON5741411073e-04
TDEL0D06500na 13ON5421891073e-04
TPHA0K02330singletonON6314471073e-04
YOL103W (ITR2)3.84ON6091491073e-04
TBLA0C01100na 14ON649871073e-04
ABL210CsingletonON4781561063e-04
TDEL0B019008.446ON6871241063e-04
KLTH0C03806g8.843ON5253811063e-04
TDEL0B07220na 15ON5731491064e-04
YEL069C (HXT13)na 16ON5641441054e-04
YNR072W (HXT17)singletonON5641441054e-04
YDL245C (HXT15)singletonON5671431054e-04
YJR158W (HXT16)singletonON5671431054e-04
YMR011W (HXT2)na 12ON5411521054e-04
TBLA0A01250singletonON5031411054e-04
Smik_15.543.84ON6111491054e-04
TBLA0A01240singletonON5691411055e-04
NCAS0I03160singletonON5751111055e-04
TDEL0D054003.84ON585711055e-04
ZYRO0A01474g2.242ON5381241045e-04
Skud_13.163na 12ON5471521045e-04
Suva_15.623.84ON6091491046e-04
NCAS0A08630singletonON5931291046e-04
NDAI0F01940singletonON5511341037e-04
Smik_5.19na 16ON5671431037e-04
SAKL0D01386g8.843ON5214761037e-04
Smik_14.401na 11ON6361431038e-04
YIL121W (QDR2)2.241ON5421481038e-04
TBLA0H00750singletonON4841521028e-04
TBLA0B00840singletonON6371361038e-04
Suva_13.4678.843ON5434291020.001
NDAI0G063108.22ON5651271020.001
SAKL0F00110gsingletonON6204571020.001
TBLA0A03500singletonON573701020.001
Smik_13.171na 12ON5411521020.001
Suva_9.702.242ON5651481020.001
YHL047C (ARN2)singletonON6202861020.001
NOTE: 1 genes in the same pillar as Kwal_56.23754 were not hit in these BLAST results
LIST: KAFR0B05450

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_56.23754
         (589 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_56.23754 s56 complement(690851..692620) [1770 bp, 589 aa] {...  1180   0.0  
KLTH0G13464g Chr7 complement(1154304..1156085) [1782 bp, 593 aa]...   835   0.0  
SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]...   681   0.0  
TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.2...   649   0.0  
ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {...   643   0.0  
AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON} S...   622   0.0  
Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON} (96992..9...   614   0.0  
KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {...   592   0.0  
TPHA0A01750 Chr1 complement(354061..355971) [1911 bp, 636 aa] {O...   556   0.0  
Kwal_26.6669 s26 complement(14202..15974) [1773 bp, 590 aa] {ON}...   531   0.0  
TBLA0F03040 Chr6 complement(735352..738072) [2721 bp, 906 aa] {O...   523   e-176
Ecym_4298 Chr4 complement(636605..638641) [2037 bp, 678 aa] {ON}...   458   e-153
KLLA0F17776g Chr6 complement(1627198..1628859) [1662 bp, 553 aa]...   348   e-112
SAKL0C02178g Chr3 complement(191542..193239) [1698 bp, 565 aa] {...   332   e-106
SAKL0E04246g Chr5 (336416..338113) [1698 bp, 565 aa] {ON} weakly...   317   e-100
Kwal_26.6697 s26 complement(26786..28519) [1734 bp, 577 aa] {ON}...   203   3e-57
TDEL0C00120 Chr3 complement(7481..9190) [1710 bp, 569 aa] {ON}        189   4e-52
CAGL0J01375g Chr10 (127843..129537) [1695 bp, 564 aa] {ON} simil...   186   6e-51
Suva_4.553 Chr4 (959592..961280) [1689 bp, 562 aa] {ON} YBR293W ...   186   7e-51
Smik_4.363 Chr4 (649481..651778) [2298 bp, 765 aa] {ON} YDR119W ...   186   9e-50
KLTH0E16720g Chr5 (1482846..1484570) [1725 bp, 574 aa] {ON} simi...   182   1e-49
NCAS0A07810 Chr1 complement(1554541..1556247) [1707 bp, 568 aa] ...   182   1e-49
Skud_2.423 Chr2 (756345..758027) [1683 bp, 560 aa] {ON} YBR293W ...   180   5e-49
Smik_13.272 Chr13 complement(427283..428968) [1686 bp, 561 aa] {...   178   3e-48
YMR088C Chr13 complement(443414..445102) [1689 bp, 562 aa] {ON} ...   178   3e-48
SAKL0A07480g Chr1 complement(658699..660420) [1722 bp, 573 aa] {...   177   1e-47
TDEL0A02490 Chr1 (446429..448093) [1665 bp, 554 aa] {ON} Anc_2.4...   174   1e-46
Suva_13.265 Chr13 complement(424929..426614) [1686 bp, 561 aa] {...   174   1e-46
KLTH0H05456g Chr8 (484160..485866) [1707 bp, 568 aa] {ON} simila...   172   4e-46
KNAG0E02560 Chr5 (506517..508253) [1737 bp, 578 aa] {ON} Anc_2.4...   171   1e-45
Skud_13.244 Chr13 complement(417271..418959) [1689 bp, 562 aa] {...   170   2e-45
NDAI0H02200 Chr8 complement(536385..538100) [1716 bp, 571 aa] {O...   170   4e-45
YDR119W Chr4 (688227..690533) [2307 bp, 768 aa] {ON}  VBA4Protei...   172   6e-45
Skud_4.379 Chr4 (659832..662111) [2280 bp, 759 aa] {ON} YDR119W ...   167   2e-43
ZYRO0A00330g Chr1 (19597..21327) [1731 bp, 576 aa] {ON} similar ...   164   4e-43
KLLA0F13684g Chr6 complement(1267367..1269082) [1716 bp, 571 aa]...   164   4e-43
Kwal_14.1585 s14 (377103..378815) [1713 bp, 570 aa] {ON} YMR088C...   162   2e-42
Suva_2.279 Chr2 (482935..485262) [2328 bp, 775 aa] {ON} YDR119W ...   163   7e-42
SAKL0E02992g Chr5 complement(243652..245364) [1713 bp, 570 aa] {...   159   2e-41
ZYRO0G03234g Chr7 (247798..249486) [1689 bp, 562 aa] {ON} simila...   151   9e-39
ZYRO0G21868g Chr7 complement(1799212..1801074) [1863 bp, 620 aa]...   150   3e-38
YBR293W Chr2 (787006..788430) [1425 bp, 474 aa] {ON}  VBA2Permea...   146   2e-37
KLTH0D05434g Chr4 (486319..488049) [1731 bp, 576 aa] {ON} simila...   148   2e-37
Smik_2.434 Chr2 (773094..774518) [1425 bp, 474 aa] {ON} YBR293W ...   144   1e-36
Kpol_467.24 s467 (55523..56632) [1110 bp, 370 aa] {ON} (55523..5...   137   4e-35
TPHA0G03150 Chr7 (670343..672145) [1803 bp, 600 aa] {ON} Anc_2.4...   140   1e-34
Kwal_26.7755 s26 (500034..501713) [1680 bp, 559 aa] {ON} YMR088C...   136   2e-33
ABL040W Chr2 (321534..323237) [1704 bp, 567 aa] {ON} Syntenic ho...   132   5e-32
ZYRO0G21890g Chr7 complement(1801391..1803121) [1731 bp, 576 aa]...   126   5e-30
Ecym_7399 Chr7 complement(820280..821971) [1692 bp, 563 aa] {ON}...   120   3e-28
KLTH0B10142g Chr2 complement(847376..849082) [1707 bp, 568 aa] {...   119   9e-28
KLTH0B00132g Chr2 (4664..6370) [1707 bp, 568 aa] {ON} similar to...   116   9e-27
NDAI0J01280 Chr10 (299922..302006) [2085 bp, 694 aa] {ON} Anc_8....   110   1e-24
Kwal_14.728 s14 complement(11659..13365) [1707 bp, 568 aa] {ON} ...   105   4e-23
Kwal_26.9616 s26 (1294683..1296371) [1689 bp, 562 aa] {ON} YPR19...   104   7e-23
KLTH0C10120g Chr3 (839780..841735) [1956 bp, 651 aa] {ON} simila...   103   2e-22
YKR105C Chr11 complement(658716..660464) [1749 bp, 582 aa] {ON} ...    97   1e-20
Smik_16.81 Chr16 complement(152022..153515,153516..153899) [1878...    97   3e-20
KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} simila...    96   3e-20
Skud_7.560 Chr7 (917668..919596) [1929 bp, 642 aa] {ON} YGR224W ...    96   7e-20
TDEL0G03260 Chr7 (605429..607267) [1839 bp, 612 aa] {ON}               95   9e-20
SAKL0A00726g Chr1 (82164..83960) [1797 bp, 598 aa] {ON} similar ...    95   1e-19
YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasm...    93   4e-19
KNAG0K01020 Chr11 complement(198213..200012) [1800 bp, 599 aa] {...    93   5e-19
Smik_17.11 Chr17 complement(8582..10216) [1635 bp, 544 aa] {ON} ...    92   8e-19
KLLA0E09879g Chr5 complement(874102..875994) [1893 bp, 630 aa] {...    91   3e-18
Skud_16.503 Chr16 (880571..882202) [1632 bp, 543 aa] {ON} YPR198...    89   6e-18
KLTH0D16962g Chr4 (1399514..1401229) [1716 bp, 571 aa] {ON} simi...    88   1e-17
SAKL0B12716g Chr2 (1101141..1103039) [1899 bp, 632 aa] {ON} simi...    88   2e-17
CAGL0B02079g Chr2 complement(191736..193610) [1875 bp, 624 aa] {...    87   3e-17
YGR224W Chr7 (942806..944647) [1842 bp, 613 aa] {ON}  AZR1Plasma...    86   9e-17
NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {O...    84   3e-16
SAKL0C05588g Chr3 (527748..529781) [2034 bp, 677 aa] {ON} simila...    83   7e-16
KLLA0D19941g Chr4 complement(1698889..1700724) [1836 bp, 611 aa]...    83   7e-16
SAKL0A08228g Chr1 complement(732518..734227) [1710 bp, 569 aa] {...    81   2e-15
KLTH0B00594g Chr2 (64332..66188) [1857 bp, 618 aa] {ON} similar ...    81   2e-15
SAKL0F00198g Chr6 complement(10713..12326) [1614 bp, 537 aa] {ON...    81   3e-15
Skud_6.14 Chr6 complement(19547..21457) [1911 bp, 636 aa] {ON} Y...    77   4e-14
Smik_6.22 Chr6 complement(31536..33446) [1911 bp, 636 aa] {ON} Y...    77   6e-14
Suva_10.9 Chr10 complement(12679..14592) [1914 bp, 637 aa] {ON} ...    74   4e-13
Kwal_14.722 s14 (9019..10854) [1836 bp, 611 aa] {ON} YCL073C - H...    71   3e-12
Skud_18.3 Chr18 complement(10782..12554) [1773 bp, 590 aa] {ON} ...    69   2e-11
Smik_11.368 Chr11 complement(649880..651622) [1743 bp, 580 aa] {...    66   1e-10
CAGL0E04092g Chr5 (394380..396317) [1938 bp, 645 aa] {ON} simila...    65   2e-10
SAKL0F00792g Chr6 (70444..72297) [1854 bp, 617 aa] {ON} similar ...    65   3e-10
KAFR0J01620 Chr10 complement(300964..302676) [1713 bp, 570 aa] {...    64   7e-10
Suva_26.1 Chr26 (1..1602) [1602 bp, 534 aa] {ON} YOL158C (REAL)        63   8e-10
YOL158C Chr15 complement(19491..21311) [1821 bp, 606 aa] {ON}  E...    63   1e-09
Suva_8.12 Chr8 complement(20611..22512) [1902 bp, 633 aa] {ON} Y...    63   1e-09
TDEL0H00130 Chr8 complement(10267..12132) [1866 bp, 621 aa] {ON}       62   2e-09
Skud_18.6 Chr18 (14597..16429) [1833 bp, 610 aa] {ON} YCL073C (R...    62   3e-09
Kpol_1003.11 s1003 (33230..34975) [1746 bp, 581 aa] {ON} (33230....    61   6e-09
KLTH0D18150g Chr4 complement(1502817..1504640) [1824 bp, 607 aa]...    58   4e-08
Smik_21.4 Chr21 (1261..3078) [1818 bp, 605 aa] {ON} YOL158C (REAL)     58   5e-08
TPHA0B00180 Chr2 complement(29722..31623) [1902 bp, 633 aa] {ON}       58   6e-08
AFR343C Chr6 complement(1060723..1062438) [1716 bp, 571 aa] {ON}...    57   6e-08
Skud_8.3 Chr8 complement(7094..8989) [1896 bp, 631 aa] {ON} YHL0...    57   7e-08
TBLA0F00470 Chr6 (123691..125889) [2199 bp, 732 aa] {ON}               57   7e-08
KNAG0J02980 Chr10 (571855..573765) [1911 bp, 636 aa] {ON}              56   2e-07
YCL069W Chr3 (9706..11082) [1377 bp, 458 aa] {ON}  VBA3Permease ...    56   2e-07
CAGL0J09944g Chr10 (976274..978052) [1779 bp, 592 aa] {ON} simil...    56   2e-07
NDAI0B03770 Chr2 complement(947945..949660) [1716 bp, 571 aa] {O...    56   2e-07
ZYRO0G07414g Chr7 complement(583978..586101) [2124 bp, 707 aa] {...    56   2e-07
Kpol_513.33 s513 complement(95274..97154) [1881 bp, 626 aa] {ON}...    55   2e-07
KLTH0G09372g Chr7 (780184..781839) [1656 bp, 551 aa] {ON} simila...    55   3e-07
YCL073C Chr3 complement(6479..8326) [1848 bp, 615 aa] {ON}  GEX1...    55   4e-07
Skud_13.25 Chr13 (37872..39485) [1614 bp, 537 aa] {ON} YML116W (...    55   4e-07
KLLA0A10439g Chr1 complement(913342..915246) [1905 bp, 634 aa] {...    55   4e-07
Suva_5.2 Chr5 (3340..5223) [1884 bp, 627 aa] {ON} YEL065W (REAL)       55   5e-07
YHL040C Chr8 complement(19088..20971) [1884 bp, 627 aa] {ON}  AR...    54   5e-07
YKR106W Chr11 (661442..663289) [1848 bp, 615 aa] {ON}  GEX2Proto...    54   8e-07
CAGL0G08624g Chr7 complement(811931..813682) [1752 bp, 583 aa] {...    54   8e-07
TDEL0G05000 Chr7 (938512..939072) [561 bp, 186 aa] {ON}                52   8e-07
Kpol_416.6 s416 (26742..28535) [1794 bp, 597 aa] {ON} (26742..28...    54   8e-07
NDAI0H00140 Chr8 complement(10247..12145) [1899 bp, 632 aa] {ON}       54   9e-07
KAFR0J00930 Chr10 (168674..170374) [1701 bp, 566 aa] {ON} Anc_2....    54   1e-06
Kpol_1053.24 s1053 (36161..38023) [1863 bp, 620 aa] {ON} (36161....    54   1e-06
NCAS0C04760 Chr3 (969811..971634) [1824 bp, 607 aa] {ON} Anc_3.84      54   1e-06
KAFR0C01480 Chr3 complement(301605..303338) [1734 bp, 577 aa] {O...    54   1e-06
TBLA0E03800 Chr5 (956468..958294) [1827 bp, 608 aa] {ON} Anc_2.2...    53   1e-06
Suva_8.435 Chr8 (786917..788464) [1548 bp, 515 aa] {ON} YOR378W ...    53   1e-06
KLLA0C19272g Chr3 complement(1717903..1719774) [1872 bp, 623 aa]...    53   2e-06
KLTH0D00506g Chr4 (47320..49170) [1851 bp, 616 aa] {ON} similar ...    52   2e-06
KNAG0E01160 Chr5 (228323..230041) [1719 bp, 572 aa] {ON}               52   2e-06
NDAI0D01020 Chr4 complement(229357..231135) [1779 bp, 592 aa] {O...    52   3e-06
TDEL0C04580 Chr3 (829514..831187) [1674 bp, 557 aa] {ON} Anc_2.2...    52   3e-06
KNAG0I01910 Chr9 complement(373073..374869) [1797 bp, 598 aa] {O...    52   3e-06
YOR378W Chr15 (1049511..1051058) [1548 bp, 515 aa] {ON} Putative...    52   4e-06
Suva_9.71 Chr9 (129275..130960) [1686 bp, 561 aa] {ON} YIL121W (...    52   4e-06
KLLA0B00352g Chr2 (22476..23972) [1497 bp, 498 aa] {ON} highly s...    52   4e-06
TDEL0B00550 Chr2 (105483..107096) [1614 bp, 537 aa] {ON} Anc_8.8...    52   4e-06
NCAS0B06480 Chr2 complement(1225523..1227286) [1764 bp, 587 aa] ...    52   4e-06
KLLA0C18931g Chr3 (1680133..1681794) [1662 bp, 553 aa] {ON} unip...    51   5e-06
NCAS0G02990 Chr7 complement(549460..551205) [1746 bp, 581 aa] {O...    51   5e-06
TDEL0H01600 Chr8 complement(273692..275506) [1815 bp, 604 aa] {O...    51   5e-06
Smik_8.1 Chr8 complement(2797..4680) [1884 bp, 627 aa] {ON} YHL0...    51   6e-06
Kwal_56.22298 s56 (31819..33651) [1833 bp, 610 aa] {ON} YHL040C ...    51   6e-06
TPHA0A00620 Chr1 (111175..113079) [1905 bp, 634 aa] {ON} Anc_3.8...    51   6e-06
Skud_15.545 Chr15 (988549..990099) [1551 bp, 516 aa] {ON} YOR378...    51   6e-06
TBLA0C01040 Chr3 (208261..210270) [2010 bp, 669 aa] {ON}               51   7e-06
SAKL0G06600g Chr7 complement(549492..551381) [1890 bp, 629 aa] {...    51   7e-06
TPHA0E03200 Chr5 complement(677352..679232) [1881 bp, 626 aa] {O...    51   7e-06
KNAG0H03180 Chr8 complement(595395..597428) [2034 bp, 677 aa] {O...    51   8e-06
Smik_5.22 Chr5 (30048..31934) [1887 bp, 628 aa] {ON} YEL065W (REAL)    51   8e-06
Kwal_23.4824 s23 (883258..884919) [1662 bp, 553 aa] {ON} YNL065W...    50   8e-06
KNAG0K00630 Chr11 (113522..115378) [1857 bp, 618 aa] {ON} Anc_3....    50   8e-06
KLLA0C12309g Chr3 (1046848..1048557) [1710 bp, 569 aa] {ON} high...    50   9e-06
Suva_10.11 Chr10 (18934..20556) [1623 bp, 540 aa] {ON} YOR378W (...    50   1e-05
Smik_9.48 Chr9 (110001..111776) [1776 bp, 591 aa] {ON} YIL121W (...    50   1e-05
KAFR0D00790 Chr4 (168111..169796) [1686 bp, 561 aa] {ON}               50   1e-05
YNL065W Chr14 (503724..505484) [1761 bp, 586 aa] {ON}  AQR1Plasm...    50   1e-05
ADL258W Chr4 (247672..249276) [1605 bp, 534 aa] {ON} Syntenic ho...    50   1e-05
YJL219W Chr10 (19497..21200) [1704 bp, 567 aa] {ON}  HXT9Putativ...    50   1e-05
CAGL0I07447g Chr9 (716374..718086) [1713 bp, 570 aa] {ON} highly...    50   1e-05
KLTH0G09350g Chr7 (778062..779753) [1692 bp, 563 aa] {ON} simila...    50   1e-05
NDAI0A07110 Chr1 complement(1620110..1621918) [1809 bp, 602 aa] ...    50   1e-05
KNAG0B06940 Chr2 (1377486..1379168) [1683 bp, 560 aa] {ON}             50   2e-05
KAFR0I01560 Chr9 (328940..330838) [1899 bp, 632 aa] {ON}  YHL040C      50   2e-05
Smik_14.262 Chr14 (484135..485820) [1686 bp, 561 aa] {ON} YNL065...    49   2e-05
KAFR0D00800 Chr4 complement(170100..171776) [1677 bp, 558 aa] {O...    49   2e-05
Skud_14.267 Chr14 (493984..495672) [1689 bp, 562 aa] {ON} YNL065...    49   2e-05
Skud_5.24 Chr5 (26839..28722) [1884 bp, 627 aa] {ON} YEL065W (REAL)    49   2e-05
Skud_6.16 Chr6 (26284..27933) [1650 bp, 549 aa] {ON} YOR378W (REAL)    49   2e-05
KLLA0F03311g Chr6 (311639..313267) [1629 bp, 542 aa] {ON} simila...    49   2e-05
Kwal_23.2794 s23 (15194..17053) [1860 bp, 619 aa] {ON} YHL047C (...    49   3e-05
Kpol_541.16 s541 complement(43396..44982) [1587 bp, 528 aa] {ON}...    49   3e-05
SAKL0E08778g Chr5 complement(716961..718763) [1803 bp, 600 aa] {...    49   3e-05
SAKL0E06864g Chr5 (563946..565667) [1722 bp, 573 aa] {ON} simila...    49   3e-05
Kpol_1039.19 s1039 (63222..64943) [1722 bp, 573 aa] {ON} (63222....    49   3e-05
KLTH0C10560g Chr3 (875216..876763) [1548 bp, 515 aa] {ON} simila...    49   3e-05
NCAS0C03600 Chr3 complement(719502..721220) [1719 bp, 572 aa] {O...    49   3e-05
Kwal_33.15020 s33 (919334..921127) [1794 bp, 597 aa] {ON} YGR138...    49   3e-05
Smik_9.49 Chr9 (110073..111698) [1626 bp, 542 aa] {ON} YIL121W (...    49   3e-05
CAGL0M06281g Chr13 (651932..653560) [1629 bp, 542 aa] {ON} simil...    49   3e-05
NCAS0B03780 Chr2 complement(674904..676673) [1770 bp, 589 aa] {O...    49   3e-05
SAKL0E08756g Chr5 complement(714902..716599) [1698 bp, 565 aa] {...    49   3e-05
YEL065W Chr5 (27657..29543) [1887 bp, 628 aa] {ON}  SIT1Ferrioxa...    49   3e-05
YIL120W Chr9 (134417..136108) [1692 bp, 563 aa] {ON}  QDR1Multid...    49   4e-05
SAKL0C09350g Chr3 complement(849691..851427) [1737 bp, 578 aa] {...    49   4e-05
Kwal_23.4814 s23 (881364..882953) [1590 bp, 529 aa] {ON} YIL121W...    48   4e-05
TBLA0B08310 Chr2 complement(1985796..1987712) [1917 bp, 638 aa] ...    48   5e-05
TBLA0E03790 Chr5 (953931..955583) [1653 bp, 550 aa] {ON} Anc_2.2...    48   5e-05
KLTH0G11154g Chr7 complement(940157..941875) [1719 bp, 572 aa] {...    48   5e-05
TBLA0F01600 Chr6 complement(399573..401276) [1704 bp, 567 aa] {O...    48   5e-05
Suva_14.276 Chr14 (502686..504374) [1689 bp, 562 aa] {ON} YNL065...    48   6e-05
TBLA0A03420 Chr1 (824716..826449) [1734 bp, 577 aa] {ON}               48   6e-05
SAKL0C11066g Chr3 complement(998593..1000335) [1743 bp, 580 aa] ...    48   6e-05
Smik_15.560 Chr15 (995453..997003) [1551 bp, 516 aa] {ON} YOR378...    48   7e-05
TBLA0E01970 Chr5 complement(478901..480637) [1737 bp, 578 aa] {O...    47   7e-05
KLTH0C09372g Chr3 (778251..780077) [1827 bp, 608 aa] {ON} highly...    47   8e-05
Suva_4.2 Chr4 (4514..6226) [1713 bp, 570 aa] {ON} YDR497C (REAL)       47   8e-05
KNAG0E01170 Chr5 (230542..232263) [1722 bp, 573 aa] {ON}               47   9e-05
Suva_15.291 Chr15 complement(497138..498916) [1779 bp, 592 aa] {...    47   9e-05
Skud_14.406 Chr14 (740510..742204) [1695 bp, 564 aa] {ON} YNR072...    47   9e-05
TPHA0F01290 Chr6 complement(294550..296238) [1689 bp, 562 aa] {O...    47   1e-04
NCAS0I02520 Chr9 complement(472075..473838) [1764 bp, 587 aa] {O...    47   1e-04
TDEL0H04480 Chr8 complement(774396..776108) [1713 bp, 570 aa] {O...    47   1e-04
Smik_6.24 Chr6 (39520..41154) [1635 bp, 544 aa] {ON} YMR279C (REAL)    47   1e-04
Skud_9.48 Chr9 (109346..111145) [1800 bp, 599 aa] {ON} YIL120W (...    47   1e-04
KLTH0G18854g Chr7 complement(1628440..1629948) [1509 bp, 502 aa]...    47   1e-04
TPHA0C03100 Chr3 (684842..686650) [1809 bp, 602 aa] {ON} Anc_2.2...    47   1e-04
KLTH0B00110g Chr2 complement(1655..3538) [1884 bp, 627 aa] {ON} ...    47   1e-04
Skud_15.51 Chr15 (83321..84391,84482..85174) [1764 bp, 587 aa] {...    47   2e-04
Kpol_416.5 s416 (23208..25031) [1824 bp, 607 aa] {ON} (23208..25...    47   2e-04
TDEL0C04590 Chr3 (831668..833257) [1590 bp, 529 aa] {ON} Anc_2.2...    46   2e-04
Suva_13.174 Chr13 (278964..280589) [1626 bp, 541 aa] {ON} YMR011...    46   2e-04
TBLA0G02550 Chr7 complement(668523..670364) [1842 bp, 613 aa] {O...    46   2e-04
Skud_8.157 Chr8 complement(268495..270273) [1779 bp, 592 aa] {ON...    46   2e-04
KAFR0G00160 Chr7 (51436..53346) [1911 bp, 636 aa] {ON}                 46   2e-04
TDEL0E02280 Chr5 (438756..440519) [1764 bp, 587 aa] {ON} Anc_5.3...    46   2e-04
NDAI0D05020 Chr4 complement(1197075..1198796) [1722 bp, 573 aa] ...    46   2e-04
KAFR0D00750 Chr4 complement(150046..151719) [1674 bp, 557 aa] {O...    46   2e-04
TBLA0A03440 Chr1 complement(832040..833551) [1512 bp, 503 aa] {O...    46   2e-04
TBLA0A03390 Chr1 complement(806095..807819) [1725 bp, 574 aa] {O...    46   3e-04
TDEL0D06500 Chr4 (1166063..1167691) [1629 bp, 542 aa] {ON}             46   3e-04
TPHA0K02330 Chr11 (506158..508053) [1896 bp, 631 aa] {ON}              46   3e-04
YOL103W Chr15 (124001..125830) [1830 bp, 609 aa] {ON}  ITR2Myo-i...    46   3e-04
TBLA0C01100 Chr3 (227542..229491) [1950 bp, 649 aa] {ON} Anc_1.432     46   3e-04
ABL210C Chr2 complement(7071..8507) [1437 bp, 478 aa] {ON} Non-s...    45   3e-04
TDEL0B01900 Chr2 complement(335873..337936) [2064 bp, 687 aa] {O...    45   3e-04
KLTH0C03806g Chr3 (332195..333772) [1578 bp, 525 aa] {ON} simila...    45   3e-04
TDEL0B07220 Chr2 complement(1271585..1273306) [1722 bp, 573 aa] ...    45   4e-04
YEL069C Chr5 complement(21537..23231) [1695 bp, 564 aa] {ON}  HX...    45   4e-04
YNR072W Chr14 (772657..774351) [1695 bp, 564 aa] {ON}  HXT17Hexo...    45   4e-04
YDL245C Chr4 complement(11657..13360) [1704 bp, 567 aa] {ON}  HX...    45   4e-04
YJR158W Chr10 (732440..734143) [1704 bp, 567 aa] {ON}  HXT16Prot...    45   4e-04
YMR011W Chr13 (288079..289704) [1626 bp, 541 aa] {ON}  HXT2High-...    45   4e-04
TBLA0A01250 Chr1 (294923..296434) [1512 bp, 503 aa] {ON}               45   4e-04
Smik_15.54 Chr15 (87058..88893) [1836 bp, 611 aa] {ON} YOL103W (...    45   4e-04
TBLA0A01240 Chr1 complement(289083..290792) [1710 bp, 569 aa] {O...    45   5e-04
NCAS0I03160 Chr9 (587668..589395) [1728 bp, 575 aa] {ON}               45   5e-04
TDEL0D05400 Chr4 complement(978323..980080) [1758 bp, 585 aa] {O...    45   5e-04
ZYRO0A01474g Chr1 (121026..122642) [1617 bp, 538 aa] {ON} simila...    45   5e-04
Skud_13.163 Chr13 (274262..275905) [1644 bp, 547 aa] {ON} YHR094...    45   5e-04
Suva_15.62 Chr15 (97049..98878) [1830 bp, 609 aa] {ON} YOL103W (...    45   6e-04
NCAS0A08630 Chr1 complement(1704322..1706103) [1782 bp, 593 aa] ...    45   6e-04
NDAI0F01940 Chr6 (471792..473447) [1656 bp, 551 aa] {ON}               44   7e-04
Smik_5.19 Chr5 complement(25102..26805) [1704 bp, 567 aa] {ON} Y...    44   7e-04
SAKL0D01386g Chr4 (109619..111184) [1566 bp, 521 aa] {ON} unipro...    44   7e-04
Smik_14.401 Chr14 (716260..718170) [1911 bp, 636 aa] {ON} YNR072...    44   8e-04
YIL121W Chr9 (132244..133872) [1629 bp, 542 aa] {ON}  QDR2Multid...    44   8e-04
TBLA0H00750 Chr8 (171288..172742) [1455 bp, 484 aa] {ON} Anc_2.2...    44   8e-04
TBLA0B00840 Chr2 complement(188743..190656) [1914 bp, 637 aa] {O...    44   8e-04
Suva_13.467 Chr13 complement(807375..809006) [1632 bp, 543 aa] {...    44   0.001
NDAI0G06310 Chr7 (1563437..1565134) [1698 bp, 565 aa] {ON} Anc_8...    44   0.001
SAKL0F00110g Chr6 (1456..3318) [1863 bp, 620 aa] {ON} similar to...    44   0.001
TBLA0A03500 Chr1 complement(863154..864875) [1722 bp, 573 aa] {O...    44   0.001
Smik_13.171 Chr13 (279108..280733) [1626 bp, 541 aa] {ON} YDR345...    44   0.001
Suva_9.70 Chr9 (127105..128802) [1698 bp, 565 aa] {ON} YIL120W (...    44   0.001
YHL047C Chr8 complement(8351..10213) [1863 bp, 620 aa] {ON}  ARN...    44   0.001
TBLA0A03700 Chr1 (925610..927328) [1719 bp, 572 aa] {ON}               44   0.001
Kwal_56.22724 s56 complement(253699..255435) [1737 bp, 578 aa] {...    44   0.001
KLLA0D19945g Chr4 (1701681..1703615) [1935 bp, 644 aa] {ON} simi...    44   0.001
NDAI0D05010 Chr4 complement(1193201..1194925) [1725 bp, 574 aa] ...    44   0.001
YOL156W Chr15 (25273..26976) [1704 bp, 567 aa] {ON}  HXT11Putati...    44   0.001
Kwal_27.11638 s27 (886806..888977) [2172 bp, 723 aa] {ON} YDL199...    44   0.001
KAFR0E02030 Chr5 (404370..406016) [1647 bp, 548 aa] {ON}               44   0.001
KAFR0F02800 Chr6 (556502..558157) [1656 bp, 551 aa] {ON}               44   0.001
KAFR0F04080 Chr6 complement(795772..797421) [1650 bp, 549 aa] {O...    44   0.001
NCAS0A03030 Chr1 complement(593557..595281) [1725 bp, 574 aa] {O...    43   0.002
KLTH0B03894g Chr2 complement(317072..318892) [1821 bp, 606 aa] {...    43   0.002
KNAG0G03430 Chr7 complement(734828..736456) [1629 bp, 542 aa] {O...    43   0.002
Smik_14.13 Chr14 complement(23204..24826) [1623 bp, 540 aa] {ON}...    43   0.002
Skud_4.771 Chr4 complement(1363449..1365203) [1755 bp, 584 aa] {...    43   0.002
ZYRO0A13618g Chr1 (1083024..1084613) [1590 bp, 529 aa] {ON} simi...    43   0.002
NCAS0F04060 Chr6 (809459..811291) [1833 bp, 610 aa] {ON}               43   0.002
KAFR0D00740 Chr4 complement(142941..144647) [1707 bp, 568 aa] {O...    43   0.002
Kpol_2002.86 s2002 (201096..203006) [1911 bp, 636 aa] {ON} (2010...    43   0.002
KNAG0B04370 Chr2 (835663..837336) [1674 bp, 557 aa] {ON}               43   0.002
NCAS0I03210 Chr9 (600725..602431) [1707 bp, 568 aa] {ON}               42   0.003
Skud_4.809 Chr4 (1427842..1429548) [1707 bp, 568 aa] {ON} YDR536...    42   0.003
YNL318C Chr14 complement(38707..40329) [1623 bp, 540 aa] {ON}  H...    42   0.003
CAGL0A01826g Chr1 complement(184013..185779) [1767 bp, 588 aa] {...    42   0.003
TBLA0A03460 Chr1 complement(845685..847391) [1707 bp, 568 aa] {ON}     42   0.003
TBLA0A03480 Chr1 (859635..861359) [1725 bp, 574 aa] {ON}               42   0.003
SAKL0H12518g Chr8 complement(1064480..1066672) [2193 bp, 730 aa]...    42   0.003
KLTH0B00330g Chr2 (29891..31591) [1701 bp, 566 aa] {ON} highly s...    42   0.003
Skud_14.21 Chr14 complement(32206..33831) [1626 bp, 541 aa] {ON}...    42   0.003
KLTH0E10406g Chr5 (938423..940624) [2202 bp, 733 aa] {ON} weakly...    42   0.003
TBLA0A03430 Chr1 complement(827449..829143) [1695 bp, 564 aa] {O...    42   0.003
TBLA0A03410 Chr1 complement(815181..816950) [1770 bp, 589 aa] {O...    42   0.003
KLLA0E20945g Chr5 (1870154..1871740) [1587 bp, 528 aa] {ON} weak...    42   0.003
SAKL0E00132g Chr5 (3269..5131) [1863 bp, 620 aa] {ON} similar to...    42   0.004
TBLA0A03470 Chr1 complement(849164..850900) [1737 bp, 578 aa] {ON}     42   0.004
Kwal_56.24841 s56 complement(1167890..1169425) [1536 bp, 511 aa]...    42   0.004
ZYRO0C00374g Chr3 (23229..24923) [1695 bp, 564 aa] {ON} similar ...    42   0.004
NDAI0K00400 Chr11 (90040..91701) [1662 bp, 553 aa] {ON}                42   0.004
ABR223C Chr2 complement(820634..822508) [1875 bp, 624 aa] {ON} S...    42   0.004
SAKL0F00440g Chr6 complement(36452..38086) [1635 bp, 544 aa] {ON...    42   0.004
Skud_6.12 Chr6 (17593..18687,18791..19108) [1413 bp, 470 aa] {ON...    42   0.004
Smik_25.4 Chr25 (8471..9415) [945 bp, 315 aa] {ON} YJL214W (REAL)      42   0.004
Skud_4.5 Chr4 complement(9302..11023) [1722 bp, 573 aa] {ON} YJR...    42   0.004
Ecym_1317 Chr1 complement(643844..645484) [1641 bp, 546 aa] {ON}...    42   0.004
TBLA0A04910 Chr1 complement(1211111..1212838) [1728 bp, 575 aa] ...    42   0.004
TBLA0J00100 Chr10 complement(1866..3590) [1725 bp, 574 aa] {ON}        42   0.005
TBLA0B04640 Chr2 complement(1082147..1083595) [1449 bp, 482 aa] ...    42   0.005
AFL205C Chr6 complement(49039..50679) [1641 bp, 546 aa] {ON} Syn...    42   0.005
TBLA0A03400 Chr1 complement(810961..812685) [1725 bp, 574 aa] {O...    42   0.005
KLLA0E09021g Chr5 (804915..806615) [1701 bp, 566 aa] {ON} unipro...    42   0.005
NCAS0H01890 Chr8 complement(365526..367301) [1776 bp, 591 aa] {O...    42   0.005
KNAG0C04620 Chr3 complement(906275..907915) [1641 bp, 546 aa] {O...    42   0.006
Skud_7.620 Chr7 complement(1041205..1041522,1041626..1042714) [1...    41   0.006
NCAS0E01350 Chr5 complement(261125..262696) [1572 bp, 523 aa] {O...    41   0.006
KNAG0J00260 Chr10 (37950..39602) [1653 bp, 550 aa] {ON} Anc_8.84...    42   0.006
KLTH0E02750g Chr5 (248224..249927) [1704 bp, 567 aa] {ON} highly...    42   0.006
YDR497C Chr4 complement(1443713..1445467) [1755 bp, 584 aa] {ON}...    42   0.006
Ecym_1319 Chr1 complement(649182..650789) [1608 bp, 535 aa] {ON}...    41   0.006
ZYRO0A09878g Chr1 (800187..802235) [2049 bp, 682 aa] {ON} conser...    41   0.007
KLTH0H16214g Chr8 complement(1398230..1399885) [1656 bp, 551 aa]...    41   0.007
Kwal_55.20064 s55 (235602..236315) [714 bp, 238 aa] {ON} YHR094C...    40   0.007
Kwal_27.10245 s27 (259090..260637) [1548 bp, 515 aa] {ON} YML116...    41   0.007
TDEL0E02300 Chr5 (447834..449537) [1704 bp, 567 aa] {ON}  YIL170W      41   0.008
AFR602W Chr6 (1523461..1525137) [1677 bp, 558 aa] {ON} Non-synte...    41   0.008
TDEL0G04740 Chr7 complement(865319..867124) [1806 bp, 601 aa] {O...    41   0.008
CAGL0D02640g Chr4 (274285..275979) [1695 bp, 564 aa] {ON} highly...    41   0.008
CAGL0D02662g Chr4 complement(278099..279793) [1695 bp, 564 aa] {...    41   0.008
Smik_113.1 Chr113 complement(3..554) [552 bp, 184 aa] {ON} YOL15...    40   0.008
TDEL0E02310 Chr5 (450790..452493) [1704 bp, 567 aa] {ON} Anc_5.3...    41   0.008
Kpol_534.27 s534 (61814..63322) [1509 bp, 502 aa] {ON} (61814..6...    41   0.008
Suva_2.674 Chr2 complement(1195582..1197321) [1740 bp, 579 aa] {...    41   0.009
AFR333W Chr6 (1041317..1042819) [1503 bp, 500 aa] {ON} Non-synte...    41   0.009
Smik_10.8 Chr10 (9814..11523) [1710 bp, 569 aa] {ON} YJL214W (REAL)    41   0.009
Kwal_14.854 s14 complement(82977..84689) [1713 bp, 570 aa] {ON} ...    41   0.009
ZYRO0B06688g Chr2 complement(535548..537329) [1782 bp, 593 aa] {...    41   0.009
TBLA0B04810 Chr2 complement(1130085..1131812) [1728 bp, 575 aa] ...    41   0.009
AFL207C Chr6 complement(44349..45968) [1620 bp, 539 aa] {ON} Unc...    41   0.009
Smik_4.46 Chr4 (89787..92432) [2646 bp, 881 aa] {ON} YDL194W (REAL)    41   0.009
TDEL0B03990 Chr2 (713794..715239) [1446 bp, 481 aa] {ON} Anc_6.1...    41   0.010
Skud_4.64 Chr4 (108965..111619) [2655 bp, 884 aa] {ON} YDL194W (...    41   0.010
CAGL0A02321g Chr1 complement(252192..253862) [1671 bp, 556 aa] {...    40   0.011
NDAI0D00820 Chr4 complement(183287..184975) [1689 bp, 562 aa] {O...    40   0.011
KAFR0D00930 Chr4 complement(195566..197410) [1845 bp, 614 aa] {O...    40   0.011
YDL194W Chr4 (111580..114234) [2655 bp, 884 aa] {ON}  SNF3Plasma...    40   0.012
Smik_6.68 Chr6 (125842..127482) [1641 bp, 546 aa] {ON} YFL011W (...    40   0.012
KLLA0C00220g Chr3 (13632..15506) [1875 bp, 624 aa] {ON} similar ...    40   0.012
NCAS0H03600 Chr8 complement(683969..685651) [1683 bp, 560 aa] {O...    40   0.013
KAFR0B05450 Chr2 complement(1116514..1118391) [1878 bp, 625 aa] ...    40   0.013
TBLA0D05800 Chr4 complement(1435290..1437014) [1725 bp, 574 aa] ...    40   0.013
Ecym_7258 Chr7 complement(543654..545570) [1917 bp, 638 aa] {ON}...    40   0.013
NDAI0F02060 Chr6 complement(505217..506725) [1509 bp, 502 aa] {O...    40   0.014
Smik_4.774 Chr4 complement(1365084..1366838) [1755 bp, 584 aa] {...    40   0.014
Kwal_34.15711 s34 (21213..23069) [1857 bp, 618 aa] {ON} YHL047C ...    40   0.015
KNAG0E04270 Chr5 (849856..851529) [1674 bp, 557 aa] {ON}               40   0.015
Smik_13.18 Chr13 (34422..36059) [1638 bp, 545 aa] {ON} YML116W (...    40   0.016
TDEL0A04250 Chr1 (756579..758300) [1722 bp, 573 aa] {ON}  YBR298C      40   0.016
TBLA0D05810 Chr4 complement(1441639..1443363) [1725 bp, 574 aa] ...    40   0.016
KLTH0D00110g Chr4 (796..2658) [1863 bp, 620 aa] {ON} similar to ...    40   0.017
KLTH0B10450g Chr2 complement(885429..887291) [1863 bp, 620 aa] {...    40   0.017
TPHA0M00120 Chr13 (23458..25317) [1860 bp, 619 aa] {ON}                40   0.018
KLLA0E24113g Chr5 complement(2148115..2149842) [1728 bp, 575 aa]...    40   0.018
TDEL0C00450 Chr3 (65197..66762) [1566 bp, 521 aa] {ON} Anc_8.22 ...    40   0.019
KNAG0I00110 Chr9 complement(5329..7020) [1692 bp, 563 aa] {ON}         40   0.019
AFL204C Chr6 complement(51587..53194) [1608 bp, 535 aa] {ON} Unc...    40   0.019
Smik_6.20 Chr6 (28923..30632) [1710 bp, 569 aa] {ON} YJL219W (REAL)    40   0.019
Skud_96.1 Chr96 (1..624) [624 bp, 208 aa] {ON} YOL156W (REAL)          39   0.020
Suva_14.21 Chr14 complement(34919..36544) [1626 bp, 541 aa] {ON}...    40   0.020
Skud_6.61 Chr6 (114670..116310) [1641 bp, 546 aa] {ON} YFL011W (...    40   0.021
ZYRO0D11088g Chr4 complement(937064..938680) [1617 bp, 538 aa] {...    40   0.021
ZYRO0G00286g Chr7 (18542..20311) [1770 bp, 589 aa] {ON} highly s...    40   0.022
NCAS0A05720 Chr1 (1117491..1119182) [1692 bp, 563 aa] {ON}             40   0.023
NDAI0F01930 Chr6 (467932..469626) [1695 bp, 564 aa] {ON}               39   0.024
YJL214W Chr10 (26887..28596) [1710 bp, 569 aa] {ON}  HXT8Protein...    39   0.024
Smik_12.140 Chr12 (270030..271751) [1722 bp, 573 aa] {ON} YLR081...    39   0.025
Suva_4.54 Chr4 (99974..102646) [2673 bp, 890 aa] {ON} YDL194W (R...    40   0.026
TBLA0A08530 Chr1 (2104870..2106717) [1848 bp, 615 aa] {ON} Anc_4...    39   0.026
Suva_15.419 Chr15 (740086..741852) [1767 bp, 588 aa] {ON} YLR081...    39   0.027
SAKL0C00154g Chr3 complement(4145..5860) [1716 bp, 571 aa] {ON} ...    39   0.027
KNAG0D05370 Chr4 (984855..986225) [1371 bp, 456 aa] {ON}               39   0.028
Suva_12.263 Chr12 (430196..431659) [1464 bp, 487 aa] {ON} YNR072...    39   0.028
TDEL0D06610 Chr4 complement(1195341..1196834) [1494 bp, 497 aa] ...    39   0.032
Ecym_3420 Chr3 (792244..793902) [1659 bp, 552 aa] {ON} similar t...    39   0.033
KLTH0A07964g Chr1 complement(670591..672450) [1860 bp, 619 aa] {...    39   0.033
Suva_37.1 Chr37 complement(3..797) [795 bp, 265 aa] {ON} YFL011W...    39   0.034
KAFR0B01080 Chr2 (204541..206721) [2181 bp, 726 aa] {ON} Anc_7.3...    39   0.035
KAFR0B03940 Chr2 complement(820954..822597) [1644 bp, 547 aa] {O...    39   0.036
Kwal_55.19582 s55 (35002..36705) [1704 bp, 567 aa] {ON} YNR072W ...    39   0.036
TBLA0A03450 Chr1 complement(836248..837969) [1722 bp, 573 aa] {O...    39   0.036
CAGL0L02519g Chr12 complement(297555..299144) [1590 bp, 529 aa] ...    39   0.037
KAFR0A08520 Chr1 (1708192..1709877) [1686 bp, 561 aa] {ON} Anc_3...    39   0.038
AAR192C Chr1 complement(686882..688384) [1503 bp, 500 aa] {ON} N...    39   0.038
TBLA0A08520 Chr1 (2101458..2103356) [1899 bp, 632 aa] {ON}             39   0.044
Kpol_281.2 s281 complement(3711..5390) [1680 bp, 559 aa] {ON} co...    39   0.046
TDEL0E00200 Chr5 complement(25701..27407) [1707 bp, 568 aa] {ON}       39   0.048
Suva_2.730 Chr2 (1271371..1273059) [1689 bp, 562 aa] {ON} YDR536...    39   0.048
TDEL0E02290 Chr5 (441643..443358) [1716 bp, 571 aa] {ON} Anc_5.3...    39   0.049
NCAS0G03970 Chr7 (735897..737729) [1833 bp, 610 aa] {ON} Anc_1.4...    39   0.050
KAFR0L01310 Chr12 complement(241337..243691) [2355 bp, 784 aa] {...    39   0.051
NDAI0C01740 Chr3 (378218..380041) [1824 bp, 607 aa] {ON}               39   0.052
KNAG0C05190 Chr3 (1014564..1016258) [1695 bp, 564 aa] {ON}             39   0.053
Ecym_1521 Chr1 complement(1074197..1075954) [1758 bp, 585 aa] {O...    38   0.057
KLLA0A03223g Chr1 (290002..292035) [2034 bp, 677 aa] {ON} simila...    38   0.058
SAKL0G13376g Chr7 complement(1147643..1149508) [1866 bp, 621 aa]...    38   0.063
Suva_15.236 Chr15 (408206..409750) [1545 bp, 514 aa] {ON} YHR048...    38   0.065
NCAS0A06580 Chr1 (1303456..1305042) [1587 bp, 528 aa] {ON} Anc_5...    38   0.066
NCAS0B02010 Chr2 (328296..329888) [1593 bp, 530 aa] {ON} Anc_8.570     38   0.068
KNAG0C05250 Chr3 (1024201..1025895) [1695 bp, 564 aa] {ON}             38   0.069
NCAS0A13880 Chr1 complement(2723605..2726001) [2397 bp, 798 aa] ...    38   0.070
KLTH0H00308g Chr8 (28695..30227) [1533 bp, 510 aa] {ON} weakly s...    38   0.075
YLR081W Chr12 (290212..291936) [1725 bp, 574 aa] {ON}  GAL2Galac...    38   0.077
YML116W Chr13 (38196..39824) [1629 bp, 542 aa] {ON}  ATR1Multidr...    38   0.083
NCAS0F03100 Chr6 complement(618654..620366) [1713 bp, 570 aa] {O...    38   0.087
NCAS0H01230 Chr8 (233917..235386) [1470 bp, 489 aa] {ON} Anc_6.155     38   0.088
Kwal_23.6547 s23 (1635677..1637212) [1536 bp, 511 aa] {ON} YOR37...    38   0.089
Suva_9.197 Chr9 (326927..327796) [870 bp, 289 aa] {ON} YFL011W (...    37   0.090
KLTH0C00462g Chr3 complement(49362..51074) [1713 bp, 570 aa] {ON...    38   0.091
SAKL0C07920g Chr3 complement(735512..737317) [1806 bp, 601 aa] {...    37   0.100
KLTH0G00198g Chr7 (5908..7284) [1377 bp, 458 aa] {ON} similar to...    37   0.10 
TPHA0C04790 Chr3 complement(1033653..1035323) [1671 bp, 556 aa] ...    37   0.11 
TPHA0G03780 Chr7 complement(800134..801972) [1839 bp, 612 aa] {O...    37   0.11 
TBLA0A07970 Chr1 (1971258..1972760) [1503 bp, 500 aa] {ON} Anc_5...    37   0.11 
TBLA0B10150 Chr2 (2445764..2447479) [1716 bp, 571 aa] {ON}             37   0.11 
TDEL0E04480 Chr5 complement(836068..837918) [1851 bp, 616 aa] {O...    37   0.12 
YDR536W Chr4 (1508005..1509714) [1710 bp, 569 aa] {ON}  STL1Glyc...    37   0.13 
TPHA0N01930 Chr14 (410871..412556) [1686 bp, 561 aa] {ON}              37   0.13 
KLTH0G02266g Chr7 (178663..180597) [1935 bp, 644 aa] {ON} highly...    37   0.14 
Kwal_47.18919 s47 complement(1026638..1028560) [1923 bp, 640 aa]...    37   0.15 
NCAS0I00110 Chr9 complement(5312..6670) [1359 bp, 452 aa] {ON}         37   0.15 
KLLA0E14609g Chr5 (1302073..1303992) [1920 bp, 639 aa] {ON} simi...    37   0.15 
TBLA0A10350 Chr1 (2550231..2551796) [1566 bp, 521 aa] {ON} Anc_5...    37   0.16 
SAKL0H09328g Chr8 (791744..793534) [1791 bp, 596 aa] {ON} simila...    37   0.16 
Kwal_56.22285 s56 (26966..28669) [1704 bp, 567 aa] {ON} YNR072W ...    37   0.17 
SAKL0D11000g Chr4 (910457..912430) [1974 bp, 657 aa] {ON} simila...    37   0.17 
CAGL0A01782g Chr1 complement(175018..176724) [1707 bp, 568 aa] {...    37   0.18 
KLTH0F15136g Chr6 (1240733..1242346) [1614 bp, 537 aa] {ON} simi...    37   0.18 
YFL011W Chr6 (112345..113985) [1641 bp, 546 aa] {ON}  HXT10Putat...    37   0.18 
TBLA0C07220 Chr3 (1750032..1751870) [1839 bp, 612 aa] {ON}             37   0.18 
TDEL0C02370 Chr3 (416622..418817) [2196 bp, 731 aa] {ON} Anc_7.3...    37   0.18 
TBLA0A08510 Chr1 (2095273..2097174) [1902 bp, 633 aa] {ON}             37   0.19 
NDAI0A02150 Chr1 (486774..489143) [2370 bp, 789 aa] {ON} Anc_7.309     37   0.19 
TBLA0A01420 Chr1 (333707..335425) [1719 bp, 572 aa] {ON} Anc_1.4...    37   0.20 
Suva_4.49 Chr4 complement(89704..91767) [2064 bp, 687 aa] {ON} Y...    37   0.21 
KLTH0G19404g Chr7 (1672150..1673691) [1542 bp, 513 aa] {ON} weak...    36   0.22 
KAFR0J00480 Chr10 (84206..85708) [1503 bp, 500 aa] {ON} Anc_5.28...    36   0.23 
SAKL0G18810g Chr7 complement(1624866..1626581) [1716 bp, 571 aa]...    36   0.23 
Ecym_2317 Chr2 (621407..623080) [1674 bp, 557 aa] {ON} similar t...    36   0.24 
Kpol_1049.20 s1049 (47753..49456) [1704 bp, 567 aa] {ON} (47753....    36   0.24 
TPHA0B03900 Chr2 (920520..922184) [1665 bp, 554 aa] {ON} Anc_1.432     36   0.26 
SAKL0B12540g Chr2 complement(1075772..1077490) [1719 bp, 572 aa]...    36   0.26 
Kwal_26.7984 s26 complement(598830..600668) [1839 bp, 612 aa] {O...    36   0.26 
TBLA0J00980 Chr10 (221751..223532) [1782 bp, 593 aa] {ON} Anc_1....    36   0.27 
Kpol_478.3 s478 (12238..13980) [1743 bp, 580 aa] {ON} (12238..13...    36   0.27 
Kpol_365.10 s365 complement(21800..23701) [1902 bp, 633 aa] {ON}...    36   0.27 
SAKL0F10362g Chr6 complement(796504..798711) [2208 bp, 735 aa] {...    36   0.28 
KNAG0B00730 Chr2 (138284..140152) [1869 bp, 622 aa] {ON} Anc_3.5...    36   0.28 
TDEL0A03330 Chr1 complement(590772..592421) [1650 bp, 549 aa] {O...    36   0.28 
ZYRO0E09966g Chr5 (793128..794813) [1686 bp, 561 aa] {ON} simila...    36   0.28 
Kpol_1051.15 s1051 (29969..31474) [1506 bp, 501 aa] {ON} (29969....    36   0.29 
Kpol_543.5 s543 complement(10929..12629) [1701 bp, 566 aa] {ON} ...    36   0.29 
Skud_13.451 Chr13 complement(798006..799625) [1620 bp, 539 aa] {...    36   0.30 
KLLA0E03829g Chr5 (349784..351613) [1830 bp, 609 aa] {ON} highly...    36   0.30 
Klac_YGOB_Anc_2.241 Chr6 (309169..310257,310260..310979) [1809 b...    36   0.31 
KNAG0B02810 Chr2 (541349..543745) [2397 bp, 798 aa] {ON} Anc_7.3...    36   0.31 
CAGL0J09020g Chr10 (889269..891839) [2571 bp, 856 aa] {ON} highl...    36   0.32 
Skud_8.155 Chr8 complement(264872..264913,264917..265015,265033....    36   0.33 
AGL069C Chr7 complement(578235..580019) [1785 bp, 594 aa] {ON} N...    36   0.33 
NCAS0B00290 Chr2 (33760..35388) [1629 bp, 542 aa] {ON} Anc_8.843       36   0.33 
TPHA0B03770 Chr2 (890983..892545) [1563 bp, 520 aa] {ON}               36   0.35 
TPHA0J02740 Chr10 complement(608490..610214) [1725 bp, 574 aa] {...    36   0.35 
YCR098C Chr3 complement(297049..298605) [1557 bp, 518 aa] {ON}  ...    36   0.35 
ZYRO0E03916g Chr5 complement(296502..298217) [1716 bp, 571 aa] {...    36   0.35 
Skud_8.156 Chr8 complement(264872..264913,264917..265015,265033....    35   0.36 
Ecym_2797 Chr2 complement(1548238..1549803) [1566 bp, 521 aa] {O...    36   0.36 
NDAI0G01520 Chr7 complement(336365..337957) [1593 bp, 530 aa] {O...    36   0.36 
Kwal_33.14911 s33 (868216..869928) [1713 bp, 570 aa] {ON} YDR536...    35   0.39 
TPHA0I01760 Chr9 (388160..390121) [1962 bp, 653 aa] {ON} Anc_8.5...    35   0.40 
ZYRO0E09922g Chr5 (788952..790643) [1692 bp, 563 aa] {ON} simila...    35   0.41 
TPHA0H01570 Chr8 complement(354813..356744) [1932 bp, 643 aa] {O...    35   0.43 
ZYRO0B16808g Chr2 (1368857..1370446) [1590 bp, 529 aa] {ON} simi...    35   0.44 
Kpol_1017.3 s1017 (12526..14391) [1866 bp, 621 aa] {ON} (12526.....    35   0.45 
YHR096C Chr8 complement(294669..296447) [1779 bp, 592 aa] {ON}  ...    35   0.47 
TBLA0A03510 Chr1 complement(865967..867679) [1713 bp, 570 aa] {O...    35   0.48 
Smik_8.173 Chr8 complement(271033..272811) [1779 bp, 592 aa] {ON...    35   0.48 
ZYRO0F04642g Chr6 (388032..389681) [1650 bp, 549 aa] {ON} simila...    35   0.50 
TBLA0E02520 Chr5 complement(632027..633718) [1692 bp, 563 aa] {O...    35   0.51 
ZYRO0G16302g Chr7 complement(1336890..1338533) [1644 bp, 547 aa]...    35   0.52 
Kwal_14.1105 s14 (197347..198915) [1569 bp, 522 aa] {ON} YFL040W...    35   0.52 
SAKL0G19844g Chr7 (1708176..1709894) [1719 bp, 572 aa] {ON} high...    35   0.56 
TBLA0A07710 Chr1 complement(1905062..1906672) [1611 bp, 536 aa] ...    35   0.57 
NDAI0G04470 Chr7 complement(1071044..1072729) [1686 bp, 561 aa] ...    35   0.57 
SAKL0B00946g Chr2 (87829..89412) [1584 bp, 527 aa] {ON} similar ...    35   0.59 
Kpol_1014.21 s1014 (34471..36069) [1599 bp, 532 aa] {ON} (34471....    35   0.59 
Suva_15.290 Chr15 complement(493441..495144) [1704 bp, 567 aa] {...    35   0.59 
Ecym_5319 Chr5 complement(643494..645086) [1593 bp, 530 aa] {ON}...    35   0.61 
KLLA0B07227g Chr2 complement(627833..629695) [1863 bp, 620 aa] {...    35   0.67 
TBLA0E01510 Chr5 (346010..348025) [2016 bp, 671 aa] {ON} Anc_4.3...    35   0.67 
Kwal_27.9678 s27 complement(14940..16481) [1542 bp, 513 aa] {ON}...    35   0.69 
YHR094C Chr8 complement(290913..292625) [1713 bp, 570 aa] {ON}  ...    35   0.69 
NCAS0F03620 Chr6 complement(720240..722144) [1905 bp, 634 aa] {O...    35   0.71 
NCAS0B00490 Chr2 complement(71160..73154) [1995 bp, 664 aa] {ON}...    35   0.71 
ZYRO0E10054g Chr5 complement(804765..806651) [1887 bp, 628 aa] {...    35   0.73 
KNAG0C03990 Chr3 (786172..788541) [2370 bp, 789 aa] {ON} Anc_7.3...    35   0.73 
KLLA0F26246g Chr6 (2432209..2433960) [1752 bp, 583 aa] {ON} high...    35   0.74 
KNAG0D00130 Chr4 complement(6264..7961) [1698 bp, 565 aa] {ON}  ...    35   0.74 
NCAS0E00750 Chr5 (137737..139599) [1863 bp, 620 aa] {ON}               35   0.77 
Smik_3.200 Chr3 complement(296300..297856) [1557 bp, 518 aa] {ON...    35   0.77 
KLTH0D00484g Chr4 complement(44278..45819) [1542 bp, 513 aa] {ON...    35   0.79 
TBLA0C00430 Chr3 (79303..81042) [1740 bp, 579 aa] {ON} Anc_8.22 ...    35   0.83 
NCAS0E03210 Chr5 complement(637282..638961) [1680 bp, 559 aa] {O...    34   0.85 
NCAS0A02540 Chr1 complement(481807..483426) [1620 bp, 539 aa] {O...    34   0.87 
Skud_4.58 Chr4 complement(98588..100651) [2064 bp, 687 aa] {ON} ...    34   0.94 
KLLA0F05181g Chr6 (510384..512747) [2364 bp, 787 aa] {ON} unipro...    34   0.95 
KLTH0B04510g Chr2 complement(364062..365768) [1707 bp, 568 aa] {...    34   0.95 
Smik_8.172 Chr8 complement(267609..269321) [1713 bp, 570 aa] {ON...    34   0.96 
KLLA0F18106g Chr6 (1657556..1659325) [1770 bp, 589 aa] {ON} simi...    34   0.98 
ZYRO0D00286g Chr4 complement(17054..18580) [1527 bp, 508 aa] {ON...    34   0.99 
KNAG0E03090 Chr5 (616710..618212) [1503 bp, 500 aa] {ON} Anc_8.2...    34   1.0  
YDL199C Chr4 complement(101290..103353) [2064 bp, 687 aa] {ON} P...    34   1.1  
ZYRO0B00990g Chr2 complement(81433..83211) [1779 bp, 592 aa] {ON...    34   1.2  
KLTH0H05698g Chr8 (503691..505202) [1512 bp, 503 aa] {ON} simila...    34   1.2  
AEL114C Chr5 complement(407131..408903) [1773 bp, 590 aa] {ON} S...    34   1.2  
Kpol_281.3 s281 complement(9070..10740) [1671 bp, 556 aa] {ON} c...    34   1.2  
KAFR0E04120 Chr5 (826520..828211) [1692 bp, 563 aa] {ON} Anc_5.3...    34   1.3  
CAGL0A01804g Chr1 complement(180180..181871) [1692 bp, 563 aa] {...    34   1.3  
TDEL0D05710 Chr4 complement(1025468..1027318) [1851 bp, 616 aa] ...    34   1.3  
TBLA0C01160 Chr3 complement(246034..247836) [1803 bp, 600 aa] {O...    34   1.3  
Kpol_1023.17 s1023 (34188..35789) [1602 bp, 533 aa] {ON} (34188....    34   1.3  
SAKL0A06050g Chr1 (548837..550408) [1572 bp, 523 aa] {ON} simila...    34   1.4  
TBLA0D03280 Chr4 complement(815937..817679) [1743 bp, 580 aa] {O...    34   1.4  
Kpol_413.2 s413 complement(4040..6043) [2004 bp, 667 aa] {ON} co...    34   1.4  
NCAS0C02990 Chr3 (563467..565173) [1707 bp, 568 aa] {ON}               34   1.5  
Kpol_1059.39 s1059 (87634..89325) [1692 bp, 563 aa] {ON} (87634....    33   1.5  
TDEL0C00150 Chr3 (14725..16305) [1581 bp, 526 aa] {ON}                 33   1.5  
NDAI0K02970 Chr11 (678231..679943) [1713 bp, 570 aa] {ON}              33   1.6  
NDAI0C04570 Chr3 complement(1042623..1044329) [1707 bp, 568 aa] ...    33   1.6  
TDEL0C00180 Chr3 complement(21059..22825) [1767 bp, 588 aa] {ON}       33   1.6  
Kwal_27.12811 s27 (1383808..1384353) [546 bp, 181 aa] {ON} YDL13...    33   1.6  
KAFR0I01400 Chr9 complement(291910..293679) [1770 bp, 589 aa] {O...    33   1.7  
NDAI0G00490 Chr7 complement(102674..104494) [1821 bp, 606 aa] {O...    33   1.9  
KNAG0B04900 Chr2 (940751..942301) [1551 bp, 516 aa] {ON}               33   2.0  
NDAI0G01750 Chr7 (382453..384033) [1581 bp, 526 aa] {ON} Anc_8.22      33   2.0  
KAFR0K00100 Chr11 complement(10324..11913) [1590 bp, 529 aa] {ON}      33   2.0  
NCAS0J00170 Chr10 complement(17702..19309) [1608 bp, 535 aa] {ON}      33   2.0  
TPHA0A03110 Chr1 (684324..686762) [2439 bp, 812 aa] {ON} Anc_7.3...    33   2.1  
YHR048W Chr8 (204607..206151) [1545 bp, 514 aa] {ON}  YHK8Presum...    33   2.2  
KLLA0A11110g Chr1 (964084..965739) [1656 bp, 551 aa] {ON} unipro...    33   2.2  
KAFR0A05550 Chr1 complement(1107647..1109341) [1695 bp, 564 aa] ...    33   2.2  
NDAI0A04360 Chr1 (981092..982726) [1635 bp, 544 aa] {ON} Anc_5.469     33   2.3  
Skud_4.614 Chr4 complement(1092655..1093665) [1011 bp, 336 aa] {...    33   2.4  
Kwal_33.13849 s33 complement(421362..423203) [1842 bp, 613 aa] {...    33   2.4  
ADR091W Chr4 (872923..874917) [1995 bp, 664 aa] {ON} Syntenic ho...    33   2.4  
NDAI0D04840 Chr4 complement(1145041..1146960) [1920 bp, 639 aa] ...    33   2.5  
Skud_8.107 Chr8 (179754..181322) [1569 bp, 522 aa] {ON} YHR048W ...    33   2.5  
SAKL0F02442g Chr6 (211990..213822) [1833 bp, 610 aa] {ON} highly...    33   2.6  
KLLA0A07249g Chr1 complement(649905..651431) [1527 bp, 508 aa] {...    33   2.7  
ZYRO0G21648g Chr7 complement(1783532..1784998) [1467 bp, 488 aa]...    33   2.7  
TBLA0J00280 Chr10 (50047..51438) [1392 bp, 463 aa] {ON} Anc_7.51...    33   2.8  
CAGL0I10384g Chr9 (1027883..1029775) [1893 bp, 630 aa] {ON} high...    33   2.8  
NDAI0A02890 Chr1 (648510..651236) [2727 bp, 908 aa] {ON}               33   2.9  
KLLA0F06853g Chr6 (656373..657959) [1587 bp, 528 aa] {ON} simila...    33   3.0  
KLTH0E06138g Chr5 (558501..560345) [1845 bp, 614 aa] {ON} simila...    33   3.3  
YDR345C Chr4 complement(1162957..1164660) [1704 bp, 567 aa] {ON}...    32   3.4  
CAGL0C01771g Chr3 (187030..188487) [1458 bp, 485 aa] {ON} simila...    32   3.4  
CAGL0H06039g Chr8 complement(592526..594295) [1770 bp, 589 aa] {...    32   3.4  
SAKL0D10131g Chr4 complement(846993..848705) [1713 bp, 570 aa] {...    32   3.5  
Kwal_14.1625 s14 (395421..396941) [1521 bp, 506 aa] {ON} YBR241C...    32   3.6  
Kwal_34.16261 s34 (266378..267358) [981 bp, 327 aa] {ON} YFL011W...    32   3.7  
NCAS0F03110 Chr6 complement(622619..624325) [1707 bp, 568 aa] {O...    32   3.7  
Smik_4.657 Chr4 complement(1168668..1170332) [1665 bp, 554 aa] {...    32   3.7  
TBLA0D03270 Chr4 complement(813041..814693) [1653 bp, 550 aa] {O...    32   3.7  
Smik_4.609 Chr4 complement(1089106..1090809) [1704 bp, 567 aa] {...    32   3.9  
SAKL0B00264g Chr2 (22039..23598) [1560 bp, 519 aa] {ON} similar ...    32   3.9  
Kpol_2002.53 s2002 (117334..118494) [1161 bp, 386 aa] {ON} (1173...    32   4.0  
Smik_4.97 Chr4 (189933..192236) [2304 bp, 767 aa] {ON} YDL138W (...    32   4.1  
Smik_4.41 Chr4 complement(79517..81580) [2064 bp, 687 aa] {ON} Y...    32   4.1  
KNAG0G02830 Chr7 complement(625263..627296) [2034 bp, 677 aa] {O...    32   4.3  
SAKL0G03300g Chr7 (268199..270049) [1851 bp, 616 aa] {ON} simila...    32   4.3  
Skud_4.613 Chr4 complement(1091965..1092006,1092030..1092095,109...    32   4.5  
ZYRO0F05786g Chr6 complement(476413..478560) [2148 bp, 715 aa] {...    32   4.5  
Ecym_2054 Chr2 complement(87646..89100) [1455 bp, 484 aa] {ON} s...    32   5.1  
TBLA0D02900 Chr4 (714553..716628) [2076 bp, 691 aa] {ON} Anc_3.5...    32   5.2  
TPHA0N01090 Chr14 (227811..229274) [1464 bp, 487 aa] {ON} Anc_6....    32   5.3  
ZYRO0G19646g Chr7 (1631114..1632898) [1785 bp, 594 aa] {ON} simi...    32   5.3  
KNAG0F03480 Chr6 complement(657351..658997) [1647 bp, 548 aa] {O...    32   5.4  
KAFR0E03650 Chr5 (733164..734660) [1497 bp, 498 aa] {ON} Anc_5.4...    32   5.5  
TDEL0A00150 Chr1 (24714..26414) [1701 bp, 566 aa] {ON}                 32   5.6  
Suva_14.4 Chr14 (4495..6051) [1557 bp, 518 aa] {ON} YCR098C (REAL)     32   5.8  
Smik_4.607 Chr4 complement(1085753..1087465) [1713 bp, 570 aa] {...    32   6.0  
YDR343C Chr4 complement(1159608..1161320) [1713 bp, 570 aa] {ON}...    32   6.0  
YDR342C Chr4 complement(1154216..1155928) [1713 bp, 570 aa] {ON}...    32   6.0  
NDAI0E00280 Chr5 (37676..39325) [1650 bp, 549 aa] {ON} Anc_8.843       32   6.0  
SAKL0G07678g Chr7 (645867..647570) [1704 bp, 567 aa] {ON} highly...    32   6.1  
NCAS0E00160 Chr5 complement(15851..17527) [1677 bp, 558 aa] {ON}       32   6.1  
Smik_4.606 Chr4 complement(1080999..1082711) [1713 bp, 570 aa] {...    32   6.3  
Smik_8.117 Chr8 (181800..183344) [1545 bp, 514 aa] {ON} YHR048W ...    32   6.4  
Kwal_34.15746 s34 (37757..39313) [1557 bp, 518 aa] {ON} YGR224W ...    32   6.4  
KNAG0C05180 Chr3 (1007743..1009410) [1668 bp, 555 aa] {ON}             32   6.5  
ZYRO0D01672g Chr4 (134493..135791) [1299 bp, 432 aa] {ON} simila...    32   6.7  
YHR092C Chr8 complement(287081..288811) [1731 bp, 576 aa] {ON}  ...    32   6.8  
KAFR0C03590 Chr3 complement(734372..735910) [1539 bp, 512 aa] {O...    32   6.9  
KLLA0D13310g Chr4 complement(1143027..1144730) [1704 bp, 567 aa]...    32   7.2  
CAGL0A02211g Chr1 complement(229556..231214) [1659 bp, 552 aa] {...    32   7.2  
Kwal_55.20686 s55 (517314..519155) [1842 bp, 613 aa] {ON} YLL028...    32   7.3  
TPHA0H03110 Chr8 (742931..744616) [1686 bp, 561 aa] {ON}               32   7.3  
Suva_2.516 Chr2 complement(919934..921637) [1704 bp, 567 aa] {ON...    32   7.5  
TDEL0E00120 Chr5 (7519..9231) [1713 bp, 570 aa] {ON}                   32   7.6  
YDL138W Chr4 (213351..215642) [2292 bp, 763 aa] {ON}  RGT2Plasma...    32   7.9  
Kpol_1057.20 s1057 (38011..39723) [1713 bp, 570 aa] {ON} (38011....    31   8.2  
Smik_8.170 Chr8 complement(263829..265556) [1728 bp, 575 aa] {ON...    31   8.2  
TPHA0D03310 Chr4 complement(680299..682140) [1842 bp, 613 aa] {O...    31   8.4  
Suva_8.420 Chr8 (755472..757112) [1641 bp, 546 aa] {ON} YBR008C ...    31   8.4  
YDR387C Chr4 complement(1248154..1249821) [1668 bp, 555 aa] {ON}...    31   8.4  
NCAS0C05780 Chr3 complement(1188362..1190065) [1704 bp, 567 aa] ...    31   8.6  
KLTH0G06754g Chr7 (541019..542461) [1443 bp, 480 aa] {ON} simila...    31   8.9  
NCAS0H01880 Chr8 complement(361743..363464) [1722 bp, 573 aa] {O...    31   9.1  
KAFR0C02030 Chr3 complement(401836..403710) [1875 bp, 624 aa] {O...    31   9.4  
SAKL0D10450g Chr4 (875475..877151) [1677 bp, 558 aa] {ON} highly...    31   9.5  
NDAI0I02770 Chr9 (652149..654029) [1881 bp, 626 aa] {ON} Anc_3.503     31   9.5  
Smik_2.384 Chr2 complement(688838..690304) [1467 bp, 488 aa] {ON...    31   9.7  
TBLA0H03700 Chr8 complement(900652..901521) [870 bp, 289 aa] {ON...    31   9.9  
TDEL0A06670 Chr1 complement(1163596..1165473) [1878 bp, 625 aa] ...    31   9.9  

>Kwal_56.23754 s56 complement(690851..692620) [1770 bp, 589 aa] {ON}
           YBR293W - Hypothetical ORF [contig 173] FULL
          Length = 589

 Score = 1180 bits (3052), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 577/589 (97%), Positives = 577/589 (97%)

Query: 1   MSPGERTSFLAPIDKDVIQDPSTGLAGFVANEVEQQDYNSRTGHDSYGATAVDDRTATSA 60
           MSPGERTSFLAPIDKDVIQDPSTGLAGFVANEVEQQDYNSRTGHDSYGATAVDDRTATSA
Sbjct: 1   MSPGERTSFLAPIDKDVIQDPSTGLAGFVANEVEQQDYNSRTGHDSYGATAVDDRTATSA 60

Query: 61  RCDLTFPPSETPEFALXXXXXXXXXXXXFLGIFLAALDGTIVSTLLTRIGSEFNSLDKVS 120
           RCDLTFPPSETPEFAL            FLGIFLAALDGTIVSTLLTRIGSEFNSLDKVS
Sbjct: 61  RCDLTFPPSETPEFALSSSRIRIIMISMFLGIFLAALDGTIVSTLLTRIGSEFNSLDKVS 120

Query: 121 WIATSYLLSSSTCQPLYGKLSDQLGRKPLLVFSNVVFSIGCLICGMSTSIWWVVVGRFVS 180
           WIATSYLLSSSTCQPLYGKLSDQLGRKPLLVFSNVVFSIGCLICGMSTSIWWVVVGRFVS
Sbjct: 121 WIATSYLLSSSTCQPLYGKLSDQLGRKPLLVFSNVVFSIGCLICGMSTSIWWVVVGRFVS 180

Query: 181 GIGGCGLTCLASMVISDLVPLRERAVYQGLCNFIFGLGTASGGLVGAAFQDWRMAFTIQC 240
           GIGGCGLTCLASMVISDLVPLRERAVYQGLCNFIFGLGTASGGLVGAAFQDWRMAFTIQC
Sbjct: 181 GIGGCGLTCLASMVISDLVPLRERAVYQGLCNFIFGLGTASGGLVGAAFQDWRMAFTIQC 240

Query: 241 PISLASCALIVSYLELPPRHEDDKDRHWTSKLRDLDWAGVVTLVCFLFLFMLVSSLGGKE 300
           PISLASCALIVSYLELPPRHEDDKDRHWTSKLRDLDWAGVVTLVCFLFLFMLVSSLGGKE
Sbjct: 241 PISLASCALIVSYLELPPRHEDDKDRHWTSKLRDLDWAGVVTLVCFLFLFMLVSSLGGKE 300

Query: 301 IAYDSVLFALLCVTTLVLGSIFAYVELYVAVDPVLPIAFLKYRSVLGSSLANWFAMMSML 360
           IAYDSVLFALLCVTTLVLGSIFAYVELYVAVDPVLPIAFLKYRSVLGSSLANWFAMMSML
Sbjct: 301 IAYDSVLFALLCVTTLVLGSIFAYVELYVAVDPVLPIAFLKYRSVLGSSLANWFAMMSML 360

Query: 361 TTNYYLPVYWASVLNMKPTDIGKRSIPSFFSVAFGSLGAGIYMKRTGKYYWFLLAFCGIG 420
           TTNYYLPVYWASVLNMKPTDIGKRSIPSFFSVAFGSLGAGIYMKRTGKYYWFLLAFCGIG
Sbjct: 361 TTNYYLPVYWASVLNMKPTDIGKRSIPSFFSVAFGSLGAGIYMKRTGKYYWFLLAFCGIG 420

Query: 421 ILGQLKINLLTPATPVWQQYLLLVVPSFGLSVLITVTLLAMISAVPHEHHAATTSISYAF 480
           ILGQLKINLLTPATPVWQQYLLLVVPSFGLSVLITVTLLAMISAVPHEHHAATTSISYAF
Sbjct: 421 ILGQLKINLLTPATPVWQQYLLLVVPSFGLSVLITVTLLAMISAVPHEHHAATTSISYAF 480

Query: 481 RSTGATLGVSIGAAIFRSTLNTLLQNKVLQFASDEHPREELLRIINNAAHSANWVHKEAP 540
           RSTGATLGVSIGAAIFRSTLNTLLQNKVLQFASDEHPREELLRIINNAAHSANWVHKEAP
Sbjct: 481 RSTGATLGVSIGAAIFRSTLNTLLQNKVLQFASDEHPREELLRIINNAAHSANWVHKEAP 540

Query: 541 EFVRATLVECYHYASKSTFKFCLITMILAGASCSIIQEHTLHTTLKRDK 589
           EFVRATLVECYHYASKSTFKFCLITMILAGASCSIIQEHTLHTTLKRDK
Sbjct: 541 EFVRATLVECYHYASKSTFKFCLITMILAGASCSIIQEHTLHTTLKRDK 589

>KLTH0G13464g Chr7 complement(1154304..1156085) [1782 bp, 593 aa]
           {ON} weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 593

 Score =  835 bits (2157), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/592 (68%), Positives = 478/592 (80%), Gaps = 6/592 (1%)

Query: 1   MSPGERTSFLAPIDKDVIQDPSTGLAGFVANEVEQQDY--NSRTGHDSYGATAVDDRTAT 58
           M   E +  L P+D+D +QDPST L GFVAN++EQQD+  +   G  +YG+T     ++ 
Sbjct: 1   MVQSEHSPLLTPVDRDAMQDPSTDLPGFVANQIEQQDHLLDIEQGR-AYGSTTKSSISSE 59

Query: 59  SARCDL---TFPPSETPEFALXXXXXXXXXXXXFLGIFLAALDGTIVSTLLTRIGSEFNS 115
           + R D    T     + EF L            FLGIFLAALDGTIVSTLLT IGSEFNS
Sbjct: 60  NEREDAGGATVAGCGSAEFYLPSSRILIIMFSMFLGIFLAALDGTIVSTLLTHIGSEFNS 119

Query: 116 LDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPLLVFSNVVFSIGCLICGMSTSIWWVVV 175
           LDK SWIATSYLLSSSTCQPLYGKLSD+LGRKPLLVFSN VF+IGCLICG+S SIW VV 
Sbjct: 120 LDKASWIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVA 179

Query: 176 GRFVSGIGGCGLTCLASMVISDLVPLRERAVYQGLCNFIFGLGTASGGLVGAAFQDWRMA 235
           GRF+SGIGGCGLT LA+M++SDLVPLR+RAVYQGLCNF+FGLGTASGGLVGA F+DWR+A
Sbjct: 180 GRFISGIGGCGLTSLATMIMSDLVPLRDRAVYQGLCNFVFGLGTASGGLVGAYFRDWRLA 239

Query: 236 FTIQCPISLASCALIVSYLELPPRHEDDKDRHWTSKLRDLDWAGVVTLVCFLFLFMLVSS 295
           F +QCPIS+ S  LIV YLELPPR        W+++LR LDWAG  +L+ FLFLFML SS
Sbjct: 240 FILQCPISVLSGILIVVYLELPPRASASNKDCWSARLRRLDWAGATSLIAFLFLFMLTSS 299

Query: 296 LGGKEIAYDSVLFALLCVTTLVLGSIFAYVELYVAVDPVLPIAFLKYRSVLGSSLANWFA 355
           +GG  +AY S LFA +C  TLV G++F YVEL VA DPVLP+ FL+ RSVLGSSLANWF 
Sbjct: 300 MGGSSVAYGSRLFAAMCAATLVFGAVFVYVELRVAADPVLPVTFLRDRSVLGSSLANWFC 359

Query: 356 MMSMLTTNYYLPVYWASVLNMKPTDIGKRSIPSFFSVAFGSLGAGIYMKRTGKYYWFLLA 415
           MMSM+TTN+YLPVYW+SVL MK TD+GKR++PSFFSVAFGSLGAG+YMKRTGKYY+FLLA
Sbjct: 360 MMSMMTTNFYLPVYWSSVLGMKATDVGKRAMPSFFSVAFGSLGAGLYMKRTGKYYYFLLA 419

Query: 416 FCGIGILGQLKINLLTPATPVWQQYLLLVVPSFGLSVLITVTLLAMISAVPHEHHAATTS 475
           FC + I GQ++I L+TP  PVW+QYLL VVP FG+SVLITVTLLAMI+AVPHEHHAATTS
Sbjct: 420 FCVLAIAGQVQIVLITPQMPVWRQYLLQVVPGFGVSVLITVTLLAMIAAVPHEHHAATTS 479

Query: 476 ISYAFRSTGATLGVSIGAAIFRSTLNTLLQNKVLQFASDEHPREELLRIINNAAHSANWV 535
           ISYAFRSTGATLGVS+GAA+FRS+L +LL  KV++FASD H   EL  II +AA S++WV
Sbjct: 480 ISYAFRSTGATLGVSVGAAVFRSSLTSLLDAKVMRFASDGHSERELRGIIASAARSSDWV 539

Query: 536 HKEAPEFVRATLVECYHYASKSTFKFCLITMILAGASCSIIQEHTLHTTLKR 587
           H+ AP FVRATL+ECYH+AS++TFKFCL TM+LAG SCSII+EH LHT++KR
Sbjct: 540 HRSAPPFVRATLLECYHFASRATFKFCLTTMVLAGVSCSIIKEHKLHTSIKR 591

>SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]
           {ON} weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 657

 Score =  681 bits (1757), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/604 (57%), Positives = 445/604 (73%), Gaps = 20/604 (3%)

Query: 1   MSPGERTSFLAPIDKDVIQDPSTGLAGFVANEVEQQD------YNSRTGHDSYGATAVDD 54
           + P E T FL PI ++++ DP++ L GFVA E+E+Q+        + +G+DS     V  
Sbjct: 45  IEPTETTPFLQPIRRELVLDPTSDLPGFVAGELEEQEERCAEEQTNASGYDSIKKNTV-- 102

Query: 55  RTATSARCDLTFPPSETPE-FALXXXXXXXXXXXXFLGIFLAALDGTIVSTLLTRIGSEF 113
             AT+   DL     E      L            +LGIFLA+LD TIVSTLL  I SEF
Sbjct: 103 --ATAKTIDLETSSIEAKNNTGLSPARIKIIMGSMYLGIFLASLDNTIVSTLLAHIASEF 160

Query: 114 NSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPLLVFSNVVFSIGCLICGMSTSIWWV 173
           N +  +SWIAT+YLLSS+T QPLYGK+SD  GRKPLL+FSNV+F++GCLICG+S  +W +
Sbjct: 161 NEMPHISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICGLSPGLWCL 220

Query: 174 VVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQGLCNFIFGLGTASGGLVGAAFQD-- 231
           V GRF++GIGG GLT ++S+  SD+VPLR RA+YQG+CNF FGLGTA GGLVG  F +  
Sbjct: 221 VAGRFIAGIGGGGLTSMSSITTSDIVPLRNRALYQGICNFFFGLGTACGGLVGGWFSEHG 280

Query: 232 --WRMAFTIQCPISLASCALIVSYLELPPRH-----EDDKDRHWTSKLRDLDWAGVVTLV 284
             WR+AF IQ P+   SC+LIV+YLELP        + D+D   + KLR +DW G ++LV
Sbjct: 281 GGWRVAFLIQIPLCAISCSLIVAYLELPKGCKGSGIQSDEDNQISEKLRRIDWFGALSLV 340

Query: 285 CFLFLFMLVSSLGGKEIAYDSVLFALLCVTTLVLGSIFAYVELYVAVDPVLPIAFLKYRS 344
            FL LFML SSLGGKE+ + S  F  LCV  +V G+ F YVE YV+ DP+LP+AFLK R+
Sbjct: 341 VFLLLFMLASSLGGKELPFQSNGFYALCVAIVVGGATFVYVETYVSKDPILPVAFLKNRT 400

Query: 345 VLGSSLANWFAMMSMLTTNYYLPVYWASVLNMKPTDIGKRSIPSFFSVAFGSLGAGIYMK 404
           +LGSSLANWF+MM M+TT+Y+LPVYWA VLNMKPTD+GKR+IPSFFS A GSLGAG YMK
Sbjct: 401 ILGSSLANWFSMMGMMTTSYFLPVYWAGVLNMKPTDMGKRTIPSFFSTALGSLGAGYYMK 460

Query: 405 RTGKYYWFLLAFCGIGILGQLKINLLTPATPVWQQYLLLVVPSFGLSVLITVTLLAMISA 464
           +TGKY W L+AFC + ++GQL+I+L+ P   VW+QY+LLV+P FGLSVLITVTLLAMI+A
Sbjct: 461 KTGKYKWLLMAFCALAVVGQLQISLIEPNIAVWRQYILLVIPGFGLSVLITVTLLAMIAA 520

Query: 465 VPHEHHAATTSISYAFRSTGATLGVSIGAAIFRSTLNTLLQNKVLQFASDEHPREELLRI 524
           VPHEH AATTSISYAFRSTG TLGVSIG AIFR +L +LL+  V++ ASD+HPREEL +I
Sbjct: 521 VPHEHQAATTSISYAFRSTGCTLGVSIGGAIFRKSLGSLLERNVMKLASDKHPREELAKI 580

Query: 525 INNAAHSANWVHKEAPEFVRATLVECYHYASKSTFKFCLITMILAGASCSIIQEHTLHTT 584
           I++AAHS++++H  APEFVR  L+E YH+A ++T+KFCL ++  A  SC  ++E+ LHT+
Sbjct: 581 IDSAAHSSDYIHDSAPEFVRQALIESYHFACRNTYKFCLASIFCALLSCIAVKEYKLHTS 640

Query: 585 LKRD 588
           + R 
Sbjct: 641 MDRQ 644

>TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.272
           YDR119W
          Length = 631

 Score =  649 bits (1674), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/590 (57%), Positives = 421/590 (71%), Gaps = 17/590 (2%)

Query: 6   RTSFLAPIDKDVIQDPSTGLAGFVANEVEQQDYNSRTGHDSYGA-TAVDDRTATSARCDL 64
             S L PI  +++QDPST L GFVA E+ QQ+  +    + YG+ T   D    S R   
Sbjct: 45  EASLLLPIKPEILQDPSTDLPGFVAEEIGQQEEVA----NGYGSITDPHDGDNKSER--- 97

Query: 65  TFPPSETPEFALXXXXXXXXXXXXFLGIFLAALDGTIVSTLLTRIGSEFNSLDKVSWIAT 124
              P  T E  +            +LGIFLAA+D TIVST    + SEFN L KVSWIAT
Sbjct: 98  ---PVSTAE-EISGARLRVIMLSMYLGIFLAAIDNTIVSTTSAHVASEFNQLSKVSWIAT 153

Query: 125 SYLLSSSTCQPLYGKLSDQLGRKPLLVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGG 184
           SYLLSS+T QPLYGK+SD  GRK LLVF+NV F IGCL+CG+S S WW+V+ RFV+G+GG
Sbjct: 154 SYLLSSATFQPLYGKVSDIFGRKCLLVFTNVAFLIGCLMCGLSKSFWWLVIARFVAGVGG 213

Query: 185 CGLTCLASMVISDLVPLRERAVYQGLCNFIFGLGTASGGLVGAAFQD----WRMAFTIQC 240
            GLT ++S+ I+DLVPLRERA+YQG+CN  +GLGTA GG+VG  F D    WRMAF IQ 
Sbjct: 214 GGLTSMSSITITDLVPLRERAMYQGICNVFYGLGTACGGIVGGWFSDNKGGWRMAFLIQV 273

Query: 241 PISLASCALIVSYLELP-PRHEDDKDRHWTSKLRDLDWAGVVTLVCFLFLFMLVSSLGGK 299
           P+S  S  +I+ +L+LP  R   ++D     KL  +DW G  TLV FL LF+L +SLGGK
Sbjct: 274 PLSAISLLVIILHLKLPSKRATRNQDNSIKRKLLAIDWLGASTLVIFLVLFLLTASLGGK 333

Query: 300 EIAYDSVLFALLCVTTLVLGSIFAYVELYVAVDPVLPIAFLKYRSVLGSSLANWFAMMSM 359
           EIAY S  FAL+ +++L+   +F YVEL VA DP+LP+ FL  RSVLGSSL+NWF MM+ 
Sbjct: 334 EIAYGSRTFALMLISSLLSCLVFIYVELRVAADPILPLRFLAIRSVLGSSLSNWFCMMAT 393

Query: 360 LTTNYYLPVYWASVLNMKPTDIGKRSIPSFFSVAFGSLGAGIYMKRTGKYYWFLLAFCGI 419
           +TT+YYLP+Y++ VLNM PTD+GKR +P+FFSVAFGSLGAG YMK+T KYYWF L FC +
Sbjct: 394 MTTSYYLPIYFSGVLNMSPTDVGKRLMPNFFSVAFGSLGAGYYMKKTRKYYWFSLIFCAV 453

Query: 420 GILGQLKINLLTPATPVWQQYLLLVVPSFGLSVLITVTLLAMISAVPHEHHAATTSISYA 479
            +LGQL+I L+ P  P W+QY+LL+VP  G SVLITV LLAMI+AVPHEH AATTSISYA
Sbjct: 454 AVLGQLQILLIDPKIPTWRQYILLLVPGVGTSVLITVALLAMIAAVPHEHQAATTSISYA 513

Query: 480 FRSTGATLGVSIGAAIFRSTLNTLLQNKVLQFASDEHPREELLRIINNAAHSANWVHKEA 539
           FRS G TLGVSIG AIFR +L+ L    VL++ S EHP+EELL+II+ A+ S+ WVH  A
Sbjct: 514 FRSAGCTLGVSIGGAIFRESLSKLTTRYVLRYISKEHPKEELLKIIDKASESSEWVHHSA 573

Query: 540 PEFVRATLVECYHYASKSTFKFCLITMILAGASCSIIQEHTLHTTLKRDK 589
           P+F+R TL+ECYH A K+TF FC I  IL   S SII+E  LH++L R +
Sbjct: 574 PDFIRQTLLECYHKACKNTFLFCFICSILTLVSFSIIKEKKLHSSLDRKE 623

>ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 590

 Score =  643 bits (1659), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/600 (54%), Positives = 417/600 (69%), Gaps = 36/600 (6%)

Query: 5   ERTSFLAPIDKDVIQDPSTGLAGFVANEV----------EQQDYNSRTGHDSYGATAVDD 54
            RT+FL P+  D++QD ST + GFVA E+          +  DY S    D       D 
Sbjct: 12  SRTNFLNPVRDDILQDASTDIPGFVAEELEEREELYRECQGTDYGSIDNED-------DS 64

Query: 55  RTATSARCDLTFPPSETPEFALXXXXXXXXXXXXFLGIFLAALDGTIVSTLLTRIGSEFN 114
           R   ++      PP +     L            +LGIFLAA DGT+VST++  I SEFN
Sbjct: 65  RDGVASS---PVPPDKLLVITLSM----------YLGIFLAAADGTLVSTIMAHIASEFN 111

Query: 115 SLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPLLVFSNVVFSIGCLICGMSTSIWWVV 174
            L ++SWIAT+YLLSS+T QPLYGKLSD  GRKPLL+ +N+VF +GCL+CG++ S W +V
Sbjct: 112 ELPRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLV 171

Query: 175 VGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQGLCNFIFGLGTASGGLVGAAFQD--- 231
             RF+SGIGG G+T + S+ ISD+VPLR+RA+YQG+CNF FGLGTA GG+VG  F D   
Sbjct: 172 GARFISGIGGGGVTSMCSITISDIVPLRDRALYQGMCNFFFGLGTACGGVVGGWFSDHGG 231

Query: 232 -WRMAFTIQCPISLASCALIVSYLELPPRHED-DKDRHWTSKLRDLDWAGVVTLVCFLFL 289
            WRMAF IQ P+S  S  LI  +++LPPR +  +      +KL  +DW G   LV FL L
Sbjct: 232 GWRMAFLIQVPLSALSSLLIAVFMKLPPRSKRVNSPASIKNKLLSVDWIGASALVVFLSL 291

Query: 290 FMLVSSLGGKEIAYDSVLFALLCVTTLVLGSIFAYVELYVAVDPVLPIAFLKYRSVLGSS 349
           F++ +SLGGKEIA++S  F  LC+ + +  + F  VELY A DP+LP++FL+ RSVLGSS
Sbjct: 292 FLVTASLGGKEIAFNSKTFVALCIGSSLACAFFIGVELYGAKDPILPLSFLRNRSVLGSS 351

Query: 350 LANWFAMMSMLTTNYYLPVYWASVLNMKPTDIGKRSIPSFFSVAFGSLGAGIYMKRTGKY 409
            +NWF MM+M+TT+YYLP+Y++ VLNM PT +GKR +P+FFS A GSLGAG YMKRTGKY
Sbjct: 352 FSNWFCMMAMMTTSYYLPIYYSGVLNMNPTRVGKRLMPNFFSTALGSLGAGYYMKRTGKY 411

Query: 410 YWFLLAFCGIGILGQLKINLLTPATPVWQQYLLLVVPSFGLSVLITVTLLAMISAVPHEH 469
           YW  + FC + +LG L+INL+ P    W+Q++LLV+P FG SVLITV LLAMI+AVPH H
Sbjct: 412 YWLTVGFCTLSLLGHLQINLMKPDIATWRQFILLVIPGFGYSVLITVALLAMIAAVPHNH 471

Query: 470 HAATTSISYAFRSTGATLGVSIGAAIFRSTLNTLLQNKVLQFASDEHPREELLRIINNAA 529
           HAATTSISYAFRSTG+TLGVSIG AIFR +LN LL  KVL+FA D+HPR+ELL II  A+
Sbjct: 472 HAATTSISYAFRSTGSTLGVSIGGAIFRQSLNGLLSRKVLKFA-DKHPRKELLEIIEKAS 530

Query: 530 HSANWVHKEAPEFVRATLVECYHYASKSTFKFCLITMILAGASCSIIQEHTLHTTLKRDK 589
            S+ WVH  APEF+R TL+ CYH+A K TF FC +  I   AS SII+E+ LH +L R  
Sbjct: 531 KSSEWVHDSAPEFIRPTLIGCYHFACKDTFLFCTLCSIGTLASISIIKEYKLHASLDRKN 590

>AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR119W
          Length = 686

 Score =  622 bits (1605), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/597 (55%), Positives = 415/597 (69%), Gaps = 22/597 (3%)

Query: 4   GERTSFLAPIDKDVIQDPSTGLAGFVANEVE---QQDYNSRTGHDSYGATAVDDRTATSA 60
           GE++  L      ++ DPS+GL+G VA+E+E   QQ+  +    +S   +       ++ 
Sbjct: 53  GEQSGLLEASRGTLVSDPSSGLSGLVASELEVQRQQEVCAAVTAESMATSGSGSSYGSTQ 112

Query: 61  RCDLTFPPSETPEFA------LXXXXXXXXXXXXFLGIFLAALDGTIVSTLLTRIGSEFN 114
           +    +  +   E A      L             LG+FLAALDGTIV+TLL  I SEFN
Sbjct: 113 KPTEVYLTATAVEAAKEDAGGLGATRRRVVMASMCLGVFLAALDGTIVTTLLDHIASEFN 172

Query: 115 SLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPLLVFSNVVFSIGCLICGMSTSIWWVV 174
            L ++SWIAT+YLLSS+T QPLYGKLSD  GR+PLLVFSN+VF +G LICGMS ++W +V
Sbjct: 173 ELPRISWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLV 232

Query: 175 VGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQGLCNFIFGLGTASGGLVGAAFQD--- 231
           +GRFV+GIGG GLT + S+  +D+VPLR RA+YQG+CN  FGLGTA GGLVG  F D   
Sbjct: 233 LGRFVAGIGGGGLTSMCSITTTDIVPLRSRALYQGICNVFFGLGTACGGLVGGLFADRAV 292

Query: 232 -WRMAFTIQCPISLASCALIVSYLELPP---RHEDDKDRH--WTSKLRDLDWAGVVTLVC 285
            WRMAF +Q P++L S   I  +L LP     H+    R   WT+KLR +DW G VTLV 
Sbjct: 293 GWRMAFLVQVPLTLLSTTAIQLFLTLPKPVDAHKGAGQRSIPWTTKLRMVDWTGTVTLVV 352

Query: 286 FLFLFMLVSSLGGKEIAYDSVLFALLCVTTLVLGSIFAYVELYVAVDPVLPIAFLKYRSV 345
           FLF F LV SL G+++ +  ++F    V  L+ GS F Y ELYVA DP+LPI FL+ RSV
Sbjct: 353 FLFCFTLVCSLYGEDLPHLYLIF----VVILLSGSYFIYHELYVATDPILPIRFLENRSV 408

Query: 346 LGSSLANWFAMMSMLTTNYYLPVYWASVLNMKPTDIGKRSIPSFFSVAFGSLGAGIYMKR 405
           L +SL+NWF MM M+TT +Y+PVY+ASVLNM PTDIGKR +PSFFS AFGSLGAG YMKR
Sbjct: 409 LAASLSNWFCMMGMMTTGFYIPVYYASVLNMGPTDIGKRIVPSFFSTAFGSLGAGYYMKR 468

Query: 406 TGKYYWFLLAFCGIGILGQLKINLLTPATPVWQQYLLLVVPSFGLSVLITVTLLAMISAV 465
           TGKYYWFLLAFC +G+LGQ++I+ +TP+   W+QY L ++P FG +VL+TVTLLA+I AV
Sbjct: 469 TGKYYWFLLAFCLVGVLGQVQISYVTPSISTWRQYCLYMIPGFGSAVLLTVTLLALIVAV 528

Query: 466 PHEHHAATTSISYAFRSTGATLGVSIGAAIFRSTLNTLLQNKVLQFASDEHPREELLRII 525
           P  H AATTSISYAFRSTG+TLGVSIG AIFR+ L+  L +K++   S EHP  ELLRII
Sbjct: 529 PQRHQAATTSISYAFRSTGSTLGVSIGGAIFRNGLSNQLYSKLMPLQSPEHPASELLRII 588

Query: 526 NNAAHSANWVHKEAPEFVRATLVECYHYASKSTFKFCLITMILAGASCSIIQEHTLH 582
             AAHS  WVHKEAPEF R  L++CYHYA + TF FCL  M+LA  +C  I E+ LH
Sbjct: 589 EKAAHSTEWVHKEAPEFARHILIDCYHYAGRYTFHFCLACMVLATVACCFIVEYKLH 645

>Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON}
           (96992..98923) [1932 nt, 644 aa]
          Length = 643

 Score =  614 bits (1584), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/599 (54%), Positives = 416/599 (69%), Gaps = 30/599 (5%)

Query: 5   ERTSFLAPIDKDVIQDPSTGLAGFVA---NEVEQQDYNSRTGHDSYGATAVDDRTATSAR 61
           +  S L PI  +++QDPST L GF+A    E EQ+   +R+GH  YGA  ++ R  +S  
Sbjct: 57  DENSVLLPIRDELLQDPSTELPGFIAAEIEEGEQEYEETRSGH--YGA--IESRRISSKG 112

Query: 62  CDLTFPPSETPEFALXXXXXXXXXXXXFLGIFLAALDGTIVSTLLTRIGSEFNSLDKVSW 121
            +L+                       +LGIFLAALD TIVSTLL  I SEFN L ++SW
Sbjct: 113 TELS------------TARLKIIMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISW 160

Query: 122 IATSYLLSSSTCQPLYGKLSDQLGRKPLLVFSNVVFSIGCLICGMSTSIWWVVVGRFVSG 181
           +AT+YLLSS+T QP+YGK+SD  GRK +L+F N+ F +G LICG+S S  W+V GRF++G
Sbjct: 161 VATAYLLSSATFQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAG 220

Query: 182 IGGCGLTCLASMVISDLVPLRERAVYQGLCNFIFGLGTASGGLVGAAFQD----WRMAFT 237
           IGG G+T ++S+  SD+VPLR RA+YQG+CNF FGLGTA GG+VG  F D    WRM+F 
Sbjct: 221 IGGGGITSMSSITTSDIVPLRNRALYQGICNFYFGLGTALGGVVGGWFSDRSVGWRMSFL 280

Query: 238 IQCPISLASCALIVSYLELPPRHED-----DKDRHWTSKLR--DLDWAGVVTLVCFLFLF 290
           IQ PI+  S  LI+ +L LP   +      D +   T K+R   +DW G  TLV FLF F
Sbjct: 281 IQLPIAFFSTILIILFLRLPKESKGRGLQVDGNYFSTIKVRLSAVDWIGATTLVLFLFSF 340

Query: 291 MLVSSLGGKEIAYDSVLFALLCVTTLVLGSIFAYVELYVAVDPVLPIAFLKYRSVLGSSL 350
           M+ +SLGGKEI Y S  F  LCV T++   IF Y EL +A DP+LP+ FLK RSVLGSSL
Sbjct: 341 MITASLGGKEIPYTSHKFIGLCVVTVIGALIFGYTELKIAKDPILPLRFLKDRSVLGSSL 400

Query: 351 ANWFAMMSMLTTNYYLPVYWASVLNMKPTDIGKRSIPSFFSVAFGSLGAGIYMKRTGKYY 410
           +NWF MM+++T +YYLP+Y+A VLNMKPTDIGKR IP+FFS AFGSLGAG YMK+TGKYY
Sbjct: 401 SNWFCMMALMTVSYYLPIYFAGVLNMKPTDIGKRIIPNFFSTAFGSLGAGYYMKKTGKYY 460

Query: 411 WFLLAFCGIGILGQLKINLLTPATPVWQQYLLLVVPSFGLSVLITVTLLAMISAVPHEHH 470
           WF+++FC +  +G L+I  + P   V++QY L+ +P  G SVLITV LLAMI+AVPH H 
Sbjct: 461 WFVISFCVLASIGCLQIVWIQPDISVFKQYTLMFIPGLGASVLITVALLAMIAAVPHNHQ 520

Query: 471 AATTSISYAFRSTGATLGVSIGAAIFRSTLNTLLQNKVLQFASDEHPREELLRIINNAAH 530
           A TTSISYAFRSTG TLGVSIG AIFR +L+ LL++KVL+F S EH  +EL+RII+ A+ 
Sbjct: 521 AVTTSISYAFRSTGCTLGVSIGGAIFRESLDNLLKSKVLKFKSPEHSEDELMRIIDKASQ 580

Query: 531 SANWVHKEAPEFVRATLVECYHYASKSTFKFCLITMILAGASCSIIQEHTLHTTLKRDK 589
           S  WV   +P F++ TL++CYH+A K+ F FCL+  I A  S +II+EH LH TL RD 
Sbjct: 581 STEWVQNSSPSFIKQTLIDCYHFACKNVFIFCLLCTIAATFSMAIIKEHRLHNTLDRDN 639

>KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 579

 Score =  592 bits (1525), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/600 (51%), Positives = 412/600 (68%), Gaps = 33/600 (5%)

Query: 1   MSPGERTSFLAPIDKDVIQDPSTGLAGFVANEVEQQDYNSRTGHDSYGATAVDDRTATSA 60
           M   +RTS L P+   +  + S GL  +V  EV + ++   +  ++     V +   + A
Sbjct: 1   MVESDRTSLLQPVRNALNPELSEGLPAYVGAEVAETEHLLESEDEAREGLQVSE--MSRA 58

Query: 61  RCDLTFPPSETPEFALXXXXXXXXXXXXFLGIFLAALDGTIVSTLLTRIGSEFNSLDKVS 120
           R  +                         LG FLAALD TIV+TLL+ I SEFN L  +S
Sbjct: 59  RLHIII-------------------SSMCLGSFLAALDNTIVTTLLSHIASEFNELSHIS 99

Query: 121 WIATSYLLSSSTCQPLYGKLSDQLGRKPLLVFSNVVFSIGCLICGMSTSIWWVVVGRFVS 180
           WIAT+YLLSS+T QPLYGK+SD  GR+PL++ SN+ F +GCLICG+S ++W +V GRF++
Sbjct: 100 WIATAYLLSSATFQPLYGKISDIFGRRPLIIISNLFFILGCLICGLSKNLWTLVAGRFIA 159

Query: 181 GIGGCGLTCLASMVISDLVPLRERAVYQGLCNFIFGLGTASGGLVGAAFQD----WRMAF 236
           GIGG G+T L S+  SD+VPLR RA+YQG+ NF FGLG A GGL+G  F +    WRMAF
Sbjct: 160 GIGGGGVTSLGSITASDIVPLRSRALYQGIFNFFFGLGIAIGGLIGGWFSESKNGWRMAF 219

Query: 237 TIQCPISLASCALIVSYLELPP--------RHEDDKDRHWTSKLRDLDWAGVVTLVCFLF 288
            +Q P+   S  LI+ +L+LPP         ++ D       KL+ +DW G ++LV FLF
Sbjct: 220 LVQVPLCAISLVLIIIFLKLPPGCKGLGLVSNDKDGKVDIKDKLKRIDWLGSLSLVTFLF 279

Query: 289 LFMLVSSLGGKEIAYDSVLFALLCVTTLVLGSIFAYVELYVAVDPVLPIAFLKYRSVLGS 348
            FML SSLGGKEI Y+S +F LL V T++ G+ F YVELY++ DP+LPI FL  RS+LG+
Sbjct: 280 AFMLASSLGGKEIPYNSNIFKLLVVATILSGTAFIYVELYISDDPILPIRFLTNRSILGA 339

Query: 349 SLANWFAMMSMLTTNYYLPVYWASVLNMKPTDIGKRSIPSFFSVAFGSLGAGIYMKRTGK 408
           S ANWF MMS +T  +Y+PVYW+SV N+KPTD+GKR  P+FFS AFGS+GAG YMK+TG+
Sbjct: 340 SFANWFCMMSGVTLAFYVPVYWSSVQNLKPTDMGKRIAPNFFSTAFGSIGAGYYMKKTGR 399

Query: 409 YYWFLLAFCGIGILGQLKINLLTPATPVWQQYLLLVVPSFGLSVLITVTLLAMISAVPHE 468
           YY FLL F G+ +LGQL++ L+ P    W+QY+LL +P FG SVLITVTLLAMI+AVPHE
Sbjct: 400 YYGFLLKFTGLMVLGQLQVLLMKPDISTWRQYILLPLPHFGSSVLITVTLLAMIAAVPHE 459

Query: 469 HHAATTSISYAFRSTGATLGVSIGAAIFRSTLNTLLQNKVLQFASDEHPREELLRIINNA 528
           H AATTSISYAFRSTG+TLGVS+GAA+FR+ L+  L + V++F SD++ +E LL II  A
Sbjct: 460 HQAATTSISYAFRSTGSTLGVSVGAALFRNKLSGSLFDSVMKFESDKYSKEYLLSIIKQA 519

Query: 529 AHSANWVHKEAPEFVRATLVECYHYASKSTFKFCLITMILAGASCSIIQEHTLHTTLKRD 588
           + S+ +VH  AP+F++ATL++CY  A KSTF FC +  I A  SC +I+E+ LHT+++R 
Sbjct: 520 SESSEYVHANAPKFIQATLIQCYEQACKSTFAFCFLISIFAWISCGVIKEYKLHTSMERK 579

>TPHA0A01750 Chr1 complement(354061..355971) [1911 bp, 636 aa] {ON}
           Anc_8.272 YDR119W
          Length = 636

 Score =  556 bits (1432), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/615 (48%), Positives = 407/615 (66%), Gaps = 47/615 (7%)

Query: 5   ERTSFLAPIDKDVIQDPSTGLAGFVANEVEQQDYNSRTG------HDSYGATA----VDD 54
           +++  L  I  +++QD S  L GFVA E+E+++   R        H  YG+ A    +D+
Sbjct: 25  DKSPLLHAIRGELLQDSSFSLPGFVAAEIEEREELYREASIASNQHHDYGSVANSIILDN 84

Query: 55  RTATSARCDLTFPPSETPEFALXXXXXXXXXXXXFLGIFLAALDGTIVSTLLTRIGSEFN 114
                +   L    S                   +LGIFL+ALD TIVSTLL RIGSEFN
Sbjct: 85  DKNNLSPTRLRLAMSS-----------------MYLGIFLSALDNTIVSTLLARIGSEFN 127

Query: 115 SLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPLLVFSNVVFSIGCLICGMSTSIWWVV 174
            L ++SWIAT+YLLSS+T QPLYGK+SD  GRK +L F NV F IGCLICG + S W +V
Sbjct: 128 ELPRISWIATAYLLSSATFQPLYGKISDIFGRKIVLTFCNVNFFIGCLICGTAKSFWVLV 187

Query: 175 VGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQGLCNFIFGLGTASGGLVGAAFQD--- 231
           +GRF+SG+GG G+T ++++ +SD++PLR RA+YQG+CNF +GLG A GG++G  F +   
Sbjct: 188 IGRFISGVGGGGITSMSTITVSDIIPLRNRALYQGVCNFYYGLGIALGGIIGGWFTEKLG 247

Query: 232 -WRMAFTIQCPISLASCALIVSYLELPPRHE---------DDKDRHWTS-----KLRDLD 276
            WR AF  Q P+S+ S   ++ +L+LP   +         ++   + T      KL+ +D
Sbjct: 248 SWRGAFLFQVPLSVISTVTVMVWLQLPKDSKSYGLEITMSNNSSNNGTESIIMKKLKTID 307

Query: 277 WAGVVTLVCFLFLFMLVSSLGGKEIAYDSVLFALLCVTTLVLGSIFAYVELYVAVDPVLP 336
           W G ++LV FL  FM++SS GG +I+  S  F  L + ++     F Y+EL  A DP+LP
Sbjct: 308 WYGAMSLVIFLLSFMILSSAGGSDISVKSNTFLYLTLISVTSFISFIYIELKFAKDPILP 367

Query: 337 IAFLKYRSVLGSSLANWFAMMSMLTTNYYLPVYWASVLNMKPTDIGKRSIPSFFSVAFGS 396
           + FLK RSVLGSSL+NWF MM ++T +YYLP+Y+ SV+ +   D+GKR++P+FFSVAFGS
Sbjct: 368 LVFLKDRSVLGSSLSNWFTMMLLMTISYYLPIYFTSVMGIGAYDVGKRTLPNFFSVAFGS 427

Query: 397 LGAGIYMKRTGKYYWFLLAFCGIGILGQLKINLLTPATPVWQQYLLLVVPSFGLSVLITV 456
           LGAG YMK+TGKYYWF+  FC + ++G L+I L+     VW+QYLL  VP  G +VLIT+
Sbjct: 428 LGAGYYMKKTGKYYWFVTFFCLVVVIGCLQIYLINDGISVWRQYLLSFVPGLGAAVLITI 487

Query: 457 TLLAMISAVPHEHHAATTSISYAFRSTGATLGVSIGAAIFRSTLNTLLQNKVLQFASD-- 514
            LL+MI AVPHE+ A TTSISYAFRSTG TLGVSIGAA+FR +LN  L+ K+L+  S   
Sbjct: 488 ALLSMIVAVPHEYQAVTTSISYAFRSTGCTLGVSIGAALFRDSLNKYLRAKILELGSQNG 547

Query: 515 EHPREELLRIINNAAHSANWVHKEAPEFVRATLVECYHYASKSTFKFCLITMILAGASCS 574
            +  +ELL+II++A+ S +WVH EAP F + T++ECYHYA K  F FCLI  +LA  S S
Sbjct: 548 NYSEKELLQIIDHASKSIDWVHNEAPRFFKRTILECYHYACKKVFLFCLICSVLALLSIS 607

Query: 575 IIQEHTLHTTLKRDK 589
           +I+EH LH++L R +
Sbjct: 608 MIKEHKLHSSLDRKE 622

>Kwal_26.6669 s26 complement(14202..15974) [1773 bp, 590 aa] {ON}
           YBR293W - Hypothetical ORF [contig 294] FULL
          Length = 590

 Score =  531 bits (1369), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/587 (47%), Positives = 371/587 (63%), Gaps = 13/587 (2%)

Query: 3   PGERTSFLAPIDKDVIQDPSTGLAGFVANEVEQQDYNSRTGHDSYGATAVDDRTATSARC 62
           P ERT  L    +D I D     +  + ++++         H  Y +     R    +  
Sbjct: 11  PNERTHLLDRTLEDGIGD-----SDMLNSDLKSTKIKHTQRHQLYHSNLDKARNGNDSAT 65

Query: 63  DLTFPPSETPEFALXXXXXXXXXXXXFLGIFLAALDGTIVSTLLTRIGSEFNSLDKVSWI 122
           D     S      L            FLGIFLAALD TIVSTLL  IGSE N +  VS +
Sbjct: 66  DF----SSNNLSDLMSRRIFMISASMFLGIFLAALDNTIVSTLLPHIGSELNDMPNVSLV 121

Query: 123 ATSYLLSSSTCQPLYGKLSDQLGRKPLLVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGI 182
           ATSY+ S +  QPL+GK SD  GRKPLL+ SN++F  GCL CG+S +IWW+++GR V+GI
Sbjct: 122 ATSYVFSCAIFQPLFGKTSDVFGRKPLLISSNLLFFAGCLTCGLSKTIWWLILGRLVTGI 181

Query: 183 GGCGLTCLASMVISDLVPLRERAVYQGLCNFIFGLGTASGGLVGAAFQD----WRMAFTI 238
           GG GLT + +++I+D+VPLR RAVYQG  N  + LGTA GGLVG  F +    WRMAF I
Sbjct: 182 GGGGLTSMCTIIINDIVPLRNRAVYQGFGNLFYALGTACGGLVGGLFSEYGNGWRMAFMI 241

Query: 239 QCPISLASCALIVSYLELPPRHEDDKDRHWTSKLRDLDWAGVVTLVCFLFLFMLVSSLGG 298
           Q P    S   I+ YL+L    +D        KLR +DW G +TLV FL LF++  ++GG
Sbjct: 242 QLPFCFLSTISIIVYLDLSDDKQDLGRSSLYCKLRLIDWLGALTLVTFLLLFLVTMTIGG 301

Query: 299 KEIAYDSVLFALLCVTTLVLGSIFAYVELYVAVDPVLPIAFLKYRSVLGSSLANWFAMMS 358
           + + Y S+ F LLCV     G   AYVE+++A DP+LPI+FL+ ++VLGSSLANWF MM 
Sbjct: 302 QHVPYGSLRFFLLCVAVCASGLALAYVEIFLANDPILPISFLRNKNVLGSSLANWFCMMG 361

Query: 359 MLTTNYYLPVYWASVLNMKPTDIGKRSIPSFFSVAFGSLGAGIYMKRTGKYYWFLLAFCG 418
           M+T  YYLP+YW+SV N  P  +GK+SIPSFFS+A GS G   Y+++ G YY  L+  C 
Sbjct: 362 MMTITYYLPIYWSSVSNQGPIQVGKKSIPSFFSMALGSFGTAYYVQKNGTYYRLLMTSCL 421

Query: 419 IGILGQLKINLLTPATPVWQQYLLLVVPSFGLSVLITVTLLAMISAVPHEHHAATTSISY 478
           I I GQL+I  +TP  P W+QY+LL VP FG+S+LITVTLLAMI+AVPH+H AATTS+SY
Sbjct: 422 IIIFGQLQIVYITPEMPQWRQYILLAVPGFGVSILITVTLLAMIAAVPHKHQAATTSLSY 481

Query: 479 AFRSTGATLGVSIGAAIFRSTLNTLLQNKVLQFASDEHPREELLRIINNAAHSANWVHKE 538
           AFR+TG  +G S+  AIF++TL   +   V++F  DEH ++EL  +I  A  S++WV+  
Sbjct: 482 AFRTTGCIIGASLAGAIFQNTLKKNVTTAVMKFLGDEHSKKELNLVIEKALRSSDWVNNG 541

Query: 539 APEFVRATLVECYHYASKSTFKFCLITMILAGASCSIIQEHTLHTTL 585
           +PEFV   L++CY  A   TF+FCL+  +L   SCS I E  L TTL
Sbjct: 542 SPEFVHEALLKCYENACGQTFRFCLLCFLLTVISCSFITEINLPTTL 588

>TBLA0F03040 Chr6 complement(735352..738072) [2721 bp, 906 aa] {ON}
           Anc_8.272 YDR119W
          Length = 906

 Score =  523 bits (1346), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 286/587 (48%), Positives = 384/587 (65%), Gaps = 13/587 (2%)

Query: 5   ERTSFLAPIDKDVIQDPSTGLAGFVANEVEQQDYNSRTGHDSYGATAVDDRTATSARCDL 64
           + +  L PI  + IQD ST +AGFVA E+E+ +  +R   +     A+   TA+      
Sbjct: 326 DSSQILKPIRDEFIQDASTDIAGFVAGELEEIEEEAREAREGEEGEALITSTASYG---- 381

Query: 65  TFPPSETPEFALXXXXXXXXXXXXFLGIFLAALDGTIVSTLLTRIGSEFNSLDKVSWIAT 124
           T P    P   +            +LG+FLAALD T+VSTL+  IGSEFN + KV W+AT
Sbjct: 382 TLPIE--PSVEMSNMKMNIIMCSMYLGVFLAALDNTVVSTLMAHIGSEFNQIPKVPWVAT 439

Query: 125 SYLLSSSTCQPLYGKLSDQLGRKPLLVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGG 184
           SYLLSS+  QPLYGKLSD  GRK LL+FSN++F  GC+ICGMS S+  +V GRFV+GIGG
Sbjct: 440 SYLLSSAVFQPLYGKLSDIFGRKALLIFSNLIFFFGCIICGMSNSLNMLVWGRFVAGIGG 499

Query: 185 CGLTCLASMVISDLVPLRERAVYQGLCNFIFGLGTASGGLVGAAFQD----WRMAFTIQC 240
            G+T + ++ +SD+VPLR RAVYQG+CNF FGLGTA GG++G  F D    WRM F  Q 
Sbjct: 500 GGITSMTTITVSDIVPLRSRAVYQGICNFFFGLGTAFGGVIGGIFVDHQYGWRMVFWSQV 559

Query: 241 PISLASCALIVSYLELPPRHEDDKDRHWTSKLRDLDWAGVVTLVCFLFLFMLVSSL-GGK 299
           P+S  S  LI S+L +P     + +     KL  +DW G ++++ +L  F+L++++ GG 
Sbjct: 560 PVSGLSTLLICSFLVVP--RIKNYEVSLGRKLMRVDWLGSISMILWLTSFLLITTMMGGI 617

Query: 300 EIAYDSVLFALLCVTTLVLGSIFAYVELYVAVDPVLPIAFLKYRSVLGSSLANWFAMMSM 359
            +  DS  F  L + + V   IF   EL+VA DPVLP+ FL  RSVLG+SL N+F +M  
Sbjct: 618 SLDIDSDQFHYLIMFSSVSAIIFVLTELFVASDPVLPLRFLSNRSVLGASLGNFFCVMGF 677

Query: 360 LTTNYYLPVYWASVLNMKPTDIGKRSIPSFFSVAFGSLGAGIYMKRTGKYYWFLLAFCGI 419
           +T  +YLP+Y+ASVL++ PT IGKR  P+F   A GSLGAG+YMK+TGKYYWF++ F  +
Sbjct: 678 MTICFYLPIYFASVLDISPTGIGKRMAPNFLCTALGSLGAGVYMKQTGKYYWFVVLFALV 737

Query: 420 GILGQLKINLLTPATPVWQQYLLLVVPSFGLSVLITVTLLAMISAVPHEHHAATTSISYA 479
             LG   + L+     +  QYLL+V+P  G S++I V LLAMI+AVPH+H AATTSISYA
Sbjct: 738 STLGHYYLTLIPLTVSITVQYLLVVLPGVGSSIIIVVALLAMIAAVPHKHQAATTSISYA 797

Query: 480 FRSTGATLGVSIGAAIFRSTLNTLLQNKVLQFASDEHPREELLRIINNAAHSANWVHKEA 539
           FRSTG TLGV++G+++F  TL   L   VL++ S EHPR+ELLRII  A+HS  WVH++A
Sbjct: 798 FRSTGGTLGVALGSSVFHRTLIKRLHTDVLEYVSPEHPRKELLRIIKKASHSTEWVHRKA 857

Query: 540 PEFVRATLVECYHYASKSTFKFCLITMILAGASCSIIQEHTLHTTLK 586
           P F+R TL+ CY  A    F FC    +LA  S ++I+E  L T L+
Sbjct: 858 PTFIRDTLITCYDVACHDVFVFCTACALLAAISLALIREERLATGLR 904

>Ecym_4298 Chr4 complement(636605..638641) [2037 bp, 678 aa] {ON}
           similar to Ashbya gossypii AGR076C
          Length = 678

 Score =  458 bits (1179), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 258/610 (42%), Positives = 365/610 (59%), Gaps = 28/610 (4%)

Query: 2   SPGERTSFLAPIDKDVIQDPSTGLAGFVANEVEQQDYNSRTG--------HDSYGATAVD 53
           S GE   FL  IDK+VIQD S+G  GFV N++E Q+ +  +         + SYG+T+  
Sbjct: 58  SQGETIPFLTRIDKNVIQDTSSGRPGFVINKLEVQELSLGSAGSQSTTILNSSYGSTSTT 117

Query: 54  DRTATSARCDLTFPPSETPEFA-------LXXXXXXXXXXXXFLGIFLAALDGTIVSTLL 106
             T  S +    F  S + E         +             +G+FL +LDGTI+STLL
Sbjct: 118 -VTPDSNKNGNVFIRSSSVEVGNIGDSQNISQIRFAAIVSSLVVGVFLGSLDGTILSTLL 176

Query: 107 TRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPLLVFSNVVFSIGCLICGM 166
             I SEF +L  +SWIA SYLLS+   QPLYGKLSD  GRK +L+FSN++F +GCL+CG 
Sbjct: 177 DYIASEFEALPYISWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGT 236

Query: 167 STSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQGLCNFIFGLGTASGGLVG 226
           + ++WW++ GRFV+GIGG GLT + S++ISD+VPLR RA YQ L N  + LG   GG +G
Sbjct: 237 APTVWWLLAGRFVAGIGGGGLTSMPSIIISDIVPLRSRASYQDLFNICYVLGITLGGSMG 296

Query: 227 ---AAFQDWRMAFTIQCPISLASCALIVSYLELPPRHEDD-----KDRHWTSKLRDLDWA 278
              A +  WR+ F +Q   +L S   I ++L LP  H  +           +KL  +DW 
Sbjct: 297 GWLAEYGGWRLVFLLQVVAALISGCFIQAFLILPKVHHGNGIALANKESLKTKLYMMDWL 356

Query: 279 GVVTLVCFLFLFMLVSSLGGKEIAYDSVLFALLCVTTLVLGSIFAYVELYVAVDPVLPIA 338
           G   LV FL    L  SL    +  +     LL +   V G  F Y EL +A DP+L + 
Sbjct: 357 GTFCLVIFLASLTLTCSL----VDLNFNFLLLLILLMFVSGYYFVYHELNIAADPILSVH 412

Query: 339 FLKYRSVLGSSLANWFAMMSMLTTNYYLPVYWASVLNMKPTDIGKRSIPSFFSVAFGSLG 398
            L  R+VL SSLAN+F M++ + T +Y+P+Y+ASVL M P +IGKR+I SF   + GS G
Sbjct: 413 LLTDRNVLASSLANFFCMLNDVLTIFYVPMYFASVLYMGPKEIGKRTIISFLGTSIGSFG 472

Query: 399 AGIYMKRTGKYYWFLLAFCGIGILGQLKINLLTPATPVWQQYLLLVVPSFGLSVLITVTL 458
            G Y+KR GKY  F+   C IGILGQL+I L+ P+   W+QYLLL++P    + + T  L
Sbjct: 473 TGYYIKRRGKYRTFICLACIIGILGQLQIALIKPSISTWRQYLLLLIPILYTTTVRTSLL 532

Query: 459 LAMISAVPHEHHAATTSISYAFRSTGATLGVSIGAAIFRSTLNTLLQNKVLQFASDEHPR 518
           +++I+AVP+++  A  SISY FRSTGA LG S+G  IFRS+L +LL   ++   S+ HP+
Sbjct: 533 ISLIAAVPYKNQTAAASISYTFRSTGAILGASLGGGIFRSSLKSLLNTNIMPLESEIHPK 592

Query: 519 EELLRIINNAAHSANWVHKEAPEFVRATLVECYHYASKSTFKFCLITMILAGASCSIIQE 578
            +LL II+ A HS +WVH+E+PE+    L+ CYHY  K  F F ++ ++    SC  ++E
Sbjct: 593 SQLLHIIDKATHSTDWVHRESPEYAIPILISCYHYVCKRIFTFSVVCVLFTSISCYFLKE 652

Query: 579 HTLHTTLKRD 588
           + +H +  ++
Sbjct: 653 YPVHASQPQE 662

>KLLA0F17776g Chr6 complement(1627198..1628859) [1662 bp, 553 aa]
           {ON} weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 553

 Score =  348 bits (892), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 206/515 (40%), Positives = 298/515 (57%), Gaps = 17/515 (3%)

Query: 89  FLGIFLAALDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKP 148
           F+G +LAALD TIV+TLL  I SE ++ +++SWIATSYLLS S  QPLYGKLSD  GRKP
Sbjct: 39  FVGSYLAALDTTIVTTLLPTIASELDASNQMSWIATSYLLSCSAFQPLYGKLSDVFGRKP 98

Query: 149 LLVFSNVVFSIGCLICG--MSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAV 206
           LL++SN+ F  GC++CG   + S+W + +GRF++G+GG GL  L+++  SD++PLR+R V
Sbjct: 99  LLIWSNLCFGFGCILCGAPFTKSLWMLCIGRFIAGVGGGGLNSLSTITTSDIIPLRQRGV 158

Query: 207 YQGLCNFIFGLGTASGGLVGAAFQD---WRMAFTIQCPISLASCALIVSYLELPPRHED- 262
           YQG+ N +F LG ASG L+GA  Q    WR AF  Q P+SL SC+LI+ +L LP      
Sbjct: 159 YQGMGNIVFALGCASGSLIGAFLQQRIGWRWAFLCQVPLSLLSCSLIMKFLNLPAGSPGR 218

Query: 263 -----DKDRHWTSKLRD-LDWAGVVTLVCFLFLFMLVSSLGGKEIAYDSVLFALLCVTTL 316
                   +  T+ +R+ +D+ G  TL+  + L M++ S+           +AL  V   
Sbjct: 219 GLINLSNKKITTADVREHVDFTGSFTLITTMLLLMIILSVLDNPSHLTYGTWALFIVGLA 278

Query: 317 VLGSIFAYVELYVAVDPVLPIAFL-KYRSVLGSSLANWFAMMSMLTTNYYLPVYWASVLN 375
           + G  F   EL V  +P++PI  L   R+VL SSL NWF  MS     YY+PV+W +V +
Sbjct: 279 LAGYTFVSTELSVH-NPMVPIRLLGSNRTVLASSLTNWFFTMSTFVLAYYVPVFWQTVYH 337

Query: 376 MKPTDIGKRSIPSFFSVAFGSLGAGIYMKRTGKYYWFLLAFCGIGILGQLKINLLTPATP 435
           +KP +IG R++ +FF +A GS+  G+YMKRTGKY         + + G L + L T  T 
Sbjct: 338 LKPWNIGVRTVSNFFGIAIGSMMTGLYMKRTGKYKALSNTLNTVTVAGTLIVYLSTYNTE 397

Query: 436 V--WQQYLLLVVPSFGLSVLITVTLLAMISAVPHEHHAATTSISYAFRSTGATLGVSIGA 493
                +Y +L +P  G + ++T+TLL++I++V   H A  TSI YAFR+ G+TLGVS   
Sbjct: 398 PKGLLEYFMLFLPGLGYASMLTITLLSLIASVDTSHQAQVTSIQYAFRAIGSTLGVSFAG 457

Query: 494 AIFRSTLNT-LLQNKVLQFASDEHPREELLRIINNAAHSANWVHKEAPEFVRATLVECYH 552
            I++S L T LL+N V     ++      LR         N         + +     + 
Sbjct: 458 LIYQSKLQTSLLRNIVENKTLNDKYSTHQLRKWCQTLLENNSFDVSFDPLLESLAKISFQ 517

Query: 553 YASKSTFKFCLITMILAGASCSIIQEHTLHTTLKR 587
             S+    F ++  IL   S   I+EH LHT ++R
Sbjct: 518 GGSRLVLGFAVLASILGLLSSLFIREHVLHTDIQR 552

>SAKL0C02178g Chr3 complement(191542..193239) [1698 bp, 565 aa] {ON}
           weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 565

 Score =  332 bits (850), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 204/526 (38%), Positives = 300/526 (57%), Gaps = 34/526 (6%)

Query: 89  FLGIFLAALDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKP 148
            +G FL+ALD TIV+TLL  I S+ ++  ++SWIAT+YLLS S  QPLYGKLSD  GRK 
Sbjct: 48  LMGSFLSALDTTIVATLLPTIASDLDASSQMSWIATAYLLSCSAFQPLYGKLSDIFGRKI 107

Query: 149 LLVFSNVVFSIGCLICG--MSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAV 206
           LL+ SN+ F++GC ICG   + ++W +  GRFV+GIGG G   L+++  SD++PLR+R V
Sbjct: 108 LLILSNLTFALGCAICGSPWTNNVWVLSTGRFVAGIGGGGQATLSTITTSDIIPLRKRGV 167

Query: 207 YQGLCNFIFGLGTASGGLVGAAFQD---WRMAFTIQCPISLASCALIVSYLELPPRH--- 260
           YQGL N  F LG ASG ++GA  Q    WR AF +Q P++L    +I   L+LP      
Sbjct: 168 YQGLVNICFSLGCASGSVLGAVLQQGIGWRWAFLVQVPMALVCALMIAVVLDLPADSPGR 227

Query: 261 -------EDDKDRHWTSKLRDLDWAGVVTLVCFLFLFMLVSSLGGKEIAYDSVLFALLCV 313
                  +  K   W +    +D+ G  TL+  + L M   SL        + L+ LL V
Sbjct: 228 GLLWLELKRGKRLKWCTVTEMVDFVGSFTLIASMILLMTAISLLSDPTQLSTSLWLLLGV 287

Query: 314 TTLVLGSIFAYVELYVAVDPVLPIAFL-KYRSVLGSSLANWFAMMSMLTTNYYLPVYWAS 372
                   FAY E     +P++P+  L + R+V  SS  NWF  M+  T  YY+PV+W +
Sbjct: 288 LLTASSLQFAYTEC-TTRNPMVPLRLLWENRTVCASSFTNWFMTMTTFTVMYYVPVFWHT 346

Query: 373 VLNMKPTDIGKRSIPSFFSVAFGSLGAGIYMKRTGKYYWFLLA---FCGIGILGQLKINL 429
           V    P DIG RS+ +F  +A GS+ AG+YMKRTGKY+ F +A      +G+L     + 
Sbjct: 347 VYKFTPWDIGVRSMSNFVGIASGSMLAGMYMKRTGKYWSFSVATNSLFAVGVLSLFAFSF 406

Query: 430 LTPATPVWQQYLLLVVPSFGLSVLITVTLLAMISAVPHEHHAATTSISYAFRSTGATLGV 489
                 V  +YLL+ +P FG + ++TVTLLA+I++V  EH A  TSI YAFR+TG+TLGV
Sbjct: 407 KGSPQGV-VEYLLMFLPGFGYATMLTVTLLALIASVSVEHQAQVTSIQYAFRATGSTLGV 465

Query: 490 SIGAAIFRSTLNTLLQNKVL-------QFASDEHPREELLRIINNAAHSANWVHKEAPEF 542
           ++ + I++S L + L N VL       Q+ S     +    I+ + +   ++ H+ A E 
Sbjct: 466 ALASLIYQSCLQSRLYNNVLTDGPLLAQYGS-RRLMDWCQSILQDNSFDISFDHRLA-EL 523

Query: 543 VRATLVECYHYASKSTFKFCLITMILAGASCSIIQEHTLHTTLKRD 588
           VR    + + ++++    F  +  +L   S   ++EH LHT++ R 
Sbjct: 524 VR----QGFQFSNQCALGFAFVVCVLGVLSSCFMREHVLHTSVSRK 565

>SAKL0E04246g Chr5 (336416..338113) [1698 bp, 565 aa] {ON} weakly
           similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 565

 Score =  317 bits (812), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 212/525 (40%), Positives = 299/525 (56%), Gaps = 38/525 (7%)

Query: 89  FLGIFLAALDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKP 148
           FLG FL+ALD TIVSTLL  I S+ ++  ++SWIATSYLLS S  QPLYGKLSD  GRK 
Sbjct: 48  FLGSFLSALDTTIVSTLLPTIASDLDASSQMSWIATSYLLSCSAFQPLYGKLSDIFGRKI 107

Query: 149 LLVFSNVVFSIGCLICG--MSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAV 206
           LLV+SN+VF+IGC +CG   +T+IW +  GRF++GIGG GLT L+++  SD++PLR+R V
Sbjct: 108 LLVWSNLVFAIGCALCGSPWTTNIWILSAGRFIAGIGGGGLTTLSTITTSDIIPLRKRGV 167

Query: 207 YQGLCNFIFGLGTASGGLVGAAFQD---WRMAFTIQCPISLASCALIVSYLELPP----- 258
           YQGL N  F LG ASG ++GA  Q    WR AF IQ PI+L S  LIV  LELP      
Sbjct: 168 YQGLGNICFSLGCASGSVLGAVLQQGIGWRWAFLIQVPIALISGLLIVFVLELPSDSPGR 227

Query: 259 -----RHEDDKDRHWTSKLRDLDWAGVVTLVCFLFLFMLVSSLGGKEIAYDSVLFALLCV 313
                 H       W+   + +D+ G +TLV  + L M+  S            + +L +
Sbjct: 228 GLIWLEHARGNTFQWSKVTKMIDFVGSITLVMSMLLLMITISFLSDPSQLSENSWVVLVL 287

Query: 314 TTLVLGSIFAYVELYVAVDPVLPIAFL-KYRSVLGSSLANWFAMMSMLTTNYYLPVYWAS 372
                 + F + E  +  +P++P+  L + R+V  SS  NWF  MS     YY+PV+W +
Sbjct: 288 LVAGFCAKFVHTECTIH-NPMVPLRLLWENRTVFASSFTNWFMTMSTFAVMYYIPVFWQT 346

Query: 373 VLNMKPTDIGKRSIPSFFSVAFGSLGAGIYMKRTGKYYWF-----LLAFCGIGILGQLKI 427
           V    P DIG RSI +F  +A GS+ AG+YMK TGKY+ F     +L F GI  L     
Sbjct: 347 VFKFTPYDIGFRSISNFVGIATGSMLAGVYMKCTGKYWNFSLVTNILYFTGILSLFACTF 406

Query: 428 NLLTPATPVWQQYLLLVVPSFGLSVLITVTLLAMISAVPHEHHAATTSISYAFRSTGATL 487
              TP   +  +YLL+ +P FG + ++TVTLLA+I++V  EH A  TSI YAFR+TG+TL
Sbjct: 407 R-NTPQGVL--EYLLMFLPGFGYATMLTVTLLALIASVDFEHQAQVTSIQYAFRATGSTL 463

Query: 488 GVSIGAAIFRSTLNTLLQNKVL-------QFASDEHPREELLRIINNAAHSANWVHKEAP 540
           GVS+   I++++L   L   +L       ++  D+  R+    I+ + +   ++  + A 
Sbjct: 464 GVSLAGLIYQASLQYKLYRDILGDQTLLGKYGQDQL-RKWCKEILQDNSFDTSFDQRLAK 522

Query: 541 EFVRATLVECYHYASKSTFKFCLITMILAGASCSIIQEHTLHTTL 585
           E  R      + ++S+    F L    L       ++EH L  T+
Sbjct: 523 EVHRG-----FQFSSECALGFALAACTLGVVLSCFMREHVLGKTV 562

>Kwal_26.6697 s26 complement(26786..28519) [1734 bp, 577 aa] {ON}
           YBR293W - Hypothetical ORF [contig 381] FULL
          Length = 577

 Score =  203 bits (517), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 155/512 (30%), Positives = 261/512 (50%), Gaps = 52/512 (10%)

Query: 89  FLGIFLAALDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKP 148
           F  +FL+ LD TI +++   IG+EF  +   SWI T+YL++ ++ QPLYG  SD LGR+ 
Sbjct: 53  FTNVFLSGLDSTITASIYQLIGNEFEDVKVSSWITTAYLVTCTSFQPLYGSFSDTLGRRR 112

Query: 149 LLVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQ 208
            L F+N +F++GCL CG++++I+ +++ R V+GIGG GL  L+++V SD++P ++R +YQ
Sbjct: 113 CLFFANTIFALGCLGCGLTSTIYSLIIMRAVTGIGGGGLITLSTIVNSDIIPAKKRGMYQ 172

Query: 209 GLCNFIFGLGTASGGLVG---AAFQDWRMAFTIQCPISLASCALIVSYLELPPRHEDDKD 265
              N + G G   G   G   A+   WR  F +Q PIS+     +++YL +  +   DK+
Sbjct: 173 SFQNILVGTGAVVGASCGGEIASSMGWRWCFLLQVPISIGGA--VMAYLFVQDQDVVDKN 230

Query: 266 RHW------TSKLRDLDWAGVVTLVC-----FLFLFMLVSSLGGKE--IAYDSVLFALLC 312
                     SK++ +D+ G   L+       +FL +  S+  GK   ++  S+   L+ 
Sbjct: 231 PRSGALPSNVSKIKKIDFLGAFLLISGLVSQLIFLTINSSAQEGKSTWLSGRSLALGLVT 290

Query: 313 VTTLVLGSIFAYVELYVAVDPVLPIAFLKYRSVLGSSLANWFAMMSMLTTN--------- 363
             +L+L   FAYVE     +P++P        +LG     W++   ++            
Sbjct: 291 AVSLIL---FAYVEKTTTANPIIP------HDLLG----QWYSTTVLIVGVLVGFVSYAY 337

Query: 364 -YYLPVYWASVLNMKPTDIGKR-SIPSFFSVAFGSLGAGIYMKRTGKYYWFLLAFCGIGI 421
            + LP+Y+  V+     + G R ++PS F    G +  GI MK   +    L+    + +
Sbjct: 338 IFTLPLYFQVVVGDTAAEAGLRLTVPS-FCTPIGGVIMGISMKDPKRLPGLLIVGISLML 396

Query: 422 LGQLKINLLTPATPVWQQYLLLVVPSFGLSVLITVTLLAMISAVPHEHHAATTSISYAFR 481
            G L   L+ P TP W   LLLV  + G  +    TL + + A P    A  T+  Y FR
Sbjct: 397 FGNLCFLLIKPTTPYWLTSLLLVPANIGQGITFPSTLFSFLFAFPPYKQATATATLYLFR 456

Query: 482 STGATLGVSIGAAIFRSTLNTLLQNKVLQFASDEHPREELLRIINNAAHSANWVHKEAPE 541
           S G   GV+  +++ +S +      ++    +DE  +  L+++    +H  + + K  P+
Sbjct: 457 SVGCVWGVAGTSSLIQSVVRKQATKRLQGILTDEEIKSLLVKL----SHKTSLIEK-LPD 511

Query: 542 FVRATLVECYHYASKSTFKF----CLITMILA 569
            VRA ++  Y  + KST+ F    CLI +ILA
Sbjct: 512 NVRAAVLTSYEISIKSTYFFSVILCLIAIILA 543

>TDEL0C00120 Chr3 complement(7481..9190) [1710 bp, 569 aa] {ON} 
          Length = 569

 Score =  189 bits (480), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 156/517 (30%), Positives = 256/517 (49%), Gaps = 32/517 (6%)

Query: 89  FLGIFLAALDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKP 148
           F  +FL+  DGT+ ++    IG+EFN ++  SWI T+YL++S++ QPLYG  SD LGR+ 
Sbjct: 62  FTNVFLSGFDGTVTASTYQTIGNEFNHMNISSWITTAYLITSTSFQPLYGSFSDALGRRN 121

Query: 149 LLVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQ 208
            L F+N  F+IGCL CG+S +I  +   R ++GIGG GL  L+++V SD++P  +R ++Q
Sbjct: 122 CLFFANTSFTIGCLACGLSPNIVVLSFMRALTGIGGGGLITLSTIVNSDMIPSSKRGIFQ 181

Query: 209 GLCNFIFGLGTASGGLVGAAFQD---WRMAFTIQCPISLASCALIVSYLELPPRHEDDKD 265
              N + GLG   G   G +      WR  F +Q PI + +  ++ SY+   P  ++ +D
Sbjct: 182 AFQNLLLGLGAICGASFGGSIASSIGWRWCFFVQVPICITNSLIMSSYV---PNQKEYED 238

Query: 266 R------HWTSKLRDLDWAGVVTLVCFLFLFMLVSSLGGKEIAYD----SVLFALLCVTT 315
           R      H    L+D+D  G V ++  L L +L  SLG  ++       SVL  LL  + 
Sbjct: 239 REIGFLFHPKKILKDIDVTGSVFIIIGLTLQLLYLSLGSSKVGVSWTSPSVL-PLLFASG 297

Query: 316 LVLGSIFAYVELYVAVDPVLPIAFLKYR---SVLGSSLANWFAMMSMLTTNYYLPVYWAS 372
           ++L  +F Y E   +   ++P+  ++      VL  S+   FA  + L T   LP+++  
Sbjct: 298 IIL-VLFVYNEAKTSARAIIPLELMRSSFSFVVLTISILVGFASYAYLFT---LPLFFQI 353

Query: 373 VLNMKPTDIGKR-SIPSFFSVAFGSLGAGIYMKRTGKYYWFLLAFCGIGILGQLKINLLT 431
           VL       G R +IPS F+   G L  GI M R       L A   +  LG      + 
Sbjct: 354 VLGDSTAKAGLRLTIPSLFT-PVGGLITGICMSRYNCLQILLYAGVFLMALGNFLFLFIE 412

Query: 432 PATPVWQQYLLLVVPSFGLSVLITVTLLAMISAVPHEHHAATTSISYAFRSTGATLGVSI 491
             +P W   L L+  + G  +    TL   I A P    A  TS  Y FRS G+  GV++
Sbjct: 413 KGSPNWLVGLFLIPANLGQGITFPATLFTFIFAFPKSRQATATSTLYLFRSIGSVWGVAM 472

Query: 492 GAAIFRSTLNTLLQNKVLQFASDEHPREELLRIINNAAHSANWVHKEAPEFVRATLVECY 551
              + +      L++ +     ++   E + +I +N+++    +H E    ++  +++C+
Sbjct: 473 STGVIQLYFGKSLRSNLKDLLDEDKINELVTKITSNSSYIEK-LHGE----LKDVVIDCF 527

Query: 552 HYASKSTFKFCLITMILAGASCSIIQEHTLHTTLKRD 588
             ++K       I  +LA A C +I+E      +K +
Sbjct: 528 DSSTKKAHLLSTILSLLALAFC-VIKEFLKKPKIKEE 563

>CAGL0J01375g Chr10 (127843..129537) [1695 bp, 564 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088c
          Length = 564

 Score =  186 bits (471), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 139/480 (28%), Positives = 230/480 (47%), Gaps = 50/480 (10%)

Query: 90  LGIFLAALDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPL 149
           LG FL++LDGTIV+ ++ R+  EF   DK  WIATSYLL+++  QPLYGKLSD  GRK  
Sbjct: 45  LGSFLSSLDGTIVANIMNRVAEEFQESDKKQWIATSYLLTNTAFQPLYGKLSDLTGRKFA 104

Query: 150 LVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQG 209
           ++ ++  F +GCL+   + S+    + R + G+GG G+  ++S+ +SD+   RER +YQG
Sbjct: 105 VLTAHFFFGLGCLLTCFANSVTQFAIARAICGVGGGGINAMSSITVSDICTQRERGIYQG 164

Query: 210 LCNFIFGLGTASGGLVGAAFQD---WRMAFTIQCPISLASCALIVSYLELPPRH-EDDKD 265
             N +FGLG   G  +G  F D   WR+ F +Q P  L   +L+   + +   H    ++
Sbjct: 165 YANIVFGLGQILGAPIGGLFIDTLGWRILFGLQVPTILLCSSLVHKNVNIKLSHLLPVEE 224

Query: 266 RHWTSKLRDLDWAGVVTLVCFL--FLFMLVSSLGGKEIAYDSVLFALLCVTTLVLGSIFA 323
           R   S L  +D  G  TLV  +   LF+  + L            ALL + T++    F 
Sbjct: 225 RFKWSNLSRIDILGSSTLVFTISGVLFLCSTELNK----------ALLSIFTVISFIAFI 274

Query: 324 YVELYVAVDPVLPIAFLKYRSVLGSSLANWFAMMSMLTTNYYLPVYWASVLNMKPTDIGK 383
            +ELY + + ++P   LK    L S+ A   +   +    +  P+Y   +  +  T  G 
Sbjct: 275 LIELYYSKERIMPFELLKGSFGLASA-ATVISSFIIFGDIFRSPIYLQLIQGVSVTKTGF 333

Query: 384 RSIPSFFSVAFGSLGAGIYMKRTGKY-----YWFLLAFCGIGILG--------------- 423
             +    SVA GSL  G  ++ T        YW +     I +LG               
Sbjct: 334 FMLFPSISVAVGSLATGWILRHTKMKLSHCAYWIVTIGMSIQLLGLVVAYYLIQNLEPSL 393

Query: 424 ----------QLKINLLTPA-TPVWQQYLLLVVPSFGLSVLITVTLLAMISAVPHEHHAA 472
                     Q+  N+ + + T V    L L++ SFG + L+  TL+ ++  +P      
Sbjct: 394 SGSAIFGAFVQIGQNISSQSYTWVVIYALALILVSFGYACLLVATLVNIVFTIPKSQQGT 453

Query: 473 TTSISYAFRSTGATLGVSIGAAIFRSTLNTLLQNKVLQFASDEH--PREELLRIINNAAH 530
            T I Y +RS G  LG S+    +   +++ L N +     D++   ++E  +++++ ++
Sbjct: 454 VTGIFYLWRSIGNVLGASLTLVFYEKGVSSFLWNYMFNKQHDDYNFSKKEYRKLLSDTSY 513

>Suva_4.553 Chr4 (959592..961280) [1689 bp, 562 aa] {ON} YBR293W
           (REAL)
          Length = 562

 Score =  186 bits (471), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 164/541 (30%), Positives = 257/541 (47%), Gaps = 36/541 (6%)

Query: 53  DDRTATSARCDLTFPPSETPEFALXXXXXXXXXXXXFLGIFLAALDGTIVSTLLTRIGSE 112
           D+    +A  D   P S  P   +            F  +FLA  DGTI ++    IG+E
Sbjct: 36  DNEEIQNADDDEDIPLSRIPNLWIIEATL-------FSNVFLAGFDGTITASTYQTIGNE 88

Query: 113 FNSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPLLVFSNVVFSIGCLICGMSTSIWW 172
           FN +   SWI T+YL++S++ QPLYG  SD LGR+  L F+N VF+IGCL C  ST+I+ 
Sbjct: 89  FNQMSISSWITTAYLITSTSFQPLYGSFSDALGRRNCLFFANAVFTIGCLACSFSTNIYM 148

Query: 173 VVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQGLCNFIFGLGTASGGLVGAAFQD- 231
           +   R ++GIGG GL  L+++V SD++P  +R ++Q   N + G G   G   G      
Sbjct: 149 LSFMRALAGIGGGGLITLSTIVNSDVIPSSKRGIFQAFQNLLLGFGAICGASFGGTITST 208

Query: 232 --WRMAFTIQCPISLASCALIVSYLELPPRHEDDKDRHWTSK---LRDLDWAGVVTLVCF 286
             WR  F IQ PIS+ +  L+  Y+     ++D K     S    L+D+D  G + ++  
Sbjct: 209 IGWRWCFLIQVPISMIASLLMNYYVPNQKEYDDQKINILLSSKKILKDIDITGSILIIAG 268

Query: 287 LFLFMLVSSLGGKEIAYDSVLFALLCVTTLVLGSIFAYVELYVAVDPVLPIAFLKYR--- 343
           L L +L  SLG    ++ +    +L + ++V+  +F   E       ++P+  +      
Sbjct: 269 LTLQLLYLSLGA-SFSWTNPPVLMLLLASIVIIILFILNERKTTARAIIPMELVNSSFSF 327

Query: 344 SVLGSSLANWFAMMSMLTTNYYLPVYWASVLNMKPTDIGKR-SIPSFFSVAFGSLGAGIY 402
            VL  S+   FA  + L T   LP+++  VL       G R +IPS F+   GSL  GI 
Sbjct: 328 VVLSISILVGFASYAYLFT---LPLFFQIVLGDSTAKAGLRLTIPSLFT-PVGSLITGIS 383

Query: 403 MKRTGKYYWFLLAFCGIGI----LGQLKINLLTPATPVWQQYLLLVVPSFGLSVLITVTL 458
           M +    Y  L +   IGI    LG      +   +P W   + L+  + G  +    TL
Sbjct: 384 MSK----YDCLQSLLYIGIFLMFLGNFLFLFIEKTSPNWLIGVFLIPANLGQGITFPTTL 439

Query: 459 LAMISAVPHEHHAATTSISYAFRSTGATLGVSIGAAIFRSTLNTLLQNKVLQFASDEHPR 518
              I A P    A  TS  Y FRS G+  GV+I A + +      L+   L+   DEH  
Sbjct: 440 FTFIFAFPKRDQATATSTLYLFRSIGSVWGVAISAGVIQLYFARYLRFN-LKDLLDEHTI 498

Query: 519 EELLRIINNAAHSANWVHKEAPEFVRATLVECYHYASKSTFKFCLITMILAGASCSIIQE 578
            +++  IN  +     +H E    V+ T+++ +  A+K       +  +LA   C I+++
Sbjct: 499 NKIITRINANSSYIGSLHGE----VKNTVIKSFDSATKKAHLMSTLLSLLALIFC-IVKD 553

Query: 579 H 579
           +
Sbjct: 554 N 554

>Smik_4.363 Chr4 (649481..651778) [2298 bp, 765 aa] {ON} YDR119W
           (REAL)
          Length = 765

 Score =  186 bits (471), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 124/486 (25%), Positives = 238/486 (48%), Gaps = 22/486 (4%)

Query: 92  IFLAALDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPLLV 151
           +F  A+D +I+  + ++I SEF+ L ++S + + YLL ++  Q ++ KLS   G K LL 
Sbjct: 265 LFFIAMDSSIILVIASKIASEFHELWRLSLVISVYLLGNAIGQLMFLKLSLVSGVKLLLC 324

Query: 152 FSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQGLC 211
            +   F +G  +   S   W  ++ R V+G G   L  L S +++      E        
Sbjct: 325 VAQFSFILGSYLSWSSIHFWTFILARSVTGFGSGSLIALKSTIMNRFSQKNENQYPLSTS 384

Query: 212 NFIFGLGTASGGLVGAAFQD-----WRMAFTIQCPISLASCALIVS--YLELPPRHEDDK 264
             +F LG A G  + + F       W+ AF I  P  L + +++++  Y      H +  
Sbjct: 385 MTVFSLGVAVGPFLVSFFDSSHGSGWKNAFLIPVPFCLVNASIMLADIYSVKNTIHHEGP 444

Query: 265 DRHWTSKLRDLDWA----GVVTLVCFLFLFMLVSSLGGKEIAYDSVLFALLCVTTLVLGS 320
                 + + + W+     ++TL  FL  F+  +SL    + + +++  ++    ++ G 
Sbjct: 445 TTTLQKRFKKVLWSPDLYEILTLALFLLCFVQATSLDSTRLEHSTMIQEIIFSVIIICGV 504

Query: 321 IFAYVELY-VAVDPVLPIAFLKYRSVLGSSLANWFAMMSMLTTNYYLPVYWASVLNMKPT 379
           +F  +E   V ++ V  ++    + ++ + +  +F   +++    +   Y+  VLN+   
Sbjct: 505 LFFVIEKSDVRMNSVFSLSLQGDKHLIWTMMGIFFCFAALMCIIPFGTTYFMIVLNLDTL 564

Query: 380 DIGKRSIPSFFSVAFGSLGAGIYMKRTGKYYWFLLAFCGIGILGQLKINLLTPATPVWQQ 439
           +I +R +P FFS+  G      +     + Y F     G+ +L  + +  +  +  VW+Q
Sbjct: 565 EIAERLLPFFFSIVVGYFSVCYFWNSERQNYLFKFVLSGVTLLLYVALMGMNLSLSVWKQ 624

Query: 440 YLLLVVPSFGLSVLITVTLLAMISAVPHEHHAA-----TTSISYAFRSTGATLGVSIGAA 494
           Y  L +P  G S+++T     ++S + HE+H       + SI+Y F + G T+GVS    
Sbjct: 625 YTCLSLPLLGSSMILT-----LLSTLYHEYHVQRKSPISGSIAYCFAAMGGTIGVSSAGY 679

Query: 495 IFRSTLNTLLQNKVLQFASDEHPREELLRIINNAAHSANWVHKEAPEFVRATLVECYHYA 554
           +F  TL   +  +V++F+   + +++L +II +A  S+NWVHK AP+F+  TL+ECY  A
Sbjct: 680 VFHKTLVRTMNEEVMKFSKQGYLKKDLFKIIKHATQSSNWVHKSAPKFIFRTLIECYLQA 739

Query: 555 SKSTFK 560
            ++ FK
Sbjct: 740 CRNVFK 745

>KLTH0E16720g Chr5 (1482846..1484570) [1725 bp, 574 aa] {ON} similar
           to uniprot|P38358 Saccharomyces cerevisiae YBR293W VBA2
           Permease of basic amino acids in the vacuolar membrane
          Length = 574

 Score =  182 bits (463), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 149/503 (29%), Positives = 253/503 (50%), Gaps = 34/503 (6%)

Query: 89  FLGIFLAALDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKP 148
           F  +FL+ LD TI ++    IG+EF  +   SWI T+YL++ ++ QPLYG  SD LGR+ 
Sbjct: 50  FTNVFLSGLDSTISASTYQLIGNEFGDVKLSSWITTAYLITCTSFQPLYGSFSDTLGRRH 109

Query: 149 LLVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQ 208
            L F+N +F++GC  CG +T+I+ +++ R ++GIGG GL  L++++ SD++P ++R +YQ
Sbjct: 110 CLFFANTIFALGCFGCGTTTTIYSLILMRALTGIGGGGLITLSTIINSDIIPAKKRGIYQ 169

Query: 209 GLCNFIFG----LGTASGGLVGAAFQDWRMAFTIQCPISLASCALIVSYLELPPRHEDD- 263
              N + G    +G + GGL+ A    WR  F +Q PIS+     +V++  +  +  D  
Sbjct: 170 AFQNVLLGTGAVVGASCGGLI-ATTMGWRWCFLLQVPISVG--GTLVAFFFVHDQRPDIN 226

Query: 264 ------KDRHWTSKLRDLDWA----GVVTLVCFLFLFMLVSSLGGKEIAYDSVLFALLCV 313
                 +   W  KL  +D++     V+ L C LF   L S+    E  + S    +L +
Sbjct: 227 GGVSAVRTTGW-EKLEKIDFSGALLLVLGLACQLFFLTLNSTSKSSESYWYSPQSIVLTL 285

Query: 314 TTLVLGSIFAYVELYVAVDPVLPIAFLKYRSVLGSSLANWFAMMSMLTTNYY--LPVYWA 371
           +T V   +FAYVE     +P++P   L  R   G+++     ++  +   Y   LP+Y+ 
Sbjct: 286 STGVSLILFAYVEHTTKANPIIPHDLL--RQAHGATVLIISVLVGFVAYAYIFTLPLYFQ 343

Query: 372 SVLNMKPTDIGKR-SIPSFFSVAFGSLGAGIYMKRTGKYYWFLLAFCGIGILGQLKINLL 430
            V+       G R ++PS F    G L  G+ MK        L++     +LG L    +
Sbjct: 344 VVIGDTAAKAGLRLTVPS-FCTPIGGLITGLSMKNPNHLPVLLISGITCMLLGNLCFLFI 402

Query: 431 TPATPVWQQYLLLVVPSFGLSVLITVTLLAMISAVPHEHHAATTSISYAFRSTGATLGVS 490
            P TP WQ  LLLV  + G  +    TL   + A P    A  TS  Y FRS G   GV+
Sbjct: 403 KPWTPYWQTSLLLVPANVGQGITFPSTLFTFLFAFPPYKQATATSTLYLFRSVGCVWGVA 462

Query: 491 IGAAIFRSTLNTLLQNKVLQFASDEHPREELLRIINNAAHSANWVHKEAPEFVRATLVEC 550
             +++ +  +    +  +    +++  R+ LL++    +H+ + + K  P+ VR+ ++  
Sbjct: 463 GTSSLIQYAVRNQAKKSLNGLLTEKEIRKLLLQL----SHTTSQIKKLPPD-VRSAVISS 517

Query: 551 YHYASKSTF----KFCLITMILA 569
           Y  A +  +      C I ++L+
Sbjct: 518 YDNAIRQAYFLSVFLCTIAILLS 540

>NCAS0A07810 Chr1 complement(1554541..1556247) [1707 bp, 568 aa]
           {ON} Anc_2.473
          Length = 568

 Score =  182 bits (462), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 142/486 (29%), Positives = 240/486 (49%), Gaps = 61/486 (12%)

Query: 89  FLGIFLAALDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKP 148
           +LG FL++LD TIV+ ++ ++  EF   DK  WIATS+LL+++  QPLYGKLSD  GRK 
Sbjct: 47  WLGSFLSSLDSTIVANIMNKVAEEFEESDKKQWIATSFLLTNTAFQPLYGKLSDITGRKF 106

Query: 149 LLVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQ 208
            ++ S+  F +GC +   + +I    + R + GIG  G+  ++S+ +SD+   RER +YQ
Sbjct: 107 AVLTSHFFFGLGCFLTCFAQNITQFSIARAICGIGAGGVNAMSSITVSDICSTRERGIYQ 166

Query: 209 GLCNFIFGLGTASGGLVGAAFQD---WRMAFTIQCPI-----SLASCALIVSYLELPPRH 260
           G  N +FGLG   G  +G  F D   WR+ F +Q P+     +LA+  + V    +PPR 
Sbjct: 167 GYANIVFGLGQLLGAPLGGLFIDSVGWRVIFGVQVPMLLLCSTLATRNINVKLAHIPPR- 225

Query: 261 EDDKDRHWTSKLRDLDWAGVVTLVCFL--FLFMLVSSLGGKEIAYDSVLFALLCVTTLVL 318
              K+R     L  +D  G + LV  +   LF+  ++L       + ++  L  + + +L
Sbjct: 226 ---KERFTWKNLSRIDIFGSLALVGTISSLLFLTSTTL-------NKIVLTLSMIASFIL 275

Query: 319 GSIFAYVELYVAVDPVLPIAFLKYRSVLGS--SLANWFAMMSMLTTNYYLPVYWASVLNM 376
              F ++ELY A + +LP   LK    L S  ++A+ F +   +   +  P+Y   V ++
Sbjct: 276 ---FIWIELYYAKERILPFDLLKGSFGLCSLVTVASSFVVFGDI---FRSPIYLQLVQDI 329

Query: 377 KPTDIGKRSIPSFFSVAFGSLGAGIYMKRTGKY-----YWFLLA-----FCGIGILGQLK 426
             T  G   +    +VA GSL  G  ++ T K      Y  +L       CG+ I   L 
Sbjct: 330 SVTKTGLFLVFPSIAVAGGSLVTGWILRHTKKNLSHCAYGIILGGVCIQLCGLVIAYYLI 389

Query: 427 INL----------------LTPATPVWQ--QYLLLVVPSFGLSVLITVTLLAMISAVPHE 468
            NL                 TP + +W+    L L++ S+G + L+  TL++++  +   
Sbjct: 390 KNLKPAMVHIDDSAMAFFTFTPNSIMWKIIYALALILVSYGYASLLVATLVSIVFTIEKS 449

Query: 469 HHAATTSISYAFRSTGATLGVSIGAAIFRSTLNTLLQNKVLQFASDEH----PREELLRI 524
                T I Y +RS G  LG S+   I+ ++L   L N + +  + +      +EE   +
Sbjct: 450 QQGTMTGIFYLWRSIGNVLGASLTLVIYENSLAKKLWNYMFETNNKKDSYIFSKEEYYTL 509

Query: 525 INNAAH 530
           + ++++
Sbjct: 510 VRDSSY 515

>Skud_2.423 Chr2 (756345..758027) [1683 bp, 560 aa] {ON} YBR293W
           (REAL)
          Length = 560

 Score =  180 bits (457), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 149/482 (30%), Positives = 238/482 (49%), Gaps = 25/482 (5%)

Query: 89  FLGIFLAALDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKP 148
           F  +FL+  DGT+ ++    IG+EFN +   +WI T+YL++S++ QPLYG  SD LGR+ 
Sbjct: 60  FSNVFLSGFDGTVTASTYQTIGNEFNQMSISNWITTAYLITSTSFQPLYGSFSDALGRRN 119

Query: 149 LLVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQ 208
            L F+N  F+IGCL C +ST+I+ + + R ++GIGG GL  L+++V SD++P  +R ++Q
Sbjct: 120 CLFFANAAFTIGCLACSLSTNIYTLSLMRALAGIGGGGLITLSTIVNSDVIPSSKRGIFQ 179

Query: 209 GLCNFIFGLGTASGGLVGAAFQD---WRMAFTIQCPISLASCALIVSYLELPPRHEDDKD 265
              N + G G   G   G        WR  F IQ PIS+ S  L+  Y  +P + E + +
Sbjct: 180 AFQNLLLGFGAICGASFGGTIASTIGWRWCFLIQVPISIISSVLMNYY--VPNQKEYNHE 237

Query: 266 -----RHWTSKLRDLDWAGVVTLVCFLFLFMLVSSLG--GKEIAYDSVLFALLCVTTLVL 318
                R+    L D+D  G + ++  L L +L  SLG  G ++++ S    LL V ++ +
Sbjct: 238 NSNIFRNSKRILTDIDITGSILIITGLTLQLLYLSLGCSGSKLSWTSPSVLLLLVGSIAI 297

Query: 319 GSIFAYVELYVAVDPVLPIAFLKYR---SVLGSSLANWFAMMSMLTTNYYLPVYWASVLN 375
             +F   E       ++P+  +       VL  S+   FA  + L T   LP+++  VL 
Sbjct: 298 LLLFISHEKKTTARAIIPMELVSSSYSFVVLLISILVGFASYAYLFT---LPLFFQIVLG 354

Query: 376 MKPTDIGKR-SIPSFFSVAFGSLGAGIYMKRTGKYYWFLLAFCGIGILGQLKINLLTPAT 434
                 G R +IPS F+   GSL  G  M +       L     +  LG      +   +
Sbjct: 355 DSTAKAGLRLAIPSLFT-PVGSLITGFSMSKYNCLRSLLYVGVSLMFLGNFLFLFIEKTS 413

Query: 435 PVWQQYLLLVVPSFGLSVLITVTLLAMISAVPHEHHAATTSISYAFRSTGATLGVSIGAA 494
           P W   L L+  + G  +    TL   I   P    A  TS  Y FRS G+  GV+I A 
Sbjct: 414 PNWLISLFLIPANLGQGITFPTTLFTFIFLFPKSDQATATSTLYLFRSIGSVWGVAISAG 473

Query: 495 IFRSTLNTLLQNKVLQFASDEHPREELLRIINNAAHSANWVHKEAPEFVRATLVECYHYA 554
           + + +    L++  L+   DE+   +L+  +N  +     +H E    V+ T++E +  A
Sbjct: 474 VIQLSFAKYLRSN-LKDMLDENTIAKLITKLNANSSYIESLHGE----VKNTVIESFDAA 528

Query: 555 SK 556
           +K
Sbjct: 529 TK 530

>Smik_13.272 Chr13 complement(427283..428968) [1686 bp, 561 aa] {ON}
           YMR088C (REAL)
          Length = 561

 Score =  178 bits (452), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 153/539 (28%), Positives = 250/539 (46%), Gaps = 65/539 (12%)

Query: 90  LGIFLAALDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPL 149
           LG FL++LDGTIV+ ++ R+  EF+   +  WIATS+LL+++  QPLYGKLSD  GRK  
Sbjct: 44  LGSFLSSLDGTIVANIMNRVAEEFSESSRKQWIATSFLLTNTAFQPLYGKLSDITGRKSA 103

Query: 150 LVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQG 209
           L+ ++  F IGCL+   + ++    + R + GIG  GL  + S+ +SD+   RER VYQG
Sbjct: 104 LLTAHFFFGIGCLLTCFARNVTEFSIARAICGIGAGGLNAIGSIAVSDICTARERGVYQG 163

Query: 210 LCNFIFGLGTASGGLVGAAFQD---WRMAFTIQCPISLASCALIVSYLELPPRHEDD-KD 265
             N +FGLG   G  +G  F +   WR  F +Q P+ +    L +  + +   H    K+
Sbjct: 164 YANIVFGLGQLLGAPLGGVFIETIGWRALFGVQVPVIMLCSVLAIKNINIKLFHVPPMKE 223

Query: 266 RHWTSKLRDLDWAGVVTLVCFL--FLFMLVSSLGGKEIAYDSVLFALLCVTTLVLGS--I 321
           R+    L  +D  G ++LV  +   LF+  S L              L +T   +GS  +
Sbjct: 224 RYTLKNLSRIDIFGSLSLVATISGVLFLCSSHLNK------------LYLTLFTIGSFIV 271

Query: 322 FAYVELYVAVDPVLPIAFLKYRSVLGSSLANWFAMMSMLTTNYYLPVYWASVLNMKPTDI 381
           F  VE Y A + +LP+  L  RS   SS     +   +    +  P+Y   + N+  T  
Sbjct: 272 FILVERYYATEKILPLELLT-RSFCLSSAVTVISSFVVFGEIFRSPIYLQLLQNISVTKT 330

Query: 382 GKRSIPSFFSVAFGSLGAGIYMKRTGKYYWFLLAFCGI-----GILGQLKI--------- 427
           G   I    SVA GSL  G  ++ T       LA C       G++ QL           
Sbjct: 331 GLFLIFPSVSVAVGSLVTGWLLRNTK----INLAHCAYQIIFGGMITQLLGLGLGYLLLA 386

Query: 428 ---------NLLTPAT----PVWQQYLLL---VVPSFGLSVLITVTLLAMISAVPHEHHA 471
                    ++L   T     +W + + +   V+ SFG + L+  TL++++  V      
Sbjct: 387 YLNPDYTIYDMLESITFESDSIWWKLIYVFASVLVSFGYACLLVATLVSIVFTVEKSQQG 446

Query: 472 ATTSISYAFRSTGATLGVSIGAAIFRSTLNTLLQNKVLQFA-SDEH--PREELLRIINNA 528
             T + Y +RS G  LG S+    + ++L+++L N + +   SD++   +++   +IN+ 
Sbjct: 447 TMTGVFYLWRSIGNVLGASLTLVSYENSLSSMLWNYMFETKRSDKYHFTKKQYYSLINDT 506

Query: 529 AHSANWVHKEAPEFVRATLVECYHYASKSTFKFCLITMILAGASCSIIQEHTLHTTLKR 587
           +      +   P F     V       K+     L  ++LA     ++  + +H T KR
Sbjct: 507 S------YLRGPNFPTDIFVRILDIYKKAFLISYLPNIVLAVVGI-VLSFYLVHHTYKR 558

>YMR088C Chr13 complement(443414..445102) [1689 bp, 562 aa] {ON}
           VBA1Permease of basic amino acids in the vacuolar
           membrane
          Length = 562

 Score =  178 bits (452), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 138/480 (28%), Positives = 229/480 (47%), Gaps = 54/480 (11%)

Query: 90  LGIFLAALDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPL 149
           LG FL++LD TIV+ ++ R+  EF+   K  WIATS+LL+++  QPLYGKLSD  GRK  
Sbjct: 44  LGSFLSSLDSTIVANIMNRVAEEFSESSKKQWIATSFLLTNTAFQPLYGKLSDITGRKSA 103

Query: 150 LVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQG 209
           L+ +   F +GCL+   + ++    + R + GIG  GL  ++S+ +SD+   RER VYQG
Sbjct: 104 LLTAQFFFGLGCLLTCFARNVTEFSIARAICGIGAGGLNAISSIAVSDICTARERGVYQG 163

Query: 210 LCNFIFGLGTASGGLVGAAFQD---WRMAFTIQCPISLASCALIVSYLELPPRHEDD-KD 265
             N +FG G   G  +G  F +   WR  F IQ P+ +    L +  + +   H    K+
Sbjct: 164 YANIVFGFGQLLGAPLGGVFIETIGWRALFGIQVPVIMLCSVLAIKNINIKLFHVPPMKE 223

Query: 266 RHWTSKLRDLDWAGVVTLVCFL--FLFMLVSSLGGKEIAYDSVLFALLCVTTLVLGSIFA 323
           R+    L  +D  G ++LV  +   LF+  S L       + +  AL  + + +   +F 
Sbjct: 224 RYTLKNLSRIDIFGSLSLVATISGVLFLCSSQL-------NKLYLALFTIGSFI---VFI 273

Query: 324 YVELYVAVDPVLPIAFLKYRSVLGSSLANWFAMMSMLTTNYYLPVYWASVLNMKPTDIGK 383
            VE Y A + +LP   L  RS   SS     +   +    +  P+Y   + N+  T  G 
Sbjct: 274 LVERYYATEKILPFELLT-RSFCLSSAVTVISSFVVFGEIFRSPIYLQLLQNISVTKTGL 332

Query: 384 RSIPSFFSVAFGSLGAGIYMKRTGKYYWFLLAFCGIGIL-GQLKINL------------L 430
             I    SVA GSL  G  ++ T       LA C   I+ G + + L            L
Sbjct: 333 FLIFPSISVAVGSLVTGWVLRNTK----INLAHCAYQIIFGGMIMQLLGLGLGYFLLSHL 388

Query: 431 TP--------------ATPVWQQYLLL---VVPSFGLSVLITVTLLAMISAVPHEHHAAT 473
            P              +  +W + + +   V+ SFG + L+  TL++++  V        
Sbjct: 389 NPDYTIYDMLESITFRSNSIWWKLIYVFASVLVSFGYACLLVATLVSIVFTVEKSQQGTM 448

Query: 474 TSISYAFRSTGATLGVSIGAAIFRSTLNTLLQNKVLQFASDEH---PREELLRIINNAAH 530
           T + Y +RS G  LG S+    + ++L+++L N + +   D+     +++   +IN++++
Sbjct: 449 TGVFYLWRSIGNVLGASLTLVSYENSLSSMLWNYMFKTKRDDEYHFTKKQYYSLINDSSY 508

>SAKL0A07480g Chr1 complement(658699..660420) [1722 bp, 573 aa] {ON}
           similar to uniprot|P38358 Saccharomyces cerevisiae
           YBR293W VBA2 Permease of basic amino acids in the
           vacuolar membrane
          Length = 573

 Score =  177 bits (448), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 150/500 (30%), Positives = 250/500 (50%), Gaps = 35/500 (7%)

Query: 89  FLGIFLAALDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKP 148
           F  +FL+ LDGTI ++    IG+EF++ +  +WI T+YL+++++ QPLYG  SD LGR+ 
Sbjct: 52  FANVFLSGLDGTITASTYQLIGNEFDNFEISNWITTAYLVATTSFQPLYGSFSDTLGRRH 111

Query: 149 LLVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQ 208
            L F+N VF++GCL CG++  I  ++  R ++GIGG GL  L+++V SD++P   R +YQ
Sbjct: 112 CLFFANTVFALGCLGCGLAPGILSLIFMRALTGIGGGGLITLSTIVNSDIIPPESRGIYQ 171

Query: 209 GLCNFIFGLGTASGGLVG---AAFQDWRMAFTIQCPISLASCALIVSYLELPP---RHED 262
              N + G+G   G   G   A++  WR  F +Q P+S+    +   +LE         +
Sbjct: 172 AFQNVLLGIGAVIGASTGGAVASYLGWRWCFLLQVPVSVGGTIMAYMFLENQKGFVSESE 231

Query: 263 DKDRHWTSKLRDLDWAGVVTLVCFL---FLFMLVS----SLGGKEIAYDSVLFALLCVTT 315
              +   ++   +D  G + L+  L    +++ V+    S G + ++ +S+   LL V +
Sbjct: 232 SSGQLLKNRFSKIDLKGSLLLIVGLASQLMYLTVNSSMASSGSQWLSKESIGLILLTVLS 291

Query: 316 LVLGSIFAYVELYVAVDPVLPIAFLKYRS---VLGSSLANWFAMMSMLTTNYYLPVYWAS 372
           LV+   F + E     +P++P   L       VL  S+   F   + L T   LP+++  
Sbjct: 292 LVM---FIHTERTTQANPIIPTKLLSQSHSTMVLVISVLVGFVSYAYLFT---LPLFFQI 345

Query: 373 VLNMKPTDIGKR-SIPSFFSVAFGSLGAGIYMKRTGKYYWFLLAFCGI-GILGQLKINLL 430
           V+       G R +IPS F    G L  G+ M R  K   FLL+F  +  ++G     LL
Sbjct: 346 VVGDSAARAGFRLAIPS-FCTPIGGLITGLSM-RIPKTLPFLLSFGMVLMMIGNAFFLLL 403

Query: 431 TPATPVWQQYLLLVVPSFGLSVLITVTLLAMISAVPHEHHAATTSISYAFRSTGATLGVS 490
              TP W   LLL   + G  V    TL + + +   E+ A  TS  Y FRS G+  GV+
Sbjct: 404 KTTTPEWLVCLLLTPANVGQGVTFPATLFSFLFSFHPENQATATSTLYLFRSIGSLWGVA 463

Query: 491 IGAAIFRSTLNTLLQNKVLQFASDEHPREELLRIINNAAHSANWVHKEAPEFVRATLVEC 550
             + + +  +   ++ K+    S     EE+ R+ +   H  +++ K  P  ++  +VE 
Sbjct: 464 GTSGLIQLLVGRKIREKLHGILSP----EEIARLRSKIGHKTSYIEK-LPSEIKEAVVES 518

Query: 551 YHYASKS----TFKFCLITM 566
           Y  A K     +  FC+I +
Sbjct: 519 YESAIKFAHILSVSFCVIAI 538

>TDEL0A02490 Chr1 (446429..448093) [1665 bp, 554 aa] {ON} Anc_2.473
           YMR088C
          Length = 554

 Score =  174 bits (440), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 138/472 (29%), Positives = 239/472 (50%), Gaps = 41/472 (8%)

Query: 90  LGIFLAALDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPL 149
           LG F+++LDGTIV+ ++ R+  EF+  DK  WIATS+LL+++  QPLYGKLSD  GRK  
Sbjct: 43  LGSFVSSLDGTIVANIMNRVAEEFSESDKKQWIATSFLLTNTAFQPLYGKLSDVTGRKFA 102

Query: 150 LVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQG 209
           L+ +     IGCL+  ++ ++    V R + GIGG G+   +S+ +SD+   +ER +YQG
Sbjct: 103 LLMAYFFLVIGCLLTCLARNVTEFAVARAICGIGGGGINACSSITVSDICTAKERGIYQG 162

Query: 210 LCNFIFGLGTASGGLVGAAFQD---WRMAFTIQCPISLASCALIVSYLELPPRHEDDKDR 266
             N +FG+G   G  +G  F D   WR  F IQ P+ + S  L    + +   H      
Sbjct: 163 YANIVFGMGQMLGAPLGGLFIDTIGWRAIFGIQVPVVMVSAFLAYRNVNIKLSHVPPISE 222

Query: 267 HWTSK-LRDLDWAGVVTLVCFLFLFMLVSSLGGKEIAYDSVLFALLCVTTLVLGSIFAYV 325
            +T K L  +D+ G VTL   +   +++ S        + ++ +L    + VL   F +V
Sbjct: 223 RFTRKNLSRIDFLGSVTLASTICGVLVLCS-----TDLNKLVVSLATAASFVL---FLWV 274

Query: 326 ELYVAVDPVLPIAFLKYRSVLGSSLANWFAMMSMLTTNYYLPVYWASVLNMKPTDIGKRS 385
           EL+ A + +LP   LK    L SS+    +   +    +  P+Y   + ++  T+ G   
Sbjct: 275 ELFYAAERILPFELLKGPFGL-SSVVTVCSSFVIFGDIFRSPIYLQLIHDLSVTNTGLFM 333

Query: 386 IPSFFSVAFGSLGAGIYMKRTGK-----YYWFLLAFCGIGILGQL----KINLLTPA--- 433
           I    SVA GSL  G  ++RT K      Y F+LA   + + G +     + ++ PA   
Sbjct: 334 IFPSVSVAVGSLVTGAVLRRTSKSLELCSYLFVLAGIALQLTGLVISYYLVGVVEPALST 393

Query: 434 -------------TPVWQQYLLL--VVPSFGLSVLITVTLLAMISAVPHEHHAATTSISY 478
                        + +W+   +   V+  FG + L+  TL++++ ++     A  T I Y
Sbjct: 394 QMASTLTFQFASQSTLWKLVFVFASVLVGFGYACLLVSTLVSIVFSIDKSQQATMTGIFY 453

Query: 479 AFRSTGATLGVSIGAAIFRSTLNTLLQNKVLQFASDEHPREELLRIINNAAH 530
            +RS G  LG S+   +F+++L T L+  +L+ +     +++  +++ ++++
Sbjct: 454 LWRSIGNVLGASLTLVVFQNSLTTSLRKYMLE-SHRSFTKKQYYKLLTDSSY 504

>Suva_13.265 Chr13 complement(424929..426614) [1686 bp, 561 aa] {ON}
           YMR088C (REAL)
          Length = 561

 Score =  174 bits (440), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 135/480 (28%), Positives = 230/480 (47%), Gaps = 54/480 (11%)

Query: 90  LGIFLAALDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPL 149
           LG FL++LD TIV+ ++ R+  EF+   K  WIATS+LL+++  QPLYGKLSD +GR+P 
Sbjct: 44  LGSFLSSLDSTIVANIMNRVAEEFSESSKKQWIATSFLLTNTAFQPLYGKLSDIIGRRPA 103

Query: 150 LVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQG 209
           L+ +   F +GCL+   + ++    + R V GIG  GL  ++S+ +SD+   RER VYQG
Sbjct: 104 LLTAQFFFGLGCLMTCFARNVTEFSIARAVCGIGAGGLNAISSIAVSDICTARERGVYQG 163

Query: 210 LCNFIFGLGTASGGLVGAAFQD---WRMAFTIQCPISLASCALIVSYLELPPRHEDD-KD 265
             N +FG G   G  +G  F +   WR  F +Q P+ +    L +  + +   H    K+
Sbjct: 164 YANIVFGFGQLLGAPLGGIFIETIGWRALFGVQVPMIIVCSILAIKNINIKLFHVPPMKE 223

Query: 266 RHWTSKLRDLDWAGVVTLVCFL--FLFMLVSSLGGKEIAYDSVLFALLCVTTLVLGSIFA 323
           R+    L  +D  G ++LV  +   LF+  S +       + +  AL  + + +   +F 
Sbjct: 224 RYTLKNLSRIDIFGSLSLVATISGVLFLCSSHM-------NKIYLALFTIGSFI---VFV 273

Query: 324 YVELYVAVDPVLPIAFLKYRSVLGSSLANWFAMMSMLTTNYYLPVYWASVLNMKPTDIGK 383
            VE Y A + +LP   L     L SS     +   +    +  P+Y   + N+  T  G 
Sbjct: 274 LVERYYATERILPFELLTGSFCL-SSAVTVISSFVVFGEIFRSPIYLQLLQNISVTKTGL 332

Query: 384 RSIPSFFSVAFGSLGAGIYMKRTGKYYWFLLAFCGI-----GILGQLKI----------- 427
             I    SVA GSL  G  ++ T       LA C       G++ QL             
Sbjct: 333 FLIFPSISVAVGSLVTGWVLRNTKMN----LAHCAYQIIFGGMVTQLLGLGMGYLLLGHL 388

Query: 428 -------NLLTPAT----PVWQQYLLL---VVPSFGLSVLITVTLLAMISAVPHEHHAAT 473
                  ++L   T     +W + + +   V+ SFG + L+  TL++++  V        
Sbjct: 389 YPDYTVYDMLESITFKSHSIWWKLIYVFASVLVSFGYACLLVATLVSIVFTVEKSQQGTM 448

Query: 474 TSISYAFRSTGATLGVSIGAAIFRSTLNTLLQNKVLQFASDE---HPREELLRIINNAAH 530
           T + Y +RS G  LG S+    + ++L+++L + + +   D+     +++   +IN++++
Sbjct: 449 TGVFYLWRSIGNVLGASLTLVSYENSLSSMLWSYMFERKRDDGYHFTKKQYYSLINDSSY 508

>KLTH0H05456g Chr8 (484160..485866) [1707 bp, 568 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088C VBA1
           Permease of basic amino acids in the vacuolar membrane
          Length = 568

 Score =  172 bits (436), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 149/487 (30%), Positives = 240/487 (49%), Gaps = 55/487 (11%)

Query: 94  LAALDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPLLVFS 153
           + A+DGTI+ST +  I S F    KV+W+AT+Y+L++   QPLYGK SD LGRK  L+F+
Sbjct: 60  ICAVDGTIISTTMNEIASIFQEASKVTWVATAYMLTTCAVQPLYGKTSDLLGRKKCLLFA 119

Query: 154 NVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQGLCNF 213
            VVF +G ++CG + +I  ++V R + G+GG GL  + ++++SDL PL +R++Y G  + 
Sbjct: 120 EVVFIVGLVMCGAARTIEELIVARAICGVGGSGLGAMCNIILSDLAPLSQRSIYWGWGSV 179

Query: 214 IFGLGTASGGLVGAAFQDW---RMAFTIQCPISLASCALIVSYLELPPRHEDDKDRHWTS 270
           I+G   + GG +G    +W   R  F +Q P  L S +L V Y+        D       
Sbjct: 180 IWGFSQSVGGPLGGLLLNWFGVRGLFVVQIPFCLFSLSLTVKYIH-------DLSNQTQG 232

Query: 271 KLRDLDWAGVVTLVCFLFLFMLVSSLGGKEIAYDSV--LFALLCVTTLVLG-SIFAYVEL 327
             RD+D+AG   L+  +  F+ + S  G ++  DS   LF + C    VL  S F YVE 
Sbjct: 233 TWRDIDFAGSFCLITGISAFIFLCSSSG-DVTDDSAVSLFKVGCFLITVLSVSGFIYVEK 291

Query: 328 YVAVDPVLPIAFLKYRSVLGSSLANWFAMMSMLTTNYYLPVYWASVLNMKPTDIGKRSIP 387
            VA   +LP   LK    + S +    +M+S +   + +P+Y   V  +     G   + 
Sbjct: 292 NVAAKSILPAEVLKGSLGVISFIYGLASMLSYVGL-FVVPLYLQLVWGVSVAGSGGYIMY 350

Query: 388 SFFSVAFGSLGAGIYMKRTGK-YYWFLLAFCGIGILGQLKINLL------------TPA- 433
           +  S + GS G+G  +++ G       L   G+ ++G   IN L             PA 
Sbjct: 351 AVISTSIGSFGSGWLLRKYGAPDKDATLLNSGMMLIGSTLINTLGFFVMFKNILEIKPAF 410

Query: 434 ------TPVWQQYLLLVVPSFGLSVLI--TVTLLAMISAVPHEHHAATTSISYAFRSTGA 485
                 +P  + + LL     GLS        +L  ++ V  +  A++TS+++ FRS G 
Sbjct: 411 EGVKSPSPDQKFWFLLGFAIMGLSAGFQSVSVMLYTVAKVGRKGQASSTSVTFLFRSLGN 470

Query: 486 TLGVSIGAAIFRSTLNTLLQN-----------KVLQ----FASDEHPREE---LLRIINN 527
            L VSI  ++F ++L   L++           K+L+      S E P ++   LL++  +
Sbjct: 471 VLSVSISLSVFVASLKGKLKSYFQGQQSDLYRKLLKENAFLRSGEVPSDQLKDLLQVFKS 530

Query: 528 AAHSANW 534
           A   A W
Sbjct: 531 AIVKAFW 537

>KNAG0E02560 Chr5 (506517..508253) [1737 bp, 578 aa] {ON} Anc_2.473
           YMR088C
          Length = 578

 Score =  171 bits (434), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 141/487 (28%), Positives = 238/487 (48%), Gaps = 59/487 (12%)

Query: 89  FLGIFLAALDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKP 148
           +LG F++ALDGT+V+ ++  I +EF   DK  WIATSYLL+++  QPLYGKLSD  GRK 
Sbjct: 49  WLGSFVSALDGTVVANIMNSIAAEFAESDKKQWIATSYLLTNTAFQPLYGKLSDITGRKV 108

Query: 149 LLVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQ 208
            ++ ++  F++GCL+   + ++    + R + GIGG G+  ++S+ ++D+   RER VYQ
Sbjct: 109 AVITAHFFFALGCLLTCFAQNVTQFSIARAICGIGGGGINAMSSITVTDICSARERGVYQ 168

Query: 209 GLCNFIFGLGTASGGLVGAAFQD---WRMAFTIQCPISLASCALI------VSYLELPPR 259
           G  N +FG G   G  +G    D   WR  F IQ P+ L  C+++      +  + +PPR
Sbjct: 169 GYANVVFGTGQLLGAPIGGFLLDSIGWRSIFGIQVPM-LMLCSVLALKNVNIKLVHIPPR 227

Query: 260 HEDDKDRHWTSKLRDLDWAGVVTLVCFLFLFMLVSSLGGKEIAYDSVLFALLCVTTLVLG 319
           +E    R     L  +D  G ++LV  +   + ++S    +        +LL + T++  
Sbjct: 228 NE----RFTWKNLSRIDIFGSISLVATISGILFLTSSNWNK--------SLLGIFTVLSF 275

Query: 320 SIFAYVELYVAVDPVLPIAFLKYRSVLGSSLANWFAMMSMLTTNYYLPVYWASVLNMKPT 379
           S+F Y+ELYVA + ++P   LK    L SS+A       +    +  P+Y   + N+  T
Sbjct: 276 SLFIYIELYVAKERIMPFELLKGSFGL-SSIATVITSFIIYGEIFRSPIYLQLIQNVSVT 334

Query: 380 DIGKRSIPSFFSVAFGSLGAGIYMKRTGK----------YYWFLLAFCGIGI-------- 421
             G   I    ++A GS+  G  ++ T            +   ++   G+ +        
Sbjct: 335 VTGLYLIFPSVAIALGSIVTGSILRNTKMDLAHCAAAIIFGGMIMQLAGLALSYYLLSHV 394

Query: 422 -----LGQLKINLLTPAT------PVWQQYLL---LVVPSFGLSVLITVTLLAMISAVPH 467
                L  L  NL + AT       +W + +    LV+ S G + L+  TL++++  V  
Sbjct: 395 NPALDLADLPANLFSAATIYFVSDSIWWKIVYVGALVIGSSGYASLLVATLVSIVFTVDR 454

Query: 468 EHHAATTSISYAFRSTGATLGVSIGAAIFRSTLNTLLQNKVLQFASD----EHPREELLR 523
                 T I Y +RS G  LG SI   +F  +L  +L   +   +S        + E  R
Sbjct: 455 SKQGTITGIFYLWRSIGNVLGASITLVVFERSLGRMLWEFMFGDSSTTGSYRFKKSEYRR 514

Query: 524 IINNAAH 530
           +I+++++
Sbjct: 515 LISDSSY 521

>Skud_13.244 Chr13 complement(417271..418959) [1689 bp, 562 aa] {ON}
           YMR088C (REAL)
          Length = 562

 Score =  170 bits (431), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 142/538 (26%), Positives = 247/538 (45%), Gaps = 61/538 (11%)

Query: 90  LGIFLAALDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPL 149
           LG FL++LD TIV+ ++ R+  +F+   +  WIATS+LL+++  QPLYGKLSD  GRK  
Sbjct: 44  LGSFLSSLDSTIVANIMNRVAEDFSESSRKQWIATSFLLTNTAFQPLYGKLSDITGRKSA 103

Query: 150 LVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQG 209
           L+ +   F +GCL+   + ++    + R + GIG  GL  ++S+ +SD+   RER VYQG
Sbjct: 104 LLIAQFFFGLGCLLTCFARNVTEFSIARAICGIGAGGLNAISSIAVSDICTARERGVYQG 163

Query: 210 LCNFIFGLGTASGGLVGAAFQD---WRMAFTIQCPISLASCALIVSYLELPPRHEDD-KD 265
             N +FG G   G  +G  F +   WR  F +Q P+ +    L +  + +   H    K+
Sbjct: 164 YANIVFGFGQLLGAPLGGVFIETIGWRALFGVQVPMIMLCTILAIKNINIKLFHVPPMKE 223

Query: 266 RHWTSKLRDLDWAGVVTLVCFL--FLFMLVSSLGGKEIAYDSVLFALLCVTTLVLGSIFA 323
           R+    L  +D  G ++LV  +   LF+  S L       + +  +L  + + +   +F 
Sbjct: 224 RYTLKNLSRIDLFGSLSLVATISGVLFLCSSHL-------NKLYLSLFTIGSFI---VFV 273

Query: 324 YVELYVAVDPVLPIAFLKYRSVLGSSLANWFAMMSMLTTNYYLPVYWASVLNMKPTDIGK 383
            VE Y A + +LP   L     L SS     +   +    +  P+Y   + N+  T  G 
Sbjct: 274 LVERYYATERILPFELLTPSFCL-SSAVTVISSFVVFGEIFRSPIYLQLLQNISVTKTGL 332

Query: 384 RSIPSFFSVAFGSLGAGIYMKRTGKYYWFLLAFCGI-----GILGQLKINL--------L 430
             I    SVA GSL  G  ++ T       LA C       G++ QL            L
Sbjct: 333 FLIFPSISVAVGSLVTGWVLRNTK----INLAHCAYQIIFGGMVTQLLGLGLGYLLLAHL 388

Query: 431 TP--------------ATPVWQQYLLL---VVPSFGLSVLITVTLLAMISAVPHEHHAAT 473
            P              +  +W + + +   V+ SFG + L+  TL++++  V        
Sbjct: 389 NPDYTVYDMLESITFKSNSIWWKLIYVFASVLVSFGYACLLVATLVSIVFTVEKSQQGTM 448

Query: 474 TSISYAFRSTGATLGVSIGAAIFRSTLNTLLQNKVLQFASDEH---PREELLRIINNAAH 530
           T + Y +RS G  LG S+    + ++L+++L N + +   ++     +++   +I+++++
Sbjct: 449 TGVFYLWRSIGNVLGASLTLVSYENSLSSMLWNYMFKSKREDEYHFSKKQYYSLIDDSSY 508

Query: 531 SANWVHKEAPEFVRATLVECYHYASKSTFKFCLITMILAGASCSIIQEHTLHTTLKRD 588
                    P++V   +++ Y    K  F    I  I       ++  + +  TLKR 
Sbjct: 509 LRG---NNFPKYVFVRILDVY----KKAFLISYIPNIALAVIGMVLSLYLVKHTLKRS 559

>NDAI0H02200 Chr8 complement(536385..538100) [1716 bp, 571 aa] {ON} 
           YGR224W
          Length = 571

 Score =  170 bits (430), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 137/480 (28%), Positives = 227/480 (47%), Gaps = 82/480 (17%)

Query: 90  LGIFLAALDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPL 149
           LG F ++LD TIV+ ++ R+  EF   DK  WIATS+LL+++  QPLYGKLSD  GRK  
Sbjct: 51  LGSFFSSLDSTIVANIMNRVAEEFAESDKKQWIATSFLLTNTAFQPLYGKLSDITGRKFA 110

Query: 150 LVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQG 209
           ++ ++  F +GCL+   + ++    + R + G+G  G+  ++S+  SD+   RER ++QG
Sbjct: 111 VLTAHFFFGLGCLLTCFAQNVTQFSIARAICGMGAGGINAMSSITTSDICTTRERGIFQG 170

Query: 210 LCNFIFGLGTASGGLVGAAFQD---WRMAFTIQCPISLASCALIVS-----YLELPPRHE 261
             N +FG+G   G  +G  F D   WR  F IQ P+ +    L ++      L +PPR  
Sbjct: 171 YANIVFGMGQVLGAPLGGLFLDHIGWRTLFGIQVPMIMFCSYLTITNVNIKLLHVPPR-- 228

Query: 262 DDKDRHWTSKLRDLDWAGVVTLVCFL--FLFMLVSSLGGKEIAYDSVLFALLCVTTLVLG 319
             K+R     L  +D  G ++LV  +   LF+  + L       D +L +L    T +  
Sbjct: 229 --KERFTWKNLSRIDIFGSLSLVATISGILFLTSTQL-------DKLLLSLF---TFISF 276

Query: 320 SIFAYVELYVAVDPVLPIAFLKYRSVLGSSLANWFAMMSMLT--TNYYL-------PVYW 370
            +F ++ELY A + +LP   L      GS     F + S++T  ++Y +       P+Y 
Sbjct: 277 GLFMWIELYYAKERILPFDLLN-----GS-----FGLCSVVTVISSYVVFGDIFRSPIYL 326

Query: 371 ASVLNMKPTDIGKRSIPSFFSVAFGSLGAGIYMKRTGKYYWFLLAFCGIGI--------- 421
             + ++  T  G   I    ++A GSL  G  ++ T K     L+ C  GI         
Sbjct: 327 QLIQDISVTKTGLFLIIPSIAMAGGSLVTGWILRNTTKN----LSHCAYGIILSGVIIQL 382

Query: 422 ---------LGQLKINL-------------LTPATPVWQQYLL--LVVPSFGLSVLITVT 457
                    +G L  +L              T  +  W+   +  L++ S+G S ++  T
Sbjct: 383 AGLVIAYLLIGHLNPSLNQLGNVFNIAMENFTSGSRTWKVIFVFSLLLGSYGYSSILVAT 442

Query: 458 LLAMISAVPHEHHAATTSISYAFRSTGATLGVSIGAAIFRSTLNTLLQNKVLQFASDEHP 517
           L++++  +        T I Y +RS G  LG S+   ++R+TL   L   +  F ++  P
Sbjct: 443 LVSIVFTIEKSQQGTMTGIFYLWRSIGNVLGASLTLVLYRNTLAKRLW--IYMFETENKP 500

>YDR119W Chr4 (688227..690533) [2307 bp, 768 aa] {ON}  VBA4Protein
           of unknown function with proposed role as a basic amino
           acid permease based on phylogeny; GFP-fusion protein
           localizes to vacuolar membrane; physical interaction
           with Atg27p suggests a possible role in autophagy;
           non-essential gene
          Length = 768

 Score =  172 bits (435), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 130/486 (26%), Positives = 239/486 (49%), Gaps = 21/486 (4%)

Query: 92  IFLAALDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPLLV 151
           +F  A+D +I+  + ++I SEF+ L ++S + ++YLLS++  Q ++ KLS     K LL 
Sbjct: 259 LFFIAMDSSIILVIASKIASEFHELWRLSLVISAYLLSNAIGQLVFLKLSLISSVKLLLC 318

Query: 152 FSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQGLC 211
            +   F +G  +   S   W  +  R V+G GG  L  L S +++      +        
Sbjct: 319 IAQFSFILGGYLSWSSAHFWTFIFARCVTGFGGGSLIALKSTIMNRFSQKNDSRYSLSAS 378

Query: 212 NFIFGLGTASGGLVGAAFQD-----WRMAFTIQCPISLASCALIVSYL-----ELPPRHE 261
              F +G   G  +   F       WR AF I  P  L + +++++ +      L  R  
Sbjct: 379 MITFAMGVVIGPFMMNLFDSSHGSGWRNAFLIPVPFCLVNASIMLADMYSVKSTLYGRPT 438

Query: 262 DDKDRHWTSKLRDLDWAGVVTLVCFLFLFMLVSSLGGKEIAYDSVLFALLCVTTLVLGSI 321
               + + + L   D   ++TL  FL  F+ V+SL    +  ++++ ALL    +V G +
Sbjct: 439 PTLWKRFKNTLLSPDLYEILTLTLFLLCFVQVTSLDLTGLKNNTMIQALLFSVIIVCGIL 498

Query: 322 FAYVELY-VAVDPVLPIAFLKYRSVLGSSLANWFAMMSMLTTNYYLPVYWASVLNMKPTD 380
           F  +E     ++ V+ ++    + ++ + +   F   +++    +   Y+  VLN+    
Sbjct: 499 FFLIETSDTYMNSVISMSLQGDKRLIWTMIGISFCFAALMCIIPFGTTYFIIVLNLSTLQ 558

Query: 381 IGKRSIPSFFSVAFGSLGAGIYMKRTGKYYWFLLAFCGIGILGQLKINLLTPATPVWQQY 440
           + +R  P FFS+  G      + K  G+ +       G  +L  + +  ++   PVW+QY
Sbjct: 559 LAERLSPFFFSIVLGYFSVSYFWKSKGQNFLLKFVLSGATLLLYVALMGVSLNLPVWKQY 618

Query: 441 LLLVVPSFGLSVLITVTLLAMISAVPHEHHAA-----TTSISYAFRSTGATLGVSIGAAI 495
           + L +P  G S+++T     ++S + HE+H       + SI Y F + G T+G+S+G  +
Sbjct: 619 ICLSLPFLGSSMILT-----LLSNLYHEYHEQRKSPISGSIVYCFGAVGGTVGISLGGYV 673

Query: 496 FRSTLNTLLQNKVLQFASDEHPREELLRIINNAAHSANWVHKEAPEFVRATLVECYHYAS 555
           F  TL  L+  KV+ F+   + +++LL+II +A  S++WVH+ AP+FV  TL+ECY  A 
Sbjct: 674 FHKTLIKLMHEKVMPFSKQGYLKKDLLKIIKHATESSDWVHESAPKFVFQTLIECYLQAC 733

Query: 556 KSTFKF 561
           ++ FK 
Sbjct: 734 RNVFKL 739

>Skud_4.379 Chr4 (659832..662111) [2280 bp, 759 aa] {ON} YDR119W
           (REAL)
          Length = 759

 Score =  167 bits (424), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 132/490 (26%), Positives = 242/490 (49%), Gaps = 22/490 (4%)

Query: 92  IFLAALDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPLLV 151
           +F  A+D +I+  ++++I SEF+ L ++S I + YLLS++  Q L+ KLS     K LL 
Sbjct: 259 LFFIAMDSSILLVIVSKIASEFHELWRLSLIVSVYLLSNAIGQLLFLKLSIISSVKLLLC 318

Query: 152 FSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQGLC 211
            +   F +G  +   S+  W  +  RFV+G G   L  L S +++      E        
Sbjct: 319 MAQFSFILGSYLSWSSSHFWTFIFARFVAGFGSGSLIALKSTIMNRFSQKNESRYSLSAS 378

Query: 212 NFIFGLGTASGGLVGAAFQD-----WRMAFTIQCPISLASCALIVSYL---ELPPRHEDD 263
             IF LG A G  V   F       W+ AF I  P  L + +++++ +   +    HE  
Sbjct: 379 VIIFSLGVAIGPFVVGLFDSSHGSGWKNAFLIPVPFCLVNASIMLADIYSVKDNLHHEGS 438

Query: 264 KDRHWTSKLRDL---DWAGVVTLVCFLFLFMLVSSLGGKEIAYDSVLFALLCVTTLVLGS 320
               W    + L   D   ++TL  FL  F+ V++L   E+ + +++  +L    L+ G 
Sbjct: 439 TFTLWKRVKKILLSPDLYEILTLTLFLLCFVQVTTLDLTELEHRTMIQWVLFSVILICGV 498

Query: 321 IFAYVELY-VAVDPVLPIAFLKYRSVLGSSLANWFAMMSMLTTNYYLPVYWASVLNMKPT 379
           +F  +E     ++ V+ ++    + ++ +     F   +++    +   Y+  VLN+   
Sbjct: 499 LFWLIEANDTYMNSVISMSLQGDKRLIWTVTGISFCFSALMCIIPFGTTYFTIVLNLNTL 558

Query: 380 DIGKRSIPSFFSVAFGSLGAGIYMKRTGKYYWFLLAFCGIGILGQLKINLLTPATPVWQQ 439
            I +R +P FFS+  G      + K   + Y       G+ ++  + +  +  + PVW+Q
Sbjct: 559 QIAERLLPFFFSIVIGYFSVCYFWKSKKQNYLLKFVLSGVTLILYITLMGVGLSLPVWKQ 618

Query: 440 YLLLVVPSFGLSVLITVTLLAMISAVPHEHHAATTSIS-----YAFRSTGATLGVSIGAA 494
           Y+ L +P      L +  LL ++S++ HE+H    S++     Y F + G T+G+S+G  
Sbjct: 619 YVCLSLP-----FLGSSMLLTLLSSLYHEYHEQRKSLNSGSIVYCFGAIGGTIGISLGGY 673

Query: 495 IFRSTLNTLLQNKVLQFASDEHPREELLRIINNAAHSANWVHKEAPEFVRATLVECYHYA 554
           +F  TL   L  +V++F+   + +++LL+II +A  S++WVH+ AP+F+  TL+ECY  A
Sbjct: 674 VFHKTLTKSLHEEVMKFSKQGYLKKDLLKIIKHATESSDWVHESAPKFIFKTLIECYLQA 733

Query: 555 SKSTFKFCLI 564
            ++ FK   +
Sbjct: 734 CRNVFKLSAV 743

>ZYRO0A00330g Chr1 (19597..21327) [1731 bp, 576 aa] {ON} similar to
           uniprot|P38358 Saccharomyces cerevisiae YBR293W VBA2
           Permease of basic amino acids in the vacuolar membrane
          Length = 576

 Score =  164 bits (415), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 151/525 (28%), Positives = 244/525 (46%), Gaps = 36/525 (6%)

Query: 63  DLTFPPSETPEFALXXXXXXXXXXXXFLGIFLAALDGTIVSTLLTRIGSEFNSLDKVSWI 122
           D T P S  P   L            +  +FL+  D T+ ++    IG+EFN +D  SWI
Sbjct: 55  DETTPLSRIPHLWLIEAAL-------YTNVFLSGFDSTVTASTYQTIGNEFNHMDLSSWI 107

Query: 123 ATSYLLSSSTCQPLYGKLSDQLGRKPLLVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGI 182
             SYL++S++ QPLYG  SD LGR+  L F++++FSIGCL CG+S +I W+   R  +GI
Sbjct: 108 TASYLITSTSFQPLYGSFSDVLGRRKCLFFASMIFSIGCLGCGISINILWLSFMRAFTGI 167

Query: 183 GGCGLTCLASMVISDLVPLRERAVYQGLCNFIFGLGTASGGLVGAAFQD---WRMAFTIQ 239
           GG GL  L+++V SD++P  +R ++Q   N + GLG   G   G        WR  F +Q
Sbjct: 168 GGGGLITLSTIVNSDMIPTSKRGIFQAFQNLLLGLGAICGASFGGVITSSIGWRWCFLLQ 227

Query: 240 CPISLASCALIVSYLELPPRHEDDKDRHWTSK---LRDLDWAGVVTLVCFLFLFMLVSSL 296
            PISLA   +   Y+     +E  K +  +     L+ +D++G   ++  L L ++  SL
Sbjct: 228 VPISLAGALIGHLYVRNQDEYERRKSKESSQTKEMLKHIDFSGAFLIIIGLTLQLVYLSL 287

Query: 297 GGKEI----AYDSVLFALLCVTTLVLGSIFAYVELYVAVDPVLPIAFLKYRS---VLGSS 349
           G         + S   + + V + ++  +F   E   +   ++P   ++      VL  S
Sbjct: 288 GSAADESGNTWSSPGLSAVLVASFIVLVLFVLTEERTSARAIIPSKLVRSLFSFLVLTIS 347

Query: 350 LANWFAMMSMLTTNYYLPVYWASVLNMKPTDIGKR-SIPSFFSVAFGSLGAGIYMKRTGK 408
           +   FA  + L T   LP+++  +L       G R +IPS F+   G L AGI M +   
Sbjct: 348 VLVGFASYAYLFT---LPLFFQVILGDSTAKAGLRLAIPSVFT-PVGGLIAGICMSKFNC 403

Query: 409 YYWFLLAFCGIGILGQ-LKINLLTPATPVWQQYLLLVVPSFGLSVLITVTLLAMISAVPH 467
               L        LG  L + +   AT     +  L+  + G  +    +L   I A   
Sbjct: 404 LQTLLYVGIAFMCLGNFLFLYIGADATDSLIGF-FLIPANLGQGITFPSSLFTFIFAFSK 462

Query: 468 EHHAATTSISYAFRSTGATLGVSIGAAIFRSTLNTLLQNKVLQFASDEHPREELLRIINN 527
              A  TS  Y FRS G+  GV+  A I +   +  L+  +     +   R+ + +I +N
Sbjct: 463 IDQATATSTLYLFRSIGSVWGVTGSAGIVQFCFSHHLEKALEGLLDERKIRKLIKKITSN 522

Query: 528 AAHSANWVHKEAPEFVRATLVECYHYASKS----TFKFCLITMIL 568
            ++      KE    V+  ++E +  A+K     +  FCL+ +IL
Sbjct: 523 TSYI-----KELEGPVKVAVIESFDTATKKVHLISTSFCLVALIL 562

>KLLA0F13684g Chr6 complement(1267367..1269082) [1716 bp, 571 aa]
           {ON} similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 571

 Score =  164 bits (415), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 146/522 (27%), Positives = 242/522 (46%), Gaps = 60/522 (11%)

Query: 89  FLGIFLAALDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKP 148
           ++G FL +LD TIV+ ++ ++  EF   DK  WI TS+LL+++  QPLYGKLSD  GRK 
Sbjct: 47  WMGSFLGSLDSTIVANIMNKVAEEFEESDKKQWIVTSFLLTNTAFQPLYGKLSDLAGRKT 106

Query: 149 LLVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQ 208
            L+ ++  F +GCL   +S ++    + R V G+G  G++ L+S+ +SD+   +ER VYQ
Sbjct: 107 ALMVAHSFFLVGCLFTALSRNLVEFSIARAVCGMGAGGISALSSISVSDICTPKERGVYQ 166

Query: 209 GLCNFIFGLGTASGGLVGAAFQD---WRMAFTIQCPISLASCALI------VSYLELPPR 259
           G  N +FG G+  GG +G    D   W++ F  Q P+ + +C  +      +  L +PPR
Sbjct: 167 GYANVVFGTGSMLGGPIGGWLMDSFGWKVIFAGQVPL-IMTCMFLGYRNVNIKLLHVPPR 225

Query: 260 HEDDKDRHWTSKLRDLDWAGVVTLVCFLFLFMLVSSLGGKEIAYDSVLFALLCVTTLVLG 319
           HE    R+    ++ +D  G ++L+  +  F+ + S    +         LL   TL+  
Sbjct: 226 HE----RYRWENIKRIDLGGSISLIGTISGFLCLCSTDLNK--------PLLATLTLLSL 273

Query: 320 SIFAYVELYVAVDPVLPIAFLKYRSVLG-SSLANWFAMMSMLTTNYYLPVYWASVLNMKP 378
            +F   ELY A + ++P   L      G +SL   F+        +  PVY   V N+ P
Sbjct: 274 VLFIMNELYWAPERIIPTDLLS--GTFGITSLLTVFSSFIAFGDVFRNPVYLQLVQNISP 331

Query: 379 TDIGKRSIPSFFSVAFGSLGAGIYMKRTG------KYYWFLLAFC--------GIGILGQ 424
           T  G   + S  S A  SL  G  ++ T        Y    +A C        G   +  
Sbjct: 332 TSTGGFLLFSSISSALASLATGWILRNTSLGLATCSYLLITIAVCLHFISLSLGYTTISH 391

Query: 425 LKIN-------LLTPATPVW---QQY-------LLLVVPSFGLSVLITVTLLAMISAVPH 467
           L+ N       L T  T  W    Q+       + +++ S+G + L+  TL++++  +P 
Sbjct: 392 LEPNPTSHVSALDTSGTNYWFTSNQFRWRVLYVIAMILNSWGYASLLVATLVSIVFTIPK 451

Query: 468 EHHAATTSISYAFRSTGATLGVSIGAAIFRSTLNTLLQNKVLQFASDEHPREELLRIINN 527
              A  T   Y +RS G  LG S    IF S+  T    K+ Q+    +  +E   +I++
Sbjct: 452 SQQATITGCFYLWRSIGTVLGASSVLTIFESSATT----KLYQYLHPINMDKEYESLIHD 507

Query: 528 AAHSANWVHKEAPEFVRATLVECYHYASKSTFKFCLITMILA 569
            +   N    +    +     E +  +   TF   ++ +I+A
Sbjct: 508 TSFLRNHFSGKILRDLLEIYNESFLISYIPTFAVSILALIIA 549

>Kwal_14.1585 s14 (377103..378815) [1713 bp, 570 aa] {ON} YMR088C -
           Hypothetical ORF [contig 239] FULL
          Length = 570

 Score =  162 bits (409), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 144/491 (29%), Positives = 238/491 (48%), Gaps = 64/491 (13%)

Query: 94  LAALDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPLLVFS 153
           + A+DGTI+ST +  + S F     V+W+AT+Y+L++ + QPLYGK SD LGRK  L+F+
Sbjct: 63  ICAIDGTIISTTMNEVASIFQEASLVTWVATAYMLTTCSVQPLYGKTSDLLGRKKCLLFA 122

Query: 154 NVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQGLCNF 213
            VVF IG ++CGM+ ++  + + R + GIGG GL  + ++++SDL PL +R++Y GL + 
Sbjct: 123 EVVFIIGLVLCGMARTVKELAIARAICGIGGSGLGAMCNIILSDLAPLSQRSIYWGLGSL 182

Query: 214 IFGLGTASGGLVGAAFQDW---RMAFTIQCPISLASCALIVSYLELPPRHEDDKDRHWTS 270
           I+G   + GG +G    +W      F IQ P  L S  L V Y+     H+    R  T 
Sbjct: 183 IWGFSQSIGGPLGGLLLNWFGVSGLFVIQVPFCLFSLFLTVRYI-----HDLTDQRQGT- 236

Query: 271 KLRDLDWAGVVTLVCFLFLFMLVSSLGGKEIAYDSVLFALLC-VTTLVLGSIFAYVELYV 329
             RD+D+AG   L+  +  F+   S G    + D   F ++C + T+   + F  VE  +
Sbjct: 237 -WRDIDFAGSFCLIIGISAFIFSCSAGDGVDSNDEGPFKVVCLIVTIAAVAGFVVVEKRM 295

Query: 330 AVDPVLPIAFLKYR-SVLG--SSLANWFAMMSMLTTNYYLPVYWASVLNMKPTDIGKRSI 386
           A   +LP   LK    V+G    L++  + + +     YL V W + +       G   I
Sbjct: 296 ATKSILPAHVLKGSLGVVGLIYGLSSMLSYVGLFIVPLYLQVVWGTSV----AGSGGYII 351

Query: 387 PSFFSVAFGSLGAGIYMKRTGKYYWFLLAF-CGIGILGQLKINLLTPATPVWQQYLLLVV 445
            +  S + GS  +G  ++R G        F  GI ++    IN+L  A  +  + +L + 
Sbjct: 352 YAVVSTSVGSFSSGWLLRRYGSPTRCTTLFNSGIMLVSSTLINVLGFA--ILFRNILSIS 409

Query: 446 PSF----------------GLSVL--------ITVTLLAMISAVPHEHHAATTSISYAFR 481
           P+F                G  ++        ++V +L  ++ V  +  AA+TS+++ FR
Sbjct: 410 PNFENTGGPSGSQKFWFLLGFVIMGCSQGFQNVSV-MLYTVAKVGRKGQAASTSVTFLFR 468

Query: 482 STGATLGVSIGAAIFRSTL-----------------NTLLQNKVLQFAS-DEHPREELLR 523
           S G  L VSI  +++ ++L                   L +N  L+  S  E   ++LL+
Sbjct: 469 SLGNVLSVSIALSVYVASLKHDLTIYFEGQKTDLYFKLLKENAFLRSGSVPEDQLKDLLQ 528

Query: 524 IINNAAHSANW 534
           +   A   A W
Sbjct: 529 LFKAAITDAFW 539

>Suva_2.279 Chr2 (482935..485262) [2328 bp, 775 aa] {ON} YDR119W
           (REAL)
          Length = 775

 Score =  163 bits (412), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 122/490 (24%), Positives = 239/490 (48%), Gaps = 22/490 (4%)

Query: 92  IFLAALDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPLLV 151
           +F  A+D TI+ +++++I SEF+ L ++S I + YLLS++  Q ++ KLS     K LL 
Sbjct: 275 LFFIAMDSTILMSIVSKIASEFHELWRLSLIISIYLLSNAIGQLVFLKLSIVTSVKLLLC 334

Query: 152 FSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQGLC 211
            +   F +G  +   +   W  V  R ++G G   L  L S +++     ++        
Sbjct: 335 VAQFSFILGSYLSWSAFHFWTFVFARSITGFGSGALMALKSTIMNRFSDKKKNGYSLSAS 394

Query: 212 NFIFGLGTASGGLVGAAFQD-----WRMAFTIQCPISLASCALIVS---YLELPPRHEDD 263
             +F LG A G  +   F +     W+ AF I  P  L + +++++    ++    H   
Sbjct: 395 VIVFSLGVAIGPFLVYLFDNSRGSGWKNAFLIPVPFCLVNASIMLADIYSIKDNLHHGGS 454

Query: 264 KDRHWTSKLRDL---DWAGVVTLVCFLFLFMLVSSLGGKEIAYDSVLFALLCVTTLVLGS 320
               W    + L   D   ++TL   L  F+ V+SL    + + +V+  +L    +  G 
Sbjct: 455 APISWKRIKKILMSPDLYEILTLALLLLCFVQVTSLDITRLEHSAVIQGVLFFVIITCGI 514

Query: 321 IFAYVEL-YVAVDPVLPIAFLKYRSVLGSSLANWFAMMSMLTTNYYLPVYWASVLNMKPT 379
           +F ++E      + ++ ++    + ++ + +   F   +++    +   Y+  VLN+   
Sbjct: 515 LFWWIETNETYANSIISMSLRGDKHLMWTIMGISFCFAALMCIIPFGTTYFTIVLNISTL 574

Query: 380 DIGKRSIPSFFSVAFGSLGAGIYMKRTGKYYWFLLAFCGIGILGQLKINLLTPATPVWQQ 439
            I +R +P   ++  G      + K   K Y   +   G+ ++  + +   + + PVW+Q
Sbjct: 575 QIAERLLPLSVAIVVGYFSVCYFWKPQMKNYLLEVVLGGVTLILYIALMGASLSLPVWKQ 634

Query: 440 YLLLVVPSFGLSVLITVTLLAMISAVPHEHHAATTS-----ISYAFRSTGATLGVSIGAA 494
           Y+ L +P  G ++++T     ++S++ HE+H    S     I Y F + G T+G+S+G  
Sbjct: 635 YVCLSLPLLGSAMILT-----LLSSLYHEYHQPKKSPISGSIVYCFSAMGGTIGISLGGY 689

Query: 495 IFRSTLNTLLQNKVLQFASDEHPREELLRIINNAAHSANWVHKEAPEFVRATLVECYHYA 554
           +F  TL   + + V++F+   +  ++LL+II +A  S++WVH+ AP+F+  TL+ECY  A
Sbjct: 690 VFHKTLLKAVHDGVMKFSKHGYHEKDLLKIIEHATQSSDWVHESAPKFIFQTLIECYLQA 749

Query: 555 SKSTFKFCLI 564
            ++ FK   I
Sbjct: 750 CRNVFKLSAI 759

>SAKL0E02992g Chr5 complement(243652..245364) [1713 bp, 570 aa] {ON}
           similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 570

 Score =  159 bits (402), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 145/510 (28%), Positives = 238/510 (46%), Gaps = 74/510 (14%)

Query: 89  FLGIFLAALDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKP 148
           ++G FL ALDGTIV+ ++ R+  EF   DK  WIATS+LL+++  QPLYGKLSD  GRK 
Sbjct: 58  WMGSFLGALDGTIVANIMNRVAEEFQESDKKQWIATSFLLTNTAFQPLYGKLSDITGRKF 117

Query: 149 LLVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQ 208
            L+ ++  F +GCL+   + ++    + R + GIGG G++ ++S+ +SD+   RER  YQ
Sbjct: 118 ALLVAHTFFCLGCLLTCFARNVTEFSIARAICGIGGGGISAMSSITVSDICTARERGAYQ 177

Query: 209 GLCNFIFGLGTASGGLVGAAFQD---WRMAFTIQCPISLASCALIVSYLELPPRHEDDKD 265
           G  N +F  G   G  +G    D   WR  F +Q P+ L    L    + +   H    +
Sbjct: 178 GYANVVFSTGQLLGAPLGGFALDRIGWRAIFGLQVPMLLICMVLGYRNVNIKLAHVPPLE 237

Query: 266 RHWTSK-LRDLDWAGVVTLVCFL--FLFMLVSSLGGKEIAYDSVLFALLCVTTLVLGSIF 322
             +T K L  +D  G +TLVC +   LF+  +SL            A+L V T +   +F
Sbjct: 238 ERFTWKNLSRIDIGGSITLVCTISGVLFLCSTSLNK----------AILSVFTGLSFMLF 287

Query: 323 AYVELYVAVDPVLPIAFLKYRSVLGSSLANWFAMMSMLTTN---------YYLPVYWASV 373
            Y ELY+A + +LP        +LG S    F + S+LT           +  P++   V
Sbjct: 288 MYNELYLARERILPF------ELLGGS----FGLASILTVGSSFVIFGDVFRSPIFLQLV 337

Query: 374 LNMKPTDIGKRSIPSFFSVAFGSLGAGIYMKRTGK----------YYWFLLAFCGIGI-- 421
            N+  T  G   + S  + A  SL  G  ++ T            ++   L  CG+ I  
Sbjct: 338 QNISVTKTGGFLLFSSIATAAASLITGWILRNTKMNLAKCSYLIVFFSIFLQLCGLVIAV 397

Query: 422 --LGQLKIN---LLTPATPVWQQYLLL--------------VVPSFGLSVLITVTLLAMI 462
             L  L+ N   L+   T + + YL                    +G + L+  TL++++
Sbjct: 398 TLLSYLEPNQTSLMANNTRLKRDYLFKSDSLAWKCVYICASAFTGYGYASLLVSTLVSIV 457

Query: 463 SAVPHEHHAATTSISYAFRSTGATLGVSIGAAIFRSTLNTLLQNKVLQFASDEHPREELL 522
             +     A  T + Y +RS G  LG S+  +++ +TL+     K+  + S     E+  
Sbjct: 458 FTIDKSQQATITGLFYLWRSIGNVLGASLTLSLYEATLS----KKLWSYLSANDITEQ-- 511

Query: 523 RIINNAAHSANWVHKEAPEFVRATLVECYH 552
              NN +  ++++ K     + + L++ Y+
Sbjct: 512 --YNNLSRDSSYLRKNFSGELLSGLLDVYN 539

>ZYRO0G03234g Chr7 (247798..249486) [1689 bp, 562 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088C VBA1
           Permease of basic amino acids in the vacuolar membrane
          Length = 562

 Score =  151 bits (382), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 136/479 (28%), Positives = 226/479 (47%), Gaps = 47/479 (9%)

Query: 89  FLGIFLAALDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKP 148
           +LG F+ +LDGTIV+ ++ R+  EF   DK  WIATS+LL+++  QPLYGKLSD  GR+ 
Sbjct: 40  WLGSFIGSLDGTIVANIMNRVAEEFEESDKKQWIATSFLLTNTAFQPLYGKLSDITGRRF 99

Query: 149 LLVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQ 208
            L+ ++  F +GCL+   + S+    + R + GIGG G+   +S+ +SD+   +ER  YQ
Sbjct: 100 ALLTAHFFFGLGCLLTCFAQSVEQFALARAICGIGGGGINACSSIAVSDICTAKERGSYQ 159

Query: 209 GLCNFIFGLGTASGGLVGAAFQD---WRMAFTIQCPISLASCALIVSYLELPPRHEDDKD 265
           G  N +FG G   GG +G    D   WR  F +Q PI +    L    + +   H     
Sbjct: 160 GYANIVFGTGQMLGGPIGGLLIDTIGWRAIFAVQVPIIMFCSFLTYKNITIKLSHIPPVS 219

Query: 266 RHWT-SKLRDLDWAGVVTLVCFLFLFMLVSSLGGKEIAYDSVLFALLCVTTLVLGSIFAY 324
             +T   L  +D  G  +LV  +   + + S    ++        +L   T+V    F  
Sbjct: 220 ERFTWMNLSRIDIMGSSSLVVVICGILFICSTNWNKV--------ILSTFTIVGFLFFIV 271

Query: 325 VELYVAVDPVLPIAFLKYRSVLGSSLANWFAMMSMLTTNYYLPVYWASVLNMKPTDIGKR 384
            E Y A + +LP+  LK  S L  SL    +        +  P+Y+  V +M  T  G  
Sbjct: 272 TETYFAKECILPLKLLKGASGL-CSLVTVLSSFITFGEIFRAPIYYQVVQDMSVTKTGLF 330

Query: 385 SIPSFFSVAFGSLGAGIYMKRT----GKYYWFLL------AFCGIGILGQLKINLLTP-- 432
            +    SVA GS+  G  ++ T    G Y + ++         G+ +L  + IN   P  
Sbjct: 331 VLFPAVSVAVGSVVTGTALRHTKLDLGHYCYLIILRSIFTQLIGL-LLAYVVINGTEPTI 389

Query: 433 ---------------ATPVWQQYLLL---VVPSFGLSVLITVTLLAMISAVPHEHHAATT 474
                          +  +W + LL+    + S+G S L+  TL++++ +V     A  T
Sbjct: 390 GASSSTFAVHWFQFSSDSIWWKILLVSAGCMVSYGYSGLLVATLVSIVCSVEKSEQATLT 449

Query: 475 SISYAFRSTGATLGVSIGAAIFRSTLNTLLQNKVLQFASDE---HPREELLRIINNAAH 530
            I Y +RS G+ LG S+   I+ ++L   L   +    +D+   + ++E   +I ++++
Sbjct: 450 GIFYLWRSIGSVLGTSLTLVIYENSLTKSLWGAMFGSRNDDSYHYTKKEYYNLIGDSSY 508

>ZYRO0G21868g Chr7 complement(1799212..1801074) [1863 bp, 620 aa]
           {ON} weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 620

 Score =  150 bits (380), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 144/527 (27%), Positives = 240/527 (45%), Gaps = 90/527 (17%)

Query: 94  LAALDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPLLVFS 153
           L+ALDGTIVST +  + S F     V+W+AT+YLL+++  QPLYGK+SD +GR+  L+F 
Sbjct: 114 LSALDGTIVSTTVNDVASRFQQASMVTWVATAYLLTTTAAQPLYGKISDIIGRRKCLLFG 173

Query: 154 NVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQGLCNF 213
            +VF++G  +C  S SI  + + R + GIGG G   + ++++SD+ PL ER  Y G    
Sbjct: 174 EIVFAVGVGLCIFSKSIPQLAIARGICGIGGSGTGAMTNIILSDMAPLSERGKYWGY--- 230

Query: 214 IFGLGTASGGLVGAAFQDWRMA--------------FTIQCPISLASCALIVSYLELPPR 259
                   G ++G  FQ                   F  Q P  LA+  L   Y++    
Sbjct: 231 --------GSMLGGVFQSLGGPLGGILLTYFGVSGLFIPQIPFCLATLYLSWKYVQ---D 279

Query: 260 HEDDKDRHWTSKLRDLDWAGVVTLVC----FLFLFMLVSSLGGKEIA----YDSVLFALL 311
           +  D    W    + +D+ G + L+     F+F F    +    E +    Y    FA+ 
Sbjct: 280 YNQDTKGSW----KRIDFGGSICLLVGISSFIFFFSADENPSISEHSGWSPYKKWSFAIF 335

Query: 312 CVTTLVLGSIFAYVELYVAVDPVLPIAFLKYRSVLGSSLANWFAMMSML--TTNYYLPVY 369
            + T+    +F  VE YVA++ ++P+  LK    LG  LA    ++SM+  T  + +P++
Sbjct: 336 VLFTI----LFLVVEKYVALENIIPMEVLK--GTLG-LLAFIQGLVSMINYTELFIVPLF 388

Query: 370 WASVLNMKPTDIGKRSIPSFFSVAFGSLGAGIYMKRTGK--------------YYWFLLA 415
              V  +  +  G   +    S + GSL +G  +K+  K              +Y  L++
Sbjct: 389 LQLVWGISVSTSGAYIVCIVISYSVGSLLSGALIKKVAKPSRESTIYYSGVSIFYMSLIS 448

Query: 416 FCGIGILGQLKINLLTPATPVWQQYLLLVVPSFGLSVLITVTLLAM-------------I 462
             G   L +     +    PV+      V  S    ++  +TLL +             +
Sbjct: 449 MVGYYFLDR----AVRYTKPVYGD--TKVPESLNFQLIFGITLLGLCQGSQGVTIMLYNV 502

Query: 463 SAVPHEHHAATTSISYAFRSTGATLGVSIGAAIFRSTLNTLLQNKVLQFASDEHPREELL 522
           + V  +  A++TS+ + FRS G  L VS+   +F + L   L  KVL   +DE       
Sbjct: 503 AKVGRKGQASSTSVQFLFRSLGNVLSVSLAFNVFTNALRKTL-GKVLAGKNDEL----FA 557

Query: 523 RIINNAAHSANWVHKEAPEFVRATLVECYHYASKSTFKFCLITMILA 569
            ++ + A   N   K+ P     +++E +H A  S+F  C+  +IL+
Sbjct: 558 LLLKDNAFLRN---KDMPTDDLDSILEAFHKALVSSFVPCIWCLILS 601

>YBR293W Chr2 (787006..788430) [1425 bp, 474 aa] {ON}  VBA2Permease
           of basic amino acids in the vacuolar membrane
          Length = 474

 Score =  146 bits (369), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 137/454 (30%), Positives = 226/454 (49%), Gaps = 31/454 (6%)

Query: 120 SWIATSYLLSSSTCQPLYGKLSDQLGRKPLLVFSNVVFSIGCLICGMSTSIWWVVVGRFV 179
           +WI T+YL++S++ QPLYG  SD LGR+  L F+N  F+IGCL CG S +I+ +   R +
Sbjct: 5   NWITTAYLITSTSFQPLYGSFSDALGRRNCLFFANGAFTIGCLACGFSKNIYMLSFMRAL 64

Query: 180 SGIGGCGLTCLASMVISDLVPLRERAVYQGLCNFIFGLGTASGGLVGAAFQD---WRMAF 236
           +GIGG GL  L+++V SD++P  +R ++Q   N + G G   G   G        WR  F
Sbjct: 65  TGIGGGGLITLSTIVNSDVIPSSKRGIFQAFQNLLLGFGAICGASFGGTIASSIGWRWCF 124

Query: 237 TIQCPISLASCALIVSYLELPPRHEDDKDRHWTSK-----LRDLDWAGVVTLVCFLFLFM 291
            IQ PIS+ S  L+  Y  +P + E ++      +     LRD+D  G + ++  L L +
Sbjct: 125 LIQVPISVISSILMNYY--VPNQKEYNRQNSSIFQNPGKILRDIDVMGSILIITGLTLQL 182

Query: 292 LVSSLG--GKEIAYDSVLFALLCVTTLVLGSIFAYVELYVAVDPVLPIAFLKYR---SVL 346
           L  SLG    ++++ S    LL V ++++  +F   E   +   ++P+  +       VL
Sbjct: 183 LYLSLGCSTSKLSWTSPSVLLLLVGSVIILLLFILHERKTSARAIIPMELVNSSYSVVVL 242

Query: 347 GSSLANWFAMMSMLTTNYYLPVYWASVLNMKPTDIGKR-SIPSFFSVAFGSLGAGIYMKR 405
             S+   FA  + L T   LP+++  VL       G R +IPS F+   GSL  G  M  
Sbjct: 243 SISILVGFASYAYLFT---LPLFFQIVLGDSTAKAGLRLTIPSLFT-PVGSLITGFSMS- 297

Query: 406 TGKYYWF-LLAFCGIGI--LGQLKINLLTPATPVWQQYLLLVVPSFGLSVLITVTLLAMI 462
             KY    LL + GI +  LG      +   +P W   L L+  + G  +    TL   I
Sbjct: 298 --KYNCLRLLLYIGISLMFLGNFLFLFIEKTSPNWLIGLFLIPANLGQGITFPTTLFTFI 355

Query: 463 SAVPHEHHAATTSISYAFRSTGATLGVSIGAAIFRSTLNTLLQNKVLQFASDEHPREELL 522
                   A  TS  Y FRS G+  GV+I A + + +   LL++ +     +   ++ ++
Sbjct: 356 FMFSKSDQATATSTLYLFRSIGSVWGVAISAGVIQLSFAGLLRSNLKGLLDENKIKKLIV 415

Query: 523 RIINNAAHSANWVHKEAPEFVRATLVECYHYASK 556
           ++  N+++  + +H E    V+ T+++ +  A+K
Sbjct: 416 QLSANSSYIGS-LHGE----VKNTVIKSFDEATK 444

>KLTH0D05434g Chr4 (486319..488049) [1731 bp, 576 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088C VBA1
           Permease of basic amino acids in the vacuolar membrane
          Length = 576

 Score =  148 bits (373), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 142/517 (27%), Positives = 234/517 (45%), Gaps = 51/517 (9%)

Query: 89  FLGIFLAALDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSD-QLGRK 147
           +LG FL ALDGTIV+ ++ RI  EF   DK  WIATS+LL+++  QPLYGKLSD   GRK
Sbjct: 47  WLGSFLVALDGTIVANVMNRIAEEFQESDKKQWIATSFLLTNTAFQPLYGKLSDVATGRK 106

Query: 148 PLLVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVY 207
              + +   F +G +I   + ++    +GR V GIGG G++ ++S+ +SD+   +ER +Y
Sbjct: 107 LATLIAQFFFFLGLIISCFAQNVTQFAIGRAVCGIGGGGVSAMSSIAVSDICTAKERGMY 166

Query: 208 QGLCNFIFG---LGTASGGLVGAAFQDWRMAFTIQCPISLASCALIVSYLELPPRHEDDK 264
           QG  N +FG   L  A  G +      WR  F IQ P++L    L    + +   H   +
Sbjct: 167 QGYANIVFGSGQLLGAPLGGLLITTIGWRAIFAIQVPMALFCMFLTGRNVNIKLAHLPSR 226

Query: 265 DRHWTSK-LRDLDWAGVVTLVCFL--FLFMLVSSLGGKEIAYDSVLFALLCVTTLVLGSI 321
           +  +T K L  LD  G  TLV  +   LF+  +S+    I+            T+V  +I
Sbjct: 227 NERFTLKNLSRLDLLGSCTLVLSISGLLFLFSTSMNRTWIS----------AFTIVTFAI 276

Query: 322 FAYVELYVAVDPVLPIAFLKYRSVLGSSLANWFAMMSMLTTNYYLPVYWASVLNMKPTDI 381
           F Y E + A + ++P   L   S + +SL    +   M    +  P+Y   V N+     
Sbjct: 277 FIYNERFWAKERIIPFDLLCGTSGI-TSLLTVLSSFIMFGDVFRSPIYLQIVQNVSLAKS 335

Query: 382 GKRSIPSFFSVAFGSLGAGIYMKRTGK-----YYWFLLAFCGIGILGQ-----LKINLLT 431
           G   +    + A  S+  G  ++RT        Y  +L    + ++G      L  NL+ 
Sbjct: 336 GIFILFGSVACAATSVLTGWIIRRTTMDLVKCTYLIVLVMIFLQLVGTASNAILIANLIP 395

Query: 432 PATP-----------------VWQQYLLL--VVPSFGLSVLITVTLLAMISAVPHEHHAA 472
             T                   W+   +   V+ SFG   ++   L++++  VP    A 
Sbjct: 396 NNTTYADKDVAIKVALSAKGFTWKVVYVFSTVLNSFGYGGVLVAVLVSIVFTVPKSQQAT 455

Query: 473 TTSISYAFRSTGATLGVSIGAAIFRSTLNTLLQNKVLQFASDEHPREELLRIINNAAHSA 532
            T + Y +RS G  LG SI  A++    + +L++K+  F       +   +++ ++ +  
Sbjct: 456 LTGVFYLWRSIGNVLGTSITLALY----DLILKSKLRVFMEAHGLSKSYSKLVRDSGYLR 511

Query: 533 NWVHKEAPEFVRATLVECYHYASKSTFKFCLITMILA 569
           N    E    +     E + ++        L+ +ILA
Sbjct: 512 NHFSGETLAELLGVYNESFLWSFGPNIVVGLVAVILA 548

>Smik_2.434 Chr2 (773094..774518) [1425 bp, 474 aa] {ON} YBR293W
           (REAL)
          Length = 474

 Score =  144 bits (363), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 127/449 (28%), Positives = 213/449 (47%), Gaps = 21/449 (4%)

Query: 120 SWIATSYLLSSSTCQPLYGKLSDQLGRKPLLVFSNVVFSIGCLICGMSTSIWWVVVGRFV 179
           +WI T+YL++S++ QPLYG  SD LGR+  L F+N  F+IGCL CG S++I+ +   R +
Sbjct: 5   NWITTAYLITSTSFQPLYGSFSDALGRRNCLFFANATFTIGCLACGFSSNIYMLSFMRAL 64

Query: 180 SGIGGCGLTCLASMVISDLVPLRERAVYQGLCNFIFGLGTASGGLVGAAFQD---WRMAF 236
           +GIGG GL  L+++V SD++P  +R ++Q   N + G G   G   G        WR  F
Sbjct: 65  TGIGGGGLITLSTIVNSDVIPTSKRGIFQAFQNLLLGFGAICGASFGGTIASTIGWRWCF 124

Query: 237 TIQCPISLASCALIVSYLELPPRHEDDKDRHWTSK---LRDLDWAGVVTLVCFLFLFMLV 293
            IQ PIS+ S  L+  Y+     + D     +      L  +D  G + ++  L L +L 
Sbjct: 125 LIQVPISMISSILMNYYVPNQKEYNDQNSNIFNDPKKILTGIDVMGSILIITGLTLQLLY 184

Query: 294 SSLG--GKEIAYDSVLFALLCVTTLVLGSIFAYVELYVAVDPVLPIAFLKYR---SVLGS 348
            SLG     +++ S    LL   ++++  +F   E       ++P+  +       VL  
Sbjct: 185 LSLGCSTSNLSWTSPSVLLLLFGSVIILLLFILHERKTTARAIIPMELVSSSYSFVVLSI 244

Query: 349 SLANWFAMMSMLTTNYYLPVYWASVLNMKPTDIGKR-SIPSFFSVAFGSLGAGIYMKRTG 407
           S+   FA  + L T   LP+++  VL       G R +IPS F+   GSL  G  M +  
Sbjct: 245 SILVGFASYAYLFT---LPLFFQIVLGDSTAKAGLRLTIPSLFT-PVGSLITGFSMSKYN 300

Query: 408 KYYWFLLAFCGIGILGQLKINLLTPATPVWQQYLLLVVPSFGLSVLITVTLLAMISAVPH 467
                L     +  LG      +   +P W   L L+  + G  +    TL   I   P 
Sbjct: 301 CLRSLLYLGISLMFLGNFLFLFIEETSPNWLISLFLIPANLGQGITFPTTLFTFIFMFPK 360

Query: 468 EHHAATTSISYAFRSTGATLGVSIGAAIFRSTLNTLLQNKVLQFASDEHPREELLRIINN 527
              A  TS  Y FRS G+  GV+I A + + +    L   +     +   ++ ++++ +N
Sbjct: 361 SDQATATSTLYLFRSIGSVWGVAISAGVIQLSFANFLCTNLKGLLDENTIKKLVIKLSDN 420

Query: 528 AAHSANWVHKEAPEFVRATLVECYHYASK 556
           +++  + +H E    V++ +++ +  A+K
Sbjct: 421 SSYIGS-LHGE----VKSAVIKSFDAATK 444

>Kpol_467.24 s467 (55523..56632) [1110 bp, 370 aa] {ON}
           (55523..56632) [1110 nt, 370 aa]
          Length = 370

 Score =  137 bits (346), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 110/342 (32%), Positives = 166/342 (48%), Gaps = 27/342 (7%)

Query: 90  LGIFLAALDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPL 149
           LG FL+++D TIV+ ++ ++  EF    +  WIATS+LL+++  QPLYGKLSD  GRK  
Sbjct: 42  LGSFLSSIDSTIVANIMNKVAEEFQESQEKQWIATSFLLTNTAFQPLYGKLSDITGRKFA 101

Query: 150 LVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQG 209
           L+ +   F +GC +  +ST+I    + R + GIGG G+  ++S+ + D+   ++R +YQG
Sbjct: 102 LLTALSFFGLGCFLTSLSTNIKQFAIARAICGIGGGGINAISSITVGDICTAKDRGIYQG 161

Query: 210 LCNFIFGLGTASGGLVGAAF---QDWRMAFTIQCPISLASCALIVSYLEL-----PPRHE 261
             N +FG+G   G  VG  F     WR  F IQ P+ + +  L   Y+ +     PP  E
Sbjct: 162 YANIVFGMGQLLGAPVGGLFIATIGWRALFWIQVPLVIIAIILGEMYVNIKLVHVPPPSE 221

Query: 262 DDKDRHWTSKLRDLDWAGVVTLVCFLFLFMLVSSLGGKEIAYDSVLFALLCVTTLVLGSI 321
             K   W +  R +D+ G  TLV  +  F+++ S     I    +               
Sbjct: 222 RFK---WKNISR-IDFLGSFTLVSSITCFIILISTKSNVILLSLLSVLSFIA-------- 269

Query: 322 FAYVELYVAVDPVLPIAFLKYRSVLGSSLANWFAMMSMLTTNYYLPVYWASVLNMKPTDI 381
           F YVELYV+ D +LP   LK  S   +S+A   +   +    +  P+Y   V +      
Sbjct: 270 FIYVELYVSKDRILPFELLK-GSFGCNSIATVISSYVIFGEIFRSPIYLQLVQDFSVIKT 328

Query: 382 GKRSIPSFFSVAFGSLGAGIYMKRTG------KYYWFLLAFC 417
           G   I    + A GSL  G  +KRT        Y   LL  C
Sbjct: 329 GIFLIFPAITTAIGSLVTGAILKRTKLDLAYCSYKLVLLGLC 370

>TPHA0G03150 Chr7 (670343..672145) [1803 bp, 600 aa] {ON} Anc_2.473
           YMR088C
          Length = 600

 Score =  140 bits (352), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 137/517 (26%), Positives = 231/517 (44%), Gaps = 76/517 (14%)

Query: 90  LGIFLAALDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPL 149
           LG FL+ALD TIV+ ++ R+  +FN+ ++  WIATSYLL+++  QPLYG+LSD +GRK  
Sbjct: 74  LGSFLSALDATIVAVIMNRVAEDFNASNQKQWIATSYLLTNTAFQPLYGRLSDIIGRKYT 133

Query: 150 LVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQG 209
            +     F +G  +   S ++    + R V+GIGG G++ ++S+ +SD+  ++ER +YQG
Sbjct: 134 QLIVPFFFGMGSFLTTFSKTLPQFALARAVAGIGGGGISAMSSIAVSDICTVKERGMYQG 193

Query: 210 LCNFIFGLGTASGGLVGAAFQD---WRMAFTIQCPISLASCALIVSYLE-----LPPRHE 261
             N  +G G   G  +G    D   WR  F  Q P+   +  L  +YL      LPP+ E
Sbjct: 194 YANIFYGAGQLIGAPIGGLLIDRIGWRALFAFQVPMVAVAMFLSFTYLNIKLAHLPPKEE 253

Query: 262 DDKDRHWTSKLRDLDWAGVVTLVCFLFLFMLVSSLGGKEIAYDSVLFALLCVTTLVLGS- 320
             K +H    L  LD  G +TLV  + + +++ S  G              +  +VLG+ 
Sbjct: 254 RYKWKH----LSKLDIFGSITLVITIGICIVILSDNG--------------LNRMVLGAM 295

Query: 321 ------IFAYVELYVAVDPVLPIAFLKYRSVLGSSLANWFAMMSMLTTNYYLPVYWASVL 374
                 +F  +E Y     +LP+  L+  S   +SL    +   +    +  P+Y   + 
Sbjct: 296 GLLSFGLFLIIEKYYTKHQILPLKCLQ-GSFGYASLTIIISTYVIFGEYFRTPIYLQVIQ 354

Query: 375 NMKPTDIGKRSIPSFFSVAFGSLGAGIYMKRTGK----------YYWFLLAFCGIGILGQ 424
           N   +  G   +     VA GS+  G  +K++            +Y     F G+ +L  
Sbjct: 355 NFTVSQSGIFLLFPTICVAGGSVLTGRVLKQSKMDLEKCSYQLIFYSVCTQFVGLLML-T 413

Query: 425 LKINL-------------------LTPATPVWQQYLLLVVP--SFGLSVLITVTLLAMIS 463
           L IN                    LT     W+    +     +FG + ++  TL++++ 
Sbjct: 414 LLINYLHIFNSNNTKPGVGNIFHELTTVDFSWKIIFCIATSLVTFGYASILVATLVSIVH 473

Query: 464 AVPHEHHAATTSISYAFRSTGATLGVSIGAAIFRSTLNTLLQNKVLQFASDEHPR----- 518
            V      + T + Y +RS G  LG SI    + + L + L   + +   ++H       
Sbjct: 474 TVEKSQQGSITGLFYLWRSLGNVLGTSITLITYENNLTSKLYKFMFE-NPEQHMDYIFTI 532

Query: 519 EELLRIINNA----AHSANWVHKEAPEFVRATLVECY 551
           EE   ++ N+    +H +  V +E     R   V+ Y
Sbjct: 533 EEYKALVKNSGYLRSHFSKDVVEELLAVYRNAFVQSY 569

>Kwal_26.7755 s26 (500034..501713) [1680 bp, 559 aa] {ON} YMR088C -
           1:1 [contig 55] FULL
          Length = 559

 Score =  136 bits (343), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 139/480 (28%), Positives = 218/480 (45%), Gaps = 49/480 (10%)

Query: 89  FLGIFLAALDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSD-QLGRK 147
           +LG FL ALDGTIV+ ++ RI  EF   DK  WIATS+LL+++  QPLYGKLSD   GRK
Sbjct: 47  WLGSFLVALDGTIVANVMNRIAEEFQESDKKQWIATSFLLTNTAFQPLYGKLSDVATGRK 106

Query: 148 PLLVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVY 207
              + +   F +G +I   + ++    VGR V GIGG G+  ++S+V+SD+   +ER +Y
Sbjct: 107 GAALVAQFFFCLGLVISCFAQNVTQFAVGRAVCGIGGGGIAAMSSIVVSDICTAKERGMY 166

Query: 208 QGLCNFIFG---LGTASGGLVGAAFQDWRMAFTIQCPISLASCALIVSYLELPPRHEDDK 264
           QG  N +FG   L  A  G +      WR  F IQ P++L    L    + +   H    
Sbjct: 167 QGYANIVFGSGQLLGAPLGGLLITTLGWRAIFAIQVPVTLLCMVLAFRNVNIKLAHLPPP 226

Query: 265 DRHWTSK-LRDLDWAGVVTLVCFLFLFMLVSSLGGKEIAYDSVLFAL-LCVTTLVLGSIF 322
              +T K L  LD  G  TLV          S+ G    + + L  L + + T V   +F
Sbjct: 227 KECFTLKNLSRLDLLGSCTLVM---------SISGLLFLFSTTLNKLWISIFTAVSFGLF 277

Query: 323 AYVELYVAVDPVLPIAFLKYRSVLGSSLANWFAMMSMLTTNYYLPVYWASVLNMKPTDIG 382
            Y E Y A + ++P   L+  S + S+L    +   M    +  P+Y   V N+     G
Sbjct: 278 VYNEYYWATERIIPFELLRGESGVTSALTV-LSSFVMFGDVFRSPIYLQVVQNVSLARSG 336

Query: 383 KRSIPSFFSVAFGSLGAGIYMKRTGK-----YYWFLLA-----FCGIGI----LGQLKIN 428
              +    + A  S+  G  ++RT        Y  +L        G  I    + +LK N
Sbjct: 337 LFILFGSIACAGSSMLTGWLIRRTNMGLVKCAYLIVLGMIISQLAGTAINAVLIAKLKPN 396

Query: 429 -------------LLTPATPVWQQYLL--LVVPSFGLSVLITVTLLAMISAVPHEHHAAT 473
                         L P   +W+   +   V+ +FG   ++   L++++  VP    A  
Sbjct: 397 QTSHALTDSITQQTLQPEGLLWKIIYVSATVLNTFGYGGVLVAVLVSIVFTVPKSQQATL 456

Query: 474 TSISYAFRSTGATLGVSIGAAIFRSTLNTLLQNKVLQFASDEHPREELLRIINNAAHSAN 533
           T + Y +RS G  LG S+   ++  T    L+ K+ ++ S         ++I ++ +  N
Sbjct: 457 TGVFYLWRSIGNVLGTSVTLTLYDLT----LKAKLWKYMSSNGLSSSYTQLIRDSGYLRN 512

>ABL040W Chr2 (321534..323237) [1704 bp, 567 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR088C
          Length = 567

 Score =  132 bits (332), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 136/517 (26%), Positives = 234/517 (45%), Gaps = 79/517 (15%)

Query: 31  NEVEQQDYNSRTGHDSYGATAVDDRTAT-SARC---DLTFPPSETPEFALXXXXXXXXXX 86
           +E E Q   +   HDS       D+T T + RC   + + P +                 
Sbjct: 2   DESESQLRGTLLPHDSLEYGTNSDKTLTETQRCQEHNRSLPKAPI-------------LT 48

Query: 87  XXFLGIFLAALDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGR 146
             +LG FLA++D +IV+ ++ +I  EF+  DK  W+ATS+LL+++  QPLYG+ SD +GR
Sbjct: 49  SLWLGSFLASIDASIVANIMNKIAEEFHESDKKQWMATSFLLTNAAFQPLYGRCSDIVGR 108

Query: 147 KPLLVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAV 206
           K  L+ +   F +G L+   + ++    + R + G+GG G+  ++S+ +SD+   +ER +
Sbjct: 109 KCALLIAQSFFLLGTLLTCFARNVTEFAIARAICGMGGGGIGAMSSITVSDICTTKERGM 168

Query: 207 YQGLCNFIFG----LGTASGGLVGAAFQDWRMAFTIQCPISLASCALIVSY-------LE 255
           YQG  N IFG    LG   GGL+   F +WR+ F  Q  +++  C +I++Y       L 
Sbjct: 169 YQGYANVIFGAGQVLGAPVGGLIMETF-NWRIIFAAQV-VAIMIC-MILAYRNINLKLLH 225

Query: 256 LPPRHEDDKDRHWTSKLRDLDWAGVVTLVCFLFLFMLVSSLGGKEIAYDSVLFALLCVTT 315
           +PP H+    R     L  +D  G   L C L  F+++ S G        V  +L  + T
Sbjct: 226 IPPFHQ----RFTRKNLSRIDLFGSSMLSCSLVSFLMLFSSG--------VSRSLWFLLT 273

Query: 316 LVLGSIFAYVELYVAVDPVLPIAFLKYRSVLGSSLANWFAMMSMLTTNYYLPVYWASVLN 375
           LV  ++F   E Y+A + +LP   L+    L + L    + M M    Y +PVY   + +
Sbjct: 274 LVSLTLFCINERYIATERLLPNGILRGHFGLSALLIVVSSFM-MFAELYRMPVYLQLIQD 332

Query: 376 MKPTDIGKRSIPSFFSVAFGSLGAGIYMKRTGK-----YYWFLLAFCGIGILGQL----- 425
           +  +  G   + +  S +  SL  G  ++ T +      Y   LA   I ++G +     
Sbjct: 333 ISVSRSGIFLLFASVSSSGASLFTGWLLRTTKQDLGKLVYKIALASSFIQLVGMMLALFT 392

Query: 426 -----------------------KINLLTPATPVWQQYLL--LVVPSFGLSVLITVTLLA 460
                                  +++     +  W+  L   L+  SF  + L+   L++
Sbjct: 393 TSVTEPSQAVHAGWAVFSPRSAGQMHYFKSDSIAWRVLLTVALMCSSFAYASLLVSILVS 452

Query: 461 MISAVPHEHHAATTSISYAFRSTGATLGVSIGAAIFR 497
           ++        A    + Y +RS G TLG S+  +++ 
Sbjct: 453 IVDTTEKSQQATMIGVFYLWRSIGNTLGASVPLSVYE 489

>ZYRO0G21890g Chr7 complement(1801391..1803121) [1731 bp, 576 aa]
           {ON} weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 576

 Score =  126 bits (316), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 124/441 (28%), Positives = 197/441 (44%), Gaps = 40/441 (9%)

Query: 94  LAALDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPLLVFS 153
           LAALDGTIVST +  I S+F     V+W+AT+YLL+++  QPLYGK+SD +GR+  L+F 
Sbjct: 72  LAALDGTIVSTTVNDIASQFQQASMVTWVATAYLLTTTAVQPLYGKISDIIGRRKCLLFG 131

Query: 154 NVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQGLCNF 213
            V+F++G L+C  + +I  + + R + GIGG G + + +++++D++PL  RA Y      
Sbjct: 132 EVIFALGVLLCNFANTIPQLAIARAICGIGGSGNSAMGNIMLNDILPLSVRATYWSYGAI 191

Query: 214 IFGLGTASGGLVGAAFQDWRMA---FTIQCPISLASCALIVSYLELPPRHEDDKDRHWTS 270
           +  +  + GG +G     W      FT Q P  + S  L   Y+        D   H  S
Sbjct: 192 LASIFQSLGGPIGGLLLKWFGVGGLFTPQIPFCIGSIYLSYKYIH-------DYKEHARS 244

Query: 271 KLRDLDWAG-VVTLVCFLFLFMLVSSLGGKEIAYDSVLFALLCVTTLVLGSI--FAYVEL 327
             + +D+ G +  LV         S+     I  D           L++ SI  FA++E 
Sbjct: 245 SWKRIDFGGSICLLVGISSFIFFFSASDNTTIEDDGWSTPKKWSVVLLIVSIIAFAFIEN 304

Query: 328 YVAVDPVLP-----------------IAFLKYRSVLGSSL---ANWFAMMSMLTTNYYLP 367
           +VAV+ ++P                 +A + Y  +    L    NW   +S         
Sbjct: 305 FVAVECIIPRVILEGTLGLMVCIHGLVAVINYTCLFMVPLFLQLNWGVSVSRSGGYIMFI 364

Query: 368 VYWASVLNMKPTDIGKR-SIPSFFSVAFGSLGAGIYMKR---TGKYYWFLLAFCGIGILG 423
           V ++S  ++  + I  R S P+  S  F +  A  YM      G YY     +    I G
Sbjct: 365 VIFSSAGSLFTSMILNRFSKPTRSSQLFCAASAIFYMSILTIVGYYYMQKAIYYSKPIYG 424

Query: 424 QLKINLLTPATPVWQQYLLLVVPSFGLSVLITVTLLAMISAVPHEHHAATTSISYAFRST 483
               +   P    W   L + +  F          +  ++ V  +  A++TS++  FRS 
Sbjct: 425 S---DTQIPKYDNWSIILGIAILGFCQGSQNVTISIYNVAKVGRKEQASSTSVNLLFRSM 481

Query: 484 GATLGVSIGAAIFRSTLNTLL 504
           G  L VSI   IF + L   L
Sbjct: 482 GNVLSVSIALNIFTNVLKKKL 502

>Ecym_7399 Chr7 complement(820280..821971) [1692 bp, 563 aa] {ON}
           similar to Ashbya gossypii ABL040W
          Length = 563

 Score =  120 bits (302), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 112/455 (24%), Positives = 200/455 (43%), Gaps = 56/455 (12%)

Query: 93  FLAALDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPLLVF 152
           FLA++D TI++ ++  +  EF    ++ W+ATS+LL+S+  QP+YGKLSD  GR+ +LV 
Sbjct: 58  FLASMDRTIIANIMNSVTEEFKESHRIQWVATSFLLTSTVFQPIYGKLSDVTGRRFVLVL 117

Query: 153 SNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQGLCN 212
           +  +F +GCL+   + +IW    GR + GIG  G+  +  + + D+  ++E+++YQ   +
Sbjct: 118 AYSLFLLGCLVTAYARNIWEFAFGRAICGIGAGGIPTMCVITMGDMFSVKEQSIYQSYAH 177

Query: 213 FIFGLGTASGGLVGAAFQD---WRMAFTIQCP-----ISLASCALIVSYLELPPRHEDDK 264
            I+ +G   G  +G    +   WR  F  Q P     I L  C   ++   +PP  E   
Sbjct: 178 IIYTIGEVLGAPIGGIALETVGWRAIFLAQVPVLTICIYLTLCDDDLAQQHIPPHGE--- 234

Query: 265 DRHWTSKLRDLDWAGVVTLVCFLFLFMLVSSLGGKEIAYDSVLFALLCVTTLVLGSIFAY 324
            R     +  +D +G + L+  L   +L+SS         +++   + +  +    +F  
Sbjct: 235 -RLTWKNISRMDLSGSILLIISLCGVILLSS--------ATIIEYWMWLLVIASAGLFII 285

Query: 325 VELYVAVDPVLPIAFLKYRSVLGSSLANWFAMMSMLTTNYY-LPVYWASVLNMKPTDIGK 383
            ELY   + ++P  F K +  +G +         +  +  Y  P++   V NM  +  G 
Sbjct: 286 NELYWVSECIIP--FRKLKGAIGLTSLLLLVSSFIEYSELYRTPLFLQLVQNMSTSTTGV 343

Query: 384 RSIPSFFSVAFGSLGAGIYMKRTGK----------YYWFLLAFCGIGILGQLKINLLTP- 432
             + S  + A  +L +G  ++ T            +    L   G+  +  L I+ L P 
Sbjct: 344 VLLFSSAASAVATLLSGWVLRTTRTNLGEASFNHMFGSMTLQVAGLTTILVL-IHFLNPD 402

Query: 433 -------------------ATPVWQQYLL--LVVPSFGLSVLITVTLLAMISAVPHEHHA 471
                               + VW+   +  L   S G + L+  TL ++         A
Sbjct: 403 QSSIQVTSEHRLAPFMMNSDSAVWKIIYVAALSTVSSGHAGLLVSTLTSIFVHTETPDRA 462

Query: 472 ATTSISYAFRSTGATLGVSIGAAIFRSTLNTLLQN 506
             T   Y FR  G+ LG S   +++ S L+  L N
Sbjct: 463 MFTGAFYLFRYIGSVLGASTALSVYESVLSKRLWN 497

>KLTH0B10142g Chr2 complement(847376..849082) [1707 bp, 568 aa] {ON}
           similar to uniprot|P36172 Saccharomyces cerevisiae
           YKR105C Hypothetical ORF
          Length = 568

 Score =  119 bits (298), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 117/493 (23%), Positives = 211/493 (42%), Gaps = 49/493 (9%)

Query: 92  IFLAALDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPLLV 151
           +F+ ALD  IV T++  +   F    K  WI T Y L ++    L+ +LS  LG +  +V
Sbjct: 54  MFVTALDVLIVGTIIDTVCKTFGDYTKSGWIVTGYSLPNALFSLLWARLSAVLGPRISVV 113

Query: 152 FSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQGLC 211
              ++F  G LI  ++ S+  ++ GR V+GIGG GL  L+ ++   LV  + R +   L 
Sbjct: 114 SCIILFEAGSLISALANSMNMLIAGRVVAGIGGSGLQTLSLVIGCQLVDEKSRPLVLSLL 173

Query: 212 NFIFGLGTASGGLVGAAFQ---DWRMAFTIQCPISLASCALIV----------------S 252
           N  F + +  G  +G AF     WR  F I  PI   + A+ V                +
Sbjct: 174 NCTFAVASIVGPFLGGAFTTHVTWRWCFYINLPIGGLAIAIFVFFYNPEGVNLLEKFGNT 233

Query: 253 YLELPPRHEDDK--DRHWTSKLRDLDWAGVVTLVCFLFLFMLVSSLGGKEIAYDS----- 305
           + ++   H   K   +     L   D    ++      LF+L  + GG+  A++S     
Sbjct: 234 FKKVSSFHPVKKSPKKVLQQLLFGFDILSFISFTAGWLLFLLALTFGGQTHAWNSGIVIS 293

Query: 306 --VLFALLCVTTLVLG-SIFAYVELYVAVDPVLPIAFLKYRSVLGSSLANWFAMMSMLTT 362
             ++  LL   +LV    +F  ++   +  P+L    +  RS+L S+   +F+ ++    
Sbjct: 294 FIIIGVLLIAISLVYDFKVFEQIKTQDSFRPLLSWEIMSNRSILLSNFTGFFSTVAYNVQ 353

Query: 363 NYYLPVYWASVLNMKPTDIGKRSIPSFFSVAFGSLGAGIYMKRTGKYYWFLLAFCGIGIL 422
             Y   ++  V        G   IP   S    S+ +GI  K+TG     L+    +G+L
Sbjct: 354 MIYSVQFFQLVYGFSAWKAGLHLIPILVSTVVFSIASGILTKKTGHIKPLLVFGSAMGVL 413

Query: 423 GQLKINLLTPATPVWQQYLLLVVPSFGLSVLITVTLLAMISAVPHEHHA------ATTSI 476
           G   + LL   +    Q  +L++P   L  ++   L+A    +   + +       TTS+
Sbjct: 414 GGGLMTLLDNKSTKHTQIGVLILPGVALGFVLPSALIACHVQLDKGNPSYGADLLETTSV 473

Query: 477 SYAFRSTGATLGVSIGAAIFRSTLNTLLQNKVLQFASDEH--------------PREELL 522
           +   +S G TLG  +   +F +++N  +++  L     +               PR E+ 
Sbjct: 474 NALLKSLGTTLGSILSTMVFSTSMNNKMKHGGLSLEEYDRLDGIASYRMDHFDGPRSEMG 533

Query: 523 RIINNAAHSANWV 535
            I++++  +A W+
Sbjct: 534 YILSDSIKNAFWM 546

>KLTH0B00132g Chr2 (4664..6370) [1707 bp, 568 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 568

 Score =  116 bits (291), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 113/495 (22%), Positives = 212/495 (42%), Gaps = 53/495 (10%)

Query: 92  IFLAALDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPLLV 151
           +F+ ALD  IV T++  + + F    K  WI T Y L ++    L+G+LS  LG +  ++
Sbjct: 54  MFVTALDVLIVGTIIDTVCTSFGDYTKSGWIVTGYSLPNALFSLLWGRLSAVLGPRISVI 113

Query: 152 FSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQGLC 211
              ++F  G LI  ++ S+  ++ GR ++G+GG GL  L+ ++   LV  + R +   L 
Sbjct: 114 SCIILFETGSLISALAKSMNMLISGRVIAGVGGSGLQTLSLVIGCQLVNEKSRPLVLSLL 173

Query: 212 NFIFGLGTASGGLVGAAFQ---DWRMAFTIQCPISLASCALIVSYLELPPRHED--DKDR 266
           N  F + +  G  +G AF     WR  F I  PI   + A+ + +    P   D  +K  
Sbjct: 174 NCTFAVASIVGPFLGGAFTTHVTWRWCFYINLPIGGLAIAIFIFFYN--PEGADLLEKGS 231

Query: 267 HWTSKLRDLDWAG---------------VVTLVCFL---FLFMLVSSLGGKEIAYDS-VL 307
               KL     A                +V+ V F     LF+L  + GG+   + S ++
Sbjct: 232 QTFKKLLSYRRANLSLKQLLDQLLFGFDIVSFVLFTAGWLLFLLALTFGGQTHPWKSGIV 291

Query: 308 FALLCVTTLVLG-------SIFAYVELYVAVDPVLPIAFLKYRSVLGSSLANWFAMMSML 360
            + + V  L++         +F +++      P+L    +  R++L ++   +F+ ++  
Sbjct: 292 ISFIIVGVLLIALSLIYDFRLFDHIKTMDTFRPLLSWHLMSQRAILNANFTGFFSTIAYN 351

Query: 361 TTNYYLPVYWASVLNMKPTDIGKRSIPSFFSVAFGSLGAGIYMKRTGKYYWFLLAFCGIG 420
               Y   ++  V        G   IP   S    S+ +G+ +K+TG     L+    +G
Sbjct: 352 VQMIYSVQFFQLVYGFSAWKAGLHLIPILVSTVVFSIASGVIIKKTGHIKPLLVFGSAMG 411

Query: 421 ILGQLKINLLTPATPVWQQYLLLVVPSFGLSVLITVTL------LAMISAVPHEHHAATT 474
           +LG   + LL   +    Q  +L++P   L  ++   L      L   S         TT
Sbjct: 412 VLGSGLMILLNNTSTKHTQIGVLILPGVALGFVLPAALITCHVQLDRTSPSYGADMLETT 471

Query: 475 SISYAFRSTGATLGVSIGAAIFRSTLNTLLQNKVLQFASD--------------EHPREE 520
           S++   +S G T+G  +   +F ++L+  ++N  + F                 + PR E
Sbjct: 472 SVNALLKSLGTTVGSILSTMVFSTSLHNKMKNSNILFEVSGELDSIASYRLDHFDGPRSE 531

Query: 521 LLRIINNAAHSANWV 535
           +  ++N++  +  W+
Sbjct: 532 MGCMLNDSIRNTFWM 546

>NDAI0J01280 Chr10 (299922..302006) [2085 bp, 694 aa] {ON} Anc_8.272
          Length = 694

 Score =  110 bits (276), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 124/508 (24%), Positives = 226/508 (44%), Gaps = 32/508 (6%)

Query: 90  LGIFLAALDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGR-KP 148
           L +F    D T+   L T  GS        SWI  SYL++    Q L  ++S +    K 
Sbjct: 204 LLLFTIIFDFTLAMMLSTTSGSHVKQSSNSSWIIASYLITMYISQLLTAQVSGKYKNYKT 263

Query: 149 LLVFSNVVFSIGCLICGMST-SIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVY 207
           L     ++F IG  I  + T S WW+V+ RF+ G+    L  +   +I+  + L +R   
Sbjct: 264 LSYIGTMLFLIGSSILTIKTVSFWWIVMARFILGLASGSLIYVMLTIINKCI-LNKRFSR 322

Query: 208 QGLCNFIFGL-GTASGGLVGAAF-QDWRMAFTIQCPISLASCALIVSYLELPPRHEDDKD 265
             +  F   + G  S     A F   W+  + +    S  +  LI+ Y    P +E  K 
Sbjct: 323 PSMKIFTIPIVGGLSLAYATAIFITSWQNVYFLLAIFSFFTLFLIMFYF---PSNESYKT 379

Query: 266 RHWT----SKLRDLDWAGVVTLVCFLFLFMLVSSLGGKEIAYDSVLFALLCVTTLVLGSI 321
            +          D+D  G   L  FL L  ++++      +  S   A L ++ +++G +
Sbjct: 380 NNTNLSSIVATLDIDLIGCTILSVFLLLIAVITTGNSNGFSITSPYSATLVISIILVGIL 439

Query: 322 FAYVELYVAVDPVLPIAFLKYRSVLGSSLANWFAMMSMLTTNYYLPVYWASVLNMKPTDI 381
               E     +P++P+ F++ + +   SL  +FA MS++T  +Y P Y    LN+   DI
Sbjct: 440 LLLSETTTNKNPIIPLDFIENKVIFFKSLTVFFASMSLITFIHYFPFYLEKTLNISLFDI 499

Query: 382 GKRSIPSFFSVAFGSLGAGIYMKRTGKYYWFLLAFCGI-GILGQ-LKINLL---TPATPV 436
            KR+ P F ++ F  +     +       + L+ F GI G++GQ + +N +   T    +
Sbjct: 500 YKRTSPMFLTILFIIITVSRRISTQNTLSYGLVTFFGIMGLIGQCILLNYVYNDTADYKL 559

Query: 437 WQQYLLLVVPSFGLSVLITVTLLAMISAVPHEHHAATTSISYAFRSTGATLGVSIGAAIF 496
           W+Q ++ ++P  G + L+  TL+        +     ++ S+A  + G+ LG+ I   IF
Sbjct: 560 WKQCMIGILPILGSTFLVIATLM---DVTDDKKLPIISTSSFAVSTLGSILGICISGFIF 616

Query: 497 RSTLNTLLQNKVLQFASDEHPREELLR-IINNAAHSANWVHKEAPEFVRATLVECYHYAS 555
               N  L +++   +++E    +++R +INN+ + +      +  +    ++E Y   S
Sbjct: 617 ----NQGLYDELWVHSTEEKGLGKIIRKMINNSEYES------SSRYYCYEILESYFIVS 666

Query: 556 KSTFKFCLITMILAGAS-CSIIQEHTLH 582
              F F  I +++A  S C  I+    H
Sbjct: 667 GYVFLFSAICLLVAVISFCFTIKNKRHH 694

>Kwal_14.728 s14 complement(11659..13365) [1707 bp, 568 aa] {ON}
           YKR105C - Hypothetical ORF [contig 245] FULL
          Length = 568

 Score =  105 bits (261), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 110/453 (24%), Positives = 199/453 (43%), Gaps = 39/453 (8%)

Query: 92  IFLAALDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPLLV 151
           +F+ ALD  IV T++  +   F    K  WI T Y L ++    L+G++S  LG +  +V
Sbjct: 53  MFVTALDVLIVGTIIDTVCKSFGDYTKSGWIVTGYSLPNALFSLLWGRISANLGPRISIV 112

Query: 152 FSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQGLC 211
              V+F  G LI  ++ S+  ++ GR VSG+GG GL  L+ ++   LV  + R +   L 
Sbjct: 113 ACIVLFEAGSLISALARSMNMLIAGRVVSGVGGSGLQTLSLVIGCQLVDEKSRPLVLSLL 172

Query: 212 NFIFGLGTASGGLVGAAFQ---DWRMAFTIQCPISLASCALIVSYLELPPRHEDDKDRHW 268
           N  F + +  G  +G AF     WR  F I  PI     A++       P +E+  +   
Sbjct: 173 NCTFAIASIIGPFIGGAFTTHVTWRWCFYINLPI--GGVAILTFLCFYNPHNENLLEEGK 230

Query: 269 TSKLRDLDWA-----------------GVVTLVCFL---FLFMLVSSLGGKEIAYDS--V 306
            +  R L +                   +V+   F     LF+L  + GG+  ++DS  V
Sbjct: 231 KAFKRVLKFKPTSLFSSKAMHQLLFGFDIVSFALFTAGWVLFLLALTFGGQSYSWDSGVV 290

Query: 307 LFALLCVTTLVLGSIFAYVELYVA------VDPVLPIAFLKYRSVLGSSLANWFAMMSML 360
           +  L+    L+L S+F   +L+ A      + P+L    +   +++ S+ + +F+ ++  
Sbjct: 291 ISFLVVGILLILLSLFYDFKLFEAMKSQENIRPLLCWRLMSQPTIVLSNFSGFFSTVAYN 350

Query: 361 TTNYYLPVYWASVLNMKPTDIGKRSIPSFFSVAFGSLGAGIYMKRTGKYYWFLLAFCGIG 420
               Y   ++  V        G   IP   S    S+ +G+  K+TG     L+    +G
Sbjct: 351 VQMIYSVQFFQLVYGFTAWKAGLHLIPILVSTVVFSIMSGVLTKKTGHIKPLLVFGSAMG 410

Query: 421 ILGQLKINLLTPATPVWQQYLLLVVPSFGLSVLITVTLLAMISAVPHEHHA------ATT 474
           +LG   + LL   +    Q  +L++P   L  ++   L+A    +   +          T
Sbjct: 411 VLGGGLMTLLNNTSTKHTQIGVLILPGVALGFVLPSALIACHVQLDKSNSRYGADMLEVT 470

Query: 475 SISYAFRSTGATLGVSIGAAIFRSTLNTLLQNK 507
           S++   +S G TLG  +   IF +++   ++++
Sbjct: 471 SVNALLKSLGTTLGSILSTMIFSTSMYNKMKSR 503

>Kwal_26.9616 s26 (1294683..1296371) [1689 bp, 562 aa] {ON} YPR198W
           (SGE1) - Member of drug-resistance protein family
           [contig 363] FULL
          Length = 562

 Score =  104 bits (260), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 90/343 (26%), Positives = 146/343 (42%), Gaps = 40/343 (11%)

Query: 90  LGIFLAALDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPL 149
           L +FL ALD  I  TL   IG  FN    V W+ T Y L ++ C  L+G+++  +G K  
Sbjct: 15  LTLFLGALDIVICITLYDTIGKVFNDYANVGWLMTGYNLPNALCMLLWGRIASLVGLKNS 74

Query: 150 LVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQG 209
           LV S V+F  G L+  ++TS+  ++ GR ++G GG G+  L   V + +V  + RA    
Sbjct: 75  LVASIVIFEAGSLLAALATSMGMLIGGRVIAGFGGSGIETLVFAVGTRMVDEKHRARVVT 134

Query: 210 LCNFIFGLGTASGGLVGAAFQD---WRMAFTIQCPISLASCALIVSYLELPPRHEDDKDR 266
           +    + L   +G  +G AF +   WR  F I  PI   + A++        R   +   
Sbjct: 135 ILGIAYMLAEGAGPFIGGAFAEHVSWRWCFFINIPIGGVALAILCWGYNPAGRTPINALN 194

Query: 267 HWTSKLRDLDWAGV-----VTLVCFLFLF-----------------MLVSSLGGKEIAYD 304
           H+    R   W  V     +T V  LF++                 ML  + GG + A++
Sbjct: 195 HYWKSYRKCSWKKVFRLTSLTKVVKLFIYQLDIVGLLLSSGGFALIMLALTFGGNKFAWN 254

Query: 305 SVLFALLCVTTLVLGSIFAYVELYV-----------AVDPVLPIAFLKYRSVLGSSLANW 353
           S     +    + L  IF   +  V              P++P +      +L SS+A +
Sbjct: 255 SASIICMFTIGIALLGIFMLYDFVVLPYIGRRLENGEAMPLVPWSLACNMPILTSSMAGF 314

Query: 354 FAMMSMLTTNYYLPVYWASVLNMKPT----DIGKRSIPSFFSV 392
           F   +    + YL  Y+  V N  P      + + S+P+  +V
Sbjct: 315 FNSFAFELQSIYLVQYYQLVTNEGPVFASIHLWQMSVPALITV 357

>KLTH0C10120g Chr3 (839780..841735) [1956 bp, 651 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 651

 Score =  103 bits (256), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 127/476 (26%), Positives = 201/476 (42%), Gaps = 62/476 (13%)

Query: 95  AALDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPLLVFSN 154
           AALD  IV TL   IG +FN  + V W+ T Y LSS+    L+G+++  LG K  L+ S 
Sbjct: 56  AALDIVIVVTLYETIGEKFNDYNDVGWLVTGYSLSSALFTLLWGRMASLLGLKTCLMLSV 115

Query: 155 VVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQGLCNFI 214
           ++F IG LI  +S S+  ++ GR V+G GG G+  L  +V + LV  R R +   +  F 
Sbjct: 116 LIFEIGSLIAAVSNSMGMLIAGRVVAGAGGSGIQSLVYIVGTSLVSERSRGMVIMVLTFA 175

Query: 215 FGLGTASGGLVGAAFQD---WRMAFTIQCPISLASC-ALIVSY--------LELPPRHED 262
           F    A G ++G A  +   WR  F I  PI  A+   L + Y          L  + E 
Sbjct: 176 FVGSNAGGPILGGALNEHASWRWCFFINLPIGGAAAFMLFLCYNPSGKPLLSTLTSKLEA 235

Query: 263 DKDRHWTSKLRDLDWAGVVTLVCFLFL---FMLVSSL------------------GGKEI 301
            +D  +++      WA  + L  F F    F L S+                    G  I
Sbjct: 236 ARDYRYSNVCTRKFWAHALDLGVFRFDIIGFALSSAGFVLLLLGLTFGGRKYSWSSGTTI 295

Query: 302 AY---DSVLFALLCVTTLVLGSIFAYVELYVA-VDPVLPIAFLKYRSVLGSSLANWFAMM 357
           AY     VL  + C+   ++  + A    Y + V P++P   +    V  +S A++F   
Sbjct: 296 AYLTVGPVLIVVFCLYDFLVLPVLARSLAYSSEVTPLVPWPVISKPGVFATSFASFFNFF 355

Query: 358 SMLTTNYYLPVYWASVLNMKPTDIGKR----SIPSFFSVAFGSLGAGIYMKRTGKYYWFL 413
           +      YL  ++  V N  PT+        SIP+   +        I + R  K +  L
Sbjct: 356 AYNMQIIYLVQFYQVVHNESPTNASTHMWALSIPALVVI--------IVLGRINKKFGIL 407

Query: 414 --LAFCGI--GILGQLKINLLTPATPVWQQYLLLVVPSFGLSVLITVTLLAMISAVP--- 466
             +A  G   G +G   + LL  +T   Q     ++   G S ++  TLL+    V    
Sbjct: 408 KPVAVIGAACGTIGAGLLTLLKGSTTSGQSIGYCILAGAGFSAVMQSTLLSAQIQVDKTD 467

Query: 467 ---HEHHAATTSISYAFRSTGATLGVSIGAAIFRSTLNTLLQN---KVLQFASDEH 516
              ++     T+++  FR  G + G  +G  I+ ++L   L      +  FAS + 
Sbjct: 468 PKFNQKFIEITTLNNFFRVLGISFGGIMGTLIYSTSLKNELATAGPNIPSFASTDE 523

>YKR105C Chr11 complement(658716..660464) [1749 bp, 582 aa] {ON}
           VBA5Putative transporter of the Major Facilitator
           Superfamily (MFS); proposed role as a basic amino acid
           permease based on phylogeny
          Length = 582

 Score = 97.4 bits (241), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 110/460 (23%), Positives = 197/460 (42%), Gaps = 48/460 (10%)

Query: 92  IFLAALDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPLLV 151
           +F+ ALD  IV T++  +  +F +  K  W+ T Y L ++    ++G+ +  +G +  L+
Sbjct: 47  LFITALDILIVGTIIDVVAEQFGNYSKTGWLVTGYSLPNAILSLIWGRFASIIGFQHSLI 106

Query: 152 FSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQGLC 211
            + ++F  G LI  +++S+  ++ GR V+G+GG GL  L  ++   +V  R R +   + 
Sbjct: 107 LAILIFEAGSLIAALASSMNMLIFGRVVAGVGGSGLQTLCFVIGCTMVGERSRPLVISIL 166

Query: 212 NFIFGLGTASGGLVGAAFQ---DWRMAFTIQCPI-SLASCALIVSYLELPP--------- 258
           +  F +    G ++G AF     WR  F I  PI  LA    +++Y              
Sbjct: 167 SCAFAVAAIVGPIIGGAFTTHVTWRWCFYINLPIGGLAIIMFLLTYKAENKGILQQIKDA 226

Query: 259 ------------RHEDDKDRHWTSKLRDLDWAGVVTLVCFLFLFMLVSSLGGKEIAYDSV 306
                       RH+ +  R     +   D+ G       L LF+L  + GG + +++S 
Sbjct: 227 IGTISSFTFSKFRHQVNFKRLMNGIIFKFDFFGFALCSAGLVLFLLGLTFGGNKYSWNSG 286

Query: 307 LFALLCVTTLVLGS---IFAYVELYVAVDPVLPIA-FLKYRSVLGSSLANWFAMMS---- 358
                 +T LVLG    IF+ V  +   D   P    + YR +L   L    A++     
Sbjct: 287 ----QVITYLVLGVLLFIFSLVYDFFLFDKFNPEPDNISYRPLLLRRLVAKPAIIIVNMV 342

Query: 359 --MLTTNY-----YLPVYWASVLNMKPTDIGKRSIPSFFSVAFGSLGAGIYMKRTGKYYW 411
             +L T Y     Y   ++  +        G   IP   +    ++ +G+  K+ G    
Sbjct: 343 TFLLCTGYNGQMIYSVQFFQLIFASSAWKAGLHLIPIVITNVIAAIASGVITKKLGLVKP 402

Query: 412 FLLAFCGI-GILGQLKINLLTPATPVWQQYLLLVVPSFGLSVLITVTLL-AMISAVPHEH 469
            LL F G+ G++G   + L+T  +    Q  +L++P F L   +  +L+ A +       
Sbjct: 403 -LLIFGGVLGVIGAGLMTLMTNTSTKSTQIGVLLLPGFSLGFALQASLMSAQLQITKDRP 461

Query: 470 HAATTSISY-AFRSTGATLGVSIGAAIFRSTLNTLLQNKV 508
            AA   I   AF +   +LG ++G  +  +  +    NKV
Sbjct: 462 EAAMDFIEVTAFNTFMKSLGTTLGGVLSTTVFSASFHNKV 501

>Smik_16.81 Chr16 complement(152022..153515,153516..153899) [1878
           bp, 625 aa] {ON} YGR224W (REAL)
          Length = 625

 Score = 96.7 bits (239), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 63/220 (28%), Positives = 110/220 (50%), Gaps = 14/220 (6%)

Query: 30  ANEVEQQDYNSRTGHDSYGATAVDDRTA-TSARCDLTFPPSETPEFALXXXXXXXXXXXX 88
           + E +QQ       H+     AVD + A TS+  D T  P +  +  +            
Sbjct: 12  SKEAKQQ-------HEQKRQFAVDQKFAHTSSEHDETSIPEDNVKKNVELSKGSILYVSL 64

Query: 89  F---LGIFLAALDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQLG 145
               L +FLAALD  IVST++  +  +  S  ++ W+ T Y L ++    ++G+++  +G
Sbjct: 65  VAVALSLFLAALDVMIVSTIIEEVAKQLGSYSEIGWLFTGYSLPNALLVLIWGRIATPIG 124

Query: 146 RKPLLVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERA 205
            K  ++F+ V+F IG LI  +++S+  ++ GR ++GIGGCG+  L+ ++ S LV   +R 
Sbjct: 125 FKATMLFAIVIFEIGSLISALASSMNMLIGGRVIAGIGGCGIQSLSFVIGSTLVEESKRG 184

Query: 206 VYQGLCNFIFGLGTASGGLVGAAFQD---WRMAFTIQCPI 242
           +   + +  F + +  G  +G  F     WR  F I  PI
Sbjct: 185 MLIAILSSSFAIASVVGPFLGGVFTSSVTWRWCFYINLPI 224

>KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 573

 Score = 96.3 bits (238), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 88/318 (27%), Positives = 134/318 (42%), Gaps = 36/318 (11%)

Query: 98  DGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPLLVFSNVVF 157
           D  IV TL   IG +F    ++ W+ T Y L ++    L+G+L+  LG K  L FS V+F
Sbjct: 23  DIVIVITLYETIGEKFKDYARIGWLVTGYALPNALFTLLWGRLASILGLKTSLTFSIVIF 82

Query: 158 SIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQGLCNFIFGL 217
            IG LI  +S S+  ++ GR V+G GG G+  L  +V + LV  R R +   +    F +
Sbjct: 83  EIGSLIVAVSNSMGMIIGGRVVAGCGGSGIQSLVFVVGTSLVEERNRGMVITVLGLAFAV 142

Query: 218 GTASGGLVGAAFQD---WRMAFTIQCPI-SLASCALIVSYLELPPRHEDD---------- 263
             A G ++G AF +   WR  F I  PI  +A   L  SY       ++           
Sbjct: 143 AFAVGPVIGGAFTENVSWRWCFYINLPIGGVALTMLTFSYNTTEKSVQETLTYNCRQLQT 202

Query: 264 -KDRHWTSK----------LRDLDWAGVVTLVCFLFLFMLVSSLGGKEIAYDS---VLFA 309
            +   W +           + DLD+ G         LFML  + GG   A++S   + F 
Sbjct: 203 YRYGQWVTASFWRRAYNFLMFDLDFIGFALSSTGFVLFMLGLTFGGNTYAWNSGTIISFL 262

Query: 310 LLCVTTLVLGSIFAYVELYV--------AVDPVLPIAFLKYRSVLGSSLANWFAMMSMLT 361
            +    ++   +F +V LY            P+L  +      +  SS+AN F       
Sbjct: 263 TVGAILVLFWLVFDFVLLYKWAAWCRKREATPLLRRSLCFRPGIFTSSIANLFTCFGFNM 322

Query: 362 TNYYLPVYWASVLNMKPT 379
              Y+   +  V N  PT
Sbjct: 323 QTVYIVQLYQLVFNSGPT 340

>Skud_7.560 Chr7 (917668..919596) [1929 bp, 642 aa] {ON} YGR224W
           (REAL)
          Length = 642

 Score = 95.5 bits (236), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 95/462 (20%), Positives = 192/462 (41%), Gaps = 52/462 (11%)

Query: 98  DGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPLLVFSNVVF 157
           D  IVST++  +  +F S  ++ W+ T Y L ++    ++G+++  +G K  ++F+ V+F
Sbjct: 92  DTMIVSTIIEEVAKQFGSYSEIGWLFTGYSLPNALLALIWGRIATPIGFKRTMLFAIVIF 151

Query: 158 SIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQGLCNFIFGL 217
            +G LI  ++ S+  ++ GR ++G+GGCG+  L+ ++ S+LV    R V   + +  F +
Sbjct: 152 EVGSLISALANSMNVLIGGRVIAGVGGCGIQSLSFVIGSNLVEESNRGVLIAILSCSFAI 211

Query: 218 GTASGGLVGAAFQD---WRMAFTIQCPISLASCALIVSYLELPPRHEDDKDR-------- 266
            +  G  +G  F     WR  F I  PI   +  L + +    P    +  R        
Sbjct: 212 ASVVGPFLGGVFTSRVTWRWCFYINLPIGGLTFFLFLMFCNPDPHTFQETVRNILRIPSQ 271

Query: 267 ---------HWTSKLRDL----DWAGVVTLVCFLF-------------LFMLVSSLGGKE 300
                    H  SK+++L     W  ++T + F++               +L  + GG  
Sbjct: 272 LIEFVRKVGHHLSKVKELGKRTSWKILLTELVFMYDIIEFVLCTAGFTSILLAFTFGGNR 331

Query: 301 IAYDSVLFALLCVTTLVLGSIFAYVELYV-----------AVDPVLPIAFLKYRSVLGSS 349
            A+DS    +L V  ++L  + A  + +V              P++    +K   +   +
Sbjct: 332 YAWDSAEIIVLFVIGVILVILAAVYDFFVFPKFDVVKTAPRYQPLMSWRNIKRPGIFTVN 391

Query: 350 LANWFAMMSMLTTNYYLPVYWASVLNMKPTDIGKRSIPSFFSVAFGSLGAGIYMKRTGKY 409
           +A +      ++   Y+  Y+  + N          +         S+  G+   +T + 
Sbjct: 392 IALFLLCTGYISQFTYIVQYFQLIYNDSAWKAAVHLVACIIPTVITSVVCGVITDKTRQI 451

Query: 410 YWFLLAFCGIGILGQLKINLLTPATPVWQQYLLLVVPSFGLSVLITVTLLAMISAVPHEH 469
              ++    +G++G   + LL  +        LL++P      L+  ++LA    +  E 
Sbjct: 452 KPIIVISSILGVVGAGLLTLLNNSASNSAHIGLLILPGIAFGGLMQSSMLASQIQLDKES 511

Query: 470 ---HAATTSISYAFRSTGATLGVSIGAAIFRSTLNTLLQNKV 508
              H+   SI+  F +    LG ++G  I  +  +    NK+
Sbjct: 512 PTFHSDFVSIT-TFSTFSKNLGQALGGVISNTVFSAAAVNKL 552

>TDEL0G03260 Chr7 (605429..607267) [1839 bp, 612 aa] {ON} 
          Length = 612

 Score = 95.1 bits (235), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 112/468 (23%), Positives = 196/468 (41%), Gaps = 51/468 (10%)

Query: 90  LGIFLAALDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPL 149
           L IFLAALD  IVST++  +  EF    K  WI   Y L S+    ++G+++   G K  
Sbjct: 63  LSIFLAALDIMIVSTIIENVAREFGDYSKTGWIYAGYSLPSALLTLIWGRIAAVCGFKSS 122

Query: 150 LVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQG 209
           ++ + ++F +G L+  ++ S+  ++ GR ++G+GG G+  L  ++IS LV   +R +   
Sbjct: 123 MLTAIIIFEVGSLVAALANSMDMLIGGRVIAGLGGSGIQTLCFVIISTLVEESKRGLLIA 182

Query: 210 LCNFIFGLGTASGGLVGAAFQ---DWRMAFTIQCPISLASCALIVSYLELPPRHEDD--- 263
                FG+ +  G  +G AF     WR  F I  PI   + A  + +    P   D    
Sbjct: 183 CMGSAFGIASVVGPFLGGAFTTHVTWRWCFWINLPIGGLAFAFFILFYN--PHGSDQTFV 240

Query: 264 --------KDRHW---TSKLRDLD-WAGVVTLVCFLF-------------LFMLVSSLGG 298
                   +   W   + KL  L  W  +V  + + F             L +L  S GG
Sbjct: 241 GYVTDFFKQVGGWLKNSGKLLKLSTWRMIVHELIYKFDIIEFALCTTGLVLILLALSFGG 300

Query: 299 KEIAYDS----VLFAL-LCVTTLVLGSIFA-YVELYVAVD-----PVLPIAFLKYRSVLG 347
            + A++S     +F + + VT L L   FA +  L V  +     P++P+   K   +  
Sbjct: 301 NKYAWNSGSTIAMFVIGILVTILALVYDFAIFPRLKVVRENPRYQPLIPLRVAKKFFICV 360

Query: 348 SSLANWFAMMSMLTTNYYLPVYWASVLNMKPTDIGKRSIPSFFSVAFGSLGAGIYMKRTG 407
           +++A +F  M+ +    Y+  ++  + N          I          + +GI   + G
Sbjct: 361 NNIAVFFVCMAFMAQVNYIIQFFQLIYNETAWKASIHVIACVVPTVITVITSGILNSKFG 420

Query: 408 KYYWFLLAFCGIGILGQLKINLLTPATPVWQQYLLLVVPSFGLSVLITVTLL-AMISAVP 466
                 +      I+G   + LLT  +   +   LL++P       +  TL+ + I    
Sbjct: 421 IVKPINVLGITAAIVGAGLLTLLTNKSTNSEHIGLLILPGVAFGATMQSTLIGSQIQLDK 480

Query: 467 HEHH-----AATTSISYAFRSTGATLGVSIGAAIF-RSTLNTLLQNKV 508
              H      A T+++   ++ G   G  +   +F  S LN L QN +
Sbjct: 481 KSTHYRMDFIAVTTMNNFLKNLGQAFGGVLCNTVFTTSILNKLKQNDI 528

>SAKL0A00726g Chr1 (82164..83960) [1797 bp, 598 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 598

 Score = 94.7 bits (234), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 77/272 (28%), Positives = 131/272 (48%), Gaps = 30/272 (11%)

Query: 90  LGIFLAALDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPL 149
           L +FL+ALD  IVST++  +  +FN   K  W+ T Y L ++    ++G+ +  +G K  
Sbjct: 51  LALFLSALDILIVSTIIETVSRDFNEYSKSGWLVTGYSLPTALLSLVWGRAASIIGFKSS 110

Query: 150 LVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQG 209
           ++ S ++F +G L+  ++ S+  ++ GR +SG+GG GL  L  ++IS LV  R R +   
Sbjct: 111 MLLSIIIFEVGSLVSALANSMNMLIGGRVISGVGGSGLQTLCFLIISTLVNERSRGMAIS 170

Query: 210 LCNFIFGLGTASGGLVGAAFQ---DWRMAFTIQCPISLASCALIVSYLELPPRHEDDKDR 266
           + +  F + +  G  +G AF     WR  F I  PI     A +V  L   P +  +  +
Sbjct: 171 VLSCSFAVASIVGPFLGGAFTTHVTWRWCFYINLPI--GGLAFLVFVLSYNP-NGGNSIK 227

Query: 267 HWTSKLRDL---DWAGVVTLVCFLFLFMLVSSLGGKEIAYDSVLFAL----LCVTTLVLG 319
           ++T  +R +   D+ G++    +   F  +         +D V FAL     C+  ++LG
Sbjct: 228 NFTKAVRSISHVDFGGLLKAKSYYNTFEKLV------FKFDFVGFALCSAGFCL--ILLG 279

Query: 320 SIFAYVEL---------YVAVDPVLPIAFLKY 342
             F   E          Y+ +  VL IAF  Y
Sbjct: 280 LTFGGNEYSWGSGTIIAYLVIGIVLSIAFFLY 311

>YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasma
           membrane multidrug transporter of the major facilitator
           superfamily, acts as an extrusion permease; partial
           multicopy suppressor of gal11 mutations
          Length = 543

 Score = 92.8 bits (229), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 119/495 (24%), Positives = 195/495 (39%), Gaps = 70/495 (14%)

Query: 98  DGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPLLVFSNVVF 157
           D  IV TL   IG +F+    + W+ T Y LS++    L+G+L++ LG K  L+ S +VF
Sbjct: 24  DIVIVVTLYDTIGIKFHDFGNIGWLVTGYALSNAVFMLLWGRLAEILGTKECLMISVIVF 83

Query: 158 SIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQGLCNFIFGL 217
            IG LI  +S S+  ++ GR V+G GG G+  LA +V + +V    R +        + +
Sbjct: 84  EIGSLISALSNSMATLISGRVVAGFGGSGIESLAFVVGTSIVRENHRGIMITALAISYVI 143

Query: 218 GTASGGLVGAAFQD---WRMAFTIQCPISLASCALIVSY----------LELPPR----- 259
               G  +G AF +   WR  F I  PI  A   +I+++          + LP +     
Sbjct: 144 AEGVGPFIGGAFNEHLSWRWCFYINLPIG-AFAFIILAFCNTSGEPHQKMWLPSKIKKIM 202

Query: 260 ----HEDDKDRHWTSKLR----DLDWAGVVTLVCFLFLFMLVSSLGGKEIAYDS------ 305
                E  K   W +        LD  G++       L ML  S GG    ++S      
Sbjct: 203 NYDYGELLKASFWKNTFEVLVFKLDMVGIILSSAGFTLLMLGLSFGGNNFPWNSGIIICF 262

Query: 306 -----VLFALLCVTTLVLGSIFAYVELYVAVDPVLPIAFLKYRSVLGSSLANWFAMMSML 360
                +L  L C       S+         + P+L         +  SS+  + +  +  
Sbjct: 263 FTVGPILLLLFCAYDFHFLSLSGLHYDNKRIKPLLTWNIASNCGIFTSSITGFLSCFAYE 322

Query: 361 TTNYYLPVYWASVLNMKPT----DIGKRSIPSFF-SVAFGSLGAGIYMKRTGKYYWFLLA 415
             + YL   +  V   KPT     + + SIP+   ++A   L +   + +    +  L  
Sbjct: 323 LQSAYLVQLYQLVFKKKPTLASIHLWELSIPAMIATMAIAYLNSKYGIIKPAIVFGVLCG 382

Query: 416 FCGIGILGQLKINLLTPATPVWQQYLLLVVPSFGLSVLITVTLLA----MISAVP--HEH 469
             G G+   +   L        Q     ++P      +   TLL+    + S  P     
Sbjct: 383 IVGSGLFTLINGELS-------QSIGYSILPGIAFGSIFQATLLSSQVQITSDDPDFQNK 435

Query: 470 HAATTSISYAFRSTGATLGVSIGAAIFRSTLNTLLQNKVL---QFA--------SDEH-- 516
               T+ +   +S G   G ++GA IF ++L   +++  L   QF         S EH  
Sbjct: 436 FIEVTAFNSFAKSLGFAFGGNMGAMIFTASLKNQMRSSQLNIPQFTSVETLLAYSTEHYD 495

Query: 517 -PREELLRIINNAAH 530
            P+  L + IN A H
Sbjct: 496 GPQSSLSKFINTAIH 510

>KNAG0K01020 Chr11 complement(198213..200012) [1800 bp, 599 aa] {ON}
           
          Length = 599

 Score = 92.8 bits (229), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 104/473 (21%), Positives = 200/473 (42%), Gaps = 45/473 (9%)

Query: 98  DGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLS-DQLGRKPLLVFSNVV 156
           D  IV+T++  +G+ F++  K  WI   Y L ++    L+G+++   LG K  ++ + V+
Sbjct: 74  DIMIVTTIINDVGAHFDAYAKTGWIIAGYSLPNALMSLLWGRIAFSFLGFKTAMLSAIVI 133

Query: 157 FSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQGLCNFIFG 216
           F IG LIC ++ S+  ++ GR ++GIGG G+  L+ ++ S LV  R R       +  FG
Sbjct: 134 FEIGSLICALANSMDMLIGGRVIAGIGGSGIQSLSFVIGSTLVSPRGRGFIIAFMSASFG 193

Query: 217 LGTASGGLVGAAFQD---WRMAFTIQCPISLASCALIVSYLELPPRHED-----DKDRHW 268
           + +  G  +G AF     WR  F I  P+  A   +I +++  P   +         +  
Sbjct: 194 IASVIGPFIGGAFTSHVTWRWCFWINLPVG-AVALVIFTWVYNPTGKKQVLLTIHDLKEL 252

Query: 269 TSKLRDLDWAGVVTLVCF---LFLFMLVS----------SLGGKEIAYDS----VLFAL- 310
           + K++ + +  ++  + F   +  FML+S          + GG    + S    +LF + 
Sbjct: 253 SEKVKKVRFKDLLKHLLFKLDIIEFMLISAGIVCILLAFTFGGNRFKWGSYSIILLFVIG 312

Query: 311 --LCVTTLVLG-SIFAYVEL----YVAVDPVLPIAFLKYRSVLGSSLANWFAMMSMLTTN 363
             L +  LV    IF  +++    Y+   P++    L+ R +  +S+  +F  +  ++  
Sbjct: 313 GCLVIVALVYDFVIFPNLQIVKANYIQYQPLISWKNLRIRGIFTASMTTFFFCIGYMSQT 372

Query: 364 YYLPVYWASVLNMKPTDIGKRSIPSFFSVAFGSLGAGIYMKRTGKYYWFLLAFCGIGILG 423
            Y   ++  + N  P       I         ++  G    + G      +A   + ++G
Sbjct: 373 VYYVQFFQLIYNSSPWKASIHLIAVMIPTVLTAVVCGFLNGKFGYVKPITVAGMCLAVIG 432

Query: 424 QLKINLLTPATPVWQQYLLLVVPSFGLSVLITVTLLA------MISAVPHEHHAATTSIS 477
              + LL   +   Q   LL++P          T++A        S        A T+++
Sbjct: 433 AGLLTLLDNHSNSAQHIGLLILPGVAFGACNQCTMMAAQIELDKKSPTFKSDFVAVTTLN 492

Query: 478 YAFRSTGATLGVSIGAAIFRSTLNTLLQNKVLQFASDEHPREELLRIINNAAH 530
              ++ G  +G  I A++F       + NK+ + +     R     II  A H
Sbjct: 493 SFLKNCGQAVGSIISASVFGGA----VMNKIGKSSYHSEIRSVDDLIIYRAEH 541

>Smik_17.11 Chr17 complement(8582..10216) [1635 bp, 544 aa] {ON}
           YPR198W (REAL)
          Length = 544

 Score = 91.7 bits (226), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 126/505 (24%), Positives = 203/505 (40%), Gaps = 87/505 (17%)

Query: 98  DGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPLLVFSNVVF 157
           D  IV TL   IG +F+    + W+ T Y LS++    L+G+L++ LG    L+ S V+F
Sbjct: 24  DIVIVVTLYDTIGIKFHDFGNIGWLVTGYALSNAVFMLLWGRLAEILGTTECLMISVVIF 83

Query: 158 SIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQGLCNFIFGL 217
            IG LI  +S ++  ++ GR ++G GG G+  LA +V + +V    R +        + +
Sbjct: 84  EIGSLISALSNTMGTLIGGRVIAGFGGSGIESLAFVVGTSIVQENYRGIMITALAVSYVI 143

Query: 218 GTASGGLVGAAFQD---WRMAFTIQCP------ISLASCAL-----------------IV 251
               G  +G AF +   WR  F I  P      ISLA C                   I 
Sbjct: 144 AEGVGPFIGGAFNEHLSWRWCFYINLPIGAFAFISLAFCCASGGKWLSKKWLLSKINSIT 203

Query: 252 SYLELPPRHEDDKDRHWTSKLR----DLDWAGVVTLVCFLFLFMLVSSLGGKEIAYDSVL 307
           SY      +E  K   W    +     LD  G++       L ML  S GG   A++S  
Sbjct: 204 SY----KYYEIFKASFWKKVFQILVFKLDMIGIILSSAGFTLLMLGLSFGGNNFAWNSS- 258

Query: 308 FALLCVTTLVLGSIFAYVELYVAVD-PVLPIAFLKYRS----------------VLGSSL 350
              + ++   LG I   + L+ A D  +LP+  + Y+S                +  SS+
Sbjct: 259 ---IIISFFTLGPIL--LILFCAYDFHILPLLGVHYKSKYARPLLTWKIASNAGIFTSSI 313

Query: 351 ANWFAMMSMLTTNYYLPVYWASVLN----MKPTDIGKRSIPSFF-SVAFGSLGAGIYMKR 405
             +F+  +    + YL   +  VL     +    + + SIP+   ++A   L A   + +
Sbjct: 314 TGFFSCFAYELQSAYLVQLYQLVLKRNSMLASIHLWELSIPAMITTMATAYLNAKYGIIK 373

Query: 406 TGKYYWFLLAFCGIGILGQLKINLLTPATPVWQQYLLLVVPSFGLSVLITVTLLAMISAV 465
               +  L    G GI       L+         Y LL   +FG S+     L + +   
Sbjct: 374 PAIVFGVLCGIVGSGIF-----TLINGEISQSIGYSLLPGIAFG-SIFQATLLSSQVQIT 427

Query: 466 P-----HEHHAATTSISYAFRSTGATLGVSIGAAIFRSTLNTLLQN---KVLQFASDE-- 515
           P            T+ +   +S G + G +IGA IF ++L   L++    + QF S E  
Sbjct: 428 PDDPDFQNKFIEVTAFNSFAKSLGFSFGGNIGAMIFTASLKNQLRSSNANLPQFTSIETL 487

Query: 516 ---------HPREELLRIINNAAHS 531
                     P+  L + IN A H+
Sbjct: 488 LAYRTENYDGPQSLLSQFINTAIHN 512

>KLLA0E09879g Chr5 complement(874102..875994) [1893 bp, 630 aa] {ON}
           similar to uniprot|P36172 Saccharomyces cerevisiae
           YKR105C Hypothetical ORF
          Length = 630

 Score = 90.5 bits (223), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 114/518 (22%), Positives = 217/518 (41%), Gaps = 46/518 (8%)

Query: 90  LGIFLAALDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPL 149
           L   + ALD  IV+T++  +        K  W+ T Y L +S    ++G+ +  LG +  
Sbjct: 83  LAQLIVALDVFIVNTVIDVVSKNLGGYAKSGWLITGYSLPNSLLSLIWGRATSLLGFQSS 142

Query: 150 LVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQG 209
           ++ S  +F +G ++   +TS+  +VVGR V+GIGG GL  ++ ++   LV  R R +   
Sbjct: 143 MLISIFIFEVGSIVSATATSMNNLVVGRVVAGIGGSGLQTVSMIIGCSLVEERNRTIVIA 202

Query: 210 LCNFIFGLGTASGGLVGAAFQD---WRMAFTIQCPIS---------------LASCALIV 251
           +    F + +  G  +G AF     WR  F I  P+                L+  A +V
Sbjct: 203 VIMSAFAVSSLIGPFIGGAFTTHATWRWCFWISLPVGGSAAFLFFFTYNPERLSITARLV 262

Query: 252 SYLELP---PRHEDDKDRHWTSKLRDL----DWAGVVTLVCFLFLFMLVSSLGGKEIAYD 304
             L+L    P  +      + + +R+L    D  G       + LF+L  + G ++ ++ 
Sbjct: 263 RCLKLVKAIPLKQFQYVETYKTIVRNLVFRFDLIGFTLNCTGICLFLLGLTFGSEDNSWK 322

Query: 305 SVLFALLCVT--TLVLGSIFAYVELYVAVDPVLPIAFLKYRSVLGSSLA--NWFAMMSML 360
                   V    LV+ S+     ++  ++P    A   YR ++  +L    +F + + +
Sbjct: 323 RAFVVCFLVIGGLLVVCSVVYDFYIFDRINP--EPANASYRPLMVRTLIGHKYFLLANTV 380

Query: 361 TTN---------YYLPVYWASVLNMKPTDIGKRSIPSFFSVAFGSLGAGIYMKRTGKYYW 411
           T            Y   ++  VL     + G   IP   +    ++  G + K+TG   +
Sbjct: 381 TCAAAVVFAGYMVYSVQFFQLVLGYTAWNAGLHLIPLVIASLLSAIFCGGFTKKTGHVKY 440

Query: 412 FLLAFCGIGILGQLKINLLTPATPVWQQYLLLVVPSFGLSVLITVTLLAMISAVPHEHHA 471
            ++A   + ++G     LL   +    Q  + ++P FGL   +   L++    +      
Sbjct: 441 VMIANIALLLIGSGVCTLLDNYSNNSMQIGVWILPGFGLGATLQCALISSQLQIDKNSPD 500

Query: 472 ATTSISY--AFRSTGATLGVSIGAAIFRSTLNTLLQNKVLQFASDEHPREELLRIINNAA 529
           A T +    AF S   +LG SIGA +  +T  + L  K+ +   + +  +++  ++    
Sbjct: 501 AKTELVEITAFNSFCKSLGSSIGAVLSTTTFISALWRKINKAKLEGYYGKKINELVKYRL 560

Query: 530 HSANWVHKEAPEFVRATLV----ECYHYASKSTFKFCL 563
            + +    EA E   A +      CY +++ + F  CL
Sbjct: 561 QNFDGKSTEAAEIFSAAVTYVFWMCYAFSALAFFCACL 598

>Skud_16.503 Chr16 (880571..882202) [1632 bp, 543 aa] {ON} YPR198W
           (REAL)
          Length = 543

 Score = 89.0 bits (219), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 121/501 (24%), Positives = 201/501 (40%), Gaps = 82/501 (16%)

Query: 98  DGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPLLVFSNVVF 157
           D  IV TL   IG +F+    + W+ T Y L+++    L+G+L++ LG    L+ S ++F
Sbjct: 24  DIVIVVTLYDTIGIKFHDFGNIGWLVTGYALTNAVFMLLWGRLAEILGTNECLMISVIIF 83

Query: 158 SIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQGLCNFIFGL 217
            +G LI  +S S+  ++ GR ++G GG G+  LA +V + +V    R          + +
Sbjct: 84  EVGSLISALSNSMGTLISGRLIAGFGGSGIESLAFVVGTSIVQENHRGTMITALATSYVI 143

Query: 218 GTASGGLVGAAFQD---WRMAFTIQCPI----------------SLASCALIVSYLELPP 258
               G  +G AF +   WR  F I  PI                SL   +L+     +  
Sbjct: 144 AEGVGPFIGGAFNEHLSWRWCFYINLPIGAFALIILAFCNTSGESLPKVSLLSKIKSIMS 203

Query: 259 RHEDD--KDRHWTSKLR----DLDWAGVVTLVCFLFLFMLVSSLGGKEIAYD-SVLFALL 311
              D+  K   W    +     LD  GV        L ML  S GG   A++ S + +L 
Sbjct: 204 YKYDEVFKASFWKKAFKVFVFKLDMIGVTLSSAGFTLLMLGLSFGGNNFAWNSSTIISLF 263

Query: 312 CVTTLVLGSIFAYVELYVAVD-PVLPIAFLKYRS----------------VLGSSLANWF 354
            V  ++L        L+ A D   LP+  L+Y +                +  SS+  +F
Sbjct: 264 TVGPILL-------ILFCAYDFHFLPLLGLRYENKRTKPLLTWSIASNSGIFTSSVTGFF 316

Query: 355 AMMSMLTTNYYLPVYWASVLNMKPT----DIGKRSIPSFF-SVAFGSLGAGIYMKRTGKY 409
           +  +    + YL   +  VL  KPT     + + SIP+   ++A   L A   + +    
Sbjct: 317 SCFAYELQSAYLVQLYQLVLKRKPTLASIHLWELSIPAIIATMAIAYLNAKYGIIKPAIV 376

Query: 410 YWFLLAFCGIGILGQLKINLLTPATPVWQQYLLLVVPSFGLSVLITVTLLAMISAVP--- 466
           +  L   C  GI+G     L+   +     Y +L  P      +   TLL+    +    
Sbjct: 377 FGVL---C--GIVGSGLFTLINGKSSQSIGYSIL--PGLAFGSIFQATLLSSQVQIKSDD 429

Query: 467 ---HEHHAATTSISYAFRSTGATLGVSIGAAIFRSTLNTLLQNKVL---QFAS------- 513
                     T+ +   +S G   G ++GA IF ++L   +++  L   +F S       
Sbjct: 430 PEFQNKFIEVTAFNSFAKSLGFAFGGNMGAMIFTASLKNQMRSSHLSLPEFTSVETLLAY 489

Query: 514 -DEH---PREELLRIINNAAH 530
             EH    +  L ++IN A H
Sbjct: 490 NTEHYDGSQSLLSQLINTAIH 510

>KLTH0D16962g Chr4 (1399514..1401229) [1716 bp, 571 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 571

 Score = 88.2 bits (217), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 115/463 (24%), Positives = 185/463 (39%), Gaps = 58/463 (12%)

Query: 92  IFLAALDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPLLV 151
           +FL ALD  I  TL   IG EFN    V W+   Y L ++    L+G+++  +G K  L+
Sbjct: 17  LFLGALDIVICITLYDTIGQEFNDYANVGWLMAGYNLPNALFMLLWGRIASLVGLKCSLM 76

Query: 152 FSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQGLC 211
            S V+F  G L+ G + S+  ++  R +SG GG G+  L   V + +V  + RA    + 
Sbjct: 77  ASIVIFEAGSLMAGAANSMGMLIGARVISGFGGSGIESLVYGVGTSIVEEKHRARVITVL 136

Query: 212 NFIFGLGTASGGLVGAAFQD---WRMAFTIQCPIS-LASCALIVSYLELPPRHEDDKDRH 267
              + L   +G  VG    +   WR  F +  PI  +A  AL   Y            R 
Sbjct: 137 GIAYMLAEGAGPFVGGGLAEHVSWRWCFYVNLPIGGVALAALGWGYNPAGRAPGRALARF 196

Query: 268 WTSK--------LRDLDWAGVVTLVCFLF-------------LFMLVSSLGGKEIAYDSV 306
           W           L+   W     L+ F               L ML  + GG + A+ S 
Sbjct: 197 WVRARAFPYGTLLQAQFWRRAAALMVFRLDIPGLALSSGGFALVMLALTFGGNQYAWRSA 256

Query: 307 LFALLCVTTLVLGSIFAYVELYVAVD-----------PVLPIAFLKYRSVLGSSLANWFA 355
               + V    L ++F   +  V              P++P        VL SSL  +F 
Sbjct: 257 TIVCMFVFGAALLALFMLYDFVVLPRVGARIAGYEPLPLVPWRLAANVPVLTSSLCGFFN 316

Query: 356 MMSMLTTNYYLPVYWASVLNMKPT----DIGKRSIPSFFSVAFGSLGAGIYMKRTGKYYW 411
             +    + YL  Y+  V+N  PT     + + S+P+  SV    + + +  +R G    
Sbjct: 317 CFAFELQSIYLVQYYQLVVNKGPTLASVHLWQMSLPALVSV----IASAVVNERFGVVKP 372

Query: 412 FLLAFCGIGILGQLKINLLTPATPVWQQ--YLLLVVPSFGLSVLITVTLLAMISAVPH-- 467
            +LA   +G +G   + L+   T + Q   + +L   SFG      V  L++ISA     
Sbjct: 373 LVLAGVVMGFVGSGLLTLVRSDTTLGQSIGFSVLAGASFG-----CVYQLSLISAQLQVE 427

Query: 468 ----EHHAATTSISYAFRSTGATLGVSIGAAIFRSTLNTLLQN 506
               + HA    ++ ++ +   TLG S    +  +     L+N
Sbjct: 428 RDDPDFHARFIEVT-SYNTFIKTLGFSFAGIVSTTVFTVSLKN 469

>SAKL0B12716g Chr2 (1101141..1103039) [1899 bp, 632 aa] {ON} similar
           to uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 632

 Score = 87.8 bits (216), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 118/492 (23%), Positives = 208/492 (42%), Gaps = 70/492 (14%)

Query: 92  IFLAALDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPLLV 151
           +FLAALD  I+S  +  I  +FN   K  WI + Y L  +    L+G+ +   G K  L+
Sbjct: 51  LFLAALDILIMSASIEVISEQFNDYSKSGWIVSGYSLPEALLTLLWGRFATIFGFKLSLL 110

Query: 152 FSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQGLC 211
            S ++F  G LI  +S S+  ++ GR V+GIGG G+  L  ++ S L   R R V   + 
Sbjct: 111 LSILIFETGSLISAVSNSMNVLIGGRVVAGIGGSGIQSLCFVIASTLTTERSRGVAISVL 170

Query: 212 NFIFGLGTASGGLVGAAFQ---DWRMAFTIQCPI-SLASCALIVSYLELPPRHEDDKDRH 267
           +  + +   +G  +G AF     WR  F I  PI SLA   L+++Y      HE +  R 
Sbjct: 171 SCAYAVAAVAGPFMGGAFTTHVTWRWCFYINLPIGSLAFAVLVLTY----KPHEGNSARS 226

Query: 268 WTSKLRDLDWAGVVTL--------------------------VCFLFLFMLVSSLGGKEI 301
             S L+     G   L                          V F+ LF+L  + GG + 
Sbjct: 227 IVSVLKSCCEFGTARLFSKDLYLKMFDELVFGFDFIGFIFCSVGFI-LFLLGLTFGGDKY 285

Query: 302 AYDS---VLFALLCVTTLV--------LGSIFAYVELYVAVDPVLPIAFLKYRSVLGSSL 350
           A+ S   +++ ++ VT  V        +   F  V    +  P++P + +    +  +  
Sbjct: 286 AWSSGAIIVYFIVGVTISVAFLLYDFMIFPKFGRVRKNASFRPLVPWSVVSRPGIATAVA 345

Query: 351 ANWFAMMSMLTTNYYLPVYWASVLNMKPTDIGKRS-------IPSFFSVAFGSLGAGIYM 403
           AN+   ++      Y+  ++  V   + +D  + S       IP   +VA     +G   
Sbjct: 346 ANFLMCVAYSAQVVYIIQFFQLV---RGSDAWRASIHVVALEIPDIITVAI----SGAIS 398

Query: 404 KRTGKYYWFLLAFCGI--GILGQLKINLLTPATPVWQQYLLLVVPSFGLSVLITVTLLAM 461
           + TG     +  F GI  G++G   + LL   +   +   LL++P      ++  +LL+ 
Sbjct: 399 RMTGHVKPII--FVGIIAGLVGAGLLTLLDNDSGSSKHIGLLILPGVAFGAMLQGSLLSC 456

Query: 462 ISAVPHEHHA------ATTSISYAFRSTGATLGVSIGAAIFRSTLNTLLQNKVLQFASDE 515
              +P +  +      +TT++     S G + G  +   +F ++L+  + +   +F S +
Sbjct: 457 QLQIPKDSASFMPDFVSTTTVHTFSISLGMSFGSVLATMVFGTSLHNKIASSGFEFLSTK 516

Query: 516 HPREELLRIINN 527
              E +   I N
Sbjct: 517 SVDELVSYRIQN 528

>CAGL0B02079g Chr2 complement(191736..193610) [1875 bp, 624 aa] {ON}
           similar to uniprot|P50080 Saccharomyces cerevisiae
           YGR224w AZR1 or uniprot|P36172 Saccharomyces cerevisiae
           YKR105c
          Length = 624

 Score = 87.0 bits (214), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 53/179 (29%), Positives = 95/179 (53%), Gaps = 4/179 (2%)

Query: 90  LGIFLAALDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPL 149
           L +FLAALD   VST++  +  +F    KV W+ T Y L ++    ++G+++  +G K  
Sbjct: 51  LCLFLAALDVMTVSTIIEEVSQKFGDYSKVGWLFTGYSLPNALLVLIWGRIATLVGFKTS 110

Query: 150 LVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQG 209
            + + V+F +G L+  ++ S+  ++ GR ++GIGG G+  L  ++ S LV  R R +   
Sbjct: 111 TLAAIVIFEVGSLVSALANSMDMLIGGRVIAGIGGSGVQSLVFVISSTLVEERNRGLIIA 170

Query: 210 LCNFIFGLGTASGGLVGAAFQ---DWRMAFTIQCPISLASCALIVSYLELPPRHEDDKD 265
           + +  FG+ +  G  +G AF     WR  F I  P+   +  L +++   P +   +KD
Sbjct: 171 VMSSSFGIASVVGPFLGGAFTTHVTWRWCFYINLPVGGLAFFLFLTFYN-PEKWVVNKD 228

>YGR224W Chr7 (942806..944647) [1842 bp, 613 aa] {ON}  AZR1Plasma
           membrane transporter of the major facilitator
           superfamily, involved in resistance to azole drugs such
           as ketoconazole and fluconazole
          Length = 613

 Score = 85.5 bits (210), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 43/148 (29%), Positives = 82/148 (55%), Gaps = 3/148 (2%)

Query: 98  DGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPLLVFSNVVF 157
           D  IVST++  +  +F S  ++ W+ T Y L ++    ++G+++  +G K  ++F+ V+F
Sbjct: 83  DIMIVSTIIEEVAKQFGSYSEIGWLFTGYSLPNALLALIWGRIATPIGFKETMLFAIVIF 142

Query: 158 SIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQGLCNFIFGL 217
            IG LI  ++ S+  ++ GR ++G+GGCG+  L+ ++ S LV   +R +   + +  F +
Sbjct: 143 EIGSLISALANSMSMLIGGRVIAGVGGCGIQSLSFVIGSTLVEESQRGILIAVLSCSFAI 202

Query: 218 GTASGGLVGAAFQD---WRMAFTIQCPI 242
            +  G  +G  F     WR  F +  PI
Sbjct: 203 ASVVGPFLGGVFTSSVTWRWCFYVNLPI 230

>NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {ON} 
          Length = 630

 Score = 84.3 bits (207), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 50/166 (30%), Positives = 87/166 (52%), Gaps = 4/166 (2%)

Query: 98  DGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPLLVFSNVVF 157
           D  IVST++  +  +F +  K  WI   Y L ++    L+G+++  +G K  ++ + ++F
Sbjct: 94  DIMIVSTIIEDVAKKFGAYSKTGWIFAGYSLPNALLALLWGRIASIIGFKSCMLAAIIIF 153

Query: 158 SIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQGLCNFIFGL 217
            IG LI G++ S+  ++ GR ++G+GG G+  LA ++ S+LV  R R +     +  F +
Sbjct: 154 EIGSLISGVANSMNMLIGGRVIAGVGGSGIQSLAFVIGSNLVDERRRGLIIACMSSAFAV 213

Query: 218 GTASGGLVGAAF---QDWRMAFTIQCPISLASCALIVSYLELPPRH 260
            +  G  +G AF     WR  F I  P+   + AL V +   P R 
Sbjct: 214 ASVIGPFLGGAFTTHATWRWCFYINLPVGGVAFALFVVFYN-PQRK 258

>SAKL0C05588g Chr3 (527748..529781) [2034 bp, 677 aa] {ON} similar
           to uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 677

 Score = 82.8 bits (203), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 51/156 (32%), Positives = 79/156 (50%), Gaps = 3/156 (1%)

Query: 90  LGIFLAALDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPL 149
           L +FLAALD  I+S  +  I  +F    K  WI + Y L+ +    L+G+ +  +G K  
Sbjct: 126 LVLFLAALDVLIISASIEVIAEQFKDYSKSGWIVSGYSLTEALLTLLWGRFATIIGFKSS 185

Query: 150 LVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQG 209
           L+ S ++F  G LI  +S S+  ++ GR V+GIGG G+  L  ++ S L P R R +   
Sbjct: 186 LLVSILIFEAGSLISAISNSMNMLIGGRVVAGIGGSGIQSLCFVIASTLTPDRSRVIIIS 245

Query: 210 LCNFIFGLGTASGGLVGAAFQ---DWRMAFTIQCPI 242
           + +  + +    G  +G A      WR  F I  PI
Sbjct: 246 VLSCSYAVAAVVGPFLGGALTTHVTWRWCFYINLPI 281

>KLLA0D19941g Chr4 complement(1698889..1700724) [1836 bp, 611 aa]
           {ON} similar to uniprot|P36172 Saccharomyces cerevisiae
           YKR105C Hypothetical ORF
          Length = 611

 Score = 82.8 bits (203), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 115/518 (22%), Positives = 203/518 (39%), Gaps = 54/518 (10%)

Query: 32  EVEQQDYNSRTGHDSYGATAVDDRTATSARCDLTFPPSETPEFA--LXXXXXXXXXXXXF 89
           + E+   NS  G  S  A    + TA +A  D   P          +             
Sbjct: 6   QQEESLNNSMDGPMSKNAIMQVEVTADNASIDANTPDHNDNSNVRLMSGLRLYVCVAALV 65

Query: 90  LGIFLAALDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPL 149
           L  F+ ALD  IV+T++  + +      K  W+   Y L +S    ++G+ +  LG +  
Sbjct: 66  LATFIFALDVFIVNTIIDSVSASLGGYSKSGWLIAGYSLPNSLFSLIWGRTASLLGFQAS 125

Query: 150 LVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQG 209
           +  S  +F +G ++   +TS+  ++VGR ++G+GG GL  L+ ++ S +V  + RA+   
Sbjct: 126 MTLSIFIFEVGSIVSASATSMDNLIVGRVIAGVGGSGLQTLSLVIGSSIVEEKNRAMIVS 185

Query: 210 LCNFIFGLGTASGGLVGAAFQD---WRMAFTIQCPISLASCALIVSYLELPPRHEDDKDR 266
           +    F   +  G  VG AF     WR  F I  PI   +  L   Y    P+      R
Sbjct: 186 IVMSAFAAASLIGPFVGGAFTTHVIWRWCFWINLPIGAVTALLF--YFTYNPKRLSAASR 243

Query: 267 HWTSKLRDLD------WAGVVTLVC----FLFLFMLVSSLGG---------------KEI 301
            +TS  + +        A   T  C     LF F +V    G               ++ 
Sbjct: 244 -FTSCFKSVKALSFEKLASWETYRCMGKNLLFRFDIVGFATGCAGVCLLLLGLTLGGEDD 302

Query: 302 AYDSVLFALLCVTTLVLGSIFAYVELYV-----------AVDPVLPIAFLKYRSVLGSSL 350
           ++ S +     +   +L  +    + Y+           +  P+L    L  R +L  +L
Sbjct: 303 SWKSAIVICFLIVGFLLSVLSVVYDFYIFDKINPEPSNLSFRPMLVKGLLNNRFILLPNL 362

Query: 351 ANWFAMMSMLTTNYYLPVYWASVLNMKPTDIGKRSIPSFFSVAFGSLGAGIYMKRTGKYY 410
               + ++      Y   ++  V+     + G   IP   +    ++  G  MK+TG+  
Sbjct: 363 VTCASAIAFSGYMLYSVQFFQLVMGSSAWNAGLHLIPLVIASIVSAIICGGIMKKTGQVK 422

Query: 411 WFLLAFCGIGILGQLKINLLTPATPVWQQYLLLVVPSFGLSVLITVTLLAMISAVPHEHH 470
             +++   I ++G     LL   +    Q  + ++P FGL   +   L++  S +  +  
Sbjct: 423 PLMISTVSILLIGGGVSTLLDNHSGNSMQIGVWILPGFGLGAALQCALIS--SQLQIDKE 480

Query: 471 AATTSISY----AFRSTGATLGVSIGA----AIFRSTL 500
           +  + I      AF S   +LG SIG     AIF S+L
Sbjct: 481 SPNSEIELVEVTAFNSFTKSLGSSIGGVLCTAIFTSSL 518

>SAKL0A08228g Chr1 complement(732518..734227) [1710 bp, 569 aa] {ON}
           similar to uniprot|P33335 Saccharomyces cerevisiae
           YPR198W SGE1 Member of drug-resistance protein family
           multicopy suppressor of gal11 null mutation
          Length = 569

 Score = 81.3 bits (199), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 52/168 (30%), Positives = 81/168 (48%), Gaps = 5/168 (2%)

Query: 98  DGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPLLVFSNVVF 157
           D  IV T+L  I  +FN+  K+ W+ T Y LS++    L+G+ +   G K  L+ S ++F
Sbjct: 36  DIIIVVTILNTIADKFNAYSKIGWLITGYSLSNALFTLLWGRFAVIFGSKTTLMVSIIIF 95

Query: 158 SIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQGLCNFIFGL 217
            IG L+  +S S+  ++ GR ++G G  G+  L   + + LV    R     L +  + +
Sbjct: 96  EIGSLVIAVSNSMDMIIGGRVIAGCGASGIQTLVFAIATSLVDEHTRGTIVTLLSLSYAV 155

Query: 218 GTASGGLVGAAFQD---WRMAFTIQCPISLASCALIVSYLELPPRHED 262
            +A G  +G A  +   WR  F I  PI     AL V YL   P    
Sbjct: 156 ASALGPYIGGALTEYVTWRWCFYINLPI--GGLALGVFYLSYNPAQRK 201

>KLTH0B00594g Chr2 (64332..66188) [1857 bp, 618 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 618

 Score = 81.3 bits (199), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 63/221 (28%), Positives = 106/221 (47%), Gaps = 10/221 (4%)

Query: 98  DGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPLLVFSNVVF 157
           D  IV T++  + ++FN      W+ T Y L ++    L+G+     G K  ++ S V+F
Sbjct: 91  DILIVGTIMETVAAKFNGYSMTGWLVTGYNLPNALLSLLWGRFGTVAGFKTSMLLSIVIF 150

Query: 158 SIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQGLCNFIFGL 217
            +G LI   +TS+  ++ GR +SGIGG G+  L  ++ S LV  R R     + +  F +
Sbjct: 151 EVGSLIAAAATSMTMLIGGRVISGIGGSGIQTLCFVITSTLVTDRTRGTAISILSCAFAV 210

Query: 218 GTASGGLVGAAFQ---DWRMAFTIQCPI-SLASCALIVSYLELPPRHED--DKDRHWTSK 271
            + +G  +G AF     WR  F I  PI  LA    + SY    P  E+  +  +    +
Sbjct: 211 ASVAGPFLGGAFATHVTWRWCFYINLPIGGLAFFFFLFSY---NPNGENTFENFKILLGR 267

Query: 272 LRDLDWAGVVTLVCFLFLF-MLVSSLGGKEIAYDSVLFALL 311
           ++ + ++ ++T+  +  LF  LV      E A  S  F L+
Sbjct: 268 IKRISYSQLLTVSFYRRLFRTLVFKFDFFEFALSSAGFTLV 308

>SAKL0F00198g Chr6 complement(10713..12326) [1614 bp, 537 aa] {ON}
           similar to uniprot|P36172 Saccharomyces cerevisiae
           YKR105C Hypothetical ORF
          Length = 537

 Score = 80.9 bits (198), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 60/187 (32%), Positives = 92/187 (49%), Gaps = 8/187 (4%)

Query: 92  IFLAALDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPLLV 151
           +FLAALD  I+S  +  I  +FN   K  WI + Y L  +    L+G+ +   G K  L+
Sbjct: 51  LFLAALDILIMSASIEVISEQFNDYSKSGWIVSGYSLPEALLTLLWGRFATIFGFKLSLL 110

Query: 152 FSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQGLC 211
            S ++F  G LI  +S S+  ++ GR V+GIGG G+  L  ++ S L   R R V   + 
Sbjct: 111 LSILIFETGSLISAVSNSMNVLIGGRVVAGIGGSGIQSLCFVIASTLTTERSRGVAISVL 170

Query: 212 NFIFGLGTASGGLVGAAFQ---DWRMAFTIQCPI-SLASCALIVSYLELPPRHEDDKDRH 267
           +  + +   +   +G+AF     WR  F I  PI  LA   L+++Y      HE +  R 
Sbjct: 171 SCAYAVAAVASPFMGSAFTTHVTWRWCFYINLPIGGLAFAVLVLTY----KPHEGNSARS 226

Query: 268 WTSKLRD 274
             S L+ 
Sbjct: 227 IVSVLKS 233

>Skud_6.14 Chr6 complement(19547..21457) [1911 bp, 636 aa] {ON}
           YEL065W (REAL)
          Length = 636

 Score = 77.4 bits (189), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 113/468 (24%), Positives = 194/468 (41%), Gaps = 62/468 (13%)

Query: 89  FLGIFLAALDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKP 148
           FL   +AALD T          S FN    +S +  +  +  + C+P   K+SD L  +P
Sbjct: 85  FLTSAVAALDATTTYNYQPYATSSFNRHSMLSTLTIANSVIGAVCKPFIAKISD-LSSRP 143

Query: 149 LLVFSNVV-FSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVY 207
           +  F  ++ + IG +I   S +I   VVG     IG  G++ +  ++I+D   L+ R+ +
Sbjct: 144 VTYFVVLLLYVIGFVITACSPTIAAYVVGSVFIAIGQSGISLMNMVIIADTTTLKWRSFF 203

Query: 208 QGLCNFIFGLGTASGGLVGAAF--QDWRMA---FTIQCPISLASCALIVSYLE------- 255
             L +  + + T   G +       +WR     F I  P++L    L+++YLE       
Sbjct: 204 TSLLSVPYLVTTWISGYIVEDIINSNWRWGYGMFAIITPVALTPAILVMAYLEHQANKTG 263

Query: 256 ---------------LPPRHEDDKDRHW---TSKLRDLDWAGVVTLVCFLFLFMLVSSL- 296
                          +   H      +W      L ++D  G++ L     L +L  SL 
Sbjct: 264 EIPVGSDPLSKKRIEVTESHVSGFREYWELVKVSLIEIDAFGLILLGFAFSLILLPCSLY 323

Query: 297 ----GGKEIAYDSVLFALLCVTTLVLGSIFAYVELYVAVDPVLPIAFLKYRSVLGSSLAN 352
               GG     +  + A+  V  + L S +   E++ A  P+LP   L  R+ +   + +
Sbjct: 324 SYAEGGWN---NPSMIAMEVVGGIFLIS-YVVFEVFFAPFPLLPKRVLMNRTFICCVIID 379

Query: 353 WFAMMSMLTTNYYLPVYWASVLNMKPTDIGKRSIPS-----FFSVAFGSLGAGIYMKRTG 407
           +   M+   +  +   Y   VLN+   +    S  +     FF V +G+L  G +  +  
Sbjct: 380 FIYQMAGYFSLLFFTSYTFVVLNLSYRNWVYLSNTTTMGLCFFGVVWGALFRGFHRYKIF 439

Query: 408 KYYWFLLAFCGIGIL-------GQLKINLLTPATPVWQQYLLLVVPSFGLSVLITVTLLA 460
           +     +   G+G+        G   I L+  A         LVV +FG +  +  T +A
Sbjct: 440 QVVGIAIKLIGMGLYVTCSKKEGSPGIGLVVAA---------LVVTNFGDAANVMGTQVA 490

Query: 461 MISAVPHEHHAATTSISYAFRSTGATLGVSIGAAIFRSTLNTLLQNKV 508
             +AVPH+  AAT S+   + S GA +G +I +AI+   L   L   V
Sbjct: 491 AQAAVPHQDMAATISVLSLYSSIGAAVGTAITSAIWTDRLPGALSKYV 538

>Smik_6.22 Chr6 complement(31536..33446) [1911 bp, 636 aa] {ON}
           YEL065W (REAL)
          Length = 636

 Score = 76.6 bits (187), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 111/460 (24%), Positives = 198/460 (43%), Gaps = 62/460 (13%)

Query: 89  FLGIFLAALDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKP 148
           FL  ++AALD T          S FN    +S +  +  +  + C+P   K+SD L  +P
Sbjct: 85  FLTSWVAALDATTTYNYQPYATSSFNRHSMLSTLTIANSVIGAVCKPFIAKISD-LSSRP 143

Query: 149 LLVFSN-VVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVY 207
           +  F   +++ IG +I   S +I   V+G     +G  G++ +  ++I+D   L+ R+ +
Sbjct: 144 VTYFVVLLLYVIGFVITACSPNISAYVIGSVFIAVGQSGISLMNMVIIADTTTLKWRSFF 203

Query: 208 QGLCNFIFGLGTASGGLVGAAF--QDWRMA---FTIQCPISLASCALIVSYL-------- 254
             L +  + + T   G +       +WR     F I  P++L    L+++YL        
Sbjct: 204 TSLLSVPYLVTTWISGYIVEDIINSNWRWGYGMFAIITPVALTPAILVMAYLEHSANKAG 263

Query: 255 ELP--------PRHEDDKDR------HW---TSKLRDLDWAGVVTLVCFLFLFMLVSSL- 296
           E+P         + E  + R      +W      L ++D  G++ L     L +L  SL 
Sbjct: 264 EIPIGFDPLAKKKVEVTEARIRGFKVYWELLKVSLIEIDAFGLILLGFAFSLILLPCSLY 323

Query: 297 ----GGKEIAYDSVLFALLCVTTLVLGSIFAYVELYVAVDPVLPIAFLKYRSVLGSSLAN 352
               GG     +  + A+  V  ++L S +   E++ A  P+LP   L  R+ +   + +
Sbjct: 324 SYAEGGWN---NPSMIAMEVVGGILLIS-YVVFEVFFAPFPLLPKRVLMNRTFICCVIID 379

Query: 353 WFAMMSMLTTNYYLPVYWASVLNMKPTDIGKRSIPS-----FFSVAFGSLGAGIYMKRTG 407
           +   M+   +  +   Y   VLN+   D    S  +     FF V +G+L  G +  +  
Sbjct: 380 FIYQMAGYFSLLFFTSYTFVVLNLSYRDWVYLSNTTTMGLCFFGVVWGALFRGFHRYKIF 439

Query: 408 KYYWFLLAFCGIGIL-------GQLKINLLTPATPVWQQYLLLVVPSFGLSVLITVTLLA 460
           +     +   G+G+        G   I L+  A         LVV +FG +  +  T +A
Sbjct: 440 QVVGIAIKLIGMGLYVACSKKDGSPGIGLVVAA---------LVVTNFGDAANVMGTQVA 490

Query: 461 MISAVPHEHHAATTSISYAFRSTGATLGVSIGAAIFRSTL 500
             +AVPH+  AAT S+   + S GA +G +I +A++   L
Sbjct: 491 AQAAVPHQDMAATISVLSLYSSIGAAVGTAITSAVWTDQL 530

>Suva_10.9 Chr10 complement(12679..14592) [1914 bp, 637 aa] {ON}
           YEL065W (REAL)
          Length = 637

 Score = 73.9 bits (180), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 106/456 (23%), Positives = 191/456 (41%), Gaps = 62/456 (13%)

Query: 93  FLAALDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPLLVF 152
           ++AALD T          S FN    +S +  +  +  + C+P   K+SD L  +P+  F
Sbjct: 90  WIAALDATTTYNYQPYATSSFNRHSMLSTLTIANSVIGAVCKPFIAKISD-LSSRPVTYF 148

Query: 153 SN-VVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQGLC 211
              +++ IG +I   S +I   VVG     +G  G+  +  ++++D   L+ R+    L 
Sbjct: 149 VVLILYVIGFIITACSPTIAAYVVGSVFIAVGQSGINLMNMVIVADTTSLKWRSFITSLL 208

Query: 212 NFIFGLGTASGGLVGAAF--QDWRMA---FTIQCPISLASCALIVSYLELPPRHEDDKDR 266
           +  + + T   G +       +WR     F I  P++L    L+++YLE    HE +K  
Sbjct: 209 SVPYLVTTWISGYIVQNIISSNWRWGYGMFAIITPVALTPAILVMAYLE----HEANKTG 264

Query: 267 H-------WTSKLRDLDWAGVVTLVCFLFL----FMLVSSLGGKEIAYDSVLFALLC--- 312
                    T K R++  +G+     +  L     + + + G   + +   L  L C   
Sbjct: 265 EIPIGSDPLTEKKREIRESGISGFKGYWQLLKTSLIEIDAFGLILLGFAFSLILLPCSLY 324

Query: 313 ------------VTTLVLGSIF--AYV--ELYVAVDPVLPIAFLKYRSVLGSSLANWFAM 356
                       +   V+G IF  +YV  E++ A  P+LP   L  R+ +   + ++   
Sbjct: 325 SYAEGGWKNPSMIAMEVIGGIFLISYVIFEVFFAPFPLLPKRVLVNRTFICCVVIDFIYQ 384

Query: 357 MSMLTTNYYLPVYWASVLNMKPTDIGKRSIPS-----FFSVAFGSLGAGIYMKRTGKYYW 411
           M    +  +   Y   VLN+   +    S  +     FF V +G L    +  +  +   
Sbjct: 385 MGGYFSLLFFTSYTFVVLNLSYKNWVYLSNTTTMGLCFFGVVWGVLFRYFHRYKIFQVVG 444

Query: 412 FLLAFCGIGIL-------GQLKINLLTPATPVWQQYLLLVVPSFGLSVLITVTLLAMISA 464
             +   G+G+        G   I L+  A         L+V +FG +  +  T +A  +A
Sbjct: 445 IAIKLIGMGLYVACSKKDGSPGIGLIVAA---------LIVTNFGDAANVMGTQVAAQAA 495

Query: 465 VPHEHHAATTSISYAFRSTGATLGVSIGAAIFRSTL 500
           VPH+  AAT S+   + S GA +G +I +A++ + L
Sbjct: 496 VPHQDMAATISVLSLYSSIGAAVGTAITSAVWTNEL 531

>Kwal_14.722 s14 (9019..10854) [1836 bp, 611 aa] {ON} YCL073C -
           Hypothetical ORF [contig 245] FULL
          Length = 611

 Score = 71.2 bits (173), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 126/518 (24%), Positives = 209/518 (40%), Gaps = 70/518 (13%)

Query: 114 NSLDKVSWIATSYLLSSST---CQPLYGKLSDQLGRKPLLVFSNVVFSIGCLICGMSTSI 170
           NS +K S ++T  +++S      Q  + +LSD  GR  + V   +++ +G +I   +  +
Sbjct: 93  NSYEKHSLLSTIQVINSVVGVGAQISFARLSDVFGRLQMFVVGTILYVVGTIIQSQAHDV 152

Query: 171 WWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQGLCNF-IFGLGTASGGLVGAA- 228
               VG      G  G++ L  +V+SD+ PLR R  YQ   +F    +   SG +V AA 
Sbjct: 153 KVYAVGAIFYNTGFVGVSLLLILVLSDMSPLRWRLFYQFTASFPCIIISWISGDIVEAAN 212

Query: 229 -FQDWRMAFTIQCPISLASCALIVSYLELPPRHEDDKDRHWTSKLRD------------- 274
             ++W     +   I   S    ++YL     H   K + W   LR+             
Sbjct: 213 PMKNWSWDIGMWAFIFPLSSLPFITYL-FYATHISSKTKKW-KDLRNKVETHKRNIILVV 270

Query: 275 ------LDWAGVVTLVCFLFLFMLVSSLGG--KEIAYDSVLFALLCVTTLVLGSIFAYVE 326
                 +D  G V +   L L ++  +L G   E  ++  + A L +   +L  +F + E
Sbjct: 271 KDIFNQIDIVGTVLVTAALGLILVPLTLAGGVSERWHEPGIIATLVIGIALL-LVFLFWE 329

Query: 327 LYVAVDPVLPIAFLKYRSVLGSSLANWF-AMMSMLTTNYYLPVYWASVLNMKPTDIGKRS 385
              A +  LP   LK R V  S +A +   M+  + ++Y  PV   SV     +      
Sbjct: 330 AKFAKNAALPFNLLKDRGVWASIVAAFLEKMIYAMISDYLYPVLLVSVNETNKSATRIVW 389

Query: 386 IPSFF----SVAFGSLGAGIYMKRT----GKYYWFLLAFCGIGILGQLKINLLTPATPVW 437
           +P+F     SV FG L   +   +     G + W +     IG+  Q +    + +  + 
Sbjct: 390 LPTFMACLCSVFFGLLVVSVQRLKVFTICGTFLWII----SIGLFYQFRGGESSHSGIIG 445

Query: 438 QQYLLLVVPSFGLSVL---ITVTLLAMISAVPHEHHAATTSISYAFRSTGATLGVSIGAA 494
                 +V  FG ++    I VTL AM S   H++ A+ T + + F   GA  G SI  A
Sbjct: 446 AS----IVLGFGSAIFTQSIIVTLQAMAS---HDNMASITGLYFMFAQVGAATGASISGA 498

Query: 495 IFRST----LNTLLQNKVLQFASDEHPREELLRIINNAAHSANWVHKEAPEFVRATLVEC 550
           I+  T    L   L++  L  A    P E +         S  W  KE     R  +++ 
Sbjct: 499 IWTQTMYKQLLKQLKDSDLTMAVFASPYEFI--------ASYAWGTKE-----RDLVIQA 545

Query: 551 YHYASKSTFKFCLITMILAGASCSIIQEHTLHTTLKRD 588
           Y +  K T    LI  +    S    ++  L  ++  D
Sbjct: 546 YRHVQKVTMLVSLILTVPLLVSVLFTKDRKLSDSVSSD 583

>Skud_18.3 Chr18 complement(10782..12554) [1773 bp, 590 aa] {ON}
           YCL069W (REAL)
          Length = 590

 Score = 68.9 bits (167), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 111/510 (21%), Positives = 209/510 (40%), Gaps = 58/510 (11%)

Query: 90  LGIFLAALDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPL 149
           L +F+ ALD  IV T++  +  +F +  K  W+ T Y L ++    L+G+ +  +G +  
Sbjct: 53  LVLFITALDILIVGTIIDVVAKQFGNYSKTGWLVTGYSLPNAVLSLLWGRFASIIGFQHS 112

Query: 150 LVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQG 209
           L+ + ++F  G L+  ++ S+  ++VGR V+G+GG GL  L  ++   +V  R R +   
Sbjct: 113 LILAVLIFEAGSLVAALANSMNMLIVGRVVAGVGGSGLQTLCFVIGCTMVDERSRPLVIS 172

Query: 210 LCNFIFGLGTASGGLVGAAFQ---DWRMAFTIQCPI-SLASCALIVSYLELPPRHEDDKD 265
           + +  F +    G ++G AF     WR  F I  PI  LA    +++Y        D   
Sbjct: 173 ILSCAFAVAAIVGPIIGGAFTTHVTWRWCFYINLPIGGLAVIMFLLTY----DAKNDGII 228

Query: 266 RHWTSKLRDL-------------------------DWAGVVTLVCFLFLFMLVSSLGGKE 300
           +     LR +                         D+ G       L LF+L  + GG +
Sbjct: 229 QQMKGALRKISGFEFSRLKKPGNLRKAINCLIFKFDFFGFALSSTGLVLFLLGLTFGGNK 288

Query: 301 IAYDSVLFALLCVTTLVLGS---IFAYVELYVAVDPVLPIA-FLKYRSVLGSSLANWFAM 356
             + S       +T LVLG    IF+ V  +   D   P    + YR +    L    A+
Sbjct: 289 YTWSSG----QVITYLVLGIVLFIFSLVYDFFLFDKFNPERDNISYRPLFLRRLVAKPAI 344

Query: 357 MS------MLTTNY-----YLPVYWASVLNMKPTDIGKRSIPSFFSVAFGSLGAGIYMKR 405
           +       +L T Y     Y   ++  +        G   IP   +    ++ +GI  K+
Sbjct: 345 IIVNMVTFLLCTGYNGQMIYSVQFFQLIFASSAWKAGLHLIPIVITNVIAAIASGIITKK 404

Query: 406 TGKYYWFLLAFCGIGILGQLKINLLTPATPVWQQYLLLVVPSFGLSVLITVTLLAMISAV 465
            G     L+    +G++G   + L+   +    Q  +L++P F L   +  +L++  + +
Sbjct: 405 LGLVKPLLIFGGFLGVIGAGLMTLMKNNSTSSTQIGVLILPGFSLGFALQASLMS--AQL 462

Query: 466 PHEHHAATTSISY----AFRSTGATLGVSIGAAIFRSTLNTLLQNKVLQFASDEHPREEL 521
                   T + +    AF +   +LG ++G  +  +  +T L NKV     + +  + +
Sbjct: 463 QINKDRPETPMDFIEITAFNTFMKSLGTTLGGVLSTTVFSTSLHNKVSHVHLEPYAGKTV 522

Query: 522 LRIINNAAHSANWVHKEAPEFVRATLVECY 551
             +I    H+ +  H      + A++   +
Sbjct: 523 DEMILYRLHNFDGAHSTIGNILGASIKNVF 552

>Smik_11.368 Chr11 complement(649880..651622) [1743 bp, 580 aa] {ON}
           YKR105C (REAL)
          Length = 580

 Score = 66.2 bits (160), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 106/474 (22%), Positives = 204/474 (43%), Gaps = 52/474 (10%)

Query: 90  LGIFLAALDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPL 149
           L +F+ ALD  IV T++  +  +F +  K  W+ T Y L ++    ++G+ +  +G +  
Sbjct: 43  LVLFITALDILIVGTIIDVVAEQFGNYSKTGWLVTGYSLPNAILSLVWGRFASIIGFQHS 102

Query: 150 LVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQG 209
           L+ + ++F  G L+  ++ S+  ++VGR V+G+GG GL  L  ++   +V  R R +   
Sbjct: 103 LILAVLIFEAGSLVAALANSMNMLIVGRVVAGVGGSGLQTLCFVIGCTMVNERSRPLVIS 162

Query: 210 LCNFIFGLGTASGGLVGAAFQ---DWRMAFTIQCPISLASCALIVSYLELPPRHED--DK 264
           + +  F +    G ++G AF     WR  F I  PI     A+I+  L    + E+   +
Sbjct: 163 ILSCAFAVAAIVGPIIGGAFTTHVTWRWCFYINLPI--GGFAVIMFLLTYKTKSENILQQ 220

Query: 265 DRHWTSK-----LRDL-----------------DWAGVVTLVCFLFLFMLVSSLGGKEIA 302
            R+   +     LR L                 D+ G       L LF+L  + GG + +
Sbjct: 221 TRNILGRISKFELRRLTEPGNLRKALIGILFKFDFLGFALSSAGLVLFLLGLTFGGNKYS 280

Query: 303 YDS-------VLFALLCVTTLVLGSIFAYVELYVAVD-----PVLPIAFLKYRSVLGSSL 350
           ++S       VL  LL V +L+    F + +     D     P+     +   +V+  ++
Sbjct: 281 WNSGQIITYLVLGILLFVFSLIY-DFFIFQKFNPEPDNTSYRPLFLKRLVAKPAVIIVNM 339

Query: 351 ANWFAMMSMLTTNYYLPVYWASVLNMKPTDIGKRSIPSFFSVAFGSLGAGIYMKRTGKYY 410
             +   +       Y   ++  +        G   IP   +    ++ +G+  K+ G   
Sbjct: 340 VTFLLCIGYNGQMIYSVQFFQLIFASSAWKAGLHLIPIVITNVIAAIASGVITKKLGLVK 399

Query: 411 WFLLAFCGI-GILGQLKINLLTPATPVWQQYLLLVVPSFGLSVLITVTLLAMISAVPHEH 469
             LL F GI G++G   + L++  +    Q  +L++P   L   +  +L++    +  + 
Sbjct: 400 P-LLIFGGILGVIGAGLMTLMSNNSTSSTQIGVLILPGLSLGFALQASLMSAQLQIKKDR 458

Query: 470 HAATTSISY--AFRSTGATLGVSIGAAIFRSTLNTLLQNKVLQFASDEHPREEL 521
             ATT      AF +   +LG ++G  +  +  +  L+NKV      +H + E+
Sbjct: 459 PEATTDFIEITAFNTFMKSLGTTLGGVLSTTVFSASLRNKV------KHAQLEM 506

>CAGL0E04092g Chr5 (394380..396317) [1938 bp, 645 aa] {ON} similar
           to uniprot|P38731 Saccharomyces cerevisiae YHL040c ARN1
           or uniprot|P38724 Saccharomyces cerevisiae YHL047c TAF1
          Length = 645

 Score = 65.5 bits (158), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 101/410 (24%), Positives = 170/410 (41%), Gaps = 39/410 (9%)

Query: 130 SSTCQPLYGKLSDQLGRKPLLVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTC 189
           S+  Q +Y +LSD  GR  L   S V++S+G +I   +  +     G      G  G+  
Sbjct: 140 SAASQIVYARLSDVYGRFALFCVSIVLYSVGTIIQSQAYDVQRYAAGSIFYNTGYVGVIL 199

Query: 190 LASMVISDLVPLRERAVYQGLCNFIFGLGT-ASGGLVGAA--FQDWRMAFTIQCPISLAS 246
           +  +++SD   LR R VYQ +  + F + T  SG +   A   ++W     +   I   S
Sbjct: 200 VLLLILSDFSSLRWRLVYQFVPTWPFIINTWISGNVTSRANPLKNWSWDIGMWAFIFPLS 259

Query: 247 CA----LIVSYLELPPRHED----DKDRHWTSK--LRD--------LDWAGV----VTLV 284
           C     +++    L  + E+     K++ +  K  L+D        +D  GV    ++L 
Sbjct: 260 CVPLLCVMIHMWWLARKTEEWQELSKEKTFYQKHGLKDTIVELFWKIDAMGVFIMTISLG 319

Query: 285 CFLFLFMLVSSLGGKEIAYDSVLFALLCVTTLVLGSIFAYVELYVAVDPVLPIAFLKYRS 344
           C L    L    GG +  +++       V   VL  I    E   A DP++P   +K R 
Sbjct: 320 CILVPLTLA---GGTKSKWNNSHVIGPFVLGFVLIPILVLWEYKFARDPIIPYKLVKDRG 376

Query: 345 VLGSSLANWFAMMSMLTTNYYLPV-YWASVL----NMKPTDIGKRSIPSFFSVAFGSLGA 399
           V  S     FA+  ++   YY+   Y  +VL    N       + S  S F    GS   
Sbjct: 377 VWAS-----FAISFLIDFIYYMAADYLYTVLIVGVNESVKSATRISSLSTFVSTVGSPIF 431

Query: 400 GIYMKRTGKYYWFLLAFCGIGILGQ-LKINLLTPATPVWQQYLLLVVPSFGLSVLITVTL 458
            + + R  +   F++  CG+ +L   L  +    A         L V   G ++      
Sbjct: 432 SLLITRFSRLKPFIICGCGLWMLAMGLLYHYRGGAESHSGIIGALCVWGVGTTLFTYPVN 491

Query: 459 LAMISAVPHEHHAATTSISYAFRSTGATLGVSIGAAIFRSTLNTLLQNKV 508
           +++ +A  HEH A  T+++Y F   G+ +G ++  AI+  TL   L  +V
Sbjct: 492 VSVQAATSHEHMATVTALNYTFYRIGSAVGAAVSGAIWTQTLYKQLLKRV 541

>SAKL0F00792g Chr6 (70444..72297) [1854 bp, 617 aa] {ON} similar to
           uniprot|P38731 Saccharomyces cerevisiae YHL040C ARN1
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to ferrirubin
           ferrirhodin and related siderophores
          Length = 617

 Score = 64.7 bits (156), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 101/409 (24%), Positives = 170/409 (41%), Gaps = 36/409 (8%)

Query: 128 LSSSTCQPLYGKLSDQLGRKPLLVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGL 187
           L S+  Q  Y +LSD  GR  L V S V + IG +I   +  +     G     IG  GL
Sbjct: 110 LLSAASQIFYARLSDVFGRLSLFVVSMVFYVIGTIIQSQAYDVQKYAAGAVFYNIGYVGL 169

Query: 188 TCLASMVISDLVPLRERAVYQGLCNFIFGLGT-ASGGLVGAA--FQDWRMAFTIQCPISL 244
             +  +++SD   L+ R  YQ    + F + T  SG ++  A   ++W     +   I  
Sbjct: 170 FLILVLILSDCSSLKWRLFYQYAPTWPFIIITWISGNIISRANPIENWSWGIGMWAFIFP 229

Query: 245 ASCALIVSYLELPPRHEDDKDRHW---TSKLRDLDWAGVVTLVCFLF-------LFMLVS 294
            +C L + +  L  R +  K   W   +S+       G+V  +  LF       +F++  
Sbjct: 230 LTC-LPILFCMLHMRFKARKTPEWQDLSSQKSFFQTHGIVQALVQLFWKLDVVGIFIMTI 288

Query: 295 SL----------GGKEIAYDSVLFALLCVTTLVLGSIFAYVELYVAVDPVLPIAFLKYRS 344
           SL          GG    + +       V   VL  +F Y E   A DP+ P   LK R 
Sbjct: 289 SLGCILVPLTLAGGSSSKWQNSEIIGPLVLGFVLVPVFIYWESKWAKDPLAPFELLKDRG 348

Query: 345 VLGSSLANWFA-MMSMLTTNYYLPVYWASVLNMKPTDIGKRSIPSFFSVAFGSLGAGIYM 403
           +  S   N+    +  +   Y  PV   +V     +     S+ SF S    S   G  +
Sbjct: 349 IWASMCFNFLMDFVYCMAAGYLYPVLIVAVDESTKSATRITSLASFVSTV-ASPFMGYAV 407

Query: 404 KRTGKYYWFLLAFCGI-----GILGQLKINLLTPATPVWQQYLLLVVPSFGLSVLITVTL 458
            R+ +   ++++ CG+     G+L   +  L + +  +    LL +  +  +   I V+ 
Sbjct: 408 SRSTRLKPYIVSGCGMWFLATGLLYHYRSGLESHSGIIGGLVLLGLGCTLSIYP-INVSA 466

Query: 459 LAMISAVPHEHHAATTSISYAFRSTGATLGVSIGAAIFRSTL-NTLLQN 506
            ++ S   HE+ A+ T+++Y     G  +GV++  AI+  TL N LL+ 
Sbjct: 467 QSLTS---HENMASVTALNYTVYRIGGAVGVAVSGAIWTQTLYNDLLKR 512

>KAFR0J01620 Chr10 complement(300964..302676) [1713 bp, 570 aa] {ON}
           Anc_2.241 YIL121W
          Length = 570

 Score = 63.5 bits (153), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 49/169 (28%), Positives = 84/169 (49%), Gaps = 6/169 (3%)

Query: 93  FLAALDGTIVSTLLTRIGSEFN-SLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPLLV 151
           F +++ G I   +LT I  +F+ + ++V+     Y +       L G L+D LGR+P+++
Sbjct: 86  FFSSIAGAIYYPVLTVIEKKFSITEEQVNITVVVYFIFQGLSPSLMGGLADSLGRRPVVL 145

Query: 152 FSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQGLC 211
           +S V++   C+   +S +   +++ R +   G   +  + S ++ D+    ER  Y G  
Sbjct: 146 WSVVIYFGACIGLALSQNYTQIIILRCLQAAGISPVIAINSGIMGDVTTKAERGGYVGYV 205

Query: 212 NFIFGLGTASGGLVGAAFQ---DWRMAFTIQCPISLASCALIVSYLELP 257
                LG+A G L+GAA     DWR  F     I   +CAL VS+  LP
Sbjct: 206 AGFQILGSALGALIGAALSSRWDWRAIFWF-LAIGSGACAL-VSFFVLP 252

>Suva_26.1 Chr26 (1..1602) [1602 bp, 534 aa] {ON} YOL158C (REAL)
          Length = 534

 Score = 63.2 bits (152), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 67/275 (24%), Positives = 116/275 (42%), Gaps = 24/275 (8%)

Query: 89  FLGIFLAALDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKP 148
           FL  +   L G I  ++ T   + F    +V  I T   + SS     Y ++SD+ GR  
Sbjct: 66  FLQGYCTGLGGQISQSIQTYAANGFGKHSQVGSINTVKSIVSSVVAVPYARMSDRFGRIE 125

Query: 149 LLVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQ 208
             +F+ V++++G +I   + +   +  G  +   G  G   LA+ +  DL  LR+R    
Sbjct: 126 CWIFALVLYTVGEIISAATPNFGGLFAGIVIQQFGYSGFRLLATALTGDLSGLRDRTFAM 185

Query: 209 GLCNFIFGLGT-ASGGLVGA-----AFQDWRMAFTIQC---PISLASCALIVSYLE---- 255
            +      + T  SG +V +     A   WR  + I C   P S     L  +Y +    
Sbjct: 186 NIFLIPVIINTWVSGNIVSSLAGSVAPYKWRWGYGIFCIIVPFSTLILVLPYAYAQYISW 245

Query: 256 ----LPPRHEDDKDRHWTSKL----RDLDWAGVVTLVCFLFLFMLVSSLGGKEIA--YDS 305
               LPP    +K ++    +     D++  G++    FL L +L  ++ G   +   + 
Sbjct: 246 RNGTLPPFKLKEKGQNLRQTIWKFAEDINLIGIILFTAFLVLVLLPLTIAGGATSKWREG 305

Query: 306 VLFALLCVTTLVLGSIFAYVELYVAVDPVLPIAFL 340
            + A++ V    LG IF   EL  A +P +P  +L
Sbjct: 306 YIIAMIVVGGF-LGFIFLIWELRFAKNPFIPRVYL 339

>YOL158C Chr15 complement(19491..21311) [1821 bp, 606 aa] {ON}
           ENB1Endosomal ferric enterobactin transporter, expressed
           under conditions of iron deprivation; member of the
           major facilitator superfamily; expression is regulated
           by Rcs1p and affected by chloroquine treatment
          Length = 606

 Score = 62.8 bits (151), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 68/274 (24%), Positives = 116/274 (42%), Gaps = 22/274 (8%)

Query: 89  FLGIFLAALDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKP 148
           FL  +   L G I  ++ T   + F    +V  I T   + +S     Y ++SD+ GR  
Sbjct: 71  FLQGYCTGLGGQISQSIQTYAANSFGKHSQVGSINTVKSIVASVVAVPYARISDRFGRIE 130

Query: 149 LLVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQ 208
             +F+ V+++IG +I   + +   +  G  +   G  G   LA+ +  DL  LR+R    
Sbjct: 131 CWIFALVLYTIGEIISAATPTFSGLFAGIVIQQFGYSGFRLLATALTGDLSGLRDRTFAM 190

Query: 209 GLCNFIFGLGT-ASGGLVGA-----AFQDWRMAFTIQCPI-SLASCALIVSYL------- 254
            +      + T  SG +V +     A   WR  + I C I  +++  L++ Y+       
Sbjct: 191 NIFLIPVIINTWVSGNIVSSVAGNVAPYKWRWGYGIFCIIVPISTLILVLPYVYAQYISW 250

Query: 255 ---ELPPRHEDDKDRHWTSKL----RDLDWAGVVTLVCFLFLFML-VSSLGGKEIAYDSV 306
              +LPP    +K +     L     D++  GV+    FL L +L ++  GG    +   
Sbjct: 251 RSGKLPPLKLKEKGQTLRQTLWKFADDINLIGVILFTAFLVLVLLPLTIAGGATSKWREG 310

Query: 307 LFALLCVTTLVLGSIFAYVELYVAVDPVLPIAFL 340
               + V    LG IF   EL  A +P +P  +L
Sbjct: 311 HIIAMIVVGGCLGFIFLIWELKFAKNPFIPRVYL 344

>Suva_8.12 Chr8 complement(20611..22512) [1902 bp, 633 aa] {ON}
           YHL040C (REAL)
          Length = 633

 Score = 62.8 bits (151), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 101/440 (22%), Positives = 178/440 (40%), Gaps = 47/440 (10%)

Query: 96  ALDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPLLVFSNV 155
            LDG I         S ++    +S I     + S+  Q +Y +LSD  GR  L + + +
Sbjct: 94  GLDGNIRYIYTGYATSSYSEHSLLSTINVINAVVSAASQIIYARLSDVFGRLYLFISAVI 153

Query: 156 VFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQGLCNFIF 215
           ++ +G +I   +  +     G      G  G+  +  +++SD   L+ R +YQ    + F
Sbjct: 154 LYVVGTIIQSQAYDVQRYAAGSIFYNAGYVGVILILLIILSDFSSLKWRLLYQFAPTWPF 213

Query: 216 GLGTASGGLVGAAFQD----------WRMAFTIQCPISLASCALIVSYL--ELPPRH--E 261
            + T   G + +              W   F + C I +  C L + ++  + P  H  +
Sbjct: 214 IINTWIAGNITSKANPVENWSWDIGMWAFIFPLSC-IPIVLCMLHMQWIARKTPEWHALK 272

Query: 262 DDK----DRHWTSKLRDLDWA----GVVTLVCFLFLFMLVSSLGG--KEIAYDSVLFALL 311
           D+K    +  +   L  L W     GV+ + C L   ++  +L G  K    DS L    
Sbjct: 273 DEKSYYQEHGFVKVLEQLFWKLDVIGVLLMGCSLGCILVPLTLAGGVKTTWNDSRLIGPF 332

Query: 312 CVTTLVLGSIFAYVELYVAVDPVLPIAFLKYRSVLGS-SLANWFAMMSMLTTNYYLPVYW 370
            V   VL  I    E  VA DP++P   +K R V  S  ++     +  +  +Y   V  
Sbjct: 333 -VLGFVLIPILWVWEYRVARDPIIPYKLVKDRGVWSSMGISFLIDFIYYMAADYLYTVML 391

Query: 371 ASVLNMKPTDIGKRSIPSFFSVAFGSLGAGIYMKRTGKYYWFLLAFC-----GIGIL--- 422
            +V     +     ++ SF SV   S   G+ M R  +   F++  C      +G+L   
Sbjct: 392 VAVNESIKSATRISTLSSFVSVV-ASPFFGLIMTRCTRLKPFIMFGCCLWMLAMGLLYRY 450

Query: 423 --GQLKINLLTPATPVWQQYLLLVVPSFGLSVLITVTLLAMISAVPHEHHAATTSISYAF 480
             G+   + +  A  VW           G ++      +++ SAV HE+ A  T+++Y  
Sbjct: 451 RGGRESHSGIIGALCVW---------GLGTTLFTYPVTVSVQSAVSHENLATVTALNYTL 501

Query: 481 RSTGATLGVSIGAAIFRSTL 500
              G+ +G ++  AI+  TL
Sbjct: 502 YRIGSAVGAAVSGAIWTQTL 521

>TDEL0H00130 Chr8 complement(10267..12132) [1866 bp, 621 aa] {ON} 
          Length = 621

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 114/511 (22%), Positives = 197/511 (38%), Gaps = 72/511 (14%)

Query: 89  FLGIFLAALDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKP 148
           FL  F   LDG I    +T   + +++   +S +    ++ S+  Q +Y  LSD  GR  
Sbjct: 78  FLCSFGYGLDGNIRGIYMTYAMNSYSTHSLISTVGVISMVISAVAQVIYAGLSDVFGRLS 137

Query: 149 LLVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQ 208
           L + S V + +G +I   +  +     G     +G  G+     +V+SD   L+ R  Y 
Sbjct: 138 LFIVSIVFYVVGTIIQSQAYDVQRYAAGSVFYSVGLVGVMLQVILVLSDNSSLKWRLFYT 197

Query: 209 GLCNFIFGLGT-ASGGLVGAAFQD---------WRMAFTIQCPISLASCALIVSYLELPP 258
            +  +   + T  SG ++  A  +         W   F + C I L +C L   ++    
Sbjct: 198 FVPAWPSIITTWVSGNVIETANPEDNWSWNIAMWAFIFPLSC-IPLIACML---HMRWKV 253

Query: 259 RHEDDKDRHWTSK---------------LRDLDWAGVVTLV----CFLFLFMLVSSLGGK 299
           R+E +     T K                  LD  G++ L     C L    L    GG 
Sbjct: 254 RNEPEWKELQTEKTYYQSHGLIQTVVQLFWKLDVVGIILLTVGTGCILVPLTLA---GGV 310

Query: 300 EIAYDSVLFALLCVTTLVLGSIFAYVELYVAVDPVLPIAFLKYRSVLGSSLANWF-AMMS 358
              + S       V   VL +IF Y E  +A+ P+ P   LK R +       +  A + 
Sbjct: 311 STQWQSAKLIAPFVLGFVLIAIFIYWESKLALAPIAPFKMLKDRGIWAPLWIMFLIAFVY 370

Query: 359 MLTTNYYLPVYWASVLNMKPTDIGKRSIPSFFSVAFGSLGAGIYMKRTGKYYWFL----- 413
            +   Y   +   +V     +     S+ SF S  F  +  G  + R+ +   ++     
Sbjct: 371 QMAAGYLYTILMVAVDETDLSATRITSLYSFVSAIFAPV-LGFIVARSSRLKPYMVLGCS 429

Query: 414 LAFCGIGILGQLKINL-----LTPATPVWQQYLLLVVPSFGLSVLITVTLLAMISAVPHE 468
           L F  +G+  + ++       +  A  VW       + S      +TV++ ++ S   HE
Sbjct: 430 LYFVTMGLFYRYRVGKDAHQGVIGAMVVWG------ICSCLFDYPVTVSIQSVTS---HE 480

Query: 469 HHAATTSISYAFRSTGATLGVSIGAAIFRSTLNTLLQNKVLQFASDEHPREELLRIINNA 528
           + A  T++SY   S G  +  S+  AI+      LL  K+L++  D    E        A
Sbjct: 481 NMATVTALSYTIFSIGGAVAASVSGAIW----TQLLYPKLLEYIGDADLAE--------A 528

Query: 529 AHSAN---WVHKEAPEFVRATLVECYHYASK 556
           A+S+    ++       +R  +VE Y +  K
Sbjct: 529 AYSSPLTFYLDYPWGTPIRDAMVEAYKHVQK 559

>Skud_18.6 Chr18 (14597..16429) [1833 bp, 610 aa] {ON} YCL073C
           (REAL)
          Length = 610

 Score = 61.6 bits (148), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 118/525 (22%), Positives = 205/525 (39%), Gaps = 78/525 (14%)

Query: 89  FLGIFLAALDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKP 148
           FL  F  +LD T+ ST      + +     +S I     + S   Q ++ +LSD  GR  
Sbjct: 62  FLCGFGYSLDHTLRSTYTGYATNSYAEHSLLSTIQVINAVVSVGSQVVFSRLSDYFGRVE 121

Query: 149 LLVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQ 208
           L V + +++ IG ++   + S+     G      G  G+T +  +++SD   L+ R +YQ
Sbjct: 122 LFVAATILYVIGTIVQSQAYSVSIYAAGAVFYNSGNVGVTLVLLLILSDFSSLKWRILYQ 181

Query: 209 GLCNFIF-GLGTASGGLVGAAF--QDWRMAFTIQC---PISLASCALIVSYLELP----P 258
            +  + F  +   SG +V AA   +DW     +     P+S      ++ Y+       P
Sbjct: 182 YVPYWPFIIIPWISGNIVTAANPEKDWSWDIAMWAFIFPLSALPMICLLVYMMYKSSKTP 241

Query: 259 RHEDDKDRHWTSKLR-----------DLDWAGV----VTLVCFLFLFMLVSSLGGKEIAY 303
             +  K+R    K +           +LD  G+    V+L C L    L + +  K    
Sbjct: 242 EWKALKERTHIKKNQGFLKNTVFLFWELDSIGIILITVSLGCVLVPLTLANGVSQK---- 297

Query: 304 DSVLFALLCVTTLVLGS----IFAYVELYVAVDPVLPIAFLKYRSV---LGSSLANWFAM 356
                +   + TLV G     IF + E   A +P+LP   L  R +   LG +  N+F  
Sbjct: 298 ---WHSSKIIGTLVFGGVLFCIFVFWETAYAKNPLLPFKLLGDRGIWAPLGVAFFNYFTF 354

Query: 357 MSMLTTNYYLPVYWASVLNMKPTDIGKRSIPSFFSVAFGSLGAGIYMKRTGKYYWFLLAF 416
              +  ++  PV   S+     T     ++P F          GI + +  +  + ++  
Sbjct: 355 --FIACDFLYPVLLVSMNESSTTATRILNLPDFVGATLSPF-YGILVAKARRLKFSVVGG 411

Query: 417 CG-----IGILGQLKINLLTPATPVWQQYLLLVVPSFGLSVL-----ITVTLLAMISAVP 466
           C      +G+  Q +    +    +    ++      G+S L     + V+L AM +   
Sbjct: 412 CAAWMISMGLFYQYRGGSESHGGAIAASVIM------GMSGLLCSNSVIVSLQAMTT--- 462

Query: 467 HEHHAATTSISYAFRSTGATLGVSIGAAIFRSTLNTLLQ----NKVLQFASDEHPREELL 522
           H   A  TSI + F   GA +G S+  A++   +   L+    N  L  A+ E P   + 
Sbjct: 463 HGRMAVITSIYFTFSKVGAAVGASVSGAVWTQIMPNQLRKAFSNDTLADAAYESPYTFI- 521

Query: 523 RIINNAAHSANWVHKEAPEFVRATLVECYHYASKSTFKFCLITMI 567
                  +   W    +PE  R  +VE Y Y  +      L+  I
Sbjct: 522 -------YEYPW---GSPE--RIAVVEAYRYVQRIMMTIGLVCTI 554

>Kpol_1003.11 s1003 (33230..34975) [1746 bp, 581 aa] {ON}
           (33230..34975) [1746 nt, 582 aa]
          Length = 581

 Score = 60.8 bits (146), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 41/148 (27%), Positives = 70/148 (47%), Gaps = 4/148 (2%)

Query: 93  FLAALDGTIVSTLLTRIGSEFNSLDK-VSWIATSYLLSSSTCQPLYGKLSDQLGRKPLLV 151
           F +++ G I   +LT I  +FN  ++ V+     Y +         G L+D LGR+P+++
Sbjct: 111 FFSSVAGAIYYPVLTVIEKKFNITEELVNITVVVYFIFQGLAPSFMGGLADSLGRRPVVL 170

Query: 152 FSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQGLC 211
           FS +V+   C+   +S +   +VV R +   G   +  + S +  D+    ER  Y G  
Sbjct: 171 FSILVYCCACIGLALSQNYTQIVVLRCLQAAGISPVIAINSGICGDITTRAERGAYVGYV 230

Query: 212 NFIFGLGTASGGLVGAAFQD---WRMAF 236
           +    +G+A G L+GA       WR  F
Sbjct: 231 SGFIVIGSAFGALIGAGLSSTWGWRSIF 258

>KLTH0D18150g Chr4 complement(1502817..1504640) [1824 bp, 607 aa]
           {ON} similar to uniprot|P38731 Saccharomyces cerevisiae
           YHL040C ARN1 Transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates responsible for uptake of iron
           bound to ferrirubin ferrirhodin and related siderophores
          Length = 607

 Score = 58.2 bits (139), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 100/453 (22%), Positives = 180/453 (39%), Gaps = 59/453 (13%)

Query: 97  LDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPLLVFSNVV 156
           LDG++     +   S ++    +S I     + S+  Q ++ +LSD  GR  L + + + 
Sbjct: 70  LDGSVRYVYTSYAVSSYSDHPLISTITVVTAIISAASQIVFARLSDVFGRLSLFITALLF 129

Query: 157 FSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQGLCNFIFG 216
           +++G +I   +T +     G      G  GL  +  +++SD   LR R VYQ   ++ + 
Sbjct: 130 YAVGTIIQSQATDVQKYAAGAIFWSTGYVGLLLILILILSDFSSLRWRLVYQFAPSWPYI 189

Query: 217 LGTASGGLVGAAFQ-----DWRMA-FTIQCPISLASCALIVSYLELPPRHEDDKDRHWTS 270
           + T   G V A         W +A +    P+S    AL + +  L  R +  K   W +
Sbjct: 190 INTWFAGTVTARANPQEHWSWDIAMWAFIVPLS----ALPMIFCMLHMRFKARKTEQWAA 245

Query: 271 KLRD--------------------LDWAGV----VTLVCFLFLFMLVSSLGGKEIAYDSV 306
            ++D                    LD  GV    +++ C L    L    GG +  + + 
Sbjct: 246 -IKDEKSFFQSHGLIRTLVELFWKLDIVGVLLMTISVGCILAPLTLA---GGVKSKWSNP 301

Query: 307 LFALLCVTTLVLGSIFAYVELYVAVDPVLPIAFLKYRSVLGSSLANWF-AMMSMLTTNYY 365
                 V   VL  +F   E   A  PV+P   +K R+V G+    +    +      Y 
Sbjct: 302 HLIGPLVLGFVLLPLFMIWESKAAKYPVVPYGLIKDRAVWGALGCQFLIGFIYNAVAGYI 361

Query: 366 LPVYWASVLNMKPTDIGKRSIPSFFSVAFGSLGAGIYMKRTGKYYWFLLAFCGIGIL--- 422
             +   +V     +     S+ SF S    S    +Y+ R  K   +++  CGI +L   
Sbjct: 362 YTILIVAVNESVKSATVISSLSSFVSTV-ASTFFSLYITRCTKLKGYIIGGCGIWMLAMG 420

Query: 423 -------GQLKINLLTPATPVWQQYLLLVVPSFGLSVLITVTLLAMISAVPHEHHAATTS 475
                  G+   + +  A  +W           G ++LI  T +++ SA  H++ A  T+
Sbjct: 421 LFYHYRGGEFAHSGIVGAMVIW---------GLGDTLLIYPTTISVQSATSHDNMATVTA 471

Query: 476 ISYAFRSTGATLGVSIGAAIFRSTLNTLLQNKV 508
           ++Y     G   G ++  AI+  TL   L +++
Sbjct: 472 LNYTLYRIGLATGAAVSGAIWSQTLYKALLSRL 504

>Smik_21.4 Chr21 (1261..3078) [1818 bp, 605 aa] {ON} YOL158C (REAL)
          Length = 605

 Score = 57.8 bits (138), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 67/274 (24%), Positives = 113/274 (41%), Gaps = 22/274 (8%)

Query: 89  FLGIFLAALDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKP 148
           FL  +   L G I  ++ T   + F    +V  I T   + +S     Y ++SD+ GR  
Sbjct: 70  FLQGYCTGLGGQISQSIQTYAANSFGKHSQVGSINTVKSIVASVVAVPYARMSDRFGRIE 129

Query: 149 LLVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQ 208
             +F+ V++++G +I   + +   +  G  +   G  G   LA+ +  DL  LR+R    
Sbjct: 130 CWMFALVLYTVGEIISAATPTFAGLFAGIVIQQFGYSGFRLLATALTGDLSGLRDRTFAM 189

Query: 209 GLCNFIFGLGT-ASGGLVGAAF-----QDWRMAFTIQC---PISLASCALIVSYLE---- 255
            +      + T  SG +V +        +WR  + I C   P S     L  +Y +    
Sbjct: 190 NIFLIPVIINTWVSGNIVSSVAGHTTPYNWRWGYGIFCIIVPFSTLMLVLPYAYAQYIGW 249

Query: 256 ----LPPRHEDDKDRHWTSKL----RDLDWAGVVTLVCFLFLFMLVSSL-GGKEIAYDSV 306
               LPP    +K ++    L     D++  GV+    FL L +L  ++ GG    +   
Sbjct: 250 RNGTLPPYKLREKGQNLRQTLWKIVEDINLIGVILFSAFLVLLLLPLTIAGGATSKWREG 309

Query: 307 LFALLCVTTLVLGSIFAYVELYVAVDPVLPIAFL 340
               + V    LG IF   EL  A +P +P  +L
Sbjct: 310 YIIAMIVVGGCLGFIFLIWELRFAKNPFIPRVYL 343

>TPHA0B00180 Chr2 complement(29722..31623) [1902 bp, 633 aa] {ON} 
          Length = 633

 Score = 57.8 bits (138), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 113/534 (21%), Positives = 212/534 (39%), Gaps = 53/534 (9%)

Query: 89  FLGIFLAALDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKP 148
           F+  +   LDG +  T  T   S FN     S +     ++SS  Q  + + SD   R+ 
Sbjct: 83  FVIYYAYGLDGNVRPTYQTLATSSFNRHSLNSTVTCINRVTSSAGQIWFARASDIFSREF 142

Query: 149 LLVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQ 208
            +V S + + +G +I   +TS+    VG  + GIG  G+  L  + ++D   L  R V +
Sbjct: 143 SMVISILFYVVGTIISSQATSVAKYAVGACIYGIGHAGIVLLCEIYMADFSNLNWRVVAE 202

Query: 209 GLCNFIFGLGT-ASGGLVGAAFQDWRMAFTIQCPISLASCA---LIVSYLELPPRHEDDK 264
                   + T  SG +       W+    +   I  ASC    + + ++    +  ++K
Sbjct: 203 NAPMLPAIINTWVSGNITSDLGSKWQWGLGMWAIIFPASCIPLFVCIYHMRYMAKKNNEK 262

Query: 265 DRH---------WTSKLRD-----LDWAGVVTLVC-FLFLFMLVSSLGGKEIAYDSVLFA 309
            R          W   L D     LD+ G+V LV  F  + +  ++ GG    ++S  F 
Sbjct: 263 IRKIFEKPSEIAWKKYLIDIFIWKLDFIGLVLLVAVFALILVPFTTSGGLHREWNSANFI 322

Query: 310 LLCVTTLVLG-SIFAYVELYVAVDPVLPIAFLKYRSVLGSSLANWFAMMSMLTTNYYLPV 368
           +  V   V+   IF+  E   +  P+L +  +  R +  +   ++F    +   + YL  
Sbjct: 323 VPEVVGWVVALPIFSVWEWKFSRYPILRLDLISDRGIYSALSISFFIQFCLYVNDTYLYT 382

Query: 369 YWASVLNMKPTDIGKR--SIPSFFSVAFG-SLGAGIYMKRTGKYY-------WFLLAFCG 418
           +    ++ + T  G R  S+ SF +V     LG  I   R  + +       WF++    
Sbjct: 383 FLLVAVD-QTTKSGTRINSLMSFVNVITACCLGLFIVKIRRTQIFIVIGCVSWFVVYGLY 441

Query: 419 IGILGQL--KINLLTPATPVWQQYLLLVVPSFGLSVLITVTLLAMISAVPHEHHAATTSI 476
           +   G L  +  ++T +      Y  +  P       +  +L A  S+  H++ A  T++
Sbjct: 442 VHYNGGLGSRSGIITASCLSGFGYGFIKSP-------LKASLQA--SSNSHQNLAIVTAL 492

Query: 477 SYAFRSTGATLGVSIGAAIFRSTLNTLLQNKVLQFASDEHPREELLRIINNAA-HSANWV 535
             A  + G   G ++  AI+ + L   L+  +      +   +  ++ I     H+A   
Sbjct: 493 FLAIGNIGTAFGAAVAGAIWSNLLPHRLEKSIGNVTLADSAFDSPIKFIKQYKWHTA--- 549

Query: 536 HKEAPEFVRATLVECYHYASKSTFKFCLITMILAGASCSIIQEHTLHTTLKRDK 589
                  VR  LV  Y    +     CL+ +I    S  ++++  L  ++  D+
Sbjct: 550 -------VRQHLVSSYGSVWRILNIVCLVLVIPMLVSSFLLRDRKLSNSVAYDQ 596

>AFR343C Chr6 complement(1060723..1062438) [1716 bp, 571 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL103W
           (ITR2) and YDR497C (ITR1)
          Length = 571

 Score = 57.4 bits (137), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 53/199 (26%), Positives = 94/199 (47%), Gaps = 21/199 (10%)

Query: 93  FLAALDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKL-----SDQLGRK 147
           FL   D   +S+ L  +G++     ++++    Y+ S+++   L   L     +D  GR+
Sbjct: 78  FLFGYDTGYISSALQSVGTDLGH--QLTYRDKEYITSATSLGALIAALGAGICADLFGRR 135

Query: 148 PLLVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVY 207
             ++FSN++F +G ++   + + W +VVGR V G G    + ++ + IS++ P     + 
Sbjct: 136 KCIMFSNILFVVGTVLQVAAFNFWQMVVGRLVMGFGIGFGSLISPLFISEIAP----KMI 191

Query: 208 QGLCNFIFGLGTASGGLV----GAAFQDWRMAFTIQCPISLASCAL-IVSYLELPPRHED 262
           +G    I  L    G L+    GA FQ  +  + I   IS+    L  VS++ LP     
Sbjct: 192 RGRLTVINSLWLTGGQLIAYACGAGFQHVKHGWRILVGISMLPAVLQFVSFIFLP----- 246

Query: 263 DKDRHWTSKLRDLDWAGVV 281
           D  R +  K R  D A V+
Sbjct: 247 DTPRFYVMKGRLEDAANVL 265

>Skud_8.3 Chr8 complement(7094..8989) [1896 bp, 631 aa] {ON} YHL040C
           (REAL)
          Length = 631

 Score = 57.4 bits (137), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 96/430 (22%), Positives = 169/430 (39%), Gaps = 27/430 (6%)

Query: 96  ALDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPLLVFSNV 155
            LDG I         S ++    +S I     + S+  Q +Y +LSD  GR  L + + +
Sbjct: 93  GLDGNIRYIYTGYATSSYSKHSLLSTINVINAVVSAASQIIYARLSDVFGRLYLFISAVI 152

Query: 156 VFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQGLCNFIF 215
           ++ +G +I   +  +     G      G  G+  +  +++SD   L+ R +YQ    + F
Sbjct: 153 LYVVGTIIQSQAYDVQRYAAGAIFYNAGYVGVILILLIILSDFSSLKWRLLYQFAPTWPF 212

Query: 216 GLGTASGGLVGAAFQD----------WRMAFTIQC-PISLASCALIVSYLELPPRHEDDK 264
            + T   G + +              W   F + C PI L    +     + P   E   
Sbjct: 213 IINTWIAGNITSRANPVVNWSWDVGMWAFIFPLSCIPIVLCMLHMQWRAGKTPEWQELKG 272

Query: 265 DRHWTSK------LRDLDWA----GVVTLVCFLFLFMLVSSLGG--KEIAYDSVLFALLC 312
            + +  +      L  L W     GV+ + C L   ++  +L G  K    DS L     
Sbjct: 273 QKSYYQEHGLMKILEQLFWKLDVIGVLLMGCSLGCILVPLTLAGGVKTTWNDSRLIGPF- 331

Query: 313 VTTLVLGSIFAYVELYVAVDPVLPIAFLKYRSVLGS-SLANWFAMMSMLTTNYYLPVYWA 371
           V   VL  I    E   A DP+LP   +K R V  S  ++     +  +  +Y   V   
Sbjct: 332 VLGFVLIPILWVWEYSYARDPILPYKLVKDRGVWSSMGISFLIDFIYYMAADYLYTVMIV 391

Query: 372 SVLNMKPTDIGKRSIPSFFSVAFGSLGAGIYMKRTGKYYWFLLAFCGIGILGQLKINLLT 431
           +V     +     ++ SF SV   S   G+ M R  +   F+++ C + +L    +    
Sbjct: 392 AVNESIKSATRISTLSSFVSVV-ASPFFGLLMTRCTRLKPFIMSGCSLWMLAMGLLYRFR 450

Query: 432 PATPVWQQYL-LLVVPSFGLSVLITVTLLAMISAVPHEHHAATTSISYAFRSTGATLGVS 490
             +      +  L V   G ++      +++ SAV HE+ A  T+++Y     G+ +G +
Sbjct: 451 GGSESHSGIIGALCVWGVGTTLFTYPVTVSVQSAVSHENLATVTALNYTMYRIGSAVGSA 510

Query: 491 IGAAIFRSTL 500
           +  AI+  TL
Sbjct: 511 VSGAIWTQTL 520

>TBLA0F00470 Chr6 (123691..125889) [2199 bp, 732 aa] {ON} 
          Length = 732

 Score = 57.4 bits (137), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 64/273 (23%), Positives = 113/273 (41%), Gaps = 24/273 (8%)

Query: 96  ALDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPLLVFSNV 155
           +LD  +     T   S +     VS I     ++S+T Q +Y + SD  GR  LL+ + +
Sbjct: 128 SLDSRVRRVYKTYAASSYKKHSLVSTINVIDSVASATSQVVYSRASDIFGRLSLLLVAII 187

Query: 156 VFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQGLC---- 211
            + +G +I   +  I     G F   +G  G++ L ++++SD   L+ R  YQ +     
Sbjct: 188 CYVVGTIIQSQAYDIQRYCAGSFFYNLGYVGVSLLMTLILSDYSSLKWRFFYQAILAWPN 247

Query: 212 ---NFIFGLGTASGGLVGAAFQD---WRMAFTIQCPISLASCALIVSYL--------ELP 257
              ++I G+       +     D   W   F + C I +  C + + +L        +L 
Sbjct: 248 IINDWISGIIVDRANPIKHWSWDIGMWAFIFPLSC-IPILCCLIHMQWLASQTDEWKQLK 306

Query: 258 PRHEDDKDRHWTSKLRDLDW----AGVVTLVCFLFLFMLVSSL-GGKEIAYDSVLFALLC 312
                 K   +   L D+ W     GV+ L  F+ L ++  +L GG +  +         
Sbjct: 307 KGKSYFKYYGYKDSLIDMFWRFDVVGVILLAAFIGLILIPLTLAGGTKSRWSEGKLIAPF 366

Query: 313 VTTLVLGSIFAYVELYVAVDPVLPIAFLKYRSV 345
           V   V+   FA  E + A  P++P   +K RS+
Sbjct: 367 VIGCVMVPCFAIWEKWFAKHPIMPWRLIKDRSI 399

>KNAG0J02980 Chr10 (571855..573765) [1911 bp, 636 aa] {ON} 
          Length = 636

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 93/446 (20%), Positives = 177/446 (39%), Gaps = 43/446 (9%)

Query: 96  ALDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPLLVFSNV 155
            LDG I         S ++    +S I     + S+  Q +Y +LSD  GR  LLV + V
Sbjct: 94  GLDGNIRYIYTGYATSSYSEHSLLSTINVINAVVSAASQIVYARLSDIYGRMSLLVVAIV 153

Query: 156 VFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQGLCNFIF 215
           ++++G +I   +  +     G      G  G+  +  +++SD   LR R  YQ +  + F
Sbjct: 154 LYAVGTIIQCQAYDVQRYAAGSIFYNAGYVGVILILLLILSDFSSLRWRLFYQFVPTWPF 213

Query: 216 GLGT-ASGGLVGAA--FQDWRMAFTIQCPISLASCA-LIVSYLELPPRHEDDKD------ 265
            + T  SG +   A   + W     +   I   SC  ++   + +  R  +D +      
Sbjct: 214 IINTWISGNITQKANPLKHWSWDIGMWAFIFPLSCVPILCCMIHMHWRVRNDPEWKELQG 273

Query: 266 -------RHWTSKLRDLDW----AGVVTLV-CFLFLFMLVSSLGGKEIAYDSVLFALLCV 313
                    W   L+ L W     GV+ +V C   + + ++  GG    ++        V
Sbjct: 274 EKTYFQIHGWKVTLKTLFWKLDVVGVLLMVACLGCILVPLTLAGGVSSKWNHSNIIGPFV 333

Query: 314 TTLVLGSIFAYVELYVAVDPVLPIAFLKYRSVLGS-SLANWFAMMSMLTTNYYLPVYWAS 372
              VL  IF+Y E   A +P++P   +K R V  +  ++     +  +  +Y   V   +
Sbjct: 334 LGFVLIPIFSYWEARWATNPLVPYKLVKDRGVWAALGISFLIDFIFYMAVDYLYTVLIVA 393

Query: 373 VLNMKPTDIGKRSIPSFFSVAFGSLGAGIYMKRTGKYYWFLLAFCGIGIL---------- 422
           V     +     S+ SF S     + A + + R  +    ++  C + +L          
Sbjct: 394 VHESVKSATRISSLSSFVSTVASPIVA-LALTRVTRMKPVIIVGCSLWLLAMGLLYHFRG 452

Query: 423 GQLKINLLTPATPVWQQYLLLVVPSFGLSVLITVTLLAMISAVPHEHHAATTSISYAFRS 482
           G+   + +  A  VW           G ++      +++ +A  H++ A  T+++Y    
Sbjct: 453 GRESHSGIIGALCVW---------GLGTTLFTYPVTVSVQAATNHDNMATVTALNYTLYR 503

Query: 483 TGATLGVSIGAAIFRSTLNTLLQNKV 508
            G+ +G ++  AI+  TL   L  ++
Sbjct: 504 IGSAVGAAVSGAIWTQTLYKQLLKRI 529

>YCL069W Chr3 (9706..11082) [1377 bp, 458 aa] {ON}  VBA3Permease of
           basic amino acids in the vacuolar membrane
          Length = 458

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 87/377 (23%), Positives = 152/377 (40%), Gaps = 44/377 (11%)

Query: 173 VVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQGLCNFIFGLGTASGGLVGAAFQ-- 230
           ++VGR V+ +GG GL  L  ++   +V  R R +   + +  F +    G ++G AF   
Sbjct: 4   LIVGRVVASVGGSGLQTLCFVIGCTMVGERSRPLVISILSCAFAVAAIVGPIIGGAFTTH 63

Query: 231 -DWRMAFTIQCPI-SLASCALIVSYLELPP---------------------RHEDDKDRH 267
             WR  F I  PI  LA    +++Y                          RH+ +  R 
Sbjct: 64  VTWRWCFYINLPIGGLAIIMFLLTYKAENKGILQQIKDAIGTISSFTFSKFRHQVNFKRL 123

Query: 268 WTSKLRDLDWAGVVTLVCFLFLFMLVSSLGGKEIAYDS-VLFALLCVTTLVLGSIFAYVE 326
               +   D+ G       L LF+L  + GG + +++S  + A L +  L+   IF+ V 
Sbjct: 124 MNGIIFKFDFFGFALCSAGLVLFLLGLTFGGNKYSWNSGQVIAYLVLGVLLF--IFSLVY 181

Query: 327 LYVAVDPVLPIA-FLKYRSVLGSSLANWFAMMS------MLTTNY-----YLPVYWASVL 374
            +   D   P    + YR +L   L    A++       +L T Y     Y   ++  + 
Sbjct: 182 DFFLFDKFNPEPDNISYRPLLLRRLVAKPAIIIINMVTFLLCTGYNGQMIYSVQFFQLIF 241

Query: 375 NMKPTDIGKRSIPSFFSVAFGSLGAGIYMKRTGKYYWFLLAFCGI-GILGQLKINLLTPA 433
                  G   IP   +    ++ +G+  K+ G     LL F G+ G++G   + L+T  
Sbjct: 242 ASSAWKAGLHLIPIVITNVIAAIASGVITKKLGLVKP-LLIFGGVLGVIGAGLMTLMTNT 300

Query: 434 TPVWQQYLLLVVPSFGLSVLITVTLL-AMISAVPHEHHAATTSISY-AFRSTGATLGVSI 491
           +    Q  +L++P F L   +  +L+ A +        AA   I   AF +   +LG ++
Sbjct: 301 STKSTQIGVLLLPGFSLGFALQASLMSAQLQITKDRPEAAMDFIEVTAFNTFMKSLGTTL 360

Query: 492 GAAIFRSTLNTLLQNKV 508
           G  +  +  +    NKV
Sbjct: 361 GGVLSTTVFSASFHNKV 377

>CAGL0J09944g Chr10 (976274..978052) [1779 bp, 592 aa] {ON} similar
           to uniprot|P53943 Saccharomyces cerevisiae YNL065w
          Length = 592

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 46/162 (28%), Positives = 72/162 (44%), Gaps = 7/162 (4%)

Query: 93  FLAALDGTIVSTLLTRIGSEFN-SLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPLLV 151
           F ++L   I    L ++  +F+   + V+     YLL         G L+D+ GR+P+L+
Sbjct: 110 FWSSLGSPIYYPALKQLEKQFDIDENMVNITVVVYLLFQGLAPTCSGGLADKFGRRPVLL 169

Query: 152 FSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQGLC 211
              +++ +  +    + S   +V  R V  IG      ++S V+ D     ER  + G  
Sbjct: 170 IGMLIYVVASIGLACAPSYGVIVFLRCVQSIGISPSIAISSGVVGDFTVKSERGTFVGAT 229

Query: 212 NFIFGLGTASGGLVGAAFQ---DWRMAF---TIQCPISLASC 247
           +    LG A G L+GAA     DWR  F   TI C  S A C
Sbjct: 230 SGFVLLGQAFGSLIGAALAAAWDWRAIFWFLTIGCGASFAIC 271

>NDAI0B03770 Chr2 complement(947945..949660) [1716 bp, 571 aa] {ON} 
          Length = 571

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 38/148 (25%), Positives = 71/148 (47%), Gaps = 4/148 (2%)

Query: 93  FLAALDGTIVSTLLTRIGSEFNSLDK-VSWIATSYLLSSSTCQPLYGKLSDQLGRKPLLV 151
           F +++ G I   +L+ I +EFN  ++ V+     Y +       + G L+D +GR+P+++
Sbjct: 89  FFSSIAGAIYYPVLSVIENEFNITEEMVNITVVVYFIFQGIAPSIMGGLADSMGRRPVVL 148

Query: 152 FSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQGLC 211
            S +V+   C+    S +   ++V R +   G   +  + S ++ D+    ER  Y G  
Sbjct: 149 SSVLVYCCACIGLACSHTYAQIIVLRCLQAAGISPVIAINSGIMGDITTRAERGGYVGYV 208

Query: 212 NFIFGLGTASGGLVGAAFQ---DWRMAF 236
           +    +G+A G L+GA       WR  F
Sbjct: 209 SGFQVIGSAFGALIGAGLSATWSWRSIF 236

>ZYRO0G07414g Chr7 complement(583978..586101) [2124 bp, 707 aa] {ON}
           similar to uniprot|P38731 Saccharomyces cerevisiae
           YHL040C ARN1 Transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates responsible for uptake of iron
           bound to ferrirubin ferrirhodin and related siderophores
          Length = 707

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 97/437 (22%), Positives = 177/437 (40%), Gaps = 41/437 (9%)

Query: 96  ALDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPLLVFSNV 155
            LD  I     + + + F+    +S +     + S+  Q +Y +L+D  GR  L + + V
Sbjct: 110 GLDSNIRFIYTSYVTNSFSEHSLLSTVNVINAVISAASQIVYARLADVFGRLTLFITAVV 169

Query: 156 VFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQGLCNFIF 215
            +S+G +I   S +I     G     +G  G+  +  +++SD   L+ R  YQ    + F
Sbjct: 170 FYSMGTVIQSQSYNIETYAAGSIFYNLGYVGVVLVLLLILSDFSSLKWRLFYQFAPTWPF 229

Query: 216 GLGT-ASGGLVGAAFQD---------WRMAFTIQCPISLASCALIVSYL-----ELPPRH 260
            + T  SG +   A            W   F + C + L  C L + +      E    +
Sbjct: 230 IINTWISGNITSRANPQENWSWDIGMWAFIFPLSC-VPLICCMLHMWWKARRTEEWKILN 288

Query: 261 EDD---KDRHWTSKLRDLDWA--------GVVTLVCFLFLFMLVSSLGGKEIAYDSVLFA 309
           E+    K     S +++L W           V+L C L    L    GG    +D     
Sbjct: 289 EEKTYFKTHGLVSFIKELFWKLDTIGTFIMTVSLGCILVPLTLA---GGTSSKWDDSQII 345

Query: 310 LLCVTTLVLGSIFAYVELYVAVDPVLPIAFLKYRSVLGS-SLANWFAMMSMLTTNYYLPV 368
              V  +VL  +    EL  A +P+LP   +K R+V  S S++  +  +  +  +Y   V
Sbjct: 346 GPLVLGVVLLPMLIVYELKWAREPILPWKLIKDRAVWASMSISFLYDFIFYMAYDYLYTV 405

Query: 369 YWASVLNMKPTDIGKRSIPSFFSVAFGSLGAGIYMKRTGKYYWFLLAFCGI-----GILG 423
              +V     +     S+ +F S  F    A +Y+ R  +   +++A CG+     G+L 
Sbjct: 406 MIVAVDESVKSATRISSLSAFVSTVFSPFFA-LYITRVTRLKPYIIAGCGLWMVAMGLLY 464

Query: 424 QLKINLLTPATPVWQQYLLLVVPSFGLSVLITVTLLAMISAVPHEHHAATTSISYAFRST 483
             +    + +  +      L V   G ++      +++ SA  HE+ A  TS++Y     
Sbjct: 465 HFRGGKSSHSGIIGG----LCVWGVGTTMFTYPVNVSVQSATSHENMATVTSLNYTLYRI 520

Query: 484 GATLGVSIGAAIFRSTL 500
           G+ +G+++   I+   L
Sbjct: 521 GSAVGIAVSGCIWTQNL 537

>Kpol_513.33 s513 complement(95274..97154) [1881 bp, 626 aa] {ON}
           complement(95274..97154) [1881 nt, 627 aa]
          Length = 626

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 109/473 (23%), Positives = 185/473 (39%), Gaps = 53/473 (11%)

Query: 130 SSTCQPLYGKLSDQLGRKPLLVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTC 189
           S+  Q  Y + SD  GR P+L+ S + + IG LI   +T I     G  +  +G  G   
Sbjct: 104 SAAGQIWYARASDIFGRTPILILSILFYFIGTLIESQATDISKYAAGSCIYALGYAGSVL 163

Query: 190 LASMVISDLVPLRERAVYQGLCNFIFGLGTASGGLVGA--------AFQDWRMAFTIQCP 241
           +  +++SD   L+ R V   +      + T  GG +           F  W   F +   
Sbjct: 164 VTQVLVSDYSTLKWRLVSSTVLFLPNIINTWVGGNITEDVGNRWQWGFGMWAFIFPL-AS 222

Query: 242 ISLASCALIVSYLELPPRHE------DDKDRHWTSKLRD-----LDWAGVVTLVCFLFLF 290
           I L  C   + YL +  + +        +   W   L D     LD  G++ LV F  L 
Sbjct: 223 IPLLCCLAHMKYLAIKNKEDVKLTISKPRSISWARHLYDIFFWKLDMLGLILLVAFFALI 282

Query: 291 MLVSSLG-GKEIAYDSVLFALLCVTTLVLG-SIFAYVELYVAVDPVLPIAFLKYRSVLGS 348
           ++  +L  G    + S  F +  V    L   +F   EL  A +P+ P+  +K R + G 
Sbjct: 283 LVPLTLAKGLHEGWGSAKFIVPEVLGWALALPLFLTWELKFASNPITPLDLIKDRGIYGG 342

Query: 349 -SLANWFAMMSMLTTNYYLPVYWASVLNMKPTDIGKRSIPSFFSV--AFGSLGAGIYMKR 405
             ++ +   +  + + Y   V   +V     +     S+ +F SV  AF      + ++R
Sbjct: 343 IGVSLFLEFVYDIGSTYLYTVLVVAVNESTKSATRITSLFTFVSVLTAFFLGFVVVKVRR 402

Query: 406 TGKYYWFLLA--FCGIGILGQLKINLLTPATPVWQQYLLLVVPSFGLSVL-ITVTLLAMI 462
           T ++  F +A  +   G+    +    + A  +      + V  FG   +   V +    
Sbjct: 403 TKEFIIFGIAMWYIAYGLFEHYRGGAESHAGII----AAVCVHGFGNGFIKFPVRVSTQA 458

Query: 463 SAVPHEHHAATTSISYAFRSTGATLGVSIGAAIFRSTL----NTLLQNKVLQFASDEHPR 518
           SA  H+  A  TS+  A    G   G +   A++ + L    + ++QN  L   + E P 
Sbjct: 459 SAKTHDRLAIATSLYLAAGDIGMAFGSATAGAMWTNILPAQIDMVIQNSTLAKIAYESP- 517

Query: 519 EELLRIINNAAHSANWVHK-EAPEFVRATLVECYHYASK--STFKFCLITMIL 568
              ++ I          HK ++PE  R  LV  Y Y  +       CLI  +L
Sbjct: 518 ---IKFIRT--------HKWDSPE--RQALVVAYRYIQRLLMIVALCLIIPLL 557

>KLTH0G09372g Chr7 (780184..781839) [1656 bp, 551 aa] {ON} similar
           to uniprot|P53943 Saccharomyces cerevisiae YNL065W AQR1
           Plasma membrane transporter of the major facilitator
           superfamily that confers resistance to short- chain
           monocarboxylic acids and quinidine
          Length = 551

 Score = 55.5 bits (132), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 59/247 (23%), Positives = 99/247 (40%), Gaps = 12/247 (4%)

Query: 18  IQDPSTGLAGFVANEVEQQDYNSRTGHDSYGATAVDDRTATSARCDLTFPPSETPEFALX 77
           ++ P  GL G    ++  QD  SR        ++ D R    +    +  P   P   L 
Sbjct: 22  LEKPVLGLEGDNTKKLLPQDAASRVTTREMRESSSDSRDRVESSGVNSKLPQGAPFTLLS 81

Query: 78  XXXXXXXXXXXFLGIFLAALDGTIVSTLLTRIGSEFN-SLDKVSWIATSYLLSSSTCQPL 136
                          F ++L   I    L ++  +FN S + V+     YL+       +
Sbjct: 82  HGQKWFMVALLTSAGFWSSLGSPIYYPALKQLEKKFNVSEEMVNITVVVYLIFQGIAPTI 141

Query: 137 YGKLSDQLGRKPLLVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVIS 196
            G L+D  GR+P+++   +++    +    S S   +V  R +   G   +  + S V+ 
Sbjct: 142 SGGLADVYGRRPVILMGMLIYVCASIGLACSQSYGVIVFLRCLQSAGISPIIAINSGVVG 201

Query: 197 DLVPLRERAVYQGLCNFIFGLGTASGGLVGAAFQ---DWRMAF---TIQCPISLASCALI 250
           D     ER  + G  +    +G A G L+GAA     DWR  F   TI C     +C +I
Sbjct: 202 DFTLKHERGTFVGAVSGFTLMGQAFGSLIGAALTAAFDWRAIFWFLTIGC----GTC-MI 256

Query: 251 VSYLELP 257
           +++L LP
Sbjct: 257 INFLILP 263

>YCL073C Chr3 complement(6479..8326) [1848 bp, 615 aa] {ON}
           GEX1Proton:glutathione antiporter localized to the
           vacuolar and plasma membranes; imports glutathione from
           the vacuole and exports it through the plasma membrane;
           has a role in resistance to oxidative stress and
           modulation of the PKA pathway
          Length = 615

 Score = 55.1 bits (131), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 107/453 (23%), Positives = 186/453 (41%), Gaps = 54/453 (11%)

Query: 93  FLAALDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLS---SSTCQPLYGKLSDQLGRKPL 149
           F  +LD T+ ST     G   NS  + S ++T  +++   S   Q +Y +LSD  GR  L
Sbjct: 71  FGISLDYTLRSTY---TGYATNSYSEHSLLSTVQVINAVVSVGSQVVYSRLSDHFGRLRL 127

Query: 150 LVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQG 209
            + + + + +G +I   +T +     G      G  G   L ++++SD   L+ R  YQ 
Sbjct: 128 FLVATIFYIMGTIIQSQATRLTMYAAGSVFYNCGYVGTNLLLTLILSDFSSLKWRMFYQY 187

Query: 210 LCNFIF-GLGTASGGLVGAAF--QDWRMAFTIQCPISLASCALIVSYLELPPRHEDDKDR 266
              + +  +   SG ++ AA   ++W     +   I   S AL + +L L  +++  K  
Sbjct: 188 ASYWPYIIIPWISGNIITAANPQKNWSWNIAMWAFIYPLS-ALPIIFLILYMKYKSSKTA 246

Query: 267 HWTS---KLRDLDWAGVVTLVCFLF-------LFMLVSSLG--------GKEIA---YDS 305
            W S   + R     G+   + FLF       + ++  SLG          E +   ++S
Sbjct: 247 EWRSLKEQARKERTGGLFENLVFLFWKLDIVGILLITVSLGCILVPLTLANETSQKWHNS 306

Query: 306 VLFALLCVTTLVLGSIFAYVELYVAVDPVLPIAFLKYRSVLGS-SLANWFAMMSMLTTNY 364
            + A L V+   L  IF Y E   A  P+LP   L  R +     +  +      ++ +Y
Sbjct: 307 KIIATL-VSGGCLFFIFLYWEAKFAKSPLLPFKLLSDRGIWAPLGVTFFNFFTFFISCDY 365

Query: 365 YLPVYWASVLNMKPTDIGKRSIPSFFSVAFGSLGAGIYMKRTGKYYWFLLAFCG-----I 419
             PV   S+     +     ++P F + A  S    + + +T K    ++  C      +
Sbjct: 366 LYPVLLVSMKESSTSAARIVNLPDFVA-ATASPFYSLLVAKTRKLKLSVIGGCAAWMVCM 424

Query: 420 GILGQLKINLLTPATPVWQQYLLLVVPSFGLSVL-----ITVTLLAMISAVPHEHHAATT 474
           G+  + +    +    +    ++      GLS L     + V L AM +   H   A  T
Sbjct: 425 GLFYKYRGGSGSHEGVIAASVIM------GLSGLLCSNSVIVILQAMTT---HSRMAVIT 475

Query: 475 SISYAFRSTGATLGVSIGAAIFRSTL-NTLLQN 506
            I Y F   GA +G S+  AI+  T+ N L +N
Sbjct: 476 GIQYTFSKLGAAIGASVSGAIWTQTMPNQLYKN 508

>Skud_13.25 Chr13 (37872..39485) [1614 bp, 537 aa] {ON} YML116W
           (REAL)
          Length = 537

 Score = 54.7 bits (130), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 96/418 (22%), Positives = 169/418 (40%), Gaps = 46/418 (11%)

Query: 100 TIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPLLVFSNVVFSI 159
           +I++ +    GS  NS    +W+  S+ L S +   + G+L D  G K +L    VV  I
Sbjct: 92  SIMNIIANSFGSNENSR---TWLMASFPLVSGSFILISGRLGDIYGLKKMLTIGYVVIII 148

Query: 160 GCLICGM---STSIWWVVVGRFVSGIGGCGLTCLASMVISDLV---PLRERAVYQ---GL 210
             LICG+   S S  + ++ R   G+G   +      +I ++      R+  V      +
Sbjct: 149 WSLICGLTKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVSGTFRKNIVISLVGAM 208

Query: 211 CNFIFGLGTASGGLVGAAF-QDWRMAFTIQCPISLASCALIVSYLELPPRHEDDKDRHWT 269
                 LG    GL+G    + W  AF      S+ + AL V  +   P +     +H++
Sbjct: 209 APVGATLGCLFAGLIGTKNPKQWPWAFYAYTITSIINLALSVYSI---PNNIPTNIQHFS 265

Query: 270 SKLRDLDWA----GVVTLVCFLFLFMLVSSLGGKEIAYDSVLFALLCVTTLVLGSIFAYV 325
                +DW     GV+ LV   F++      G     +D     +L V ++V   +F   
Sbjct: 266 -----MDWIGSALGVIGLVLMNFVWNQAPISG-----WDQAYIIVLLVISVVFLVVFIIY 315

Query: 326 ELYVAVDPVLPIAFLKYRSVLGSSLANWFAMMSMLTTNYYLPVYWASVLNMKPTDIGKRS 385
           E   A  P+LP A LK R ++   LA +F   S     +Y   Y+   LN++        
Sbjct: 316 ENRFAKSPLLPRAVLKDRHMIQIMLALFFGWGSFGIFTFY---YFQFQLNIRHYSAVWAG 372

Query: 386 IPSFFSVAFGSLGA---GIYMKRTGKYYWFLLAFCGIGILGQLKINLLTPATPVWQQYL- 441
              F  + +G + A   GIY+K+     +  L+     I      +++   TPV + Y  
Sbjct: 373 GTYFMFLIWGIIAALLVGIYIKKVSPSVFLFLSMMAFNIG-----SIMASVTPVHETYFR 427

Query: 442 ----LLVVPSFGLSVLITVTLLAMISAVPHEHHAATTSISYAFRSTGATLGVSIGAAI 495
                +++ SFG+      + +     +P E+     S+     +   +L + +GA +
Sbjct: 428 TQLGTMIILSFGMDFSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATV 485

>KLLA0A10439g Chr1 complement(913342..915246) [1905 bp, 634 aa] {ON}
           similar to uniprot|P38731 Saccharomyces cerevisiae
           YHL040C ARN1 Transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates responsible for uptake of iron
           bound to ferrirubin ferrirhodin and related siderophores
          Length = 634

 Score = 55.1 bits (131), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 96/446 (21%), Positives = 174/446 (39%), Gaps = 46/446 (10%)

Query: 96  ALDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPLLVFSNV 155
            LDG + S   T   + +++   +S I     +  +  Q +Y +LSD  GR  L V + V
Sbjct: 95  GLDGNLRSFYTTWATNSYSTHSLLSTIGVVNAVMGAASQIVYARLSDVYGRFTLFVTAIV 154

Query: 156 VFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQGLCNFIF 215
            + +G +I   +  +     G     IG  G+  +  +++SD   L+ R  Y  +  + F
Sbjct: 155 FYVVGTIIESQAHDVQRYAAGAVFYNIGYVGVILIVLLILSDFSSLKWRLFYSFVPTWPF 214

Query: 216 GLGT-ASGGLVGAAFQD---------WRMAFTIQCPISLASCALIV--------SYLELP 257
            + T  SG +V  A  +         W   F + C + L  C L +        ++ EL 
Sbjct: 215 IINTWISGNIVDVAKPEQNWSWDIAMWAFIFPLSC-LPLLGCMLHMKWRARQTEAWKELS 273

Query: 258 PRHEDDKDRHWTSKLRDLDWA----GVVTLVCFLFLFMLVSSL-GGKEIAYDSVLFALLC 312
            +    +       L  L W     GV  ++  L   ++  +L GG    +++       
Sbjct: 274 SQKTYYQTHGLVQSLVQLFWKLDVIGVFFMIIILGCILVPLTLAGGISNKWNNPHIIAPF 333

Query: 313 VTTLVLGSIFAYVELYVAVDPVLPIAFLKYRSVLGS-SLANWFAMMSMLTTNYYLPVYWA 371
           +   VL   F   E   A +P+ P   L+ R +  +  +A     +  +   Y   +   
Sbjct: 334 ILGFVLIPFFIAWESKWAREPIAPFKLLRDRGIWAALCIAFLINFIFTMAAGYLYTILMV 393

Query: 372 SVLNMKPTDIGKRSIPSFFSVAFGSLGAGIYMKRTGKYYWFLLAFC-----GIGIL---- 422
           +V     +     S+ +F S  F    A +++ R  +   F++A C      +GIL    
Sbjct: 394 AVNESVTSATRISSVSTFTSTVFSPFFA-LFITRFTRLKPFIIAGCSLWMVAMGILFHFR 452

Query: 423 -GQLKINLLTPATPVWQQYLLLVVPSFGLSVLITVTLLAMISAVPHEHHAATTSISYAFR 481
            GQ     +  A  VW           G ++      +++ S   HE+ A  T++SY   
Sbjct: 453 SGQNSDKGIIGALVVW---------GLGTTMFTYPVTVSLQSVTSHENMATVTALSYTMY 503

Query: 482 STGATLGVSIGAAIFRSTL-NTLLQN 506
             G+ +G ++  AI+   L   LLQ+
Sbjct: 504 RIGSAVGSAVSGAIWTQLLYKQLLQH 529

>Suva_5.2 Chr5 (3340..5223) [1884 bp, 627 aa] {ON} YEL065W (REAL)
          Length = 627

 Score = 54.7 bits (130), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 124/530 (23%), Positives = 208/530 (39%), Gaps = 56/530 (10%)

Query: 89  FLGIFLAA----LDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQL 144
           F  IFL A    LDG I  T      S ++    +S +     + ++  Q  + +LSD  
Sbjct: 74  FFSIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIF 133

Query: 145 GRKPLLVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRER 204
           GR  +LV S + +S+G +I   + +I    VG     +G  G+  +  ++ SD   L  R
Sbjct: 134 GRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLGLTGVILILEVIASDFSNLNWR 193

Query: 205 AVYQGLCNFIFGLGT-ASGGLVGAAFQDWR-----MAFTIQCP-ISLASCALIVSYLELP 257
            +   +    F + T  SG +  A   +W+      AF +    I L  C L + YL   
Sbjct: 194 LLALFVPALPFIVNTWISGDVTSAIGTNWKWGIGMWAFILPLACIPLGLCMLHMRYLA-- 251

Query: 258 PRHEDDKDRHWTSKLRDLDWAGVVTLVCF----LFLFMLVSSLGG------------KEI 301
            +H  DK R     L +LDW      + F    L   +LV++  G            KE 
Sbjct: 252 RKHAKDKLRPEFETLNNLDWKSFSIDIVFWKLDLIGLLLVTAFFGCVLVPFTLAGGLKEE 311

Query: 302 AYDSVLFALLCVTTLVLGSIFAYVELYVAVDPVLPIAFLKYRSVLGSSLANWFAMMS-ML 360
              + +     +  +V   ++   E+  +  P+ P   +K R VL +    +F   +  +
Sbjct: 312 WKAAHIIVPEVIGWVVALPLYMVWEVKYSRHPLTPWDLIKDRGVLFALFIAFFINFNWYM 371

Query: 361 TTNYYLPVYWASVLNMKPTDIGKRSIPSFFSVAFGSLGAGIYMK--RTGKYYWFLLA--F 416
             +Y   V   +V     +     ++ SF SV  G++   I +K  RT  +  F ++   
Sbjct: 372 QGDYMYTVLVVAVHESIKSATRITALYSFVSVIVGTILGFILIKVRRTKPFILFGISCWI 431

Query: 417 CGIGILGQLKINLLTPATPVWQQYLLLVVPSFGLSVLITVTLLAM-ISAVPHEHHAATTS 475
              G+L   + +    A  +    LL     FG      VT  ++  SA  H   A  TS
Sbjct: 432 VSFGLLVHYRGDSGAHAGIIGSLCLL----GFGAGSFTYVTQASIQASAGTHARMAIVTS 487

Query: 476 ISYAFRSTGATLGVSIGAAIFRSTLNTLLQNKVLQFASDEHPREELLRIINNAAHSANWV 535
           +  A  + G+  G S+  A++ + L   +  ++    SD     E          +  W 
Sbjct: 488 LYLATYNIGSAFGSSVSGAVWTNILPKEISKRI----SDPTLAAEAYGSPFTFITTYTW- 542

Query: 536 HKEAPEFVRATLVECYHYASKSTFKFCLITMI----LAGASCSIIQEHTL 581
               PE  R  LV  Y Y  K     C+I ++    L G +C +++ H L
Sbjct: 543 --GTPE--RIALVMSYRYVQK---ILCIIGLVFCFPLLGCAC-MLRNHKL 584

>YHL040C Chr8 complement(19088..20971) [1884 bp, 627 aa] {ON}
           ARN1Transporter, member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates; responsible for uptake of
           iron bound to ferrirubin, ferrirhodin, and related
           siderophores
          Length = 627

 Score = 54.3 bits (129), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 94/434 (21%), Positives = 171/434 (39%), Gaps = 35/434 (8%)

Query: 96  ALDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPLLVFSNV 155
            LDG I         S ++    +S I     + S+  Q +Y +LSD  GR  L + + +
Sbjct: 89  GLDGNIRYIYTGYATSSYSEHSLLSTINVINAVVSAASQIIYARLSDVFGRLYLFISAVI 148

Query: 156 VFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQGLCNFIF 215
           ++ +G +I   +  +     G      G  G+  +  +++SD   L+ R +YQ +  + F
Sbjct: 149 LYVVGTIIQSQAYDVQRYAAGAIFYNAGYVGVILILLIILSDFSSLKWRLLYQFVPTWPF 208

Query: 216 GLGTASGGLVGAAFQD----------WRMAFTIQC-PISLASCALIVSYLELPPRHEDDK 264
            + T   G + +              W   F + C PI L    +     + P  H    
Sbjct: 209 IINTWIAGNITSRANPVVNWSWDVGMWAFIFPLSCVPIVLCMLHMQWRARKTPEWHALKG 268

Query: 265 DRHWTSK------LRDLDW----AGVVTLVCFLFLFMLVSSLGG--KEIAYDSVLFALLC 312
            + +  +      L+ L W     GV+ + C L   ++  +L G  K    DS L     
Sbjct: 269 QKSYYQEHGFIKILKQLFWMLDVVGVLLMGCSLGCILVPLTLAGGVKTTWNDSRLIGPF- 327

Query: 313 VTTLVLGSIFAYVELYVAVDPVLPIAFLKYRSVLGS-SLANWFAMMSMLTTNYYLPVYWA 371
           V   VL  I    E   A DP+LP   +K R+V  S  ++     +  +  +Y   V   
Sbjct: 328 VLGFVLIPILWIWEYRFARDPILPYRLVKDRAVWSSMGISFLIDFIYYMAADYLYTVMIV 387

Query: 372 SVLNMKPTDIGKRSIPSFFSVAFGSLGAGIYMKRTGKYYWFLLAFCGI-----GILGQLK 426
           +V     +     ++ SF S       A + + R  +   F++  C +     G+L   +
Sbjct: 388 AVNESVKSATRIATLSSFVSTVASPFFA-LLVTRCTRLKPFIMFGCALWMVAMGLLYHFR 446

Query: 427 INLLTPATPVWQQYLLLVVPSFGLSVLITVTLLAMISAVPHEHHAATTSISYAFRSTGAT 486
               + +  +      L V   G ++      +++ SAV HE+ A  T+++Y     G+ 
Sbjct: 447 GGSQSHSGIIGA----LCVWGVGTTLFTYPVTVSVQSAVSHENMATVTALNYTLYRIGSA 502

Query: 487 LGVSIGAAIFRSTL 500
           +G ++  AI+  TL
Sbjct: 503 VGSAVSGAIWTQTL 516

>YKR106W Chr11 (661442..663289) [1848 bp, 615 aa] {ON}
           GEX2Proton:glutathione antiporter localized to the
           vacuolar and plasma membranes; expressed at a very low
           level; almost identical to paralog Gex1p; potential role
           in resistance to oxidative stress and modulation of the
           PKA pathway
          Length = 615

 Score = 53.9 bits (128), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 106/453 (23%), Positives = 185/453 (40%), Gaps = 54/453 (11%)

Query: 93  FLAALDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLS---SSTCQPLYGKLSDQLGRKPL 149
           F  +LD T+ ST     G   NS  + S ++T  +++   S   Q +Y +LSD  GR  L
Sbjct: 71  FGISLDYTLRSTY---TGYATNSYSEHSLLSTVQVINAVVSVGSQVVYSRLSDHFGRLRL 127

Query: 150 LVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQG 209
            + + + + +G +I   +T +     G      G  G   L ++++SD   L+ R  YQ 
Sbjct: 128 FLVATIFYIMGTIIQSQATRLTMYAAGSVFYNCGYVGTNLLLTLILSDFSSLKWRMFYQY 187

Query: 210 LCNFIF-GLGTASGGLVGAAF--QDWRMAFTIQCPISLASCALIVSYLELPPRHEDDKDR 266
              + +  +   SG ++ AA   ++W     +   I   S   I+ +L L  +++  K  
Sbjct: 188 ASYWPYIIIPWISGNIITAANPQKNWSWNIAMWAFIYPLSTLPII-FLILYMKYKSSKTA 246

Query: 267 HWTS---KLRDLDWAGVVTLVCFLF-------LFMLVSSLG--------GKEIA---YDS 305
            W S   + R     G+   + FLF       + ++  SLG          E +   ++S
Sbjct: 247 EWRSLKEQARKERTGGLFENLVFLFWKLDIVGILLITVSLGCILVPLTLANETSQKWHNS 306

Query: 306 VLFALLCVTTLVLGSIFAYVELYVAVDPVLPIAFLKYRSVLGS-SLANWFAMMSMLTTNY 364
            + A L V+   L  IF Y E   A  P+LP   L  R +     +  +      ++ +Y
Sbjct: 307 KIIATL-VSGGCLFFIFLYWEAKFAKSPLLPFKLLSDRGIWAPLGVTFFNFFTFFISCDY 365

Query: 365 YLPVYWASVLNMKPTDIGKRSIPSFFSVAFGSLGAGIYMKRTGKYYWFLLAFCG-----I 419
             PV   S+     +     ++P F + A  S    + + +T K    ++  C      +
Sbjct: 366 LYPVLLVSMKESSTSAARIVNLPDFVA-ATASPFYSLLVAKTRKLKLSVIGGCAAWMVCM 424

Query: 420 GILGQLKINLLTPATPVWQQYLLLVVPSFGLSVL-----ITVTLLAMISAVPHEHHAATT 474
           G+  + +    +    +    ++      GLS L     + V L AM +   H   A  T
Sbjct: 425 GLFYKYRGGSGSHEGVIAASVIM------GLSGLLCSNSVIVILQAMTT---HSRMAVIT 475

Query: 475 SISYAFRSTGATLGVSIGAAIFRSTL-NTLLQN 506
            I Y F   GA +G S+  AI+  T+ N L +N
Sbjct: 476 GIQYTFSKLGAAIGASVSGAIWTQTMPNQLYKN 508

>CAGL0G08624g Chr7 complement(811931..813682) [1752 bp, 583 aa] {ON}
           similar to uniprot|P40474 Saccharomyces cerevisiae
           YIL121w
          Length = 583

 Score = 53.9 bits (128), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 41/152 (26%), Positives = 72/152 (47%), Gaps = 5/152 (3%)

Query: 89  FLGIFLAALDGTIVSTLLTRIGSEFNSLDK-VSWIATSYLLSSSTCQPLYGKLSDQLGRK 147
           + G+F + + G I   +L+ I  +F+  ++ V+     Y +       L G L+D LGR+
Sbjct: 89  YTGLF-STMAGAIYYPVLSVIEKQFHITEELVNITVVVYFIFQGIAPTLMGGLADSLGRR 147

Query: 148 PLLVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVY 207
           P+++F+  V+   C+    + +   +VV R +   G   +  + S +I D+    ER  Y
Sbjct: 148 PVVLFAVTVYFGACIGLACAQTYAQIVVLRCLQAAGISPVIAINSGIIGDVTTRAERGGY 207

Query: 208 QGLCNFIFGLGTASGGLVGAAFQD---WRMAF 236
            G  +    LG+A G L+GA       WR  F
Sbjct: 208 VGYISGFQVLGSAFGALIGAGLSSRWGWRSIF 239

>TDEL0G05000 Chr7 (938512..939072) [561 bp, 186 aa] {ON} 
          Length = 186

 Score = 51.6 bits (122), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 41/167 (24%), Positives = 70/167 (41%), Gaps = 6/167 (3%)

Query: 422 LGQLKINLLTPATPVWQQYLLLVVPSFGLSVLITVTLLAMISAVPHEHHAATTSISYAFR 481
           LG      +   +P W   L L+  + G  +    TL   I A P    A  TS  Y FR
Sbjct: 20  LGNFLFLFIEKGSPNWLVGLFLIPANLGQGITFPATLFTFIFAFPKSRQATATSTLYLFR 79

Query: 482 STGATLGVSIGAAIFRSTLNTLLQNKVLQFASDEHPREELLRIINNAAHSANWVHKEAPE 541
           S G+  GV++   + +      L++ +     ++   E + +I +N+++    +H E  +
Sbjct: 80  SIGSVWGVAMSTGVIQLYFGKSLRSNLKDLLDEDKINELVTKITSNSSYIEK-LHGELKD 138

Query: 542 FVRATLVECYHYASKSTFKFCLITMILAGASCSIIQEHTLHTTLKRD 588
            V   L+     A K T     I  +LA A C +I+E      +K +
Sbjct: 139 VVIDVLI----LARKKTHLLSTILSLLALAFC-VIKEFLKKPKIKEE 180

>Kpol_416.6 s416 (26742..28535) [1794 bp, 597 aa] {ON}
           (26742..28535) [1794 nt, 598 aa]
          Length = 597

 Score = 53.9 bits (128), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 106/498 (21%), Positives = 200/498 (40%), Gaps = 63/498 (12%)

Query: 130 SSTCQPLYGKLSDQLGRKPLLVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTC 189
           S+  Q  + + SD  GR  +L+ + + + +G ++   +  +     G  +  +G  G+  
Sbjct: 113 SAAGQIWFARASDLFGRGTILIVAVMFYVVGTIVESQAVDVSKFAAGACLFQLGYDGVVM 172

Query: 190 LASMVISDLVPLRERAV---YQGLCNFIFGLGTASGGLVGAAFQDWRMAFTIQC---PIS 243
           +  +++SD   L  R     +  L N I      SG +  A  ++W+    +     P+S
Sbjct: 173 MVQILVSDFSNLNWRVTAVAFPVLPNVINTW--VSGDIASAVDENWKWGIGMWAFIFPLS 230

Query: 244 LASCALIVSYLELPPRHEDD---------KDRHWTSKLRD-----LDWAGVVTLVCFLFL 289
                +++ +++   R  +D         +D  W   L +     LD+ G++  V F  L
Sbjct: 231 CIPFGILLLHMKYLARKNNDTLKSSFDKPEDITWKQYLTEIFLWKLDFIGLLLAVAFFGL 290

Query: 290 FMLVSSLGGKEIAYDSVLFALLCVTTLVLGSIFAYV-----ELYVAVDPVLPIAFLKYRS 344
            ++  +L G     +        +   VLG + A+      E+  A  P+ P   +K R 
Sbjct: 291 VLVPFTLAG---GLNKKWKTARIIVPEVLGWVVAFPAFLTWEIKFAKYPLTPWKTVKDRG 347

Query: 345 VLGSSLANWFAMMSM-LTTNYYLPVYWASVLNMKPTDIGKRSIPSFFSVAFGSLGAGIYM 403
           V  + +   F   +  +   Y   +   +V   K +     S+ +F +   G+L   + +
Sbjct: 348 VFSALIIAIFLQTAFYMQKTYMYTILLVAVNQTKKSATRINSLFTFVTALSGTLLGLVIV 407

Query: 404 K--RTGKYYWFLLA--FCGIGILGQLKINLLTPATPVWQQYLL-LVVPSFGLSVLITVTL 458
           K  RT ++ +F +A  F   G+L +      T  T  +   +  L +  FG   +   T 
Sbjct: 408 KVRRTKEFIFFGIAVWFLSFGLLERY-----TGGTNAYAGIIAALCLLGFGNGFIKYPTK 462

Query: 459 LAM-ISAVPHEHHAATTSISYAFRSTGATLGVSIGAAIFRSTL----NTLLQNKVLQFAS 513
            +M  SA+ HE  A  TS+  A  + G ++G S+  AI+ + L       L N  L   +
Sbjct: 463 ASMQASALTHEMMAIITSLFMAISTIGTSVGSSVAGAIWTNVLPDKIEKGLNNSTLANFA 522

Query: 514 DEHPREELLRIINNAAHSANWVHKEAPEFVRATLVECYHYASKSTF--KFCLITMILAGA 571
              P + +L+         NW   E+PE  R  +V  Y +  K       C +  +L GA
Sbjct: 523 YNSPTKFILQY--------NW---ESPE--RQIVVNAYKHVEKILIIVGLCFLVPLLGGA 569

Query: 572 SCSIIQEHTLHTTLKRDK 589
              +++   L   +  DK
Sbjct: 570 --FLLRNQRLEDAVALDK 585

>NDAI0H00140 Chr8 complement(10247..12145) [1899 bp, 632 aa] {ON} 
          Length = 632

 Score = 53.9 bits (128), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 100/454 (22%), Positives = 175/454 (38%), Gaps = 55/454 (12%)

Query: 96  ALDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPLLVFSNV 155
            LDG I         S +     +S +     + S+  Q +Y +LSD  GR  L V + V
Sbjct: 85  GLDGNIRYIYTGYATSSYAEHSLLSTVTVINAVVSAASQIVYSRLSDFFGRFILFVIAIV 144

Query: 156 VFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQGLCNFIF 215
           ++ +G +I   +  +     G      G  G+  +  +++SD   L+ R  YQ    + F
Sbjct: 145 LYVVGTIIQSQAYDVQRYAAGAIFYNAGYVGVLLILLLILSDFSSLKWRLFYQFAPTWPF 204

Query: 216 GLGT-ASGGLVGAA---------FQDWRMAFTIQCPISLASCAL---------------- 249
            + T  SG +  AA            W   F + C I +  C +                
Sbjct: 205 IINTWISGNITLAANPLVHWSWDVGMWAFIFPLSC-IPMLLCMIHMQWKASKTEEWKELK 263

Query: 250 -IVSYLELPPRHEDDKDRHWTSKLRDLDWAGVVTLVCFLFLFMLVSSL-GGKEIAYDSVL 307
              SY E        K+  W      LD  GV+ +V +L   ++  +L GG +  ++   
Sbjct: 264 KEKSYYEKHGLLLTLKELFWR-----LDIIGVLLMVAWLGCILVPLTLAGGVKSKWNDGR 318

Query: 308 FALLCVTTLVLGSIFAYVELYVAVDPVLPIAFLKYRSVLGS-SLANWFAMMSMLTTNYYL 366
                V   VL  IFA  E + A DP++P A +K R V  S  ++     +  + ++Y  
Sbjct: 319 IIGPFVLGFVLVPIFAAWEYFFARDPLIPYALIKDRGVWASMGISFLIDFIFYMASDYLY 378

Query: 367 PVYWASVLNMKPTDIGKRSIPSFFSVAFGSLGAGIYMKRTGKYYWFLLAFCGIGIL---- 422
            V   +V     +     S+ SF S       A + + R  +   F++  C + +L    
Sbjct: 379 TVLIVAVHESVKSATRISSLSSFVSTVASPFFA-LLLTRCSRLKPFIMVGCSLWMLSMGL 437

Query: 423 ------GQLKINLLTPATPVWQQYLLLVVPSFGLSVLITVTLLAMISAVPHEHHAATTSI 476
                 G+   + +  A  VW           G ++      +++ SA  HE+ A  T+I
Sbjct: 438 LYHFRGGEQSHSGIIGALCVW---------GIGTTLFTYPVNVSVQSATSHENMATVTAI 488

Query: 477 SYAFRSTGATLGVSIGAAIFRSTLNTLLQNKVLQ 510
           +Y     G+ +G ++  AI+   L   +  +V +
Sbjct: 489 NYTCYRLGSAIGAAVSGAIWTQKLYPDILKRVTE 522

>KAFR0J00930 Chr10 (168674..170374) [1701 bp, 566 aa] {ON} Anc_2.242
           YNL065W
          Length = 566

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 48/172 (27%), Positives = 78/172 (45%), Gaps = 12/172 (6%)

Query: 93  FLAALDGTIVSTLLTRIGSEFN-SLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPLLV 151
           F ++L   I    L  +  +FN   +KV+     YLL       + G L+D  GR+P+++
Sbjct: 101 FWSSLGSPIYYPALKELEQKFNIDENKVNVTVVVYLLFQGVAPAISGGLADVYGRRPVIL 160

Query: 152 FSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQGLC 211
              ++F +  +    + S   +V  R +  IG      ++S V+SD    RER  + G  
Sbjct: 161 GGMLIFVVASIGIAKAPSYGVIVFLRCIQSIGISPTIAISSGVVSDFTVKRERGTFVGAT 220

Query: 212 NFIFGLGTASGGLVGA---AFQDWRMAF---TIQCPISLASCALIVSYLELP 257
           + +  +G   G L+GA   A   WR  F   TI C     SC +I+ +  LP
Sbjct: 221 SGLVLIGQGIGPLLGAVITAALHWRAVFWFLTIGC----GSC-MIIGFFLLP 267

>Kpol_1053.24 s1053 (36161..38023) [1863 bp, 620 aa] {ON}
           (36161..38023) [1863 nt, 621 aa]
          Length = 620

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 36/118 (30%), Positives = 60/118 (50%), Gaps = 6/118 (5%)

Query: 93  FLAALDGTIVSTLLTRIGSEFNSLD----KVSWIATSYLLSSSTCQPLYGKLSDQLGRKP 148
           F+   D   +ST L  IG++ +  +       +I  +  L +       G  +D  GRKP
Sbjct: 131 FMFGYDTGYISTALISIGTDLDHKELTYGNKEFITAATSLGALISSIFAGISADIFGRKP 190

Query: 149 LLVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIG-GCGLTCLASMVISDLVPLRERA 205
            ++ SN++F IG +I   + + W +VVGRF+ G G G G + +A + IS++ P   R 
Sbjct: 191 CILLSNLMFLIGAIIQVTAHTFWQMVVGRFIMGFGVGIG-SLIAPLYISEIAPKNIRG 247

>NCAS0C04760 Chr3 (969811..971634) [1824 bp, 607 aa] {ON} Anc_3.84
          Length = 607

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 52/200 (26%), Positives = 89/200 (44%), Gaps = 22/200 (11%)

Query: 93  FLAALDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTC------QPLYGKLSDQLGR 146
           F+   D   +S+ L  IG++ +  +KV       +++++T         + G  +D  GR
Sbjct: 122 FMFGYDTGYISSALVSIGTDLD--NKVLSYGDKEIITAATSLGALITSTMAGTAADIFGR 179

Query: 147 KPLLVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIG-GCGLTCLASMVISDLVPLRERA 205
           +P L+FSNV+F IG ++   +   W + VGR + G G G G + ++ + IS++ P     
Sbjct: 180 RPCLMFSNVMFVIGAILQITAHKFWQMAVGRLIMGFGVGIG-SLISPLFISEIAP----K 234

Query: 206 VYQGLCNFIFGLGTASGGLV----GAAFQDWRMAFTIQCPISLASCALIVSYLELPPRHE 261
           + +G    I  L    G L+    GA        + I   +SL    L  S+    P   
Sbjct: 235 MIRGRLTVINSLWLTGGQLIAYGCGAGLNHVNNGWRILVGLSLIPTVLQFSFFLFLP--- 291

Query: 262 DDKDRHWTSKLRDLDWAGVV 281
            D  R++  K R  D   V+
Sbjct: 292 -DTPRYYVMKGRYDDAKSVL 310

>KAFR0C01480 Chr3 complement(301605..303338) [1734 bp, 577 aa] {ON}
           Anc_3.84 YDR497C
          Length = 577

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 63/119 (52%), Gaps = 8/119 (6%)

Query: 93  FLAALDGTIVSTLLTRIGSEFNSLD----KVSWIATSYLLSSSTCQPLYGKLSDQLGRKP 148
           F+   D   +S+ L  IG++ ++ +       +I  +  L +       G  +D  GRKP
Sbjct: 92  FMFGYDTGYISSALVSIGTDLDNKELTYGDKEFITAATSLGALISSIFAGVAADMYGRKP 151

Query: 149 LLVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIG-GCGLTCLASMVISDLVP--LRER 204
            L+FSNV+F IG ++   +++ W + VGR + G G G G + ++ + IS++ P  LR R
Sbjct: 152 CLMFSNVMFLIGAILQISASNFWQMTVGRLIMGFGVGIG-SLISPLFISEIAPKMLRGR 209

>TBLA0E03800 Chr5 (956468..958294) [1827 bp, 608 aa] {ON} Anc_2.241
           YIL121W
          Length = 608

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 42/152 (27%), Positives = 75/152 (49%), Gaps = 5/152 (3%)

Query: 89  FLGIFLAALDGTIVSTLLTRIGSEFN-SLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRK 147
           F G+F +++ G+I   +L+ +  EF  + ++V+     Y +  +    L G L+D LGR+
Sbjct: 107 FTGLF-SSIAGSIYYPVLSVMEKEFYITEEQVNVSVVVYFIFQALSPTLMGGLADSLGRR 165

Query: 148 PLLVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVY 207
           P+++ S V++   C+     T+   ++  R +   G   +  + S ++ D+    ER  Y
Sbjct: 166 PVVLSSIVLYFCACIGLARCTNYSQLIGLRCLQAAGISPVIAVNSGIMGDVTTKAERGGY 225

Query: 208 QGLCNFIFGLGTASGGLVGAAFQ---DWRMAF 236
            GL +    LGTA G L+GA       WR  F
Sbjct: 226 MGLVSGTQVLGTAFGALIGAGLSSRWSWRSIF 257

>Suva_8.435 Chr8 (786917..788464) [1548 bp, 515 aa] {ON} YOR378W
           (REAL)
          Length = 515

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 95/414 (22%), Positives = 163/414 (39%), Gaps = 51/414 (12%)

Query: 109 IGSEFNSLD--KVSWIATSYLLSSSTCQPLYGKLSDQLGRKPLLVFSNVVFSIGCLICGM 166
           IG  F + +  ++SW A+SY L+  T   + G+L D  G +   +     +++  L+ G 
Sbjct: 71  IGDSFGTTNPGQLSWFASSYSLTVGTFILIAGRLGDIFGHRKFFILGFFWYALWSLLAGF 130

Query: 167 ---STSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQGLCNFIFGLGTASGG 223
              S  I++     F     G G   L    I+ L    +    + +   +FG     G 
Sbjct: 131 SVYSNKIFFDCCRAFQ----GMGPAFLLPNAIAILGRTYKPGKRKNMVFSLFGASAPGGF 186

Query: 224 LVGAAFQD-------WRMAF---TIQCPISLASCALIVSYLELPPRHEDDKDRHWTSKLR 273
           ++GA F         W  A+    I C +   +   ++ ++++P R     +      L 
Sbjct: 187 VLGAVFSSMLGQLAWWPWAYWIMGIACFLLAVAGYFVIPHVQMPSRDSPSFNM-----LE 241

Query: 274 DLDWAGVVTLVCFLFLFMLVSSLG---GKEIAYDSVLFALLCVTTLVLGSIFAYVELYVA 330
            +D+AG VT V  L LF    + G   G E  Y  V   LL V T+ LG +F ++E   A
Sbjct: 242 RVDFAGSVTGVIGLILFNFAWNQGPVVGWETPYTYV---LLIVGTVFLG-VFVFIESRAA 297

Query: 331 VDPVLPIAFLKYRS--VLGSSLANWFAMMSMLTTNYYLPVYWASVLNMKPTDIGKRSIPS 388
             P+LP A L   +  VLG   A W +    +   +Y   +        P     +  P 
Sbjct: 298 Y-PLLPFAALSSDAAFVLGCIAAGWSSFGIWI---FYTWQFMEESRKQSPLLSSAQFAPV 353

Query: 389 FFSVAFGSLGAGIYMKRTGKYYWFLLAFCG--IGILGQLKINLLTPATPVWQQY-----L 441
             S    ++  G  +  T      L A     +GI       +L    PV Q Y     +
Sbjct: 354 AISGFCAAVTTGFLLSHTPASTVMLFAMTAFTVGI-------ILIATAPVHQTYWAQTFV 406

Query: 442 LLVVPSFGLSVLITVTLLAMISAVPHEHHAATTSISYAFRSTGATLGVSIGAAI 495
            ++V  +G+ +      + + +++PHEH     S+     +   ++G+ I   I
Sbjct: 407 SIIVMPWGMDMSFPAATIMLSNSMPHEHQGLAASLVNTVVNYSISIGLGIAGTI 460

>KLLA0C19272g Chr3 complement(1717903..1719774) [1872 bp, 623 aa]
           {ON} similar to uniprot|P38724 Saccharomyces cerevisiae
           YHL047C ARN2 Transporter or YHL040C uniprot|P38731
           Saccharomyces cerevisiae YHL040C ARN1 Transporter,
           member of the ARN family of transporters that
           specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to the siderophore
           triacetylfusarinine C,
          Length = 623

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 73/283 (25%), Positives = 118/283 (41%), Gaps = 30/283 (10%)

Query: 89  FLGIFLAALDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKP 148
           FL  +   LDG++ S   T   + +++   +S I+   L+  ++ Q  + +LSD  GR  
Sbjct: 75  FLCSYGYGLDGSVRSVYTTYATNSYSTHSLLSTISIINLVIGASAQVFFARLSDVFGRLT 134

Query: 149 LLVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQ 208
           LL+ + V +S+G +I   +  +     G     +G  G+     +++SD   LR R  Y 
Sbjct: 135 LLIVATVFYSVGTIIQSQAYDVQRYAAGAVFYNVGLVGVVLQVILILSDFSSLRWRLFYT 194

Query: 209 GLCNFIFGLGT-ASGGLVGAA--FQDWRMA-------FTIQCPISLASCALIVSYLELPP 258
            + ++ F +    SG +V AA   ++W  +       F + C + L  C L + Y     
Sbjct: 195 FVPSWPFIINMWVSGNVVNAANPLENWSWSIGMWAFIFPLTC-LPLVCCILHMRYRASKT 253

Query: 259 ---RHEDDKDRHWTSK---------LRDLDWAGV----VTLVCFLFLFMLVSSLGGKEIA 302
              RH   +  ++ S             LD  GV    VTL C L    L    GG    
Sbjct: 254 EAWRHLQLEKTYYQSHGLLQTLIQLFWKLDVVGVLLLTVTLGCILVPLTLA---GGVSQK 310

Query: 303 YDSVLFALLCVTTLVLGSIFAYVELYVAVDPVLPIAFLKYRSV 345
           +++       V   VL  IF   E   A+DP+ P   LK R V
Sbjct: 311 WNNPHVIAPFVLGFVLLPIFVVWESKWALDPIAPFELLKDRGV 353

>KLTH0D00506g Chr4 (47320..49170) [1851 bp, 616 aa] {ON} similar to
           uniprot|P38731 Saccharomyces cerevisiae YHL040C ARN1
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to ferrirubin
           ferrirhodin and related siderophores
          Length = 616

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 92/424 (21%), Positives = 171/424 (40%), Gaps = 69/424 (16%)

Query: 131 STCQPLYGKLSDQLGRKPLLVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCL 190
           +  Q +Y +L+D  GR  L + + V +++G +I   +  +     G     IG  G+  +
Sbjct: 112 AASQLVYARLADTFGRLSLFITAIVFYAVGTIIQSQAYDVQRYAAGAVFYNIGYVGVILV 171

Query: 191 ASMVISDLVPLRERAVYQGLCNFIFGLGT-ASGGLVGAAFQD---------WRMAFTIQC 240
             +++SD   LR R +Y  +  + F + T  SG +  AA  +         W   F + C
Sbjct: 172 LLLMLSDFSSLRWRLLYTIVPTWPFIINTWISGNITSAAKPETNWSWDIGMWAFIFPLSC 231

Query: 241 PISLASCALIVSYLELPPRH-------EDDKDRHWTSKLRD--------LDWAGVVTLVC 285
            + L +C +   ++ +  R        + +K    T+ L D        LD  GV+ L+ 
Sbjct: 232 -VPLIACMI---HMRIKARKTPEWIALKQEKSYFQTNGLWDTLVELFWKLDVVGVLLLIA 287

Query: 286 FLFLFMLVSSL-GGKEIAYDSVLFALLCVTTLVLGSIFAYVELYVAVDPVLPIAFLKYRS 344
            L   ++  +L GG    +++       V   VL  I  + E+  A DP++P   +K R 
Sbjct: 288 TLGCILVPLTLAGGYNSKWNNPHIIGPFVLGFVLVPILMFWEMRWARDPLVPYGLIKDRG 347

Query: 345 V---LGSSLANWFA-------MMSMLTTNYYLPVYWASVLNMKPTDIGKRSIPSFFSVAF 394
           V   L  S  N+F        + ++L       V  A+ ++   + +     P F     
Sbjct: 348 VWSALAISFLNYFIFALAAGYLYAILLVAVDESVKSATRISSLSSFVSVVWSPIF----- 402

Query: 395 GSLGAGIYMKRTGKYYWFLLAFC-----GIGIL-----GQLKINLLTPATPVWQQYLLLV 444
                 +++ R  K   +++  C     GIG+L     G    + +  A  VW       
Sbjct: 403 -----SLFITRQKKLKPYIVLGCAMWMVGIGLLYHYRGGSYAHSGIIGALCVWGA----- 452

Query: 445 VPSFGLSVLITVTLLAMISAVPHEHHAATTSISYAFRSTGATLGVSIGAAIFRSTLNTLL 504
               G ++      +++ SA  HE+ A  T+++Y     G  +G ++  AI+  TL   L
Sbjct: 453 ----GSTMWTYPVNISVQSATSHENLATVTALNYTLYRIGGAVGTAVSGAIWTQTLYKQL 508

Query: 505 QNKV 508
             ++
Sbjct: 509 LKRL 512

>KNAG0E01160 Chr5 (228323..230041) [1719 bp, 572 aa] {ON} 
          Length = 572

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 45/169 (26%), Positives = 81/169 (47%), Gaps = 6/169 (3%)

Query: 93  FLAALDGTIVSTLLTRIGSEFN-SLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPLLV 151
           F +++ G I   +L+ I ++F+ + ++V+     Y +       L G L+D LGR+P+++
Sbjct: 91  FFSSIAGAIYYPVLSVIENKFHINEEQVNMTVVVYFIFQGLSPTLMGGLADSLGRRPVIL 150

Query: 152 FSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQGLC 211
            S +++   C+    S +   V+  R +   G   +  + S ++ D+    ER  Y G  
Sbjct: 151 CSVIIYFCACIGLACSNNYAQVIALRCLQAAGISPVIAINSGMMGDVTTKAERGGYVGYV 210

Query: 212 NFIFGLGTASGGLVGAAFQD---WRMAFTIQCPISLASCALIVSYLELP 257
           +    +GTA+G + GA       WR  F     I   +C+ IVS L LP
Sbjct: 211 SGFQVVGTATGAVFGALLSSRWGWRSIFWF-LAIGSGACS-IVSLLLLP 257

>NDAI0D01020 Chr4 complement(229357..231135) [1779 bp, 592 aa] {ON} 
          Length = 592

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 47/170 (27%), Positives = 77/170 (45%), Gaps = 8/170 (4%)

Query: 93  FLAALDGTIVSTLLTRIGSEFN-SLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPLLV 151
           F ++L   I    L ++  EFN   +KV+     YLL       + G L+D  GR+P+++
Sbjct: 112 FWSSLGSPIYYPALRQLEKEFNMDENKVNVTVVVYLLFQGIAPTVSGGLADVFGRRPIIL 171

Query: 152 FSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQGLC 211
              V++ +  +    + S   +   R +  IG      ++S V+ D     ER  + G  
Sbjct: 172 GGMVIYVVASIGLACAPSYGVICFLRCIQSIGISPTIAISSGVVGDFTLKHERGTFVGAT 231

Query: 212 NFIFGLGTASGGLVGA---AFQDWRMAFTIQCPISLAS-CALIVSYLELP 257
           + +  LG   G L+GA   A  DWR  F     +++ S  ALIV+   LP
Sbjct: 232 SGLVLLGQCFGSLIGAVLTARWDWRAIFWF---LAIGSGVALIVAAFTLP 278

>TDEL0C04580 Chr3 (829514..831187) [1674 bp, 557 aa] {ON} Anc_2.241
           YIL121W
          Length = 557

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 40/148 (27%), Positives = 67/148 (45%), Gaps = 4/148 (2%)

Query: 93  FLAALDGTIVSTLLTRIGSEFN-SLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPLLV 151
           F + +   I   +LT I   F+ S +KV+     Y +       L G L+D LGR+P+++
Sbjct: 81  FFSTIAAAIYYPVLTVIEDLFDISEEKVNITVVVYFIFQGISPTLMGGLADYLGRRPIVI 140

Query: 152 FSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQGLC 211
            S +V+   C+    S S   ++  R +   G   +  + S ++ D+    ER  Y G  
Sbjct: 141 LSVLVYFSACVGLACSQSYAQIIALRCLQAAGISPVIAINSGIMGDVTTRAERGGYVGYV 200

Query: 212 NFIFGLGTASGGLVGAAFQD---WRMAF 236
           +    +G+A G L+GA       WR  F
Sbjct: 201 SGCQVVGSAFGALIGAGLSSRWGWRSIF 228

>KNAG0I01910 Chr9 complement(373073..374869) [1797 bp, 598 aa] {ON} 
          Length = 598

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 41/148 (27%), Positives = 68/148 (45%), Gaps = 4/148 (2%)

Query: 93  FLAALDGTIVSTLLTRIGSEFN-SLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPLLV 151
           F ++L   I    L ++  EF+ +  +V+     YLL         G L+D+ GR+P+++
Sbjct: 124 FWSSLGSPIYYPALRQLEKEFHLNESQVNVTVVVYLLFQGIAPTFSGGLADRYGRRPIIL 183

Query: 152 FSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQGLC 211
              +V+ +  +    + S   +V  R V  IG      ++S V+SD    RER  + G  
Sbjct: 184 GGMLVYVVASIGLARAPSYGVIVFLRIVQSIGISPTIAISSGVVSDYTLKRERGTFVGAT 243

Query: 212 NFIFGLGTASGGLVG---AAFQDWRMAF 236
           +    +G   G L+G   AA  DWR  F
Sbjct: 244 SGFVLIGQGIGPLLGAVIAARWDWRAIF 271

>YOR378W Chr15 (1049511..1051058) [1548 bp, 515 aa] {ON} Putative
           paralog of ATR1, but not required for boron tolerance;
           member of the DHA2 family of drug:H+ antiporters;
           YOR378W is not an essential gene
          Length = 515

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 97/406 (23%), Positives = 157/406 (38%), Gaps = 35/406 (8%)

Query: 109 IGSEFNSLD--KVSWIATSYLLSSSTCQPLYGKLSDQLGRKPLLVFSNVVFSIGCLICGM 166
           IG+ F + +  ++SW A++Y L+  T   + G+L D  G K   V     +++  L+ G 
Sbjct: 70  IGNSFGTTNAGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGF 129

Query: 167 ---STSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQGLCNFIFGLGTASGG 223
              S  I++     F     G G   L    I+ L    +    + +   +FG     G 
Sbjct: 130 SVYSNQIFFDCCRAFQ----GMGPAFLLPNAIAILGRTYKPGRRKNMVFSLFGASAPGGF 185

Query: 224 LVGAAFQD-------WRMAFTIQCPISLASCALIVS-YLELPPRHEDDKDRHWTSKLRDL 275
            +GA F         W  A+ I   + +A   L V+ Y  +P      +D      L  +
Sbjct: 186 FLGAVFSSMLGQLAWWPWAYWI---MGIACFVLAVAGYFVIPHTPMPSRDASSFKLLERI 242

Query: 276 DWAGVVTLVCFLFLFMLVSSLG---GKEIAYDSVLFALLCVTTLVLGSIFAYVELYVAVD 332
           D+AG VT V  L LF    + G   G +  Y    +ALL V T  L  IFAY+E   A  
Sbjct: 243 DFAGSVTGVVGLILFNFAWNQGPVVGWQTPYT---YALLIVGTFFL-VIFAYIESRAAF- 297

Query: 333 PVLPIAFLKYRS--VLGSSLANWFAMMSMLTTNYYLPVYWASVLNMKPTDIGKRSIPSFF 390
           P+LP A L   +  VL    A W    S     +Y   +        P     +  P   
Sbjct: 298 PLLPFAALSSDTAFVLSCIAAGW---ASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAI 354

Query: 391 SVAFGSLGAGIYMKRTGKYYWFLLAFCGIGILGQLKINLLTPATPVWQQ-YLLLVVPSFG 449
           S    ++  G  +  T      L A     + G + I         W Q ++ ++V  +G
Sbjct: 355 SGFCAAVTTGFLLSHTPPSTVMLFAMTAFTV-GTILIATAPVHQTYWAQTFVSIIVMPWG 413

Query: 450 LSVLITVTLLAMISAVPHEHHAATTSISYAFRSTGATLGVSIGAAI 495
           + +      + +  ++PHEH     S+     +   ++G+ I   I
Sbjct: 414 MDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTI 459

>Suva_9.71 Chr9 (129275..130960) [1686 bp, 561 aa] {ON} YIL121W
           (REAL)
          Length = 561

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 44/169 (26%), Positives = 79/169 (46%), Gaps = 6/169 (3%)

Query: 93  FLAALDGTIVSTLLTRIGSEFNSLDKVSWIA-TSYLLSSSTCQPLYGKLSDQLGRKPLLV 151
           F + + G+I   +LT I  +FN  ++++ +    Y +       + G L+D  GR+P+++
Sbjct: 76  FFSTVAGSIYYPVLTVIEKKFNITEELANVTIVVYFVFQGLAPSIMGGLADTFGRRPVVL 135

Query: 152 FSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQGLC 211
           ++ + +   C+    S +   ++  R +   G   +  + S ++ D+    ER  Y GL 
Sbjct: 136 WAVLTYCCACIGLASSHNYAQILALRCLQAAGISPVIAINSGIMGDVTTKVERGGYVGLV 195

Query: 212 NFIFGLGTASGGLVGAAFQD---WRMAFTIQCPISLASCALIVSYLELP 257
           +    +GTA G L+GA       WR  F     I    C L+VS L LP
Sbjct: 196 SGFQVVGTAFGALIGAGLSSRWGWRAIFWF-LAIGSGIC-LVVSALLLP 242

>KLLA0B00352g Chr2 (22476..23972) [1497 bp, 498 aa] {ON} highly
           similar to uniprot|Q08902 Saccharomyces cerevisiae
           YOR378W
          Length = 498

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 96/413 (23%), Positives = 168/413 (40%), Gaps = 44/413 (10%)

Query: 106 LTRIGSEF--NSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPLLVFSNVVFSIGCLI 163
           L  IG  F   +  ++SW A+++ L+  T   + G+L D  G K   V   + +++  ++
Sbjct: 54  LQIIGDSFGIKNPGQLSWFASAFSLTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSIL 113

Query: 164 CGMSTSIWWVVVG--RFVSGIG-GCGLTCLASMVISDLVPLRERAVYQGLCNFIFGLGTA 220
            G S     +     R   GIG    L    +++     P R+    Q +   +FG    
Sbjct: 114 AGFSVYSNQIFFDCCRAFQGIGPAFTLPNAIAIIARTYRPGRK----QNMIFSLFGACAP 169

Query: 221 SGGLVGAAFQD-------WRMAFTIQCPISLASCAL--IVSYLEL---PPRHEDDKDRHW 268
           SG +VGA F         W  A+ I       +C L  +  YL +   PP H D+K    
Sbjct: 170 SGFVVGAVFSSLLSEFAWWPWAYWIMG----ITCFLLGVAGYLVIPHHPPIHPDEK---- 221

Query: 269 TSKLRDLDWAGVVTLVCFLFLFMLVSSLG---GKEIAYDSVLFALLCVTTLVLGSIFAYV 325
            S +  +D AG VT V  L LF    + G   G E +Y    +ALL V +  L + F ++
Sbjct: 222 CSLVERIDVAGSVTGVVGLILFNFAWNQGPVVGWETSYT---YALLIVGSAFLAA-FGFI 277

Query: 326 ELYVAVDPVLPIAFLKYRS--VLGSSLANWFAMMSMLTTNYYLPVYWASVLNMKPTDIGK 383
           E   A  P+LP+  L   +  V+G   A W    S     YY     A++ +  P     
Sbjct: 278 ESR-AKHPLLPVRKLSSDTIFVMGCIAAGW---SSFGIWVYYTWQLMANLRDQPPLLSSA 333

Query: 384 RSIPSFFSVAFGSLGAGIYMKRTGKYYWFLLAFCGIGILGQLKINLLTPATPVWQQ-YLL 442
           + +P   S    ++     + RT      ++A     + G + +  +  +   W Q ++ 
Sbjct: 334 QFVPVAISGLCAAMSTEFLLTRTSPSTVMIIAMIAFTV-GSILVATVPVSQTYWAQTFVS 392

Query: 443 LVVPSFGLSVLITVTLLAMISAVPHEHHAATTSISYAFRSTGATLGVSIGAAI 495
           ++V  +G+ +      + + +A+P  H     S+     +   ++G+     I
Sbjct: 393 IIVMPWGMDMSFPAATIILSTAMPASHQGLAASLVNTIINYSISIGLGFAGTI 445

>TDEL0B00550 Chr2 (105483..107096) [1614 bp, 537 aa] {ON} Anc_8.843
           YMR279C
          Length = 537

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 98/424 (23%), Positives = 167/424 (39%), Gaps = 87/424 (20%)

Query: 118 KVSWIATSYLLSSSTCQPLYGKLSDQLGRKPLLVFSNVVFSIGCLICGMST---SIWWVV 174
           K SW+  S+ L S +   + G+L D  G K +L+   +  +I  LICG+S+   +  + +
Sbjct: 101 KSSWLMASFPLVSGSFILISGRLGDIYGLKKMLLLGYIWLTIWSLICGLSSFSHNDTFFI 160

Query: 175 VGRFVSGIGGCGLTCLASMVISDLVPL---------RERAVYQGLCNFIFGLGTASGGLV 225
             R   G+G        S V+ +L+ +         R + +   L      +G   GGL 
Sbjct: 161 TSRAFQGLG-------ISFVLPNLLGIVGNIYKPGTRRKNIVISLIGMCAPIGATFGGLF 213

Query: 226 GAAF-----QDWRMAFTIQCPISLASCALIVSYLELPPRHEDDKDRHWTSKLRDLDWAGV 280
                     DW  AF      +  +   I+SY  +P     + ++        +DW G 
Sbjct: 214 AGVVVIRKDSDWPWAFYAYTIAAFLTT--IISYFVIPNSIPVNVNKF------AMDWIGS 265

Query: 281 VTLVCFLFLFMLV---SSLGGKEIAYDSVLFALLCVTTLVLGSIFAYVELYVAVDPVLPI 337
              V  L LF  V   S++ G    Y   + ALL V+  ++   F + E+  A  P+LP 
Sbjct: 266 ALGVSGLVLFNFVWNQSTVVGWATGY---IIALLIVSIFLIALFFIF-EIKYAKVPLLPK 321

Query: 338 AFLKYRS---VLGSSLANW--------FAMMSMLTTNYYLPVYWASVLNMKPTDIGKRSI 386
              + RS   +L S +A W        +    +LT   Y PV WA               
Sbjct: 322 EVTESRSIIMILASLMAGWGSFGIWIFYYFQFVLTLRNYSPV-WAG-------------- 366

Query: 387 PSFFSVA----FGSLGAGIYMKRTGK---YYWFLLAF-CGIGILGQLKINLLTPATPVWQ 438
            +FF V+      +L  G  +KR G     ++ ++AF CG         +++   TPV +
Sbjct: 367 GTFFMVSIVGCIAALTVGFSIKRVGPAVLLFFSMIAFTCG---------SIILSVTPVHE 417

Query: 439 QYL-----LLVVPSFGLSVLITVTLLAMISAVPHEHHAATTSISYAFRSTGATLGVSIGA 493
            Y       +V+ SFG+ +      + +   +  ++     S+     +   +L + IG 
Sbjct: 418 TYFRSCLGAMVILSFGMDLSFPAASIILSDELSMQYQGMAGSLVNTVVNYSMSLFLGIGG 477

Query: 494 AIFR 497
            I R
Sbjct: 478 TIER 481

>NCAS0B06480 Chr2 complement(1225523..1227286) [1764 bp, 587 aa]
           {ON} 
          Length = 587

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 38/148 (25%), Positives = 68/148 (45%), Gaps = 4/148 (2%)

Query: 93  FLAALDGTIVSTLLTRIGSEFN-SLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPLLV 151
           F +++  +I   +LT I   F+ S + V+     Y +       + G L+D LGR+P+++
Sbjct: 105 FFSSIASSIYYPVLTVIEKLFDISEESVNITVVVYFIFQGLSPSIMGGLADSLGRRPVVL 164

Query: 152 FSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQGLC 211
           FS  V+   C+    + +   ++V R +   G   +  + S ++ D+    ER  Y G  
Sbjct: 165 FSVAVYFCACVGLACAQTYPQIIVLRCLQAAGISPVIAINSGIMGDVTTRAERGGYVGYV 224

Query: 212 NFIFGLGTASGGLVGAAFQ---DWRMAF 236
           +    LG + G L+GA       WR  F
Sbjct: 225 SGFQVLGNSFGALIGAGISSTWSWRAIF 252

>KLLA0C18931g Chr3 (1680133..1681794) [1662 bp, 553 aa] {ON}
           uniprot|Q874B4 Kluyveromyces lactis KLLA0C18931g Drug
           efflux permease KNQ1
          Length = 553

 Score = 51.2 bits (121), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 70/295 (23%), Positives = 134/295 (45%), Gaps = 24/295 (8%)

Query: 91  GIFLAALDGTIVSTLLTRIGSEFN-SLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPL 149
           G+ LA++   IV  L+T I + FN S  +  W  TSY+++ +     +G++ D +G   +
Sbjct: 33  GLDLASVGAMIV--LVTDIETRFNVSHTQSGWALTSYVITFAGFIAFFGRVGDIVGNGIM 90

Query: 150 LVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLV--PLRER--A 205
           +   +V+F I  L+C +  +     V R   G+ G G+   A  +++ +   P  +R  +
Sbjct: 91  MCVFSVIFGIFSLLCAVVPNFIAFTVFRAFQGMAGAGIVPCAYALVNKMFQGPNLQRYFS 150

Query: 206 VYQGLCNFIFGLGTASGGLVGAAFQDWRMAFTIQCPISLASCALI---VSYLELPPRHED 262
           +   + + + G+G   GG  G     ++  F      SLA+ A+I   + Y EL      
Sbjct: 151 ILSSVISAMAGVGFIIGGAFGETALGYKSFFYFLFAASLATAAVICVLIGYPELLLNRHS 210

Query: 263 DKDRHWTSKLRDLDWAGVVTLVCFLF----LFMLVSSLGGKEIAYDSVLFALLCVTTLVL 318
            K++    ++  LD  G     C LF    + ++V    G E   D   +  L V+ ++L
Sbjct: 211 YKEKF--QRVYKLDVIG-----CLLFISGSILLVVGLTQGGESWNDPTAYVPLAVSIVLL 263

Query: 319 GSIFAYVELY-VAVDPVLPIAFLKYRSVLGSSLANWFAMMSMLTTNYYLPVYWAS 372
              F +   Y V +  + PI+  K  + + S   N     +++ ++ ++PV  A+
Sbjct: 264 IIFFMWNLGYAVVLKLIKPISTHKGYAYMES--VNLLIPKNLMFSHNFIPVLLAT 316

>NCAS0G02990 Chr7 complement(549460..551205) [1746 bp, 581 aa] {ON} 
          Length = 581

 Score = 51.2 bits (121), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 45/172 (26%), Positives = 77/172 (44%), Gaps = 12/172 (6%)

Query: 93  FLAALDGTIVSTLLTRIGSEFN-SLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPLLV 151
           F ++L   I    L ++  +F    +KV+     YLL       + G L+D  GR+P+++
Sbjct: 101 FWSSLGSPIYYPALRQLEKQFGLDENKVNVTVVVYLLFQGIAPTISGGLADVFGRRPVIL 160

Query: 152 FSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQGLC 211
              +++ +  +    + S   +V  R +  IG      ++S V+ D     ER  + G  
Sbjct: 161 IGMLIYVVASIGLACAPSYGVIVFLRIIQSIGISPTIAISSGVVGDFTLKHERGTFVGAT 220

Query: 212 NFIFGLGTASGGLVG---AAFQDWRMAF---TIQCPISLASCALIVSYLELP 257
           + +  LG   G L+G   AA  +WR  F   TI C  S      I+++L LP
Sbjct: 221 SGLVLLGQCFGSLIGAVLAAAWNWRAIFWFLTIGCGTS-----FIIAFLLLP 267

>TDEL0H01600 Chr8 complement(273692..275506) [1815 bp, 604 aa] {ON} 
          Length = 604

 Score = 51.2 bits (121), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 64/274 (23%), Positives = 113/274 (41%), Gaps = 22/274 (8%)

Query: 89  FLGIFLAALDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKP 148
           FL  +   L G I  ++ T   + F    ++  I T   + ++     Y +LSD+ GR  
Sbjct: 69  FLQGYCTGLGGQISQSIQTYAANAFKKQPQIGSINTVKSVVAAAVAVPYARLSDRFGRIE 128

Query: 149 LLVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQ 208
             +F+ V++++G +I   + +   +  G  +   G  G   LA+ + +D+  LR+R    
Sbjct: 129 CWIFALVLYTVGDIISAATPTFGGLFAGVVIQQFGYSGFRLLATALTADISGLRDRTFAM 188

Query: 209 GLCNFIFGLGT-ASGGLVGA-----AFQDWRMAFTIQCPISLASCALIV------SYL-- 254
            +      + T  SG +V +        +WR  + I C I   S  L++       YL  
Sbjct: 189 NIFLIPVIINTWVSGNIVDSLAGVKVPYEWRWGYGIFCIIVPFSTLLLILPYAYAQYLAW 248

Query: 255 ---ELPPRHEDDKDRHWTSKL----RDLDWAGVVTLVCFLFLFMLVSSL-GGKEIAYDSV 306
               LP      + + W   L     D++  G+V    FL L +L  +L GG    +   
Sbjct: 249 REGRLPQFEFRKQGQSWKQALWKLTEDVNLIGIVLFTAFLVLVLLPLTLAGGASTKWKEG 308

Query: 307 LFALLCVTTLVLGSIFAYVELYVAVDPVLPIAFL 340
               + V     G +F   EL++A  P +P  +L
Sbjct: 309 HIIAMIVVGGCCGILFFVWELWLAKKPFIPRVYL 342

>Smik_8.1 Chr8 complement(2797..4680) [1884 bp, 627 aa] {ON} YHL040C
           (REAL)
          Length = 627

 Score = 51.2 bits (121), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 94/439 (21%), Positives = 170/439 (38%), Gaps = 45/439 (10%)

Query: 96  ALDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPLLVFSNV 155
            LDG I         S ++    +S I     + S+  Q +Y +LSD  GR  L + + +
Sbjct: 89  GLDGNIRYIYTGYATSSYSEHSLLSTINVINAVVSAASQIIYARLSDVFGRLYLFISAVI 148

Query: 156 VFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQGLCNFIF 215
           ++ +G +I   +  +     G      G  G+  +  +++SD   L+ R +YQ    + F
Sbjct: 149 LYVVGTIIQSQAYDVQRYAAGAIFYNAGYVGVILILLIILSDFSSLKWRLLYQFAPTWPF 208

Query: 216 GLGTASGGLVGAAFQD----------WRMAFTIQC-PISLASCALIVSYLELPPRHEDDK 264
            + T   G + +              W   F + C PI L    +     + P  H    
Sbjct: 209 IINTWIAGNITSRANPVVNWSWDVGMWAFIFPLSCIPIVLCMLHMQWRAKKTPEWHTLKG 268

Query: 265 DRHWTSK------LRDLDWA----GVVTLVCFLFLFMLVSSLGG--KEIAYDSVLFALLC 312
            + +  +      ++ L W     GV+ + C L   ++  +L G  K    DS L     
Sbjct: 269 QKSYYQEHGFIKIIKQLFWMLDIIGVLLMGCSLGCILVPLTLAGGVKTTWNDSRLIGPF- 327

Query: 313 VTTLVLGSIFAYVELYVAVDPVLPIAFLKYRSVLGS-SLANWFAMMSMLTTNYYLPVYWA 371
           V   VL  +    E   A DP+LP   +K R+V  S  ++     +  +  +Y   V   
Sbjct: 328 VLGFVLIPVLWIWEYRFARDPILPYKLVKDRAVWSSMGISFLIDFIYYMAADYLYTVMIV 387

Query: 372 SVLNMKPTDIGKRSIPSFFSVAFGSLGAGIYMKRTGKYYWFLLAFC-----GIGIL---- 422
           +V     +     ++ SF S       A + + R  +   F++  C      +G+L    
Sbjct: 388 AVNESVKSATRISTLSSFVSTVASPFFA-LLVTRCTRLKPFIMFGCSLWMVAMGLLYHFR 446

Query: 423 -GQLKINLLTPATPVWQQYLLLVVPSFGLSVLITVTLLAMISAVPHEHHAATTSISYAFR 481
            G    + +  A  VW           G ++      +++ SAV HE+ A  T+++Y   
Sbjct: 447 GGSQSHSGIIGALGVW---------GVGTTLFTYPVTVSVQSAVSHENMATVTALNYTLY 497

Query: 482 STGATLGVSIGAAIFRSTL 500
             G+ +G ++  AI+  TL
Sbjct: 498 RIGSAVGSAVSGAIWTQTL 516

>Kwal_56.22298 s56 (31819..33651) [1833 bp, 610 aa] {ON} YHL040C
           (ARN1) - Product of gene unknown [contig 187] FULL
          Length = 610

 Score = 51.2 bits (121), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 89/407 (21%), Positives = 161/407 (39%), Gaps = 49/407 (12%)

Query: 130 SSTCQPLYGKLSDQLGRKPLLVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTC 189
           S+  Q  + +LSD  GR  L V +   + +G +I   +  I    VG     IG  G+  
Sbjct: 106 SAASQIFFARLSDVFGRLSLFVTAIAFYVVGTIIQSQAYDIQRYAVGSVFWSIGYVGILL 165

Query: 190 LASMVISDLVPLRERAVYQGLCNFIFGLGTASGGLVGAAF---QDWRMAFTIQCPISLAS 246
           +  +++SD   LR R +YQ   ++   + T   G + A     + W     +   I   +
Sbjct: 166 MLILIVSDFSSLRWRLLYQFAPSWPGIINTWIAGTITARSNPQEKWSWNIGMWAFIIPLT 225

Query: 247 C-ALIVSYLELPPRHEDDKDRHWTSKLRD----LDWAGVVTLVCFLF-------LFMLVS 294
           C  +I+  L +  R +  +   W ++LR+        G++  +  LF       + ++ +
Sbjct: 226 CLPMILCMLHM--RFKARRTEQW-AELRNERSYYQTHGLIKTLIELFWKVDVVGILLMTA 282

Query: 295 SL----------GGKEIAYDSVLFALLCVTTLVLGSIFAYVELYVAVDPVLPIAFLKYRS 344
           S+          GG    + +       V   VL  IF   E   A DP++P   +K R+
Sbjct: 283 SIGCVLAPLTLAGGTGSKWQNPRVISPFVLGFVLLPIFLIWEKKWARDPIIPYDLIKDRA 342

Query: 345 VLGSSLANWF-AMMSMLTTNYYLPVYWASVLNMKPTDIGKRSIPSFFSVAFGSLGAGIYM 403
           V  S  + +    + M+   Y   +    V N         +I S F     S    +++
Sbjct: 343 VWASLNSQFLIGFIYMMAAGYIYNILIVGV-NESIKSATTITILSSFVATAASPPFCLWI 401

Query: 404 KRTGKYYWFLLAFCGIGIL----------GQLKINLLTPATPVWQQYLLLVVPSFGLSVL 453
            R  +   +++A CG+ +L          G+     +  A  VW           G  +L
Sbjct: 402 TRCTRMKGYIVAGCGLWMLAMGLFYHYRGGEFAHGGIVAAMVVW---------GLGDVLL 452

Query: 454 ITVTLLAMISAVPHEHHAATTSISYAFRSTGATLGVSIGAAIFRSTL 500
           I    +++ SA  H++ A  T+++Y     G + G +I  AI+  TL
Sbjct: 453 IYPITVSVQSATSHDNMAMVTALNYTTYRIGLSTGSAISGAIWTQTL 499

>TPHA0A00620 Chr1 (111175..113079) [1905 bp, 634 aa] {ON} Anc_3.84
           YDR497C
          Length = 634

 Score = 51.2 bits (121), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 59/119 (49%), Gaps = 8/119 (6%)

Query: 93  FLAALDGTIVSTLLTRIGSEFNSL-----DKVSWIATSYLLSSSTCQPLYGKLSDQLGRK 147
           FL   D   +S+ L  IG++ ++      DK  +I  +  L +       G  +D  GRK
Sbjct: 145 FLFGYDTGYISSALISIGNDLDNRPLTYGDK-EFITAATSLGALISSIFAGTAADVFGRK 203

Query: 148 PLLVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIG-GCGLTCLASMVISDLVPLRERA 205
           P L+FSN++F +G ++   +   W +  GR V G G G G + +A + I ++ P + R 
Sbjct: 204 PCLMFSNLMFVVGAIVQITAHKFWQMTAGRLVMGFGVGIG-SLIAPLYIGEIAPRKIRG 261

>Skud_15.545 Chr15 (988549..990099) [1551 bp, 516 aa] {ON} YOR378W
           (REAL)
          Length = 516

 Score = 50.8 bits (120), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 98/414 (23%), Positives = 159/414 (38%), Gaps = 40/414 (9%)

Query: 109 IGSEFNSLD--KVSWIATSYLLSSSTCQPLYGKLSDQLGRKPLLVFSNVVFSIGCLICGM 166
           IG  F + +  ++SW A++Y L+  T   + G+L D  G K   V     +++  L+ G 
Sbjct: 71  IGKSFGTTNPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGF 130

Query: 167 ---STSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQGLCNFIFGLGTASGG 223
              S  I++     F     G G   L    I+ L    +    + +   +FG     G 
Sbjct: 131 SVYSNKIFFDCCRAFQ----GMGPAFLLPNAIAILGRTYKSGKRKNMVFSLFGACAPGGF 186

Query: 224 LVGAAFQD-------WRMAF---TIQCPISLASCALIVSYLELPPRHEDDKDRHWTSKLR 273
           ++GA F         W  A+    I C     +   I+ +  +P RH           L 
Sbjct: 187 VLGAVFSSLLGQLAWWPWAYWIMGIACFFLAIAGYFIIPHTAMPSRHASSFKL-----LE 241

Query: 274 DLDWAGVVTLVCFLFLFMLVSSLG---GKEIAYDSVLFALLCVTTLVLGSIFAYVELYVA 330
            +D+AG VT V  L LF    + G   G +  Y  +   LL V T+ L +IFA++E   A
Sbjct: 242 RVDFAGSVTGVIGLILFNFAWNQGPVVGWQTPYTYI---LLIVGTVFL-AIFAFIESRAA 297

Query: 331 VDPVLPIAFLKYRS--VLGSSLANWFAMMSMLTTNYYLPVYWASVLNMKPTDIGKRSIPS 388
             P+LP A L   +  VL    A W    S     +Y   +        P     +  P 
Sbjct: 298 F-PLLPFAALSSDTAFVLSCIAAGW---ASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPV 353

Query: 389 FFSVAFGSLGAGIYMKRTGKYYWFLLAFCGIGILGQLKINLLTPATPVWQQ-YLLLVVPS 447
             S    +L  G  + RT      L A       G + I         W Q ++ ++V  
Sbjct: 354 AVSGFCAALTTGYLLSRTPPSTVMLFAMTAF-TAGTILIATAPVHQTYWAQTFVSIIVMP 412

Query: 448 FGLSVLITVTLLAMISAVPHEHHAATTSISYAFRSTGATLGVSIGAAIFRSTLN 501
           +G+ +      + +  ++PHEH     S+     +   ++G+ I   I  S +N
Sbjct: 413 WGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTI-ESNVN 465

>TBLA0C01040 Chr3 (208261..210270) [2010 bp, 669 aa] {ON} 
          Length = 669

 Score = 50.8 bits (120), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 103/454 (22%), Positives = 179/454 (39%), Gaps = 59/454 (12%)

Query: 96  ALDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPLLVFSNV 155
            LDG I         S +     +S I     ++S+  Q +Y + SD  GR  L + S V
Sbjct: 127 GLDGNIRYIYTGYATSSYAEHSLLSTINVINAVASAASQIVYARASDVFGRLSLFIVSVV 186

Query: 156 VFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQGLCNFIF 215
            +++G +I   +  +     G F   IG  G+  +  +++SD   L+ R  YQ    + +
Sbjct: 187 FYAVGTIIQCQAYDVQRYCAGSFFYNIGYVGVILVLLLILSDFSSLKWRLFYQFAPTWPY 246

Query: 216 GLGT-ASGGLVGAA--FQDWR-----MAF--------TIQCPISLASCALIVSYLELPPR 259
            + T  SG +  AA   + W       AF         I C I +   A      +L  +
Sbjct: 247 IINTWISGNITSAANPLKHWSWDIGMWAFIFPLSSIPIILCLIHMRWMASKTKEWKLLKQ 306

Query: 260 HEDDKDRH-WTSKLRDLDWA----GVV----TLVCFLFLFMLVSSLGGKEIAYDSVLFAL 310
            +    +H + S + DL W     GV+    +L C L    L    GG    ++      
Sbjct: 307 EKSYIQQHTFVSAITDLFWRLDVIGVLLMGASLGCILVPLTLA---GGTSSKWNHGNIIA 363

Query: 311 LCVTTLVLGSIFAYVELYVAVDPVLPIAFLKYRSVLGSSLANWFAMMSMLTTNYYLPV-Y 369
                 VL  IF + E   +  P++P   +K R+V  S      A+  ++   +Y+ V Y
Sbjct: 364 PFALGFVLIPIFTFWEWKFSKSPLIPSKLVKDRAVWSS-----MAISFLIDFIFYMAVDY 418

Query: 370 WASVLNMKPTDIGK-----RSIPSFFSVAFGSLGAGIYMKRTGKYYWFLLAFCGIGIL-- 422
             +VL +   +  K      S+ SF S   GS    + + R  +   F++A C + +L  
Sbjct: 419 LYTVLIVGVNESVKSATRISSLSSFVSTV-GSPIFALLITRFTRLKPFIVAGCALWMLSM 477

Query: 423 --------GQLKINLLTPATPVWQQYLLLVVPSFGLSVLITVTLLAMISAVPHEHHAATT 474
                   G    N +  +  VW           G ++      +++ +AV H   A  T
Sbjct: 478 GLLYHYRGGASSHNGIIASLCVW---------GVGTTLFTYPINVSVQAAVSHADMATVT 528

Query: 475 SISYAFRSTGATLGVSIGAAIFRSTLNTLLQNKV 508
           +++Y     G+ +G ++  AI+  TL   L  ++
Sbjct: 529 ALNYTMYRIGSAVGAAVSGAIWTQTLYKQLHKRM 562

>SAKL0G06600g Chr7 complement(549492..551381) [1890 bp, 629 aa] {ON}
           similar to uniprot|P39980 Saccharomyces cerevisiae
           YEL065W SIT1 Ferrioxamine B transporter member of the
           ARN family of transporters that specifically recognize
           siderophore-iron chelates transcription is induced
           during iron deprivation and diauxic shift potentially
           phosphorylated by Cdc28p
          Length = 629

 Score = 50.8 bits (120), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 63/282 (22%), Positives = 114/282 (40%), Gaps = 28/282 (9%)

Query: 89  FLGIFLAALDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKP 148
           FL  F+  LD  +  ++     + +     +S +     ++++   PLY +LSD  GR  
Sbjct: 82  FLMGFVFRLDSMVRRSMNAYATNSYKQHSLLSTVNVVRSVAAACGLPLYSRLSDVFGRIE 141

Query: 149 LLVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQ 208
           L+V S +++  G +IC  +  +     G  +   G CGL  L  ++ +D   L  R    
Sbjct: 142 LIVVSVLLYVAGTIICTQAYDVTRYAAGMILYQFGLCGLAILFKVIAADFSNLNWRVFCT 201

Query: 209 GLCNFIFGLGT-ASGGLVGAAFQDWRM----AFTIQCPISLASCALIVSYLELPPRHEDD 263
            +    F + T  SG +V A   +W       + I  P++     L   +++   +   D
Sbjct: 202 LISAAPFIINTWVSGDIVEAIGDNWSWPGIGVWAICLPVATIPLVLCFIHMQYLAKKSGD 261

Query: 264 KD--RHWTSKLR--------------DLDWAGVVTLVCFLFLFMLVSSLGGKEIAYDSVL 307
            +  R   ++ +               LD  GV++L+  L L +   +L G E A     
Sbjct: 262 LNQLRGMQTEYKRLGFKKFVVEVFFWKLDIFGVLSLMIILGLILTPLTLAGGETAEWR-- 319

Query: 308 FALLCVTTLVLG----SIFAYVELYVAVDPVLPIAFLKYRSV 345
                +  L+LG     +FA+ E  +A  P+ P    + R V
Sbjct: 320 -TAKVIVPLILGFCWIPVFAFWENRIATHPIAPTDMFRDRGV 360

>TPHA0E03200 Chr5 complement(677352..679232) [1881 bp, 626 aa] {ON}
           Anc_5.180
          Length = 626

 Score = 50.8 bits (120), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 58/244 (23%), Positives = 107/244 (43%), Gaps = 14/244 (5%)

Query: 90  LGI--FLAALDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPL-YGKLSDQLGR 146
           LGI  F+ A+   +V+  +    + F   ++V  +  S ++      PL +  LS++LGR
Sbjct: 159 LGIICFVVAMMSAVVTGDINAPAAHFGVSEEVIILTVSLMVWGFGLGPLVFAPLSEELGR 218

Query: 147 KPLLVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAV 206
             +   +  V  I  + C ++ +I  ++  RF+ G+      C+    +SD+    ER +
Sbjct: 219 NWIYCTTLFVAVIFIIPCAVAQNIGTLLAFRFLDGLAFSAPMCIIGGSLSDIWRTEERGI 278

Query: 207 YQGLCNFIFGLGTASGGLVGA---AFQDWRMAFTIQCPISLASCALIVSYLELPPRHEDD 263
              + +    LG   G +VG+    +  WR  +     I L+ C   V ++ LP  H   
Sbjct: 279 AMSIFSAAPFLGPVMGPIVGSLLTVYCGWRWVYIFM--IILSGCLYAVLFVFLPETHHQT 336

Query: 264 KDRHWTSKLRDLDWAGVVTLVCFLFLFMLVSSLGGKEIAYDSVLFALLCVTTLVLGSIFA 323
             +    KLR L        V  + +  L      KEIA DS+L  L+ ++ L++  +  
Sbjct: 337 ILKRRAKKLRKLTGDQSYRAVSEIKVRTL------KEIANDSLLRPLILLSELIVFLVTM 390

Query: 324 YVEL 327
           Y+ +
Sbjct: 391 YMAI 394

>KNAG0H03180 Chr8 complement(595395..597428) [2034 bp, 677 aa] {ON} 
          Length = 677

 Score = 50.8 bits (120), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 28/88 (31%), Positives = 47/88 (53%), Gaps = 8/88 (9%)

Query: 483 TGATLGVSIGAAIFRSTLNTLLQNKVLQFASDEHPREELLRIINNAAHSANWVHKEAPEF 542
           T A + ++  + +F   L   L   + Q  S+EHP+E+L +I++ A  S++W+   APEF
Sbjct: 579 TAAGVAITGASILFNVALRKSLWTALEQLVSEEHPQEQLQQILHRALESSHWIQHSAPEF 638

Query: 543 VRATLVECYHYASKSTFKFCLITMILAG 570
            + T+     YAS   F+    T+ LA 
Sbjct: 639 AQETI-----YAS---FRHNFTTLFLAA 658

>Smik_5.22 Chr5 (30048..31934) [1887 bp, 628 aa] {ON} YEL065W (REAL)
          Length = 628

 Score = 50.8 bits (120), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 100/451 (22%), Positives = 181/451 (40%), Gaps = 35/451 (7%)

Query: 89  FLGIFLAA----LDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQL 144
           F  +FL A    LDG I  T      S ++    +S +     + ++  Q  + +LSD  
Sbjct: 74  FFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIF 133

Query: 145 GRKPLLVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRER 204
           GR  +++ S + +S+G +I   + +I    VG     +G  G+  +  ++ SD   L  R
Sbjct: 134 GRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWR 193

Query: 205 AVYQGLCNFIFGLGT-ASGGLVGAAFQDWR-----MAFTIQCP-ISLASCALIVSYL--- 254
            +   +    F + T  SG +  A   +W+      AF +    I L  C L + YL   
Sbjct: 194 LLALFIPALPFIINTWISGDVTSAIGTNWKWGIGMWAFILPLACIPLGICMLHMRYLARK 253

Query: 255 ----ELPPRHEDDKDRHWTSKLRD-----LDWAGVVTLVCFLFLFMLVSSLGG--KEIAY 303
                L P  E      W S   D     LD  G++ +  F    ++  +L G  KE   
Sbjct: 254 HAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITVFFGCVLVPFTLAGGLKEEWK 313

Query: 304 DSVLFALLCVTTLVLGSIFAYVELYVAVDPVLPIAFLKYRSVLGSSLANWFAMMS-MLTT 362
            + +     +  +V+  ++   E+  +  P+ P   +K R +  + L  +F   +  +  
Sbjct: 314 SAHIIVPEVIGWVVVLPLYMLWEMKYSRHPLTPWDLIKDRGIFFALLIAFFINFNWYMQG 373

Query: 363 NYYLPVYWASVLNMKPTDIGKRSIPSFFSVAFGSLGAGIYMK--RTGKYYWFLLA--FCG 418
           +Y   V   +V     +     S+ SF SV  G++   I +K  RT  +  F ++     
Sbjct: 374 DYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILGFILIKVRRTKPFIIFGISCWIVS 433

Query: 419 IGILGQLKINLLTPATPVWQQYLLLVVPSFGLSVLITVTLLAM-ISAVPHEHHAATTSIS 477
            G+L   + +    +  +    LL     FG      VT  ++  SA  H   A  TS+ 
Sbjct: 434 FGLLVHYRGDSGAHSGIIGSLCLL----GFGAGSFTYVTQASIQASAKTHARMAVVTSLY 489

Query: 478 YAFRSTGATLGVSIGAAIFRSTLNTLLQNKV 508
            A  + G+  G S+  A++ + L   +  ++
Sbjct: 490 LATYNIGSAFGSSVSGAVWTNILPKEISKRI 520

>Kwal_23.4824 s23 (883258..884919) [1662 bp, 553 aa] {ON} YNL065W
           (AQR1) - multidrug resistance transporter [contig 5]
           FULL
          Length = 553

 Score = 50.4 bits (119), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 45/172 (26%), Positives = 79/172 (45%), Gaps = 12/172 (6%)

Query: 93  FLAALDGTIVSTLLTRIGSEFN-SLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPLLV 151
           F ++L   I    L ++  +F+ S + V+     YL+       + G L+D  GR+P+++
Sbjct: 97  FWSSLGSPIYYPALKQLEKQFSVSEELVNITVVVYLIFQGVAPTISGGLADVYGRRPVIL 156

Query: 152 FSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQGLC 211
              +++    +    S S   +V  R +   G   +  + S V+ D    +ER  + G  
Sbjct: 157 IGMLIYVCASIGLACSNSYGVIVFLRCLQSAGISPIIAINSGVVGDFTVKQERGTFVGAV 216

Query: 212 NFIFGLGTASGGLVGAAFQ---DWRMAF---TIQCPISLASCALIVSYLELP 257
           +    +G A G L+GAA     DWR  F   TI C     +C ++V++L LP
Sbjct: 217 SGFTLMGQAFGSLIGAALTAAFDWRAIFWFLTIGC----GTC-MLVNFLLLP 263

>KNAG0K00630 Chr11 (113522..115378) [1857 bp, 618 aa] {ON} Anc_3.84
           YDR497C
          Length = 618

 Score = 50.4 bits (119), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 50/198 (25%), Positives = 86/198 (43%), Gaps = 19/198 (9%)

Query: 93  FLAALDGTIVSTLLTRIGSEFN----SLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKP 148
           FL   D   +S+ L  IG++ +    +      +  +  L +     + G  +D  GRKP
Sbjct: 132 FLFGYDTGYISSALISIGTDLDGRVLTYGNKEIVTAATSLGALISSTMAGTAADMYGRKP 191

Query: 149 LLVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIG-GCGLTCLASMVISDLVPLRERAVY 207
            ++FSN++F +G ++   +   W +  GR + G G G G + ++ + IS++ P     + 
Sbjct: 192 CIMFSNIMFLVGAILQVSAHKFWQMAAGRLIMGFGVGIG-SLISPLFISEIAP----KMI 246

Query: 208 QGLCNFIFGLGTASGGLV----GAAFQDWRMAFTIQCPISLASCALIVSYLELPPRHEDD 263
           +G    I  L    G L+    GAAF      + I   +SL    L   +    P    D
Sbjct: 247 RGRLTVINSLWLTGGQLIAYGLGAAFNHVNNGWRILVGLSLVPTVLQFCFFLFLP----D 302

Query: 264 KDRHWTSKLRDLDWAGVV 281
             R++  K  D + A VV
Sbjct: 303 TPRYYVLK-GDYEMAKVV 319

>KLLA0C12309g Chr3 (1046848..1048557) [1710 bp, 569 aa] {ON} highly
           similar to uniprot|P30606 Saccharomyces cerevisiae
           YOL103W ITR2 Myo-inositol transporter with strong
           similarity to the major myo-inositol transporter Itr1p,
           member of the sugar transporter superfamily; expressed
           constitutively
          Length = 569

 Score = 50.4 bits (119), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 38/119 (31%), Positives = 59/119 (49%), Gaps = 8/119 (6%)

Query: 93  FLAALDGTIVSTLLTRIGSEFNSL-----DKVSWIATSYLLSSSTCQPLYGKLSDQLGRK 147
           F+   D   +S+ L  IG++ ++      DK   I  +  L +       G  +D  GRK
Sbjct: 73  FMFGYDTGYISSALVSIGTDLDNKALTYGDK-EIITAATSLGALISAVFAGISADIFGRK 131

Query: 148 PLLVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIG-GCGLTCLASMVISDLVPLRERA 205
           P L+FSN++F IG  +   + S W + VGR + G G G G + LA + IS++ P   R 
Sbjct: 132 PCLMFSNILFVIGAALQVSAHSFWQMAVGRLIMGFGVGIG-SLLAPLFISEIAPKHIRG 189

>Suva_10.11 Chr10 (18934..20556) [1623 bp, 540 aa] {ON} YOR378W
           (REAL)
          Length = 540

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 58/222 (26%), Positives = 94/222 (42%), Gaps = 16/222 (7%)

Query: 89  FLGIFLAALDGTIVSTLLTRIGSEFN-SLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRK 147
           FLG     L+   + +L+  +  +++ S    SW  TSY ++ +      G+L D +G  
Sbjct: 35  FLGCTFDLLNVASMISLIDDLAQKYDISYTTASWSLTSYAVTFAGFIAFMGRLGDIVGNS 94

Query: 148 PLLVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVY 207
            L   S   F+I  L+C +  +     V R + GI   GL   A  +I  L P  E   Y
Sbjct: 95  ILFTVSCFFFAILSLLCAVMPNFPAFAVFRAIQGISAAGLVPCAYALIPMLAPEEEVQKY 154

Query: 208 QGL--CNF--IFGLGTASGGLVGAAFQDWR----MAFTIQCPISLASCALI--VSYLELP 257
             +  C F    GLG   GG   A    ++    + F +   IS+ +      V  L  P
Sbjct: 155 FSIVSCGFSSTIGLGLIIGGAFAATKIGYKGIFYLTFAVMFLISIVAFFFTYGVENLSEP 214

Query: 258 PRHEDDKDRHWTSKLRDLDWAGVVTLVCFLFLFMLVSSLGGK 299
           PR +       T+++R LD+ G +  V    L ++  + GG+
Sbjct: 215 PRKD-----QATNRVRSLDFIGSLIFVTGSILIVVGLTEGGE 251

>Smik_9.48 Chr9 (110001..111776) [1776 bp, 591 aa] {ON} YIL121W
           (REAL)
          Length = 591

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 52/233 (22%), Positives = 96/233 (41%), Gaps = 16/233 (6%)

Query: 13  IDKDVIQDPSTGLAGFVANEVEQQDYNSRTGHDSYGATAVDDR-----TATSARCDLTFP 67
           +D+D+ +      +  + N++E +   S     SY    VD +     T+     D+T P
Sbjct: 18  LDQDIAKMAGRISSIMLKNDIEGELAES---MQSYKTETVDKQALQRTTSVKPEPDITVP 74

Query: 68  PSETPEFALXXXXXXXXXXXXFLGIFLAALDGTIVSTLLTRIGSEFNSLDK-VSWIATSY 126
           P     F+             F G F + + G I   +L+ I  EF+  ++ V+     Y
Sbjct: 75  PHS--RFS-RSFKTVLIAQCAFTG-FFSTIAGAIYYPVLSVIEGEFDIDEQLVNITVVVY 130

Query: 127 LLSSSTCQPLYGKLSDQLGRKPLLVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCG 186
            +         G  +D LGR+P+++ + +++   C+    + +   ++V R +   G   
Sbjct: 131 FVFQGLAPTFMGGFADSLGRRPVVLAAIIIYFGACIGLACAQTYAQIIVLRCLQAAGISP 190

Query: 187 LTCLASMVISDLVPLRERAVYQGLCNFIFGLGTASGGLVGAAFQ---DWRMAF 236
           +  + S ++ D+    ER  Y G       LG+A G L+GA       WR  F
Sbjct: 191 VIAINSGIMGDITTRAERGGYVGYAAGFQVLGSAFGALIGAGLSFRWGWRAIF 243

>KAFR0D00790 Chr4 (168111..169796) [1686 bp, 561 aa] {ON} 
          Length = 561

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 40/135 (29%), Positives = 63/135 (46%), Gaps = 8/135 (5%)

Query: 139 KLSDQLGRKPLLVFSNVVFSIGCLICGMSTSIWW-VVVGRFVSGIGGCGLTCLASMVISD 197
           KL D  GRK  L    +++ +G +IC  S   W+   +GR V+G+G  G+  L+ M+IS+
Sbjct: 129 KLGDMYGRKIGLTCVTIIYIVGQVICIASVDKWYQYFIGRIVAGLGVGGIAVLSPMLISE 188

Query: 198 LVPLRERAV----YQGLC--NFIFGLGTASGGLVGAAFQDWRMAFTIQCPISLASCALIV 251
             P   R      YQ +C      G  T  G    +    WR+A  I    +L     + 
Sbjct: 189 TSPKHLRGTLVSCYQLMCTAGIFLGYCTNYGTSKYSNSVQWRVALGISFAWALFMIGGL- 247

Query: 252 SYLELPPRHEDDKDR 266
           +++   PR+  +KDR
Sbjct: 248 TFVPESPRYLCEKDR 262

>YNL065W Chr14 (503724..505484) [1761 bp, 586 aa] {ON}  AQR1Plasma
           membrane multidrug transporter of the major facilitator
           superfamily, confers resistance to short-chain
           monocarboxylic acids and quinidine; involved in the
           excretion of excess amino acids
          Length = 586

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 48/172 (27%), Positives = 77/172 (44%), Gaps = 12/172 (6%)

Query: 93  FLAALDGTIVSTLLTRIGSEFN-SLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPLLV 151
           F ++L   I    L ++  +FN   + V+     YLL       + G L+D  GR+P+++
Sbjct: 111 FWSSLGSPIYYPALRQLEKQFNVDENMVNVTVVVYLLFQGISPTVSGGLADCFGRRPIIL 170

Query: 152 FSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQGLC 211
              +++ I  +    + S   ++  R +  IG      ++S V+ D     ER  + G  
Sbjct: 171 AGMLIYVIASIGLACAPSYGVIIFLRCIQSIGISPTIAISSGVVGDFTLKHERGTFVGAT 230

Query: 212 NFIFGLGTASGGLVGA---AFQDWRMAF---TIQCPISLASCALIVSYLELP 257
           +    LG   G L+GA   A  DWR  F   TI C     SC LI ++L LP
Sbjct: 231 SGFVLLGQCFGSLIGAVLTARWDWRAIFWFLTIGC----GSCFLI-AFLILP 277

>ADL258W Chr4 (247672..249276) [1605 bp, 534 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL065W (AQR1),
           YIL121W and YIL120W (QDR1); Tandem gene duplication in
           Saccharomyces cerevisiae
          Length = 534

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 49/198 (24%), Positives = 84/198 (42%), Gaps = 12/198 (6%)

Query: 93  FLAALDGTIVSTLLTRIGSEFN-SLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPLLV 151
           F ++L    V   L  +  EF  S D V+     YLL       +   L+D  GR+P+++
Sbjct: 80  FWSSLGSPAVYPALRNLQREFGVSEDLVNIAVVVYLLFQGVAPTVCSGLADTYGRRPVIL 139

Query: 152 FSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQGLC 211
              ++F +  +    S S   V+  R +   G   +  + S V+ D     ER  + G  
Sbjct: 140 MGMLIFIVSSIGIACSNSFALVIALRCIQSSGISPIIAINSGVVGDFTLKSERGTFIGAV 199

Query: 212 NFIFGLGTASGGLVGAAFQ---DWRMAF---TIQCPISLASCALIVSYLELPPRHEDDKD 265
           + +  LG A G L+GA+     +WR  F   TI C +       + ++L LP  H     
Sbjct: 200 SGLTLLGQAFGSLIGASLTAAYNWRAVFWFMTIGCGV-----CFLANFLFLPETHRCIVG 254

Query: 266 RHWTSKLRDLDWAGVVTL 283
                  R+++++ V+ L
Sbjct: 255 NLSLKPKRNINFSPVLLL 272

>YJL219W Chr10 (19497..21200) [1704 bp, 567 aa] {ON}  HXT9Putative
           hexose transporter that is nearly identical to Hxt11p,
           has similarity to major facilitator superfamily (MFS)
           transporters, expression of HXT9 is regulated by
           transcription factors Pdr1p and Pdr3p
          Length = 567

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 49/214 (22%), Positives = 91/214 (42%), Gaps = 18/214 (8%)

Query: 23  TGLAGFVANEVEQQDYNSRTGHDSYGATAVDDRTATSARCDLTFPPSETPEFALXXXXXX 82
           +G+    AN++   + NS +  ++       + +  S   D T PP + P+  L      
Sbjct: 2   SGVNNTSANDLSTTESNSNSVANAPSVKTEHNDSKNSLNLDATEPPIDLPQKPLSAYTTV 61

Query: 83  XXX--XXXFLGIFLAALDGTI-----VSTLLTRIGSE------FNSLDKVSWIATSYLLS 129
                   F G       GTI     +S  + R G +      + S  ++  I + + + 
Sbjct: 62  AILCLMIAFGGFIFGWDTGTISGFVNLSDFIRRFGQKNDKGTYYLSKVRMGLIVSIFNIG 121

Query: 130 SSTCQPLYGKLSDQLGRKPLLVFSNVVFSIGCLICGMSTSIWW-VVVGRFVSGIGGCGLT 188
            +    +  K+ D  GR+  L+    ++ +G LI   S + W+   +GR +SG+G  G+ 
Sbjct: 122 CAIGGIVLSKVGDIYGRRIGLITVTAIYVVGILIQITSINKWYQYFIGRIISGLGVGGIA 181

Query: 189 CLASMVISDLVPLRERA----VYQGLCNFIFGLG 218
            L+ M+IS++ P + R     +YQ +C     LG
Sbjct: 182 VLSPMLISEVAPKQIRGTLVQLYQLMCTMGIFLG 215

>CAGL0I07447g Chr9 (716374..718086) [1713 bp, 570 aa] {ON} highly
           similar to uniprot|P30606 Saccharomyces cerevisiae
           YOL103w ITR2 myo-inositol permease minor
          Length = 570

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 37/120 (30%), Positives = 62/120 (51%), Gaps = 10/120 (8%)

Query: 93  FLAALDGTIVSTLLTRIGSEFNSLD------KVSWIATSYLLSSSTCQPLYGKLSDQLGR 146
           FL   D   +S+ L  IG++ ++ +      +++  ATS  L +     + G   D  GR
Sbjct: 85  FLFGYDTGYISSALISIGTDLDNKELTYGEKEITTAATS--LGALIFALVAGFSVDIFGR 142

Query: 147 KPLLVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIG-GCGLTCLASMVISDLVPLRERA 205
           KP L+FSN++F IG ++   +   W +  GRF+ G G G G + +A + IS++ P   R 
Sbjct: 143 KPCLMFSNIMFLIGAILQVTAHKFWQMTAGRFIMGFGVGIG-SLIAPLYISEIAPKMIRG 201

>KLTH0G09350g Chr7 (778062..779753) [1692 bp, 563 aa] {ON} similar
           to uniprot|P40474 Saccharomyces cerevisiae YIL121W QDR2
           Multidrug transporter required for resistance to
           quinidine barban cisplatin and bleomycin member of the
           major facilitator superfamily of transporters conferring
           multiple drug resistance (MFS- MDR)
          Length = 563

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 48/172 (27%), Positives = 81/172 (47%), Gaps = 9/172 (5%)

Query: 91  GIFLAALDGTIVSTLLTRIGSEFN-SLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPL 149
           GIF + + G I    LT I ++F+ S + V+     Y L       L G L+D  GR+P+
Sbjct: 54  GIF-STIAGPIYYPALTTIENQFHISTELVNVSVVLYFLFQGLAPTLMGGLADSFGRRPI 112

Query: 150 LVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQG 209
           +++S  ++   C+    S +   ++V R +   G   +  + S ++ D+    +R  Y G
Sbjct: 113 VMWSIALYLAACIGIACSRTYAQILVLRCLQSAGISPVIAVNSGIMGDVTTRAQRGGYVG 172

Query: 210 LCNFIFGLGTASGGLVGAAFQD---WRMAFTIQCPISLAS-CALIVSYLELP 257
           L      LG+A G L+G        WR  F     +++ S C+L+ S L LP
Sbjct: 173 LTAGFQVLGSAFGALIGGGIVSTWGWRAIFWF---LAIGSGCSLVCSSLLLP 221

>NDAI0A07110 Chr1 complement(1620110..1621918) [1809 bp, 602 aa]
           {ON} Anc_3.84
          Length = 602

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 52/206 (25%), Positives = 89/206 (43%), Gaps = 30/206 (14%)

Query: 19  QDPSTGLAGFVANEVEQ-----QDYNSRTGHDSYGATAVDDRTATSARCD-------LTF 66
           Q P+T    F+ NE E+     ++  + T  D   A+  DDR       D       +TF
Sbjct: 32  QRPTTDYEEFL-NEQEESTKKMKNKQTTTSFDYENASDNDDRIQIKPVNDEDNTSVIITF 90

Query: 67  PPSETPEFALXXXXXXXXXXXXFLGIFLAALDGTIVSTLLTRIGSEFNSLDKVSWIATSY 126
               +P F +             +  F+   D   +S+ L  IG++ +  +KV       
Sbjct: 91  NQKISP-FIITLTFVAS------ISGFMFGYDTGYISSALISIGTDLD--NKVLSYGDKE 141

Query: 127 LLSSSTC------QPLYGKLSDQLGRKPLLVFSNVVFSIGCLICGMSTSIWWVVVGRFVS 180
           +++++T           G  +D  GRKP L+FSNV+F IG ++   +   W +  GR + 
Sbjct: 142 IVTAATSLGALISSIFAGTAADVFGRKPCLMFSNVMFIIGAILQISAHKFWQMAAGRLIM 201

Query: 181 GIG-GCGLTCLASMVISDLVPLRERA 205
           G G G G + ++ + IS++ P   R 
Sbjct: 202 GFGVGIG-SLISPLFISEIAPKMIRG 226

>KNAG0B06940 Chr2 (1377486..1379168) [1683 bp, 560 aa] {ON} 
          Length = 560

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 35/141 (24%), Positives = 67/141 (47%), Gaps = 6/141 (4%)

Query: 137 YGKLSDQLGRKPLLVFSNVVFSIGCLICGMSTSIWW-VVVGRFVSGIGGCGLTCLASMVI 195
           + K+ DQ+GR+  LVF   V+ +G +I   S + W+   +GR +SG+G  G+   + ++I
Sbjct: 125 FSKIGDQVGRRLALVFVTAVYMVGLVISIASINKWYQYFIGRIISGLGVGGIAVYSPLLI 184

Query: 196 SDLVPLRERAVYQGLCNFIFGLGTASGGLVGAAFQDWRMAFTIQCPISLA---SCALIVS 252
           S++ P   R         +  LG   G       +++  +   + P+ L    +  +I +
Sbjct: 185 SEVSPKHVRGTLVSCYQLMITLGIFLGYCTNYGTKNYDNSVQWRVPLGLGFAWALFMIAA 244

Query: 253 YLELP--PRHEDDKDRHWTSK 271
              +P  PR+  +K R   +K
Sbjct: 245 MFFVPESPRYLIEKGRMEDAK 265

>KAFR0I01560 Chr9 (328940..330838) [1899 bp, 632 aa] {ON}  YHL040C
          Length = 632

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 102/462 (22%), Positives = 182/462 (39%), Gaps = 56/462 (12%)

Query: 130 SSTCQPLYGKLSDQLGRKPLLVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTC 189
           S+  Q +Y +LSD  GR  L V + V++S+G +I   +  +     G      G  G+  
Sbjct: 116 SAASQIVYARLSDAFGRFRLFVVAIVLYSMGTIIQCQAYDVQRYAAGSIFYNAGYVGVIL 175

Query: 190 LASMVISDLVPLRERAVYQGLCNFIFGLGT-ASGGLVGAA--FQDWRMAFTIQCPISLAS 246
           +  +++SD+  LR R  YQ +  + + + T  SG +  AA   ++W     +   I   S
Sbjct: 176 VLLLILSDMSTLRWRLFYQFVPTWPYIINTWISGNITSAANPIENWSWDVGMWAFIFPLS 235

Query: 247 CALIVS---YLELPPRHEDD-KD--------------RHWTSKLRDLDWAGVVTLVCFLF 288
           C  I++   +++   R   + KD              +   S    +D  GV+ +   L 
Sbjct: 236 CLPILACMIHMQWRARKTQEWKDLKTQKTYYQQHGLMKSLVSLFWKIDIIGVLLMAASLG 295

Query: 289 LFMLVSSL-GGKEIAYDSVLFALLCVTTLVLGSIFAYVELYVAVDPVLPIAFLKYRSVLG 347
             ++  +L GG    +       + V   VL  IF   E   A DP++P   +K R V  
Sbjct: 296 CILVPLTLAGGTSSKWRDSRIIGVFVLGFVLIPIFFIWEKKFATDPIVPYKLVKDRGVWA 355

Query: 348 S-SLANWFAMMSMLTTNYYLPVYWASVLNMKPTDIGKRSIPSFFSVA---FGSLGAGIYM 403
           S  ++     +  +  +Y   V   +V           S+ SF S     F SL    + 
Sbjct: 356 SLGISFLIDFIYYMAADYLYTVLIVAVNESVSAATRISSLYSFVSTVASPFVSLALTRFT 415

Query: 404 KRT-----GKYYWFLLAFCGIGILGQLKINLLTPATPVWQQYLLLVVPSFGLSVLITVTL 458
           +       G   WFL     +G+L   +    + +  +      L V   G +       
Sbjct: 416 RLKPFIIFGCCLWFL----AMGLLYHFRGGASSHSGIIGG----LCVWGLGSTFFTYPVT 467

Query: 459 LAMISAVPHEHHAATTSISYAFRSTGATLGVSIGAAIFRSTLN----TLLQNKVLQFASD 514
           +++ +AV HE  A  ++++Y F   G+ +G ++  AI+   L     +L+ +  L  A+ 
Sbjct: 468 VSVQAAVSHEQMATVSALNYTFYRIGSAVGAAVSGAIWTQKLYKKLLSLMGDATLATAAY 527

Query: 515 EHPREELLRIINNAAHSANWVHKEAPEFVRATLVECYHYASK 556
             P   ++        +  W     PE  R  +VE Y Y  +
Sbjct: 528 GSPYTFIV--------TYTW---GTPE--REAMVEAYRYIQR 556

>Smik_14.262 Chr14 (484135..485820) [1686 bp, 561 aa] {ON} YNL065W
           (REAL)
          Length = 561

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 47/172 (27%), Positives = 77/172 (44%), Gaps = 12/172 (6%)

Query: 93  FLAALDGTIVSTLLTRIGSEFN-SLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPLLV 151
           F ++L   I    L ++  +FN   + V+     YLL       + G L+D  GR+P+++
Sbjct: 110 FWSSLGSPIYYPALRQLEKQFNVDENMVNVTVVVYLLFQGISPTVSGGLADCFGRRPIIL 169

Query: 152 FSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQGLC 211
              +++ +  +    + S   ++  R +  IG      ++S V+ D     ER  + G  
Sbjct: 170 AGMLIYVVASIGLACAPSYGVIIFLRCIQSIGISPTIAISSGVVGDFTLKHERGTFVGAT 229

Query: 212 NFIFGLGTASGGLVGA---AFQDWRMAF---TIQCPISLASCALIVSYLELP 257
           +    LG   G L+GA   A  DWR  F   TI C     SC LI ++L LP
Sbjct: 230 SGFVLLGQCFGSLIGAVLTARWDWRSIFWFLTIGC----GSCFLI-AFLILP 276

>KAFR0D00800 Chr4 complement(170100..171776) [1677 bp, 558 aa] {ON} 
          Length = 558

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 40/135 (29%), Positives = 63/135 (46%), Gaps = 8/135 (5%)

Query: 139 KLSDQLGRKPLLVFSNVVFSIGCLICGMSTSIWW-VVVGRFVSGIGGCGLTCLASMVISD 197
           KL D  GRK  L    +++ +G +IC  S   W+   +GR V+G+G  G+  L+ M+IS+
Sbjct: 126 KLGDMYGRKIGLTCVTIIYIVGQVICIASVDKWYQYFIGRIVAGLGVGGIAVLSPMLISE 185

Query: 198 LVPLRERAV----YQGLC--NFIFGLGTASGGLVGAAFQDWRMAFTIQCPISLASCALIV 251
             P   R      YQ +C      G  T  G    +    WR+A  I    +L     + 
Sbjct: 186 TSPKHLRGTLVSCYQLMCTAGIFLGYCTNYGTSKYSNSVQWRVALGISFAWALFMIGGL- 244

Query: 252 SYLELPPRHEDDKDR 266
           +++   PR+  +KDR
Sbjct: 245 TFVPESPRYLCEKDR 259

>Skud_14.267 Chr14 (493984..495672) [1689 bp, 562 aa] {ON} YNL065W
           (REAL)
          Length = 562

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 46/172 (26%), Positives = 77/172 (44%), Gaps = 12/172 (6%)

Query: 93  FLAALDGTIVSTLLTRIGSEFN-SLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPLLV 151
           F ++L   I    L ++  +FN   + ++     YLL       + G L+D  GR+P+++
Sbjct: 111 FWSSLGSPIYYPALRQLEKQFNVDENMINITVVVYLLFQGVSPTISGGLADCFGRRPIIL 170

Query: 152 FSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQGLC 211
              +++ +  +    + S   ++  R +  IG      ++S V+ D     ER  + G  
Sbjct: 171 AGMLIYVVASIGLACAPSYGVIIFLRCIQSIGISPTIAISSGVVGDFTLKHERGTFVGAT 230

Query: 212 NFIFGLGTASGGLVGA---AFQDWRMAF---TIQCPISLASCALIVSYLELP 257
           +    LG   G L+GA   A  DWR  F   TI C     SC LI ++L LP
Sbjct: 231 SGFVLLGQCFGSLIGAVLTARWDWRSIFWFLTIGC----GSCFLI-AFLVLP 277

>Skud_5.24 Chr5 (26839..28722) [1884 bp, 627 aa] {ON} YEL065W (REAL)
          Length = 627

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 102/451 (22%), Positives = 179/451 (39%), Gaps = 35/451 (7%)

Query: 89  FLGIFLAA----LDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQL 144
           F  +FL A    LDG I  T      S ++    +S +     + ++  Q  + +LSD  
Sbjct: 74  FFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIF 133

Query: 145 GRKPLLVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRER 204
           GR  +LV S + + +G +I   + +I    VG     +G  G+  +  ++ SD   L  R
Sbjct: 134 GRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWR 193

Query: 205 AVYQGLCNFIFGLGT-ASGGLVGAAFQDWR-----MAFTIQCP-ISLASCALIVSYL--- 254
            +   +    F + T  SG +  A   +W+      AF +    I L  C L + YL   
Sbjct: 194 LLALFIPALPFIINTWISGNVTSAIGTNWKWGIGMWAFILPLACIPLGLCMLHMRYLARK 253

Query: 255 ----ELPPRHEDDKDRHWTSKLRD-----LDWAGVVTLVCFLFLFMLVSSLGG--KEIAY 303
                L P  E      W S   D     LD  G++ +  F    ++  +L G  KE   
Sbjct: 254 HAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITAFFGCVLVPFTLAGGLKEEWR 313

Query: 304 DSVLFALLCVTTLVLGSIFAYVELYVAVDPVLPIAFLKYRSVLGSSLANWFAMMS-MLTT 362
            + +     +  +V   ++   E+  +  P+ P   +K R +  + L  +F   +  +  
Sbjct: 314 TAHIIVPEVIGWVVALPLYMLWEMKYSRHPLTPWDLIKDRGIFFALLIAFFINFNWYMQG 373

Query: 363 NYYLPVYWASVLNMKPTDIGKRSIPSFFSVAFGSLGAGIYMK--RTGKYYWFLLA--FCG 418
           +Y   V   +V     +     S+ SF SV  G++   I +K  RT  +  F ++     
Sbjct: 374 DYMYTVLIVAVHESIKSATRITSLYSFVSVIVGTILGFILIKVRRTKPFILFGISCWIVS 433

Query: 419 IGILGQLKINLLTPATPVWQQYLLLVVPSFGLSVLITVTLLAM-ISAVPHEHHAATTSIS 477
            G+L   + +    A  +    LL     FG      VT  ++  SA  H   A  TS+ 
Sbjct: 434 FGLLVHYRGDSGAHAGIIGSLCLL----GFGAGSFTYVTQASIQASAKTHARMAIVTSLY 489

Query: 478 YAFRSTGATLGVSIGAAIFRSTLNTLLQNKV 508
            A  + G+  G S+  A++ + L   +  ++
Sbjct: 490 LATYNIGSAFGSSVSGAVWTNILPREISKRI 520

>Skud_6.16 Chr6 (26284..27933) [1650 bp, 549 aa] {ON} YOR378W (REAL)
          Length = 549

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 97/451 (21%), Positives = 170/451 (37%), Gaps = 43/451 (9%)

Query: 89  FLGIFLAALDGTIVSTLLTRIGSEFN-SLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRK 147
           FLG     L+   + +L+  +   +N S    SW  TSY ++ +      G+L D +G  
Sbjct: 35  FLGCTFDLLNVASMISLIDDLAKTYNISYTTASWSLTSYAVTFAGFIACMGRLGDIIGNS 94

Query: 148 PLLVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVY 207
            L   S   F++  L+C +  +     V R + GI   GL   A  +I  L P  +   Y
Sbjct: 95  VLFTISCSCFAVLSLLCAVMPNFPAFAVFRAIQGICAAGLVPCAYALIPILAPKEKVQKY 154

Query: 208 QGL--CNF--IFGLGTASGGLVGAAFQDWR----MAFTIQCPISLASCALIVSYLELPPR 259
             +  C F    GLG   GG        +R    + F +   IS+   A   +Y      
Sbjct: 155 FSIVSCGFSSTIGLGLIIGGAFATTKIGYRGIFYLTFAVMTLISII--AFFFTYGVEKLN 212

Query: 260 HEDDKDRHWTSKLRDLDWAGVVTLVCFLFLFMLVSSLGG----KEIAYDSVLFALL---- 311
            +  KD+  TS ++ LD+ G +  V    L ++  + GG    + + Y +++  ++    
Sbjct: 213 KKPQKDQASTS-VKSLDFIGSLIFVAGSILIVVGLTEGGESWNRPVTYVTLVIGIILFFG 271

Query: 312 -----CVTTLVLGSIFAYV-----ELYVAVDPVLPIAFLKYRSVLGSSLANWFAMMSMLT 361
                C  T ++   F Y      + +  V  ++PI  L  ++ +   LA       + +
Sbjct: 272 FFVWNCTYTKIVRG-FKYCGIDTSKYFEKVQLLIPIDVLFMKNFIPIVLAFALNNACLFS 330

Query: 362 TNYYLPVYWASVLNMKPTDIGKRSIPSFFSVAFG----SLGAGIYMKRTGKYYWFLLAFC 417
             Y +  Y        P   G + +P    +  G    +  +     R G    F LA  
Sbjct: 331 CLYIIDQYSQYAERNSPLLAGVKLVPLIICMVIGNALCAFESTKLRPRVGVAIGFFLALA 390

Query: 418 GIGILGQLKINLLTPATPVWQQYL-LLVVPSFGLSVLITVTLLAMISAVPHEHHAATTSI 476
           G  IL QL    L      W+ +     +  FG+++     L   +   P E     + +
Sbjct: 391 GSIILIQLH---LVKEDLFWKIFFSAQALVGFGVAIFYPYALQIAVGGAPDESRGIASGV 447

Query: 477 SYAFRSTGATLGVSIGAAIFRSTLNTLLQNK 507
           +  F      LG+ I  ++  S L  + + K
Sbjct: 448 AQTF----GQLGIEITFSVMASVLGNINEMK 474

>KLLA0F03311g Chr6 (311639..313267) [1629 bp, 542 aa] {ON} similar
           to uniprot|P53943 Saccharomyces cerevisiae YNL065W AQR1
           Plasma membrane transporter of the major facilitator
           superfamily that confers resistance to short- chain
           monocarboxylic acids and quinidine
          Length = 542

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 43/172 (25%), Positives = 75/172 (43%), Gaps = 5/172 (2%)

Query: 93  FLAALDGTIVSTLLTRIGSEFNSLDK-VSWIATSYLLSSSTCQPLYGKLSDQLGRKPLLV 151
           F ++L   I    L  + +EF+  ++ ++     YLL       + G L+D  GR+P+++
Sbjct: 93  FWSSLGSPIYYPALKELEAEFDVNEELINITVVVYLLFQGIAPTISGGLADVYGRRPIIL 152

Query: 152 FSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQGLC 211
              +++ I  +    S S   VV  R +   G   +  + S V  D     ER  + G  
Sbjct: 153 LGMLIYVIASIGLACSKSYGAVVFLRCLQSAGISPIIAINSGVAGDFTVKSERGTFVGAV 212

Query: 212 NFIFGLGTASGGLVGAAFQ---DWRMAFTIQCPISLASCALIVSYLELPPRH 260
           +    +G A G L+GAA     DWR  F     I   +C +I+ +L +  + 
Sbjct: 213 SGFTLMGQAFGSLIGAALTAAYDWRAIFWFLV-IGCGTCMIILCFLLIETKR 263

>Kwal_23.2794 s23 (15194..17053) [1860 bp, 619 aa] {ON} YHL047C
           (ARN2) - Triacetylfusarinine C transporter [contig 246]
           FULL
          Length = 619

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 109/519 (21%), Positives = 195/519 (37%), Gaps = 88/519 (16%)

Query: 89  FLGIFLAALDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKP 148
           F+  F   LD  I    +T    ++     +S +    L+ S+  Q  +  LSD  GR  
Sbjct: 77  FICSFAYGLDSIIRDIYMTYAMDDYAEHSLLSTVNVVSLMISAVGQIFFAGLSDVFGRLS 136

Query: 149 LLVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQ 208
           L V + + + +G +I   +  +   V G     IG  G     ++++SD   L+ R  Y 
Sbjct: 137 LFVVAIIFYVVGTIIQSQAYDVGRYVAGSIFYNIGLVGAIFQVTIILSDCSSLKWRLFY- 195

Query: 209 GLCNFI-----FGLGTASGGLVGAA--FQDWRMAFTIQCPISLASCALIVSYLELPPRHE 261
              NF+     F     SG ++  A   ++W     +   I  ASC  +++ + L  R +
Sbjct: 196 ---NFVPAWPAFVTVWISGNVIHIANPSENWSWGIGMWGFIFPASCLPLIACM-LHMRWK 251

Query: 262 DDKDRHWTSKLRD-------------------LDWAGVVTL-VCFLFLFMLVSSLGGKEI 301
              DR W     +                   LD AGV+ L  C   + + ++  GG   
Sbjct: 252 VKNDREWKELQEEKSYFQTHGVVQSLVQLFWKLDVAGVLLLTACTGCILVPLTIAGGVSA 311

Query: 302 AYDSVLFALLCVTTLVLGSIFAYVELYVAVDPVLPIAFLKYRSVLGSSLANWFAMMSMLT 361
            + S       V    L  +F Y E  +A+ P+ P   LK R +         A+M ++ 
Sbjct: 312 QWRSAKVIAPFVLGFALVPVFLYWESRIALVPLAPFKMLKDRGIWAP-----LAIMFLIC 366

Query: 362 TNYYLP---VYWASVLNMKPTDIGKRSIPSFFS--VAFGSLGAGIYMKRTGKYYWFLLAF 416
             Y +    +Y   ++    +D+    I S +S   A  S   G+ + R+ +   + L  
Sbjct: 367 FIYQMAAGYLYTVLLVAANESDLSATRITSLYSFVAAIFSPILGVLVARSTRLKPYTLVG 426

Query: 417 CGIGIL----------GQLKINLLTPATPVWQQYLLLVVPSFGLSVLITVTLLAMISAVP 466
           C +  +          G+     +  A  VW       + S      I++++  + S   
Sbjct: 427 CSLYFVTMGLFYHYRGGEDAGKGIIGAMVVWG------ISSCLYDYPISISMQTVTS--- 477

Query: 467 HEHHAATTSISYAFRSTGATLGVSIGAAIFRSTLNTLLQNKVLQFASDEHPREELLRIIN 526
           HE  A  T+++      G  +G ++  AI+   L               +P+  LL+++ 
Sbjct: 478 HEMMATVTALNLTIFRIGGAVGAAVSGAIWTQAL---------------YPK--LLKLLG 520

Query: 527 NAAHSANWVHKEA----PEF-----VRATLVECYHYASK 556
           +   +A   + E     P++     VR   VE Y Y  K
Sbjct: 521 DPEMAAK-AYDEPLTFIPDYEWGTSVRDATVEAYRYVQK 558

>Kpol_541.16 s541 complement(43396..44982) [1587 bp, 528 aa] {ON}
           complement(43396..44982) [1587 nt, 529 aa]
          Length = 528

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 91/403 (22%), Positives = 164/403 (40%), Gaps = 57/403 (14%)

Query: 102 VSTLLTRIGSEFNSLDKVS-WIATSYLLSSSTCQPLYGKLSDQLGRKPLLVFSNVVFSIG 160
           +  +LTR   + +S D +  W+  S+ L S +   + G+L D  G K +L+   V+  I 
Sbjct: 78  IMNVLTR---QLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIW 134

Query: 161 CLICGMST---SIWWVVVGRFVSGIGGCGLTCLASMVISDLVPL-----RERAVYQGLCN 212
            LI G+S    S  + ++ R   G+G        S+V+ +++ L     +   + + +  
Sbjct: 135 SLITGLSGYSHSGIFFIIARAFQGLG-------ISLVLPNVLGLIGMIYKPGTLKKNMVI 187

Query: 213 FIFGLGTASGGLVGAAFQ---------DWRMAFTIQCPISLASCALIVSYLELPPRHEDD 263
            I G  +  G  +G  F           W  AF      +  +    +SY  +P     +
Sbjct: 188 SIVGAMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINT--FISYYSIPNNIPTN 245

Query: 264 KDRHWTSKLRDLDWAGVVTLVCFLFLFMLVSSLGGKEIAYDSVLFALLCVTTLVLGSIFA 323
            +R        +DW G  T V  L LF  V +    +    + L  LL ++ + L + F 
Sbjct: 246 VNR------LSMDWIGSFTGVLGLILFNFVWNQAPADGWNSAYLIVLLVISVIALIA-FG 298

Query: 324 YVELYVAVDPVLPIAFLKYRSVLGSSLANWFAMMSMLTTNYYLPVYWASVLNMK---PTD 380
             EL  A +P+LP   ++ R ++    A  F   S     +Y   Y++ VLN++   P  
Sbjct: 299 IYELRYAENPLLPSEIIRNRQLIMILTAMTFGWGSFGIWTFY---YFSFVLNLRNYSPLW 355

Query: 381 IGKRSIPSFFSVAFGSLGAGIYMKRTGKYYWFLLAFCGIGI-LGQLKINLLTPATPVWQQ 439
            G        S    ++  G  MK+       LL F  +G  LG     ++   TPV Q 
Sbjct: 356 AGGSYFIFVISGTITAISCGFLMKKIRPA--VLLTFSMVGFNLGC----IIFSVTPVHQT 409

Query: 440 YL------LLVVPSFGLSVLITVTLLAMISAVPHEHHAATTSI 476
           Y       ++++P  G+ +    + + +   +P++H     S+
Sbjct: 410 YFRNILGTMIILP-LGMDLSFPASSIILSDNLPNQHQGMAGSL 451

>SAKL0E08778g Chr5 complement(716961..718763) [1803 bp, 600 aa] {ON}
           similar to uniprot|P40474 Saccharomyces cerevisiae
           YIL121W QDR2 Multidrug transporter required for
           resistance to quinidine barban cisplatin and bleomycin
           member of the major facilitator superfamily of
           transporters conferring multiple drug resistance
           (MFS-MDR)
          Length = 600

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 39/150 (26%), Positives = 70/150 (46%), Gaps = 5/150 (3%)

Query: 91  GIFLAALDGTIVSTLLTRIGSEFN-SLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPL 149
           G+F + +   I    LT I  +FN S + V+     Y +       L G L+D++GR+P+
Sbjct: 89  GLF-STISAPIYYPALTIIEEDFNISQEMVNITVVVYFILQGLAPMLMGGLADKVGRRPI 147

Query: 150 LVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQG 209
           ++ S  ++++ C+    + +   V+  R +   G   +  + + +I D+    ER  Y G
Sbjct: 148 VLCSIALYAVACIGLASAQNYGEVLFLRCLQSAGISPVVAVNNGIIGDITTKAERGGYLG 207

Query: 210 LCNFIFGLGTASGGLVGAAFQ---DWRMAF 236
           L      +G+A G L+GA       WR  F
Sbjct: 208 LMAGTQVIGSAFGALIGAGITARWGWRAIF 237

>SAKL0E06864g Chr5 (563946..565667) [1722 bp, 573 aa] {ON} similar
           to uniprot|Q9HFF8 Saccharomyces carlsbergensis FSY1
           Fructose symporter
          Length = 573

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 43/145 (29%), Positives = 67/145 (46%), Gaps = 10/145 (6%)

Query: 140 LSDQLGRKPLLVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIG-GCGLTCLASMVISDL 198
           L++  GRK  ++ S V +++G ++C  S     +  GRF+ G+G G    C+  + IS+ 
Sbjct: 163 LNEWFGRKASIIISCVWYTVGAILCAASHDHHLMYAGRFMLGVGVGIEGGCVG-IYISES 221

Query: 199 VPLRERAVYQGLCNFIFGLGTASGGLVGAAFQDWRMAFTIQCPISLA-SCALIVSYLELP 257
           VP   R     L  F   LG   G ++G  F D +  +      SL  S AL++    LP
Sbjct: 222 VPSSVRGNLVSLYQFNIALGELFGYIIGVIFFDVKGGWRFMVGSSLVFSTALLIGLFFLP 281

Query: 258 --PR---HEDDKDRHWT--SKLRDL 275
             PR   H+      W    +LRD+
Sbjct: 282 ESPRWLVHKGRIGEAWNVWKRLRDI 306

>Kpol_1039.19 s1039 (63222..64943) [1722 bp, 573 aa] {ON}
           (63222..64943) [1722 nt, 574 aa]
          Length = 573

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 45/171 (26%), Positives = 79/171 (46%), Gaps = 10/171 (5%)

Query: 93  FLAALDGTIVSTLLTRIGSEFNSLDK--VSWIATSYLLSSSTCQPLYGKLSDQLGRKPLL 150
           F ++L   I    L ++  +F+ +D+  V+     YLL       + G L+D  GR+P++
Sbjct: 113 FWSSLGSPIYYPALRQLEKQFD-IDENLVNVTVVVYLLFQGISPTVCGGLADIYGRRPVI 171

Query: 151 VFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQGL 210
           +F  +V+ +  +    + S   ++  R +   G   +  ++S  + D     ER  + G 
Sbjct: 172 LFGMLVYIVASIALACANSYGVIIFLRCLQSCGISPIIAISSGCVGDFTMKAERGTFVGA 231

Query: 211 CNFIFGLGTASGGLVGAAFQ---DWRMAFTIQCPISL-ASCALIVSYLELP 257
            + +  LG A G L+GAA     DWR  F     +++ A C L V  L LP
Sbjct: 232 VSGLVLLGQAFGSLIGAALAAAWDWRAIFWF---LAIGAGCCLFVGILVLP 279

>KLTH0C10560g Chr3 (875216..876763) [1548 bp, 515 aa] {ON} similar
           to uniprot|Q08902 Saccharomyces cerevisiae YOR378W
           Hypothetical ORF
          Length = 515

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 95/390 (24%), Positives = 155/390 (39%), Gaps = 42/390 (10%)

Query: 109 IGSEFNSLD--KVSWIATSYLLSSSTCQPLYGKLSDQLGRKPLLVFSNVVFSIGCLICGM 166
           IG  F + +  ++SW A +Y L+  T   + G+L D  G K   +     +++  L+ G 
Sbjct: 73  IGDSFGTRNPGQLSWFAAAYSLTVGTFILIAGRLGDVYGHKKFFIIGFFWYALWSLLAGF 132

Query: 167 STSIWWVVVG--RFVSGIGGCGLTCLASMVIS-DLVPLRERAVYQGLCNFIFGLGTASGG 223
           S     +     R   GIG   L   A  ++    VP R +A+   L    FG    +G 
Sbjct: 133 SVYSNQIFFDCCRAFQGIGPALLLPNAIAILGRTYVPGRRKAMILSL----FGATAPAGF 188

Query: 224 LVGAAFQD-------WRMAF---TIQCPISLASCALIVSYLELPPRHEDDKDRHWTSKLR 273
           ++GA F         W  A+    I C     +  L++  + LP   E D      S  +
Sbjct: 189 VLGAVFSSIFGQLTWWPWAYWAMGIVCFFLAVAGILVIPRMPLP---ELDTS---VSTYQ 242

Query: 274 DLDWAGVVTLVCFLFLFMLVSSLG---GKEIAYDSVLFALLCVTTLVLGSIFAYVELYVA 330
            LD  G VT V  L L     + G   G +  Y    ++LL V+ + L  +FA++E   A
Sbjct: 243 RLDIPGSVTGVIGLVLLNFAWNQGPVVGWQTPYT---YSLLIVSAVFL-CVFAFIE-SRA 297

Query: 331 VDPVLPIAFLKYRS--VLGSSLANWFAMMSMLTTNYYLPVYWASVLNMKPTDIGKRSIPS 388
             P+LP++ L   +  VLG   A W    S     YY  ++   +    P     +  P 
Sbjct: 298 PHPLLPLSALSSDAAFVLGCVGAGW---SSFGIWIYYFWLFLEELRGHSPLLTSAQFAPV 354

Query: 389 FFSVAFGSLGAGIYMKRTGKYYWFLLAFCGIGILGQLKINLLTPATPVW--QQYLLLVVP 446
             S    +L  G  + R       L A     + G L      P   V+  Q ++ ++V 
Sbjct: 355 AISGLCAALTTGFVITRVRASLVMLFAMTAFTVGGILIAT--APVKQVYWAQAFVSIIVM 412

Query: 447 SFGLSVLITVTLLAMISAVPHEHHAATTSI 476
            +G+ +      + +  ++PHEH     S+
Sbjct: 413 PWGMDMSFPAATIMLSDSMPHEHQGLAASL 442

>NCAS0C03600 Chr3 complement(719502..721220) [1719 bp, 572 aa] {ON} 
          Length = 572

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 43/169 (25%), Positives = 76/169 (44%), Gaps = 6/169 (3%)

Query: 93  FLAALDGTIVSTLLTRIGSEFN-SLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPLLV 151
           F + + G I   +L+ I   F+ S + V+     Y +       + G L+D +GR+P+++
Sbjct: 92  FFSTIAGAIYYPVLSEIEEIFHISEESVNITVVVYFIFQGISPSIMGGLADTMGRRPIVL 151

Query: 152 FSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQGLC 211
            S  V+   C+      +   +VV R +   G   +  + S ++ D+    ER  + G  
Sbjct: 152 CSIAVYFCACIGLACCQTYPQIVVLRCLQAAGISPVIAINSGIMGDITTRAERGGFVGYV 211

Query: 212 NFIFGLGTASGGLVGAAFQ---DWRMAFTIQCPISLASCALIVSYLELP 257
           +    +G+A G L+GA       WR  F     I    C LI+S++ LP
Sbjct: 212 SGFQVMGSAFGALIGAGISSTWSWRAIFWF-LAIGSGIC-LIISFIILP 258

>Kwal_33.15020 s33 (919334..921127) [1794 bp, 597 aa] {ON} YGR138C
           (TPO2) -  [contig 96] FULL
          Length = 597

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 34/143 (23%), Positives = 65/143 (45%), Gaps = 5/143 (3%)

Query: 136 LYGKLSDQLGRKPLLVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVI 195
            +  LS++ GR P+ + + ++  +  + CG + +I  ++  RF+ G+      CL    +
Sbjct: 176 FFAPLSEEFGRNPVYLITLLIAVVFIVPCGAAKNIGTLLAFRFLDGLAFSAPMCLIGGSL 235

Query: 196 SDLVPLRERAVYQGLCNFIFGLGTASGGLVG---AAFQDWRMAFTIQCPISLASCALIVS 252
           SD+   +ER V   L +    LG   G +VG   + +  WR  +     + L+ C   V 
Sbjct: 236 SDMWRNKERGVAMSLFSAAPFLGPVMGPIVGSLLSVYCSWRWVYWFM--VILSGCLYAVM 293

Query: 253 YLELPPRHEDDKDRHWTSKLRDL 275
            + +P  H     +    KLR++
Sbjct: 294 AVFMPETHHQTLLKKRAKKLREI 316

>Smik_9.49 Chr9 (110073..111698) [1626 bp, 542 aa] {ON} YIL121W
           (REAL)
          Length = 542

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 50/223 (22%), Positives = 91/223 (40%), Gaps = 15/223 (6%)

Query: 25  LAGFVANEVEQQDYNSRTGH--DSYGATAVDDR-----TATSARCDLTFPPSETPEFALX 77
           +AG +++ + + D          SY    VD +     T+     D+T PP     F+  
Sbjct: 1   MAGRISSIMLKNDIEGELAESMQSYKTETVDKQALQRTTSVKPEPDITVPPHS--RFS-R 57

Query: 78  XXXXXXXXXXXFLGIFLAALDGTIVSTLLTRIGSEFNSLDK-VSWIATSYLLSSSTCQPL 136
                      F G F + + G I   +L+ I  EF+  ++ V+     Y +        
Sbjct: 58  SFKTVLIAQCAFTG-FFSTIAGAIYYPVLSVIEGEFDIDEQLVNITVVVYFVFQGLAPTF 116

Query: 137 YGKLSDQLGRKPLLVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVIS 196
            G  +D LGR+P+++ + +++   C+    + +   ++V R +   G   +  + S ++ 
Sbjct: 117 MGGFADSLGRRPVVLAAIIIYFGACIGLACAQTYAQIIVLRCLQAAGISPVIAINSGIMG 176

Query: 197 DLVPLRERAVYQGLCNFIFGLGTASGGLVGAAFQ---DWRMAF 236
           D+    ER  Y G       LG+A G L+GA       WR  F
Sbjct: 177 DITTRAERGGYVGYAAGFQVLGSAFGALIGAGLSFRWGWRAIF 219

>CAGL0M06281g Chr13 (651932..653560) [1629 bp, 542 aa] {ON} similar
           to uniprot|P38125 Saccharomyces cerevisiae YBR180w DTR1
          Length = 542

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 46/189 (24%), Positives = 80/189 (42%), Gaps = 15/189 (7%)

Query: 93  FLAALDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLY-GKLSDQLGRKPLLV 151
           FL  L G +    L  +  EFN  +       S  +++ +  PL+ G L+D+ GRK L +
Sbjct: 90  FLGPLAGNVFIPALPLLQKEFNVSETTINATVSVFMATFSISPLFWGALADKGGRKILYI 149

Query: 152 FS-NVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQGL 210
            S +++  I  L+  +   I  ++  R +       +  L +  ++DL P ++R   + +
Sbjct: 150 ISISLMVIINILLASVPKKIGSLIFLRIIQAFASSSVISLGAGTVADLTPPKDRG--KAM 207

Query: 211 CNFIFG------LGTASGGLVGAAFQDWRMAFTIQCPISLASCALIVSYLELPPRHE--- 261
             F+ G      L     GL+     +WR  F   C +S     LI+  L LP       
Sbjct: 208 AYFMLGPNLGPILAPIIAGLILLDNNNWRWLFGFLCIVS--GLGLIMVILLLPETLRCIV 265

Query: 262 DDKDRHWTS 270
            + DR W +
Sbjct: 266 GNGDRQWEN 274

>NCAS0B03780 Chr2 complement(674904..676673) [1770 bp, 589 aa] {ON}
           Anc_8.272 YDR119W
          Length = 589

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 68/303 (22%), Positives = 126/303 (41%), Gaps = 23/303 (7%)

Query: 284 VCFLFLFMLVSSLGGKEIAYDSVLFALLCVTTLVLGSIFAYVE-----LYVAVDPVLPIA 338
           +C  +++ L+S LG       S +F  L     ++ +I A ++     LY  +D +    
Sbjct: 298 LCKKYVYYLISMLGAVCGTITSGVFCDLWRKIYIIPTILAIIQIVLLFLYFPLDDITNKD 357

Query: 339 FLKY-RSVLGSSLANWFAMMSMLTTNYYLPVYWASVLNMKPTDIGKRSIPSFFSVAFGSL 397
            +   R  L   L N F+M++++ T  YLPVY   V N     +  R +P + S+     
Sbjct: 358 EISISRKNLLDLLPNMFSMLALIATLIYLPVYSTIVWNESYLQLSIRVLPIYLSM----F 413

Query: 398 GAGIYMKRTGKYYWFLLAFCGIGILGQLKINLLTPATPVWQQYLLLVVPSFGLSVLITVT 457
              +   R  K Y   L    +G++G  ++  L  +TP W  ++   +P      LI VT
Sbjct: 414 AVVLIQARYAKKYNTSLLGSLVGLIGYYQLYSLDKSTPDWFHFVAGCIP------LIGVT 467

Query: 458 LLAMISAVPHEHHAATTSISYAFRSTGATLGVSIGAAIFRSTLNTLLQNKVLQFASDEHP 517
            + M +       A    +       G +  + +   +F  TL+  L++ +L+  S+   
Sbjct: 468 SVIMANTKNMRDFAVGILV-------GGSATIILCQGLFTRTLHDTLRDNLLKLQSEGLK 520

Query: 518 REELLRIINNAAHSANWVHKEAPEFVRATLVECYHYASKSTFKFCLITMILAGASCSIIQ 577
           ++ELL+I+     +  W   +AP   R  +   +  A    F   L+  I    S  ++ 
Sbjct: 521 KKELLKILEKTIKNPQWALIDAPAITRGAITNSFALAIHQIFLSLLVISIFIIISSCLVS 580

Query: 578 EHT 580
            H+
Sbjct: 581 THS 583

>SAKL0E08756g Chr5 complement(714902..716599) [1698 bp, 565 aa] {ON}
           similar to uniprot|P53943 Saccharomyces cerevisiae
           YNL065W AQR1 Plasma membrane transporter of the major
           facilitator superfamily that confers resistance to
           short- chain monocarboxylic acids and quinidine
          Length = 565

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 45/174 (25%), Positives = 77/174 (44%), Gaps = 12/174 (6%)

Query: 91  GIFLAALDGTIVSTLLTRIGSEFN-SLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPL 149
           G F ++L   I    L ++   FN + + V+     Y +       + G L+D  GR+P+
Sbjct: 106 GGFWSSLGSPIYYPALKQLEQVFNINEEMVNITVVVYFIFQGVAPTISGGLADVYGRRPI 165

Query: 150 LVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQG 209
           ++   +++ +  +    S S   +V  R V   G   L  ++S V+ D     ER  + G
Sbjct: 166 ILAGMLIYVVASIGLACSNSYGVIVFLRCVQSAGISPLIAISSGVVGDFTTKSERGSFVG 225

Query: 210 LCNFIFGLGTASGGLVGA---AFQDWRMAF---TIQCPISLASCALIVSYLELP 257
             +    +G A G L+GA   A  DWR  F   TI C     +C  ++++  LP
Sbjct: 226 AVSGFALMGQAFGSLIGAGLTAAYDWRAIFWFLTIGC----GTC-FVINFFLLP 274

>YEL065W Chr5 (27657..29543) [1887 bp, 628 aa] {ON}
           SIT1Ferrioxamine B transporter, member of the ARN family
           of transporters that specifically recognize
           siderophore-iron chelates; transcription is induced
           during iron deprivation and diauxic shift; potentially
           phosphorylated by Cdc28p
          Length = 628

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 99/451 (21%), Positives = 181/451 (40%), Gaps = 35/451 (7%)

Query: 89  FLGIFLAA----LDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQL 144
           F  +FL A    LDG I  T      S ++    +S +     + ++  Q  + +LSD  
Sbjct: 74  FFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIF 133

Query: 145 GRKPLLVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRER 204
           GR  +++ S + +S+G +I   + +I    VG     +G  G+  +  ++ SD   L  R
Sbjct: 134 GRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWR 193

Query: 205 AVYQGLCNFIFGLGT-ASGGLVGAAFQDWR-----MAFTIQCP-ISLASCALIVSYL--- 254
            +   +    F + T  SG +  A   +W+      AF +    I L  C L + YL   
Sbjct: 194 LLALFIPALPFIINTWISGNVTSAIDANWKWGIGMWAFILPLACIPLGICMLHMRYLARK 253

Query: 255 ----ELPPRHEDDKDRHWTSKLRD-----LDWAGVVTLVCFLFLFMLVSSLGG--KEIAY 303
                L P  E      W S   D     LD  G++ +  F    ++  +L G  KE   
Sbjct: 254 HAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITVFFGCVLVPFTLAGGLKEEWK 313

Query: 304 DSVLFALLCVTTLVLGSIFAYVELYVAVDPVLPIAFLKYRSVLGSSLANWFAMMS-MLTT 362
            + +     +  +V+  ++   E+  +  P+ P   ++ R +  + L  +F   +  +  
Sbjct: 314 TAHIIVPEVIGWVVVLPLYMLWEIKYSRHPLTPWDLIQDRGIFFALLIAFFINFNWYMQG 373

Query: 363 NYYLPVYWASVLNMKPTDIGKRSIPSFFSVAFGSLGAGIYMK--RTGKYYWFLLA--FCG 418
           +Y   V   +V     +     S+ SF SV  G++   I +K  RT  +  F ++     
Sbjct: 374 DYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILGFILIKVRRTKPFIIFGISCWIVS 433

Query: 419 IGILGQLKINLLTPATPVWQQYLLLVVPSFGLSVLITVTLLAM-ISAVPHEHHAATTSIS 477
            G+L   + +    +  +    LL     FG      VT  ++  SA  H   A  TS+ 
Sbjct: 434 FGLLVHYRGDSGAHSGIIGSLCLL----GFGAGSFTYVTQASIQASAKTHARMAVVTSLY 489

Query: 478 YAFRSTGATLGVSIGAAIFRSTLNTLLQNKV 508
            A  + G+  G S+  A++ + L   +  ++
Sbjct: 490 LATYNIGSAFGSSVSGAVWTNILPKEISKRI 520

>YIL120W Chr9 (134417..136108) [1692 bp, 563 aa] {ON}  QDR1Multidrug
           transporter of the major facilitator superfamily,
           required for resistance to quinidine, ketoconazole,
           fluconazole, and barban
          Length = 563

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 35/148 (23%), Positives = 69/148 (46%), Gaps = 4/148 (2%)

Query: 93  FLAALDGTIVSTLLTRIGSEFNSLDKVSWIA-TSYLLSSSTCQPLYGKLSDQLGRKPLLV 151
           F + + G+I   +LT I  +FN  ++++ +    Y +       + G L+D  GR+P+++
Sbjct: 80  FFSTVAGSIYYPVLTIIERKFNITEELANVTIVVYFIFQGVAPSIMGGLADTFGRRPIVL 139

Query: 152 FSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQGLC 211
           ++ + +   C+    + +   ++  R +   G   +  + S ++ D+    ER  Y GL 
Sbjct: 140 WAILAYFCACIGLACAHNYAQILALRCLQAAGISPVIAINSGIMGDVTTKVERGGYVGLV 199

Query: 212 NFIFGLGTASGGLVGAAFQD---WRMAF 236
                +GTA G L+GA       WR  F
Sbjct: 200 AGFQVVGTAFGALIGAGLSSKWGWRAIF 227

>SAKL0C09350g Chr3 complement(849691..851427) [1737 bp, 578 aa] {ON}
           similar to uniprot|P30605 Saccharomyces cerevisiae
           YDR497C ITR1
          Length = 578

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 64/127 (50%), Gaps = 9/127 (7%)

Query: 93  FLAALDGTIVSTLLTRIGSEFN----SLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKP 148
           F+   D   +S+ L  IG++ +    +  +   I  +  L +       G  +D  GRKP
Sbjct: 80  FMFGYDTGYISSALVSIGTDLDNKTLTYGEKEIITAATSLGALITAVFAGVSADLFGRKP 139

Query: 149 LLVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIG-GCGLTCLASMVISDLVP--LRER- 204
            ++FSN++F IG ++   + + W + +GR V G G G G + ++ + IS++ P  +R R 
Sbjct: 140 CIMFSNLLFVIGAILQVSAHTFWQMAIGRLVMGFGVGIG-SLISPLFISEIAPKMIRGRL 198

Query: 205 AVYQGLC 211
            V   LC
Sbjct: 199 TVVNSLC 205

>Kwal_23.4814 s23 (881364..882953) [1590 bp, 529 aa] {ON} YIL121W -
           Hypothetical ORF [contig 5] FULL
          Length = 529

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 43/170 (25%), Positives = 79/170 (46%), Gaps = 8/170 (4%)

Query: 93  FLAALDGTIVSTLLTRIGSEFN-SLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPLLV 151
           F + + G I    L  I  +F+ S + V+     Y L       L G L+D  GR+P+++
Sbjct: 31  FFSTIAGAIYYPALNTIEGQFHISTELVNVSIVLYFLFQGLSPTLMGGLADSFGRRPVVL 90

Query: 152 FSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQGLC 211
           +S  ++   C+    S +   ++V R +   G   +  + S ++ D+    +R  Y GL 
Sbjct: 91  WSVALYMAACIGIACSKTYAQILVLRCLQSAGISPVIAVNSGIMGDVTTREQRGGYVGLT 150

Query: 212 NFIFGLGTASGGLVGAAFQ---DWRMAFTIQCPISLASC-ALIVSYLELP 257
                +G+A G L+G        WR  F     +++AS  +L+V+++ LP
Sbjct: 151 AGFQVIGSAFGALIGGGIVSTWSWRAVFWF---LAIASGFSLVVTFIMLP 197

>TBLA0B08310 Chr2 complement(1985796..1987712) [1917 bp, 638 aa]
           {ON} Anc_3.84 YDR497C
          Length = 638

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 45/78 (57%), Gaps = 5/78 (6%)

Query: 138 GKLSDQLGRKPLLVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIG-GCGLTCLASMVIS 196
           G  +D  GRKP L+FSNV+F +G ++   S + W +  GR + G G G G + ++ + IS
Sbjct: 198 GTAADVFGRKPCLMFSNVMFVVGAILQISSHTFWQMCAGRLIMGFGVGIG-SLISPLFIS 256

Query: 197 DLVP--LRER-AVYQGLC 211
           ++ P  +R R  V   LC
Sbjct: 257 EIAPKMIRGRLTVINSLC 274

>TBLA0E03790 Chr5 (953931..955583) [1653 bp, 550 aa] {ON} Anc_2.242
           YNL065W
          Length = 550

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 37/142 (26%), Positives = 71/142 (50%), Gaps = 2/142 (1%)

Query: 93  FLAALDGTIVSTLLTRIGSEFN-SLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPLLV 151
            L++L G+I   +L+ +  +F+ + ++++     Y +  +    L G L+D LGR+P+++
Sbjct: 111 LLSSLAGSIYYPVLSVLEVKFHITEEQINISVVVYYVFQAVSPTLMGGLADSLGRRPVII 170

Query: 152 FSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQGLC 211
            S  ++   C+      +   ++  R +   G   +  + S ++ D+    ER  Y GL 
Sbjct: 171 TSVFLYFCACIGLACCNNYSQLIGLRCLQATGISPVIAVNSGLMGDVTTKAERGGYMGLV 230

Query: 212 NFIFGLGTASGGLVGAA-FQDW 232
           +    LGTA G L+GAA F  W
Sbjct: 231 SGTQVLGTAFGALIGAALFSRW 252

>KLTH0G11154g Chr7 complement(940157..941875) [1719 bp, 572 aa] {ON}
           conserved hypothetical protein
          Length = 572

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 50/192 (26%), Positives = 86/192 (44%), Gaps = 11/192 (5%)

Query: 94  LAALDGTIVSTLLTRIGSEFN-SLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPLLVF 152
           L+ +D +I+S     +    + S  + S +++   L +     +   L++  GRK  ++ 
Sbjct: 112 LSGIDQSIISGASIGMNKALHLSAHEASMVSSLMPLGAMAGSVIMSPLNEWFGRKSSIMI 171

Query: 153 SNVVFSIGCLICGMSTSIWWVVVGRFVSGIG-GCGLTCLASMVISDLVPLRERAVYQGLC 211
           S + +++G ++C  STS   +  GRF+ G+G G    C+  + +S+ VP   R     + 
Sbjct: 172 SCIWYTVGAILCAASTSHHLMYAGRFILGVGVGIEGGCVG-IYVSESVPSTVRGNLVSMY 230

Query: 212 NFIFGLGTASGGLVGAAFQDWRMAFTIQCPISLA-SCALIVSYLELP--PR---HEDDKD 265
            F   LG   G +VG  F D    +      SL  S  L+V    LP  PR   H+    
Sbjct: 231 QFNIALGELFGYIVGVIFFDVHGGWRFMVGSSLVFSTILLVGMFFLPESPRWLVHKGRIG 290

Query: 266 RHWT--SKLRDL 275
             W    +LRD+
Sbjct: 291 EGWNVWKRLRDV 302

>TBLA0F01600 Chr6 complement(399573..401276) [1704 bp, 567 aa] {ON} 
          Length = 567

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 60/129 (46%), Gaps = 11/129 (8%)

Query: 138 GKLSDQLGRKPLLVFSNVVFSIGCLICGMSTSIWW-VVVGRFVSGIGGCGLTCLASMVIS 196
           GKL D  GR+  L+F   +F +G +I   S S W+   +GR ++GIG   +  L+ M+IS
Sbjct: 142 GKLGDLYGRRWGLIFGTSIFVVGVIIQIASVSKWFQYFIGRIIAGIGMGVIAVLSPMLIS 201

Query: 197 DLVPLRERAV----YQGLCNFIFGLGTAS--GGLVGAAFQDWRMAFTIQCPISLASCALI 250
           ++ P   R      YQ +  F   LG     G       + WR+A  +Q       C ++
Sbjct: 202 EVAPKELRGAMVSCYQLMITFGIFLGNCCNYGTKSYQNSKQWRIAVGLQ----FLWCIIM 257

Query: 251 VSYLELPPR 259
           VS +   P 
Sbjct: 258 VSGMTFVPE 266

>Suva_14.276 Chr14 (502686..504374) [1689 bp, 562 aa] {ON} YNL065W
           (REAL)
          Length = 562

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 43/169 (25%), Positives = 73/169 (43%), Gaps = 11/169 (6%)

Query: 93  FLAALDGTIVSTLLTRIGSEFN-SLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPLLV 151
           F ++L   I    L ++  EFN   + ++     YL+       + G L+D  GR+P+++
Sbjct: 111 FWSSLGSPIYYPALRQLEKEFNVDENMINITVVVYLMFQGIAPTVCGGLADCFGRRPIIL 170

Query: 152 FSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQGLC 211
              +V+ +  +    + S   ++  R V  IG      ++S V+ D     ER  + G  
Sbjct: 171 GGMLVYVVASVGLACAPSYGVIIFLRCVQSIGISPTIAISSGVVGDFTLKHERGTFVGAT 230

Query: 212 NFIFGLGTASGGLVGAAFQ---DWRMAF---TIQCPISLASCALIVSYL 254
           +    LG   G L+GA      DWR  F   TI C     +C LI  ++
Sbjct: 231 SGFVLLGQCFGSLIGAVLTARWDWRSIFWFLTIGC----GTCFLIAFFI 275

>TBLA0A03420 Chr1 (824716..826449) [1734 bp, 577 aa] {ON} 
          Length = 577

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 44/139 (31%), Positives = 69/139 (49%), Gaps = 14/139 (10%)

Query: 138 GKLSDQLGRKPLLVFSNVVFSIGCLICGMSTSIWW-VVVGRFVSGIGGCGL-TCLASMVI 195
           G++ D  GR+  +VF+  +F +G +I   S   W+  ++GR V+G+ GCGL   L  M+I
Sbjct: 130 GRVGDLYGRRIGIVFATTIFIVGTIIQIASVKAWYQYMIGRIVAGV-GCGLFPVLCPMLI 188

Query: 196 SDLVPLRERAV----YQGLCNFIFGLG--TASGGLVGAAFQDWRMAFTIQCPISLASCAL 249
           S++ P   R      YQ +      LG  T  G  V    + WR+   +Q   +L    L
Sbjct: 189 SEVSPKHLRGALVSCYQLMVTMGIFLGDCTNYGTKVYHDSRQWRIGLGLQFAWAL---FL 245

Query: 250 IVSYLELP--PRHEDDKDR 266
           I + L +P  PR+  +K R
Sbjct: 246 ITAMLFVPESPRYLIEKGR 264

>SAKL0C11066g Chr3 complement(998593..1000335) [1743 bp, 580 aa]
           {ON} similar to uniprot|P30605 Saccharomyces cerevisiae
           YDR497C
          Length = 580

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 34/118 (28%), Positives = 56/118 (47%), Gaps = 6/118 (5%)

Query: 93  FLAALDGTIVSTLLTRIGSEFN----SLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKP 148
           F+   D   +S  L  +G + +    S  +   I  +  L +       G L+D  GRKP
Sbjct: 90  FMFGYDTGYISAALVSLGKDLDNKYLSYGEKEIITAATSLGALITSLFAGTLADIFGRKP 149

Query: 149 LLVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIG-GCGLTCLASMVISDLVPLRERA 205
           + + SNV+F IG ++   + S W +  GR + G G G G + L+ + IS++ P   R 
Sbjct: 150 VTMSSNVMFLIGAILQACTRSFWQMAAGRLLMGFGIGIG-SLLSPLFISEIAPSEYRG 206

>Smik_15.560 Chr15 (995453..997003) [1551 bp, 516 aa] {ON} YOR378W
           (REAL)
          Length = 516

 Score = 47.8 bits (112), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 96/413 (23%), Positives = 159/413 (38%), Gaps = 38/413 (9%)

Query: 109 IGSEFNSLD--KVSWIATSYLLSSSTCQPLYGKLSDQLGRKPLLVFSNVVFSIGCLICGM 166
           IG  F + +  ++SW A++Y L+  T   + G+L D  G K   V     +++  L+ G 
Sbjct: 71  IGDSFGTANPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGF 130

Query: 167 ---STSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQGLCNFIFGLGTASGG 223
              S  I++     F     G G   L    I+ L    +    + +   +FG     G 
Sbjct: 131 SVYSNQIFFDCCRAF----QGMGPAFLLPNAIAILGRTYKPGRRKNMVFSLFGASAPGGF 186

Query: 224 LVGAAFQD-------WRMAFTIQCPISLASCAL--IVSYLELPPRHEDDKDRHWTSKLRD 274
           ++GA F         W  A+ +       +C L  +  Y  +P     ++D      L  
Sbjct: 187 VLGAVFSSMLGQLAWWPWAYWLMG----IACFLLAVAGYYLIPHTPMPNRDVASFKLLER 242

Query: 275 LDWAGVVTLVCFLFLFMLVSSLG---GKEIAYDSVLFALLCVTTLVLGSIFAYVELYVAV 331
           +D+AG VT V  L LF    + G   G +  Y    +ALL V T+ L  IFA++E   A 
Sbjct: 243 IDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYT---YALLIVGTVFL-IIFAFIESRAAF 298

Query: 332 DPVLPIAFLKYRS--VLGSSLANWFAMMSMLTTNYYLPVYWASVLNMKPTDIGKRSIPSF 389
            P+LP A L   +  VL    A W    S     +Y   +        P     +  P  
Sbjct: 299 -PLLPFAALSSDTAFVLSCIAAGW---ASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVA 354

Query: 390 FSVAFGSLGAGIYMKRTGKYYWFLLAFCGIGILGQLKINLLTPATPVWQQ-YLLLVVPSF 448
            S    +L  G  +  T        A     + G + I         W Q ++ ++V  +
Sbjct: 355 ISGFCAALMTGFLLSHTPPSTVMFFAMTAFTV-GTILIATAPVHQTYWAQTFVSIIVMPW 413

Query: 449 GLSVLITVTLLAMISAVPHEHHAATTSISYAFRSTGATLGVSIGAAIFRSTLN 501
           G+ +      + +  ++PHEH     S+     +   ++G+ I   I  S +N
Sbjct: 414 GMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTI-ESNVN 465

>TBLA0E01970 Chr5 complement(478901..480637) [1737 bp, 578 aa] {ON} 
          Length = 578

 Score = 47.4 bits (111), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 41/143 (28%), Positives = 68/143 (47%), Gaps = 10/143 (6%)

Query: 138 GKLSDQLGRKPLLVFSNVVFSIGCLICGMSTSIWW-VVVGRFVSGIGGCGLTCLASMVIS 196
           GKL D  GR+  L+ + ++F IG LI   S   W+   +GR ++GIG   +  L+ M+IS
Sbjct: 134 GKLGDIYGRRWGLILATIIFVIGVLIEITSVDKWYQYFIGRIIAGIGMGLIAVLSPMLIS 193

Query: 197 DLVPLRERAV----YQGLCNFIFGLGTAS--GGLVGAAFQDWRMAFTIQCPIS-LASCAL 249
           ++ P   R      YQ +  F   LG     G    +    WR+   +Q   S +  CA+
Sbjct: 194 EVAPKELRGAMVSCYQLMITFGIFLGNCCNYGTKSYSNSAQWRIGVGLQFLWSIIMVCAM 253

Query: 250 IVSYLELPPRHEDDKDRHWTSKL 272
           +  ++   PR+   K +   +K+
Sbjct: 254 M--FVPESPRYLIQKGKTEQAKI 274

>KLTH0C09372g Chr3 (778251..780077) [1827 bp, 608 aa] {ON} highly
           similar to uniprot|P30605 Saccharomyces cerevisiae
           YDR497C ITR1 Myo-inositol transporter with strong
           similarity to the minor myo-inositol transporter Itr2p,
           member of the sugar transporter superfamily; expression
           is repressed by inositol and choline via Opi1p and
           derepressed via Ino2p and Ino4p
          Length = 608

 Score = 47.4 bits (111), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 55/199 (27%), Positives = 87/199 (43%), Gaps = 21/199 (10%)

Query: 93  FLAALDGTIVSTLLTRIGSEFN----SLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKP 148
           F+   D   +S+ L  IG++ +    +      I  +  L +       G  +D  GRKP
Sbjct: 112 FMFGYDTGYISSALVSIGTDLDHRALTYGDKEIITAATSLGALISSIFAGTSADIWGRKP 171

Query: 149 LLVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIG-GCGLTCLASMVISDLVPLRERAVY 207
            L+FSN++F++G ++   + S W + VGR + G G G G + ++ + I ++ P   R   
Sbjct: 172 CLMFSNLLFTVGAVLQISARSFWQMAVGRLIMGFGVGIG-SLISPLFIGEIAPKNIR--- 227

Query: 208 QGLCNFIFGLGTASGGLV----GAAFQDWRMAFTIQCPISL-ASCALIVSYLELPPRHED 262
            G    I  L    G LV    GA        + I   +SL  +C   V +  LP     
Sbjct: 228 -GRLVVINSLCLTGGQLVAYGCGAGLDKVHNGWRILVGLSLIPTCIQFVCFWFLP----- 281

Query: 263 DKDRHWTSKLRDLDWAGVV 281
           D  R++  K R LD A  V
Sbjct: 282 DTPRYYVMKGR-LDKAAEV 299

>Suva_4.2 Chr4 (4514..6226) [1713 bp, 570 aa] {ON} YDR497C (REAL)
          Length = 570

 Score = 47.4 bits (111), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 54/200 (27%), Positives = 87/200 (43%), Gaps = 10/200 (5%)

Query: 89  FLGIFLAALDGTIVSTLLTRIGSEFN-SLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRK 147
           F GI L+ +D +I+S     +    + S  + S +++   L +     L    S+  GRK
Sbjct: 109 FAGI-LSGIDQSIISGASIGMNKMLHLSTHEASLVSSLMPLGAVAGSILLTPFSEYFGRK 167

Query: 148 PLLVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVY 207
             L  S V +++G ++C  +++   +  GRF+ GIG         + I++ VP   R   
Sbjct: 168 KSLAISCVFYTVGAIVCAAASNHHEMYAGRFLIGIGVGLEGGGIGVYIAESVPSSVRGSL 227

Query: 208 QGLCNFIFGLGTASGGLVGAAFQDWRMAFTIQCPISLA-SCALIVSYLELP--PR---HE 261
             L  F   LG   G +VG  F D +  +      SL  S  L +  L LP  PR   H+
Sbjct: 228 VSLYQFNIALGELFGYIVGVIFFDVKGGWRYMVGSSLVFSTTLFIGLLFLPESPRWLMHK 287

Query: 262 DDKDRHWT--SKLRDLDWAG 279
                 W    +LRD++  G
Sbjct: 288 GRVGESWNVWKRLRDVNEEG 307

>KNAG0E01170 Chr5 (230542..232263) [1722 bp, 573 aa] {ON} 
          Length = 573

 Score = 47.4 bits (111), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 43/169 (25%), Positives = 78/169 (46%), Gaps = 6/169 (3%)

Query: 93  FLAALDGTIVSTLLTRIGSEFN-SLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPLLV 151
           F + +  +I   +L  +  +F+ S ++V+     Y +  +    L G L+D LGR+P+++
Sbjct: 92  FFSTIAASIYFPVLGVVQRKFHISEEQVNMTVVVYYIFQALSPTLMGGLADSLGRRPVVL 151

Query: 152 FSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQGLC 211
            S +++   C+      +   ++  R V   G   +  + S ++ D+    ER  Y G  
Sbjct: 152 SSVIIYFCACVGLARCNTYAQIIALRCVQAAGISPVIAINSGMMGDVTTKAERGGYVGYV 211

Query: 212 NFIFGLGTASGGLVGAAFQD---WRMAFTIQCPISLASCALIVSYLELP 257
           +    +GTA+G + GA       WR  F     I   +C+ IVS L LP
Sbjct: 212 SGFQVVGTATGAVFGALLSSRWGWRSIFWF-LAIGSGACS-IVSLLLLP 258

>Suva_15.291 Chr15 complement(497138..498916) [1779 bp, 592 aa] {ON}
           YHR094C (REAL)
          Length = 592

 Score = 47.4 bits (111), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 47/85 (55%), Gaps = 5/85 (5%)

Query: 139 KLSDQLGRKPLLVFSNVVFSIGCLICGMSTSIWW-VVVGRFVSGIGGCGLTCLASMVISD 197
           +L D  GRK  LV   V++S+G +I   S   W+   +GR +SG+G  G+T L+ M+IS+
Sbjct: 156 RLGDMYGRKIGLVIVVVIYSVGIIIQIASIDKWYQYFIGRIISGLGVGGITVLSPMLISE 215

Query: 198 LVPLRERAV----YQGLCNFIFGLG 218
           + P + R      YQ +  F   LG
Sbjct: 216 VSPKQLRGTLVSCYQLMITFGIFLG 240

>Skud_14.406 Chr14 (740510..742204) [1695 bp, 564 aa] {ON} YNR072W
           (REAL)
          Length = 564

 Score = 47.4 bits (111), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 39/149 (26%), Positives = 74/149 (49%), Gaps = 18/149 (12%)

Query: 136 LYGKLSDQLGRKPLLVFSNVVFSIGCLICGMSTSIWW-VVVGRFVSGIGGCGLTCLASMV 194
           ++ + +D+LGR+  +V   +V+ +G +I   S+  W+   VG+ + G+G  G + L  M+
Sbjct: 125 IFARFADKLGRRLAIVIVVLVYMVGAIIQISSSHKWYQYFVGKIIYGLGAGGCSVLCPML 184

Query: 195 ISDLVPLRER----AVYQGLCNFIFGLGTASGGLVGAAFQDWRMAFTIQCPISLASCAL- 249
           +S++ P   R    ++YQ   N  FG+      + G    D     T Q  + L  C L 
Sbjct: 185 LSEIAPKDLRGGLISLYQ--LNMTFGIFLGYCSVYGTRKYD----DTAQWRVPLGLCFLW 238

Query: 250 ----IVSYLELP--PRHEDDKDRHWTSKL 272
               IV  L +P  PR+  ++++H  +++
Sbjct: 239 ALIIIVGMLLVPESPRYLIEREKHEEARI 267

>TPHA0F01290 Chr6 complement(294550..296238) [1689 bp, 562 aa] {ON}
           Anc_2.241 YIL121W
          Length = 562

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 42/172 (24%), Positives = 77/172 (44%), Gaps = 12/172 (6%)

Query: 93  FLAALDGTIVSTLLTRIGSEFN-SLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPLLV 151
           F ++L   I    L ++  +F+   + V+     YL+         G L+D  GR+P+++
Sbjct: 102 FWSSLGSPIYYPALKQLEKQFDVDENMVNVTVVVYLIFQGLSPTFCGGLADLFGRRPVIL 161

Query: 152 FSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQGLC 211
              +++++  +    S S   +V  R +   G      ++S  + D     ER  + G  
Sbjct: 162 TGMLIYTVASIGLACSNSYGVIVFLRCLQSAGISPTISISSGAVGDFTVKSERGTFVGAV 221

Query: 212 NFIFGLGTASGGLVGAAFQ---DWRMAF---TIQCPISLASCALIVSYLELP 257
           + +  LG A G L+GAA     +WR  F   TI C +S     ++V++  LP
Sbjct: 222 SGLVLLGQAFGSLIGAALAASFNWRAIFWFLTIGCGVS-----MMVAFFVLP 268

>NCAS0I02520 Chr9 complement(472075..473838) [1764 bp, 587 aa] {ON}
           Anc_3.84
          Length = 587

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 40/139 (28%), Positives = 62/139 (44%), Gaps = 14/139 (10%)

Query: 138 GKLSDQLGRKPLLVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIG-GCGLTCLASMVIS 196
           G  +D  GRKP L+FSNV+F IG ++   +   W +  GR + G G G G + ++ + IS
Sbjct: 148 GTAADIFGRKPCLMFSNVLFVIGAILQITAHRFWQMNAGRLIMGFGVGIG-SLISPLFIS 206

Query: 197 DLVPLRERAVYQGLCNFIFGLGTASGGLV----GAAFQDWRMAFTIQCPISLASCALIVS 252
           ++ P     + +G    I  L    G L+    GA        + I   +SL    L  S
Sbjct: 207 EIAP----KMIRGRLTVINSLWLTGGQLIAYGCGAGLNHVHNGWRILVGLSLIPTVLQFS 262

Query: 253 YLELPPRHEDDKDRHWTSK 271
           +    P    D  R++  K
Sbjct: 263 FFLFLP----DTPRYYVMK 277

>TDEL0H04480 Chr8 complement(774396..776108) [1713 bp, 570 aa] {ON} 
          Length = 570

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 42/144 (29%), Positives = 65/144 (45%), Gaps = 8/144 (5%)

Query: 140 LSDQLGRKPLLVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLV 199
           LS+  GRK  LV S + +++G ++C  + +   +  GRF+ G+G         + I++ V
Sbjct: 160 LSETFGRKKALVMSCIFYTVGAIVCAAAGNHHEMYAGRFLIGVGVGIEGGGIGVYIAESV 219

Query: 200 PLRERAVYQGLCNFIFGLGTASGGLVGAAFQDWRMAFTIQCPISLA-SCALIVSYLELP- 257
           P   R     L  F   LG   G +VG  F D +  +      SL  S  L++  L LP 
Sbjct: 220 PSSVRGSLVSLYQFNIALGELFGYIVGVIFFDVKGGWRYMVGSSLVFSTILLIGLLFLPE 279

Query: 258 -PR---HEDDKDRHWT--SKLRDL 275
            PR   H+      W    +LRD+
Sbjct: 280 SPRWLMHKGRVGESWNVWKRLRDV 303

>Smik_6.24 Chr6 (39520..41154) [1635 bp, 544 aa] {ON} YMR279C (REAL)
          Length = 544

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 90/436 (20%), Positives = 168/436 (38%), Gaps = 33/436 (7%)

Query: 89  FLGIFLAALDGTIVSTLLTRIGSEFN-SLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRK 147
           FLG     L+   + +L+  +  ++N S    SW  TSY ++ +      G+L D +G  
Sbjct: 35  FLGCTFDLLNVASMISLIDDLAKKYNISYTTASWSLTSYAVTFAGFIACMGRLGDIVGNS 94

Query: 148 PLLVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVY 207
            L   S   F+I  L+C +  +     V R + GI   GL   A  +I  L P  +   Y
Sbjct: 95  VLFTISCSCFAILSLLCAVMPNFPAFAVFRAIQGICAAGLVPCAYALIPILAPKEKVQKY 154

Query: 208 QGL--CNF--IFGLGTASGGLVGAAFQDWRMAFTIQCPISLASCALIVSYLELPPRHEDD 263
             +  C F    GLG   GG   A    +R  F +   + ++  ++I  +      + D 
Sbjct: 155 FSIVSCGFSSTIGLGLIIGGAFAATKIGYRGIFYLTFAV-MSLISVIAFFFTYNVENFDK 213

Query: 264 KDRHWTSK--LRDLDWAGVVTLVCFLFLFMLVSSLGG----KEIAYDSVLFALL------ 311
           K +   ++  ++ LD+ G +  V    L ++  + GG    + + Y +++  +L      
Sbjct: 214 KPQKIQAQTSVKSLDFIGSLIFVAGSILIVVGLTEGGESWNRPVTYVTLIIGILLFFGFF 273

Query: 312 ---CV-TTLVLGSIFAYVE---LYVAVDPVLPIAFLKYRSVLGSSLANWFAMMSMLTTNY 364
              C    +V G  F  ++    +  V  ++P+  L  ++ +   LA       + +  Y
Sbjct: 274 VWNCTYAKIVRGIRFVGIDTSKYFEKVQLLIPVDVLFMKNFIPIVLAFALNNACLFSCLY 333

Query: 365 YLPVYWASVLNMKPTDIGKRSIPSFFSVAFG----SLGAGIYMKRTGKYYWFLLAFCGIG 420
            +  Y        P   G + +P    +  G    +  +     R G    F LA  G  
Sbjct: 334 IIDQYSQYAEKDSPLLAGVKLVPLIICMVVGNALCAFESTKLKPRVGVALGFSLALAGSI 393

Query: 421 ILGQLKINLLTPATPVWQQYL-LLVVPSFGLSVLITVTLLAMISAVPHEHHAATTSISYA 479
           IL QL    L      W+ +     +  FG+++     L   +   P +     + ++  
Sbjct: 394 ILIQLH---LIKDNVFWKIFFSSQALVGFGVAIFYPYALQIAVGGAPDQSKGIASGVAQT 450

Query: 480 FRSTGATLGVSIGAAI 495
           F   G  +  S+ A++
Sbjct: 451 FGQLGIEITFSVMASV 466

>Skud_9.48 Chr9 (109346..111145) [1800 bp, 599 aa] {ON} YIL120W
           (REAL)
          Length = 599

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 35/148 (23%), Positives = 66/148 (44%), Gaps = 4/148 (2%)

Query: 93  FLAALDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQP-LYGKLSDQLGRKPLLV 151
           F + + G I   +L+ I  +FN  +++  +            P L G  +D LGR+P+++
Sbjct: 94  FFSTIAGAIYYPVLSVIERKFNIDEQLVNVTVVVYFVFQGLAPTLMGGFADSLGRRPVVL 153

Query: 152 FSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQGLC 211
            + +++   C+    + +   ++V R +   G   +  + S ++ D+    ER  Y G  
Sbjct: 154 IAIIIYFGACVGLACTQTYAQIIVLRCLQAAGISPVIAINSGIMGDITTRAERGGYVGYA 213

Query: 212 NFIFGLGTASGGLVGAAFQD---WRMAF 236
                LG+A G L+GA       WR  F
Sbjct: 214 AGFQVLGSAFGALIGAGLSSRWGWRAIF 241

>KLTH0G18854g Chr7 complement(1628440..1629948) [1509 bp, 502 aa]
           {ON} similar to uniprot|P43562 Saccharomyces cerevisiae
           YFL040W Hypothetical ORF
          Length = 502

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 40/71 (56%)

Query: 136 LYGKLSDQLGRKPLLVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVI 195
           L+G ++D+LGR P      +++ IG +I     ++W ++ GRF+ GI     + L  + I
Sbjct: 68  LFGIMTDKLGRAPTFRVLALIWIIGSIISAAVLNVWMLIAGRFIRGIAVGSFSVLLPVYI 127

Query: 196 SDLVPLRERAV 206
            ++VP + R +
Sbjct: 128 GEVVPEQRRGL 138

>TPHA0C03100 Chr3 (684842..686650) [1809 bp, 602 aa] {ON} Anc_2.242
           YNL065W
          Length = 602

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 36/148 (24%), Positives = 66/148 (44%), Gaps = 4/148 (2%)

Query: 93  FLAALDGTIVSTLLTRIGSEFNSLDKVSWIATS-YLLSSSTCQPLYGKLSDQLGRKPLLV 151
           F +++ G I   +LT I   F   ++ + I+   Y +       + G L+D  GR+PL++
Sbjct: 134 FFSSIAGAIYYPVLTLIEGLFKITEEQANISVVVYFIFQGIAPIIVGNLADTNGRRPLIL 193

Query: 152 FSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQGLC 211
              +++   C+      +   ++  R +   G   +  + S +  D+   RER  Y G  
Sbjct: 194 SCLLIYFCACVGLASCNTYAQLIGLRCLQAAGIAPVIAINSGIAGDITTRRERGSYIGYV 253

Query: 212 NFIFGLGTASGGLVGAAFQ---DWRMAF 236
           +    +G+A G L+GA      DWR  F
Sbjct: 254 SGFVVIGSAFGALIGAGLSSTWDWRAIF 281

>KLTH0B00110g Chr2 complement(1655..3538) [1884 bp, 627 aa] {ON}
           similar to uniprot|P25596 Saccharomyces cerevisiae
           YCL073C and similar to uniprot|P36173 Saccharomyces
           cerevisiae YKR106W
          Length = 627

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 98/409 (23%), Positives = 166/409 (40%), Gaps = 38/409 (9%)

Query: 130 SSTCQPLYGKLSDQLGRKPLLVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTC 189
           S   Q ++ +LSD  GR  L +   V++ +G +I   +  I    VG      G  G++ 
Sbjct: 126 SIAAQIIFAQLSDIFGRLQLFLVGTVLYIVGTIIQCEARDIRTYAVGAAFYNSGYVGVSI 185

Query: 190 LASMVISDLVPLRERAVYQGLCNF-IFGLGTASGGLVGAA--FQDWRMAFTIQC---PIS 243
           L  +V+SDL P + R ++Q   ++    +   SG +V +A   ++WR    +     PIS
Sbjct: 186 LLIIVLSDLSPSKWRLLFQFATSWPCIIICWISGDIVQSANPAKNWRFDIGMWAFLFPIS 245

Query: 244 LASCALIVSYL--------ELPPRHEDDKDR-----HWTSKL-RDLDWAG----VVTLVC 285
                + + Y         E      D+K+      +W   +  ++D  G     V+L C
Sbjct: 246 ALPFIIFLLYFTRQASKTAEWKEIQGDNKEPSVRIVYWIKSIYSNIDVVGTSLVTVSLGC 305

Query: 286 FLFLFMLVSSLGGKEIAYDSVLFALLCVTTLVLGSIFAYVELYVAVDPVLPIAFLKYRSV 345
            L    L    GG    ++        V   V    F   ++  A + VLP   LK R V
Sbjct: 306 ILVPLTLA---GGISDDWNKPGIIATIVVGFVSFMFFLAWDIKFAKNAVLPFKLLKDRGV 362

Query: 346 LGSSLANWFAMMSMLTTNYYL-PVYWASVLNMKPTDIGKRSIPSFFSVAFGSLGAGIYMK 404
             S  A     +   T + YL PV   SV     +      +P+F +   GS+  G+ + 
Sbjct: 363 WASLAAALLEKLIYATISDYLYPVLLVSVNESSKSATRILWLPTFVACT-GSIFFGLLVV 421

Query: 405 RTGKYYWFLLAFCGIGI-LGQLKINLLTPATPVWQQYLLLVVPSFGL---SVLITVTLLA 460
           RT +    L  +  IG+ L  L I L          +  ++  S  L   S + T +L+ 
Sbjct: 422 RTKR----LKIYSIIGVCLWILSIGLFYHYRGGASSHSGIIGASVVLGTGSAIFTQSLIV 477

Query: 461 MISAV-PHEHHAATTSISYAFRSTGATLGVSIGAAIFRSTLNTLLQNKV 508
            +  +  H++ A+ T + + F   G+  G SI  AI+  T+   L  ++
Sbjct: 478 NLQTMTSHKNMASITGLYFMFAQIGSASGASISGAIWTQTMYKQLYKRL 526

>Skud_15.51 Chr15 (83321..84391,84482..85174) [1764 bp, 587 aa] {ON}
           YOL103W (REAL)
          Length = 587

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 42/149 (28%), Positives = 69/149 (46%), Gaps = 15/149 (10%)

Query: 138 GKLSDQLGRKPLLVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIG-GCGLTCLASMVIS 196
           G  +D  GR+P L+FSN++F IG ++   +   W +  GR + G G G G + ++ + IS
Sbjct: 178 GTAADVFGRRPCLMFSNLMFLIGAILQITAHRFWQMAAGRLIMGFGVGIG-SLISPLFIS 236

Query: 197 DLVPLRERAVYQGLCNFIFGLGTASGGLV----GAAFQDWRMAFTIQCPISLASCALIVS 252
           ++ P     + +G    I  L    G L+    GA     +  + I   +SL    L  S
Sbjct: 237 EIAP----KMIRGRLTVINSLWLTGGQLIAYGCGAGLNHVKNGWRILVGLSLIPTVLQFS 292

Query: 253 YLELPPRHEDDKDRHWTSKLRDLDWAGVV 281
           +    P    D  R++  K  DL+ A +V
Sbjct: 293 FFCFLP----DTPRYYVMK-GDLERAKMV 316

>Kpol_416.5 s416 (23208..25031) [1824 bp, 607 aa] {ON}
           (23208..25031) [1824 nt, 608 aa]
          Length = 607

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 93/439 (21%), Positives = 172/439 (39%), Gaps = 48/439 (10%)

Query: 97  LDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPLLVFSNVV 156
           LD ++  T  T   S +N    +S ++    + S+  Q  + + +D  GR  +L+ S V 
Sbjct: 76  LDNSVRGTYQTLATSSYNQHSLLSTVSCIKAVISAAAQIWFARSADMFGRTTILMISIVF 135

Query: 157 FSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQGLCNFIFG 216
           + +G ++   +  +     G  +  +G   +   + + ++D   L  R            
Sbjct: 136 YVVGTVVESQAVDVSKFAAGACLYAVGHSAIVLFSEVYVADFSNLNWRVTAAAAPLLPNV 195

Query: 217 LGTASGGLVGAAFQD--------WRMAFTIQCPISLASCALIVSYLELPPRHEDD----- 263
           + T   G + AA  +        W   F + C I + +C L + YL    +++DD     
Sbjct: 196 INTWISGDITAAIDENWKWGIGMWAFIFPLSC-IPMGACILHMKYL--AKKNKDDLKVAF 252

Query: 264 -KDRH--WTSKLRDLDW------AGVVTLVCFLFLFMLVSSLGGKEIAYDSVLFALLCVT 314
            K  H  W+  L D+ +        ++ +  F  + +  +  GG+E  + +       + 
Sbjct: 253 KKPEHYTWSQYLVDVFFWKLDLVGLLLLVAIFGMILIPFTLAGGEEKVWSTAR----IIV 308

Query: 315 TLVLGSIFAYV-----ELYVAVDPVLPIAFLKYRSVLGSSLANWFAMMS-MLTTNYYLPV 368
             VLG  FA       E+  A  P+ P   LK R ++ + +   F   +  + + Y   V
Sbjct: 309 PEVLGWAFALPLFLVWEIKFARYPLTPKDALKNRGIVSALVLVLFLQFAYQMQSTYLYTV 368

Query: 369 YWASVLNMKPTDIGKRSIPSFFSVAFGSLGAGIYMK--RTGKYYWFLLAFCGIGILGQLK 426
              +V   K +      + SF SV  G L   +  K  RT ++ +F     GIG+   + 
Sbjct: 369 LLVAVDESKKSATRINKLFSFVSVITGFLSGFVVAKVRRTKEFIFF-----GIGVWF-IS 422

Query: 427 INLLTPATPVWQQYLLLVVP----SFGLSVL-ITVTLLAMISAVPHEHHAATTSISYAFR 481
             L+   T     ++ ++V      FG   L          SA  HE  A  TS+  A  
Sbjct: 423 FGLMIRYTGGLDSHVGIIVARCILGFGNGFLKFPARASIQASAYSHEMMAVMTSLFLAVS 482

Query: 482 STGATLGVSIGAAIFRSTL 500
           S G+  G ++  +I+ + L
Sbjct: 483 SIGSAFGDAVAGSIWTNVL 501

>TDEL0C04590 Chr3 (831668..833257) [1590 bp, 529 aa] {ON} Anc_2.242
           YNL065W
          Length = 529

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 49/169 (28%), Positives = 73/169 (43%), Gaps = 17/169 (10%)

Query: 93  FLAALDGTIVSTLLTRIGSEFN-SLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPLLV 151
           F ++L   I    L ++  EFN   DKV+     YLL         G L+D  GR+P++V
Sbjct: 74  FWSSLGSPIYYPALRQLEKEFNIDEDKVNVTVVVYLLFQGIAPTFSGGLADIYGRRPVIV 133

Query: 152 FSNVVF---SIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQ 208
              +++   S+G L C  S  +  +V  R +          ++S  + D     ER  + 
Sbjct: 134 IGMIIYVAVSVG-LACSNSYGV--LVFLRILQSACISPTIAISSGFVGDFTLKFERGTFV 190

Query: 209 GLCNFIFGLGTASGGLVGAAFQ---DWRMAF---TIQCPISLASCALIV 251
           G  +    LG A G L+GAA     DWR  F    I C +    C LI+
Sbjct: 191 GATSGFALLGQAFGSLIGAALAAAWDWRAIFWFLVIGCGV----CMLII 235

>Suva_13.174 Chr13 (278964..280589) [1626 bp, 541 aa] {ON} YMR011W
           (REAL)
          Length = 541

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 41/152 (26%), Positives = 70/152 (46%), Gaps = 7/152 (4%)

Query: 138 GKLSDQLGRKPLLVFSNVVFSIGCLICGMSTSIWW-VVVGRFVSGIGGCGLTCLASMVIS 196
           G+L D  GRK  L+   +V+ +G +I   ST  W+   +GR +SG+G  G+  L+  +IS
Sbjct: 125 GRLGDIYGRKIGLMCVILVYIVGIVIQIASTDKWYQYFIGRIISGMGVGGIAVLSPTLIS 184

Query: 197 DLVPLRERAVYQGLCNFIFGLGTASGGLVGAAFQDWRMAFTIQCPISLA---SCALIVSY 253
           +  P   R         +  LG   G       +D+  +   + P+ +    +  +I   
Sbjct: 185 ETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSIQWRVPLGMNFAFAIFMIAGM 244

Query: 254 LELP--PRHEDDKDRHWTSKLRDLDWAGVVTL 283
           L +P  PR   +K R+  +K R L  +  VT+
Sbjct: 245 LMVPESPRFLVEKGRYEDAK-RSLARSNKVTI 275

>TBLA0G02550 Chr7 complement(668523..670364) [1842 bp, 613 aa] {ON}
           Anc_2.242 YNL065W
          Length = 613

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 38/150 (25%), Positives = 68/150 (45%), Gaps = 8/150 (5%)

Query: 93  FLAALDGTIVSTLLTRIGSEFN---SLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPL 149
           F ++L   I    L ++  +FN   +L  VS +   YL+       + G L+D  GR+P+
Sbjct: 109 FWSSLGSPIYYPALKQLEKKFNVDENLVNVSVVV--YLIFQGFAPAVSGGLADIYGRRPV 166

Query: 150 LVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQG 209
           ++F  +V+ +  +      S   ++  R +   G   L  ++S  + D     ER  + G
Sbjct: 167 ILFGMLVYVVASIGIAACNSYGVIIFLRCLQSTGISPLIAISSGAVGDFTVKAERGTFVG 226

Query: 210 LCNFIFGLGTASGGLVGAAFQ---DWRMAF 236
             + +  +G A G L+GAA     +WR  F
Sbjct: 227 AVSGLVLMGQAFGSLIGAALAAAYNWRAIF 256

>Skud_8.157 Chr8 complement(268495..270273) [1779 bp, 592 aa] {ON}
           YHR094C (REAL)
          Length = 592

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 47/85 (55%), Gaps = 5/85 (5%)

Query: 139 KLSDQLGRKPLLVFSNVVFSIGCLICGMSTSIWW-VVVGRFVSGIGGCGLTCLASMVISD 197
           +L D  GRK  L+   V++S+G +I   S   W+   +GR +SG+G  G+T LA M+IS+
Sbjct: 156 RLGDMYGRKIGLMSVVVIYSVGIIIQIASIDKWYQYFIGRIISGLGVGGITVLAPMLISE 215

Query: 198 LVPLRERAV----YQGLCNFIFGLG 218
           + P + R      YQ +  F   LG
Sbjct: 216 VSPKQLRGTLVSCYQLMITFGIFLG 240

>KAFR0G00160 Chr7 (51436..53346) [1911 bp, 636 aa] {ON} 
          Length = 636

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/108 (27%), Positives = 49/108 (45%), Gaps = 2/108 (1%)

Query: 139 KLSDQLGRKPLLVFSNVVFSIGCLICGMSTSIWW--VVVGRFVSGIGGCGLTCLASMVIS 196
           K+ D  GRK  ++F NV++ IG LIC  S    W    +GR +SG+   G   L  + ++
Sbjct: 210 KIGDIYGRKIGIIFMNVIYIIGQLICITSMKHKWYQYTIGRIISGLAVGGFMTLIPIFLA 269

Query: 197 DLVPLRERAVYQGLCNFIFGLGTASGGLVGAAFQDWRMAFTIQCPISL 244
           +  P   R +   +  F+  LG   G       +D+      + P+ L
Sbjct: 270 ETAPKHLRGLAISVGMFMCTLGILLGYCANLGLKDYTTTAQWRIPLGL 317

>TDEL0E02280 Chr5 (438756..440519) [1764 bp, 587 aa] {ON} Anc_5.396
           YHR096C
          Length = 587

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 41/68 (60%), Gaps = 1/68 (1%)

Query: 139 KLSDQLGRKPLLVFSNVVFSIGCLICGMSTSIWW-VVVGRFVSGIGGCGLTCLASMVISD 197
           K  D  GR+  LVF  V++++G LI   S   W+   +GR +SG+G  G+T ++ M+IS+
Sbjct: 152 KAGDLYGRRLGLVFVVVIYTVGILIQICSFDKWYQYFIGRIISGLGVGGITVMSPMLISE 211

Query: 198 LVPLRERA 205
           + P + R 
Sbjct: 212 VAPKQTRG 219

>NDAI0D05020 Chr4 complement(1197075..1198796) [1722 bp, 573 aa]
           {ON} 
          Length = 573

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 52/111 (46%), Gaps = 1/111 (0%)

Query: 136 LYGKLSDQLGRKPLLVFSNVVFSIGCLICGMSTSIWW-VVVGRFVSGIGGCGLTCLASMV 194
           L+ +L D  GR+  LVF  VV+ +G +I   S   W+   +GR +SG+G  G+   + ++
Sbjct: 136 LFSRLGDIYGRRKALVFVTVVYMVGLIISIASIDKWYQYFIGRIISGMGVGGIAVYSPLL 195

Query: 195 ISDLVPLRERAVYQGLCNFIFGLGTASGGLVGAAFQDWRMAFTIQCPISLA 245
           IS++ P   R         +  LG   G       +++  +   + P+ L 
Sbjct: 196 ISEVSPKHVRGTLVSCYQLMITLGIFLGYCTNYGTRNYSNSVQWRVPLGLG 246

>KAFR0D00750 Chr4 complement(150046..151719) [1674 bp, 557 aa] {ON} 
          Length = 557

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 50/97 (51%), Gaps = 1/97 (1%)

Query: 110 GSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPLLVFSNVVFSIGCLICGMSTS 169
           GS + S  +   I + + +  +    ++ KL DQ GR+  LV   +V+ +G LI   S  
Sbjct: 95  GSYYFSKVRTGLIVSIFCIGCAIGGIVFSKLGDQYGRRIALVIVTIVYMVGILISIASID 154

Query: 170 IWW-VVVGRFVSGIGGCGLTCLASMVISDLVPLRERA 205
            W+   +GR ++G+G  G+   + ++IS++ P   R 
Sbjct: 155 KWYQYFIGRIIAGLGVGGIAVYSPLLISEVSPKHLRG 191

>TBLA0A03440 Chr1 complement(832040..833551) [1512 bp, 503 aa] {ON} 
          Length = 503

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 39/145 (26%), Positives = 71/145 (48%), Gaps = 16/145 (11%)

Query: 138 GKLSDQLGRKPLLVFSNVVFSIGCLICGMSTSIWW-VVVGRFVSGIGGCGLTC-LASMVI 195
           G++ D  GR+  ++ ++++F +G +I  +S   W+  ++GR V+G+ GCGL   L+ M+I
Sbjct: 67  GRIGDMYGRRFGIIVASIIFIVGTVIQIVSVKAWYQYMIGRIVAGL-GCGLIAILSPMLI 125

Query: 196 SDLVPLRERAV----YQGLCNF--IFGLGTASGGLVGAAFQDWRMAFTIQCPISLASCAL 249
           S++ P   R      YQ +     + G G+  G       + WR+   +Q     A C  
Sbjct: 126 SEVSPKHMRGAMVSCYQLMITLGILLGYGSNYGTKRYDDSRQWRVPLGLQ----FAWCLF 181

Query: 250 IVS---YLELPPRHEDDKDRHWTSK 271
           +V    ++   PR   +K R+   K
Sbjct: 182 LVGAMLFVPESPRFLIEKGRYKDGK 206

>TBLA0A03390 Chr1 complement(806095..807819) [1725 bp, 574 aa] {ON}
           Anc_5.395 YHR094C
          Length = 574

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 35/141 (24%), Positives = 68/141 (48%), Gaps = 8/141 (5%)

Query: 138 GKLSDQLGRKPLLVFSNVVFSIGCLICGMSTSIWW-VVVGRFVSGIGGCGLTCLAS-MVI 195
           G+L D  GR+  ++ ++++F +G +I   S   W+  ++GR V+G+ GCG+  ++S M+I
Sbjct: 138 GRLGDMYGRRMAIIIASIIFVVGTIIQIASVKAWYQYMIGRIVAGL-GCGIIAISSPMLI 196

Query: 196 SDLVPLRERAVYQGLCNFIFGLGTASGGLVGAAFQDWRMAFTIQCPISL--ASCALIVS- 252
           S++ P   R         +  +G   G       + +  +   + P+ L  A C  +V  
Sbjct: 197 SEVSPKHLRGAMVSCYQLMITMGIFLGYCANYGTKKYDDSRQWRVPLGLQFAWCLFLVGA 256

Query: 253 --YLELPPRHEDDKDRHWTSK 271
             ++   PR   +K R+   K
Sbjct: 257 MLFVPESPRFLIEKGRYEDGK 277

>TDEL0D06500 Chr4 (1166063..1167691) [1629 bp, 542 aa] {ON} 
          Length = 542

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 49/189 (25%), Positives = 82/189 (43%), Gaps = 22/189 (11%)

Query: 108 RIGSEFNSLDKVSWIATS-YLLSSSTCQPLYGKLSD--QLGRKPLLVFSNVVFSIGCLIC 164
           +I  EFN    V  +  S Y+L        +  LS+  ++GR+PL + +  +F++  +  
Sbjct: 124 QIQQEFNVGHVVGTLNLSMYVLGYGLGPIFFSPLSEFAKIGRQPLYIITFFLFAMLQIGT 183

Query: 165 GMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQGLCNFIFGLGTASGGL 224
            +  +I  +V+ RF++GI            + D+VP     ++ GL +         G L
Sbjct: 184 ALVKNIAGLVILRFITGILCSPSLATGGATVGDIVPPDYVPLFIGLWSVGAVSAPVVGPL 243

Query: 225 VGAAF---QDWRMAFTIQCPISLASCALIVSYLELPPRHEDD--------------KDRH 267
           +GAA    +DWR  F +   + LAS  LIV     P   ED                DR+
Sbjct: 244 LGAAMVDAKDWRWIFWLL--MWLASATLIVLVFFFPETSEDSILYRRAIRLRRITGDDRY 301

Query: 268 WTSKLRDLD 276
           +T+K +  D
Sbjct: 302 YTAKAKSED 310

>TPHA0K02330 Chr11 (506158..508053) [1896 bp, 631 aa] {ON} 
          Length = 631

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 93/447 (20%), Positives = 168/447 (37%), Gaps = 74/447 (16%)

Query: 155 VVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQGLCNFI 214
           V++S+G +I   +  +     G      G  G+  +  +++SD   L+ R  YQ    + 
Sbjct: 148 VLYSVGTIIQSQAYDVQRYAAGAIFYNAGYSGVLFILLIILSDFSSLKWRLAYQFAPTWP 207

Query: 215 FGLGT-ASGGLVGAA--FQDWRMAFTIQCPISLASCALIVS---YLELPPRHEDDKDRHW 268
           F + T  SG +  AA   ++W     ++  I   SC   ++   ++E   R    K   W
Sbjct: 208 FIINTWISGNITSAANPIENWSWDIGMRAFIIPLSCLPFIACMIHMEWKAR----KTPEW 263

Query: 269 TSKLRD--------------------LDWAGVV----TLVCFLFLFMLVSSLGGKEIAYD 304
              L++                    LD AG++    +L C L    L    GG    ++
Sbjct: 264 KELLKEKTFYEEHNGLWGTLVELFWRLDVAGLILMGSSLGCILVPLTLA---GGTSSKWN 320

Query: 305 SVLFALLCVTTLVLGSIFAYVELYVAVDPVLPIAFLKYRSVLGS-SLANWFAMMSMLTTN 363
                   +   VL   FA  E + A DP+LP   +K R V  +  ++     +  +  +
Sbjct: 321 HGNVIGPFILGFVLIPFFALWEKFFARDPLLPAKLVKDRGVWSAMGISFLIDFIYYMAAD 380

Query: 364 YYLPVYWASVLNMKPTDIGKRSIPSFFSVAFGSLGAGIYMKRTGKYYWFLLAFCGIGIL- 422
           Y   V   +V     +     S+ SF S       A +Y+ R  +   +++  C + +L 
Sbjct: 381 YLYTVLIVAVDESVKSATRISSLSSFVSTVASPFFA-LYLTRCSRLKPWIMLGCSLWMLA 439

Query: 423 ---------GQLKINLLTPATPVWQQYLLLVVPSFGLSVLITVTLLAMISAVPHEHHAAT 473
                    G+   + +  A  VW           G ++      +++ +AV HE+ A  
Sbjct: 440 MGLLYYFRGGRESHSGIIGALCVW---------GVGTTLFTYPVTVSVQAAVSHENMATV 490

Query: 474 TSISYAFRSTGATLGVSIGAAIFRSTLNTL----LQNKVLQFASDEHPREELLRIINNAA 529
           T+ +Y     G+ +G ++  AI+  TL       LQ+  L  A+   P            
Sbjct: 491 TAANYTLYRIGSAIGAAVSGAIWTQTLYKQLYKHLQDIALATAAYSSPY----------T 540

Query: 530 HSANWVHKEAPEFVRATLVECYHYASK 556
            + N+     PE  R  +V+ Y Y  +
Sbjct: 541 FTTNYAWGTPPE--REAVVQAYRYVQR 565

>YOL103W Chr15 (124001..125830) [1830 bp, 609 aa] {ON}
           ITR2Myo-inositol transporter with strong similarity to
           the major myo-inositol transporter Itr1p, member of the
           sugar transporter superfamily; expressed constitutively
          Length = 609

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 42/149 (28%), Positives = 68/149 (45%), Gaps = 15/149 (10%)

Query: 138 GKLSDQLGRKPLLVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIG-GCGLTCLASMVIS 196
           G  +D  GR+P L+FSN++F IG ++   +   W +  GR + G G G G + ++ + IS
Sbjct: 170 GTAADVFGRRPCLMFSNLMFLIGAILQITAHKFWQMAAGRLIMGFGVGIG-SLISPLFIS 228

Query: 197 DLVPLRERAVYQGLCNFIFGLGTASGGLV----GAAFQDWRMAFTIQCPISLASCALIVS 252
           ++ P     + +G    I  L    G L+    GA     +  + I   +SL    L  S
Sbjct: 229 EIAP----KMIRGRLTVINSLWLTGGQLIAYGCGAGLNHVKNGWRILVGLSLIPTVLQFS 284

Query: 253 YLELPPRHEDDKDRHWTSKLRDLDWAGVV 281
           +    P    D  R++  K  DL  A +V
Sbjct: 285 FFCFLP----DTPRYYVMK-GDLKRAKMV 308

>TBLA0C01100 Chr3 (227542..229491) [1950 bp, 649 aa] {ON} Anc_1.432
          Length = 649

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 47/87 (54%), Gaps = 6/87 (6%)

Query: 140 LSDQLGRKPLLVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIG-GCGLTCLASMVISDL 198
           +SD LGRK  L  S +++ IGC I   ST +  +VVGR ++G+G G G+   A M   +L
Sbjct: 88  VSDALGRKCSLHVSCILWCIGCGIQSGSTGVAMLVVGRVIAGVGIGFGVAA-APMYCVEL 146

Query: 199 VPLRERAVYQGLCNFIFGLGTASGGLV 225
            P R R    G    IF L   +G LV
Sbjct: 147 APPRVRGTVVG----IFQLAVTAGILV 169

>ABL210C Chr2 complement(7071..8507) [1437 bp, 478 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YKL217W
           (JEN1)
          Length = 478

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 43/156 (27%), Positives = 69/156 (44%), Gaps = 10/156 (6%)

Query: 89  FLGIFLAALDGTIVSTLLTRIGSEFNSLD-KVSWIATSYLLSSSTCQPLYGKLSDQLGRK 147
           F  + + A D  IVS  + +I  + N  D KV+W  T  L++ +    LYG + DQ G+K
Sbjct: 51  FFALLVEATDFFIVSLNVVKIAEDLNVNDEKVTWGMTIALMTRTIGAVLYGYIGDQFGQK 110

Query: 148 PLLVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGI--GGCGLTCLASMVISDLVPLRERA 205
              + +  + SI  L+ G +T+  + +  R   G+  GGC  T  A+    D +P   R+
Sbjct: 111 ASFMINIGMISILQLLTGFATTFPYFIACRAYFGVELGGCFGT--ATTQCLDDLPENARS 168

Query: 206 VYQGLCNFIFGLGTASGGLVGAAFQD-----WRMAF 236
              G     + LG     ++     D     WR  F
Sbjct: 169 WVSGGFQQAYSLGFLVATILTRVLADTTEKRWRTCF 204

>TDEL0B01900 Chr2 complement(335873..337936) [2064 bp, 687 aa] {ON}
           Anc_8.446 YDL199C
          Length = 687

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 63/124 (50%), Gaps = 12/124 (9%)

Query: 90  LGIFLAALDGTIVSTLLTR--IGSEFNSLDK------VSWIATSYLLSSSTCQPLYGKLS 141
           LG+FL   D  ++S  LT     + FN+  +      VS +    L+SS     L G+L 
Sbjct: 114 LGVFLFGYDQGVMSGCLTGHYFKNHFNNPSRAAIGNMVSILEIGALVSSL----LVGRLG 169

Query: 142 DQLGRKPLLVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPL 201
           ++ GR+  + + +++F IG L  G +  +  +++GR +SG+G   L+ +  +  S++ P 
Sbjct: 170 EKWGRRRTIKYGSLIFVIGGLFQGFADKMMHLIIGRTISGLGVGLLSTIVPIYQSEISPP 229

Query: 202 RERA 205
             R 
Sbjct: 230 HNRG 233

>KLTH0C03806g Chr3 (332195..333772) [1578 bp, 525 aa] {ON} similar
           to uniprot|P13090 Saccharomyces cerevisiae YML116W ATR1
           Multidrug efflux pump of the major facilitator
           superfamily required for resistance to aminotriazole and
           4-nitroquinoline-N-oxide
          Length = 525

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 92/381 (24%), Positives = 164/381 (43%), Gaps = 48/381 (12%)

Query: 120 SWIATSYLLSSSTCQPLYGKLSDQLGRKPLLVFSNVVFSIGCLICGMST---SIWWVVVG 176
           +W+  S+ L S +   + GK+ D  G K  L+    V  I  LICG+S+   ++ + +V 
Sbjct: 90  AWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLICGLSSYAHNVDFFIVA 149

Query: 177 RFVSGIGGCGLTCLASMVISDLVPLRERAVYQ-----GLCNFIFG-LGTASGGLVGAAFQ 230
           R   G+G   +    + ++ ++     +A        G C  I   LG    GL+G   +
Sbjct: 150 RSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSMIGACAPIGATLGCLFSGLIGTESE 209

Query: 231 DWRMAFTIQCPISLASCALIVSYLELPPRHEDDKDRHWTSKLRDLDWAGVVTLVCFLFLF 290
            W  A+T      +A+   ++++  +P     +  +        +DW G    VC L +F
Sbjct: 210 AW--AWTFYAYTIVAALNGLIAWYVIPDNIPTNVHKF------KMDWLGSFLGVCGLIMF 261

Query: 291 MLVSSLGGKEIAYDSVLFALLCVTTLVLGSIFAYVELYVAVDPVLPIAFLKYRS---VLG 347
             V +    +  +DS    +L V +++L  IF   E   A +P+LP A L  R    +L 
Sbjct: 262 NFVWNQAPTD-GWDSAYIIVLLVISVILLLIFIIFEARFAKEPLLPRAVLFNRKLMMILA 320

Query: 348 SSLANWFAMMSMLTTNYYLPVYWASVLNMK---PTDIGKRSIPSFFSVA-FGSLGA---G 400
           S    W +    + T YY+    A VLN++   P   G     S+F  A FG++ A   G
Sbjct: 321 SLFLGWGSF--GIWTYYYM----AFVLNLRHYTPLWAGG----SYFMFAIFGTIAAFLVG 370

Query: 401 IYMKRTGKYYWFLLAFCGIGILGQLKINLLTPATPVWQQYL-----LLVVPSFGLSVLIT 455
             + +TG     L +     + G + +++    TPV Q Y       +V+ SFG+ +   
Sbjct: 371 HTIHKTGPAIILLASVIAFDV-GCIMLSV----TPVDQTYFRMSLGTMVILSFGMDLSFP 425

Query: 456 VTLLAMISAVPHEHHAATTSI 476
            + + +   +P ++     S+
Sbjct: 426 ASSIILSDQLPSQYQGMAGSL 446

>TDEL0B07220 Chr2 complement(1271585..1273306) [1722 bp, 573 aa]
           {ON}  YDR536W
          Length = 573

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 38/149 (25%), Positives = 69/149 (46%), Gaps = 14/149 (9%)

Query: 142 DQLGRKPLLVFSNVVFSIGCLICGMSTSIWWV----VVGRFVSGIGGCGLTCLASMVISD 197
           +++GRKPL+V  +V+  +G +I   +   +W     VVGR ++G+G    T    +  S+
Sbjct: 100 EKIGRKPLIVIGSVITIVGAVISTTAFRDYWALGQFVVGRVITGVGTGLNTSTIPVWQSE 159

Query: 198 LVPLRERAVYQGLCNFIFGLGTASGGLV--GAAFQD----WRMAFTIQCPISLASCALIV 251
           +     R +   L      +GT     +  G +F D    WR   ++Q   +L  C +IV
Sbjct: 160 MSDPSIRGILVNLEGSTIAIGTMLAYWIDFGFSFIDSSVQWRFPVSMQILFALILCFMIV 219

Query: 252 SYLELP----PRHEDDKDRHWTSKLRDLD 276
           +  E P     +   ++ R+   +L D+D
Sbjct: 220 NLPESPRWLISQSRTEEARYLLGQLDDVD 248

>YEL069C Chr5 complement(21537..23231) [1695 bp, 564 aa] {ON}
           HXT13Hexose transporter, induced in the presence of
           non-fermentable carbon sources, induced by low levels of
           glucose, repressed by high levels of glucose
          Length = 564

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 40/144 (27%), Positives = 69/144 (47%), Gaps = 18/144 (12%)

Query: 136 LYGKLSDQLGRKPLLVFSNVVFSIGCLICGMSTSIWW-VVVGRFVSGIGGCGLTCLASMV 194
           ++ +L+D LGR+  +V   +V+ +G +I   S   W+   VG+ + G+G  G + L  M+
Sbjct: 125 IFARLADTLGRRLAIVIVVLVYMVGAIIQISSNHKWYQYFVGKIIYGLGAGGCSVLCPML 184

Query: 195 ISDLVPLRER----AVYQGLCNFIFGLGTASGGLVGAAFQDWRMAFTIQCPISLASCAL- 249
           +S++ P   R    ++YQ   N  FG+      + G    D     T Q  + L  C L 
Sbjct: 185 LSEIAPTDLRGGLVSLYQ--LNMTFGIFLGYCSVYGTRKYD----NTAQWRVPLGLCFLW 238

Query: 250 ----IVSYLELP--PRHEDDKDRH 267
               I+  L +P  PR+  + +RH
Sbjct: 239 ALIIIIGMLLVPESPRYLIECERH 262

>YNR072W Chr14 (772657..774351) [1695 bp, 564 aa] {ON}  HXT17Hexose
           transporter, up-regulated in media containing raffinose
           and galactose at pH 7.7 versus pH 4.7, repressed by high
           levels of glucose
          Length = 564

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 40/144 (27%), Positives = 69/144 (47%), Gaps = 18/144 (12%)

Query: 136 LYGKLSDQLGRKPLLVFSNVVFSIGCLICGMSTSIWW-VVVGRFVSGIGGCGLTCLASMV 194
           ++ +L+D LGR+  +V   +V+ +G +I   S   W+   VG+ + G+G  G + L  M+
Sbjct: 125 IFARLADTLGRRLAIVIVVLVYMVGAIIQISSNHKWYQYFVGKIIYGLGAGGCSVLCPML 184

Query: 195 ISDLVPLRER----AVYQGLCNFIFGLGTASGGLVGAAFQDWRMAFTIQCPISLASCAL- 249
           +S++ P   R    ++YQ   N  FG+      + G    D     T Q  + L  C L 
Sbjct: 185 LSEIAPTDLRGGLVSLYQ--LNMTFGIFLGYCSVYGTRKYD----NTAQWRVPLGLCFLW 238

Query: 250 ----IVSYLELP--PRHEDDKDRH 267
               I+  L +P  PR+  + +RH
Sbjct: 239 TLIIIIGMLLVPESPRYLIECERH 262

>YDL245C Chr4 complement(11657..13360) [1704 bp, 567 aa] {ON}
           HXT15Protein of unknown function with similarity to
           hexose transporter family members, expression is induced
           by low levels of glucose and repressed by high levels of
           glucose
          Length = 567

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 40/143 (27%), Positives = 69/143 (48%), Gaps = 18/143 (12%)

Query: 137 YGKLSDQLGRKPLLVFSNVVFSIGCLICGMSTSIWW-VVVGRFVSGIGGCGLTCLASMVI 195
           + +L+D LGR+  +V   +V+ +G +I   S   W+   VG+ + G+G  G + L  M++
Sbjct: 129 FARLADTLGRRLAIVIVVLVYMVGAIIQISSNHKWYQYFVGKIIYGLGAGGCSVLCPMLL 188

Query: 196 SDLVPLRER----AVYQGLCNFIFGLGTASGGLVGAAFQDWRMAFTIQCPISLASCAL-- 249
           S++ P   R    ++YQ   N  FG+      + G      + + T Q  I +  C L  
Sbjct: 189 SEIAPTDLRGGLVSLYQ--LNMTFGIFLGYCSVYGTR----KYSNTAQWRIPVGLCFLWA 242

Query: 250 ---IVSYLELP--PRHEDDKDRH 267
              IV  L +P  PR+  + +RH
Sbjct: 243 LIIIVGMLLVPESPRYLIECERH 265

>YJR158W Chr10 (732440..734143) [1704 bp, 567 aa] {ON}  HXT16Protein
           of unknown function with similarity to hexose
           transporter family members, expression is repressed by
           high levels of glucose
          Length = 567

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 40/143 (27%), Positives = 69/143 (48%), Gaps = 18/143 (12%)

Query: 137 YGKLSDQLGRKPLLVFSNVVFSIGCLICGMSTSIWW-VVVGRFVSGIGGCGLTCLASMVI 195
           + +L+D LGR+  +V   +V+ +G +I   S   W+   VG+ + G+G  G + L  M++
Sbjct: 129 FARLADTLGRRLAIVIVVLVYMVGAIIQISSNHKWYQYFVGKIIYGLGAGGCSVLCPMLL 188

Query: 196 SDLVPLRER----AVYQGLCNFIFGLGTASGGLVGAAFQDWRMAFTIQCPISLASCAL-- 249
           S++ P   R    ++YQ   N  FG+      + G      + + T Q  I +  C L  
Sbjct: 189 SEIAPTDLRGGLVSLYQ--LNMTFGIFLGYCSVYGTR----KYSNTAQWRIPVGLCFLWA 242

Query: 250 ---IVSYLELP--PRHEDDKDRH 267
              IV  L +P  PR+  + +RH
Sbjct: 243 LIIIVGMLLVPESPRYLIECERH 265

>YMR011W Chr13 (288079..289704) [1626 bp, 541 aa] {ON}
           HXT2High-affinity glucose transporter of the major
           facilitator superfamily, expression is induced by low
           levels of glucose and repressed by high levels of
           glucose
          Length = 541

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 40/152 (26%), Positives = 70/152 (46%), Gaps = 7/152 (4%)

Query: 138 GKLSDQLGRKPLLVFSNVVFSIGCLICGMSTSIWW-VVVGRFVSGIGGCGLTCLASMVIS 196
           G+L D  GR+  L+   +V+ +G +I   S+  W+   +GR +SG+G  G+  L+  +IS
Sbjct: 125 GRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLSPTLIS 184

Query: 197 DLVPLRERAVYQGLCNFIFGLGTASGGLVGAAFQDWRMAFTIQCPISLA---SCALIVSY 253
           +  P   R         +  LG   G       +D+  +   + P+ L    +  +I   
Sbjct: 185 ETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGLNFAFAIFMIAGM 244

Query: 254 LELP--PRHEDDKDRHWTSKLRDLDWAGVVTL 283
           L +P  PR   +K R+  +K R L  +  VT+
Sbjct: 245 LMVPESPRFLVEKGRYEDAK-RSLAKSNKVTI 275

>TBLA0A01250 Chr1 (294923..296434) [1512 bp, 503 aa] {ON} 
          Length = 503

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 35/141 (24%), Positives = 69/141 (48%), Gaps = 8/141 (5%)

Query: 138 GKLSDQLGRKPLLVFSNVVFSIGCLICGMSTSIWW-VVVGRFVSGIGGCGLTCLAS-MVI 195
           G+L D  GR+  ++ ++++F +G +I   S   W+  ++GR V+G+ GCG+  ++S M+I
Sbjct: 67  GRLGDMYGRRIAIIVASIIFVVGTVIQIASVKAWYQYMIGRIVAGL-GCGIIAISSPMLI 125

Query: 196 SDLVPLRERAVYQGLCNFIFGLGTASGGLVGAAFQDWRMAFTIQCPISL--ASCALIVS- 252
           S++ P   R         +  +G   G       + +  +   + P+ L  A C  +V  
Sbjct: 126 SEVSPKHLRGAMVSCYQLMITMGIFLGYCANYGTKRYDDSTQWRVPLGLQFAWCLFLVGA 185

Query: 253 --YLELPPRHEDDKDRHWTSK 271
             ++   PR   +K R+  +K
Sbjct: 186 MLFVPESPRFLIEKGRYEDAK 206

>Smik_15.54 Chr15 (87058..88893) [1836 bp, 611 aa] {ON} YOL103W
           (REAL)
          Length = 611

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 42/149 (28%), Positives = 67/149 (44%), Gaps = 15/149 (10%)

Query: 138 GKLSDQLGRKPLLVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIG-GCGLTCLASMVIS 196
           G  +D  GR+P L+FSN++F IG ++   +   W +  GR + G G G G + ++ + IS
Sbjct: 172 GTAADVFGRRPCLMFSNLMFLIGAILQITAHRFWQMAAGRLIMGFGVGIG-SLISPLFIS 230

Query: 197 DLVPLRERAVYQGLCNFIFGLGTASGGLV----GAAFQDWRMAFTIQCPISLASCALIVS 252
           ++ P     + +G    I  L    G L+    GA        + I   +SL    L  S
Sbjct: 231 EIAP----KMIRGRLTVINSLWLTGGQLIAYGCGAGLNHVNNGWRILVGLSLIPTVLQFS 286

Query: 253 YLELPPRHEDDKDRHWTSKLRDLDWAGVV 281
           +    P    D  R++  K  DL  A +V
Sbjct: 287 FFCFLP----DTPRYYVMK-GDLKRAKMV 310

>TBLA0A01240 Chr1 complement(289083..290792) [1710 bp, 569 aa] {ON} 
          Length = 569

 Score = 45.1 bits (105), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 35/141 (24%), Positives = 69/141 (48%), Gaps = 8/141 (5%)

Query: 138 GKLSDQLGRKPLLVFSNVVFSIGCLICGMSTSIWW-VVVGRFVSGIGGCGLTCLAS-MVI 195
           G+L D  GR+  ++ ++++F +G +I   S   W+  ++GR V+G+ GCG+  ++S M+I
Sbjct: 133 GRLGDMYGRRIAIIVASIIFIVGTVIQIASVKAWYQYMIGRIVAGL-GCGIIAISSPMLI 191

Query: 196 SDLVPLRERAVYQGLCNFIFGLGTASGGLVGAAFQDWRMAFTIQCPISL--ASCALIVS- 252
           S++ P   R         +  +G   G       + +  +   + P+ L  A C  +V  
Sbjct: 192 SEVSPKHLRGAMVSCYQLMITMGIFLGYCANYGTKRYDDSTQWRVPLGLQFAWCLFLVGA 251

Query: 253 --YLELPPRHEDDKDRHWTSK 271
             ++   PR   +K R+  +K
Sbjct: 252 MLFVPESPRFLIEKGRYEDAK 272

>NCAS0I03160 Chr9 (587668..589395) [1728 bp, 575 aa] {ON} 
          Length = 575

 Score = 45.1 bits (105), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 28/111 (25%), Positives = 51/111 (45%), Gaps = 1/111 (0%)

Query: 136 LYGKLSDQLGRKPLLVFSNVVFSIGCLICGMSTSIWW-VVVGRFVSGIGGCGLTCLASMV 194
           L+ +L D  GR+  LVF   V+ IG +I   +   W+   +GR +SG+G  G+   + ++
Sbjct: 137 LWSRLGDMWGRRKALVFVTTVYMIGLIISIAAVKHWYQYFIGRIISGLGVGGIAVYSPLL 196

Query: 195 ISDLVPLRERAVYQGLCNFIFGLGTASGGLVGAAFQDWRMAFTIQCPISLA 245
           IS++ P   R         +  LG   G       +++  +   + P+ L 
Sbjct: 197 ISEVAPKHVRGTLVSCYQLMITLGIFLGYCTNFGTRNYSNSVQWRVPLGLG 247

>TDEL0D05400 Chr4 complement(978323..980080) [1758 bp, 585 aa] {ON}
           Anc_3.84 YDR497C
          Length = 585

 Score = 45.1 bits (105), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 2/71 (2%)

Query: 136 LYGKLSDQLGRKPLLVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIG-GCGLTCLASMV 194
           + G  +D  GRK  ++FSNV+F +G ++   + S W + VGR + G G G G + ++ + 
Sbjct: 147 MAGTAADLYGRKACIMFSNVMFLVGAILQATAFSFWQMAVGRLIMGFGVGIG-SLISPLF 205

Query: 195 ISDLVPLRERA 205
           IS++ P   R 
Sbjct: 206 ISEIAPKMIRG 216

>ZYRO0A01474g Chr1 (121026..122642) [1617 bp, 538 aa] {ON} similar
           to uniprot|P40474 Saccharomyces cerevisiae YIL121W QDR2
           Multidrug transporter required for resistance to
           quinidine barban cisplatin and bleomycin member of the
           major facilitator superfamily of transporters conferring
           multiple drug resistance (MFS-MDR)
          Length = 538

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 61/124 (49%), Gaps = 7/124 (5%)

Query: 138 GKLSDQLGRKPLLVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISD 197
           G ++D LGR+P+++ S +++ + CL      +   ++  R +   G   +  + S +++D
Sbjct: 109 GNMADTLGRRPVILVSVLIYFVACLGIASCNTYSQLIGLRCLQAAGISPVIAINSGMMTD 168

Query: 198 LVPLRERAVYQGLCNFIFGLGTASGGLVGAAFQD---WRMAFTIQCPISLAS-CALIVSY 253
           +    ER  Y G  +    LG+A G L+GA       WR  F     +S+ S   L++S 
Sbjct: 169 ITTRAERGGYVGYTSGCQVLGSAFGALIGAGLSSRWGWRSVFWF---LSIGSGICLVIST 225

Query: 254 LELP 257
           L LP
Sbjct: 226 LLLP 229

>Skud_13.163 Chr13 (274262..275905) [1644 bp, 547 aa] {ON} YHR094C
           (REAL)
          Length = 547

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 40/152 (26%), Positives = 71/152 (46%), Gaps = 7/152 (4%)

Query: 138 GKLSDQLGRKPLLVFSNVVFSIGCLICGMSTSIWW-VVVGRFVSGIGGCGLTCLASMVIS 196
           G+L D  GR+  L+   +V+ +G +I   S++ W+   +GR +SG+G  G+  L+  +IS
Sbjct: 125 GRLGDIYGRRIGLMCVVLVYIVGIVIQIASSNKWYQYFIGRIISGMGVGGIAVLSPTLIS 184

Query: 197 DLVPLRERAVYQGLCNFIFGLGTASGGLVGAAFQDWRMAFTIQCPISLA---SCALIVSY 253
           +  P   R         +  LG   G       +D+  +   + P+ L    +  +I   
Sbjct: 185 ETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYTNSVQWRVPLGLGFAFAIFMIAGM 244

Query: 254 LELP--PRHEDDKDRHWTSKLRDLDWAGVVTL 283
           L +P  PR   +K R+  +K R L  +  VT+
Sbjct: 245 LMVPESPRFLVEKGRYEDAK-RSLAKSNKVTV 275

>Suva_15.62 Chr15 (97049..98878) [1830 bp, 609 aa] {ON} YOL103W
           (REAL)
          Length = 609

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 41/149 (27%), Positives = 68/149 (45%), Gaps = 15/149 (10%)

Query: 138 GKLSDQLGRKPLLVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIG-GCGLTCLASMVIS 196
           G  +D  GR+P L+FSN++F IG ++   +   W +  GR V G G G G + ++ + IS
Sbjct: 170 GTAADVFGRRPCLMFSNLMFLIGAILQITAHRFWQMAAGRLVMGFGVGIG-SLISPLFIS 228

Query: 197 DLVPLRERAVYQGLCNFIFGLGTASGGLV----GAAFQDWRMAFTIQCPISLASCALIVS 252
           ++ P     + +G    I  L    G L+    GA        + I   +SL    +  +
Sbjct: 229 EIAP----KMIRGRLTVINSLWLTGGQLIAYGCGAGLNHVNNGWRILVGLSLVPTVIQFT 284

Query: 253 YLELPPRHEDDKDRHWTSKLRDLDWAGVV 281
           +    P    D  R++  K  DL+ A +V
Sbjct: 285 FFCFLP----DTPRYYVMK-GDLEKAKMV 308

>NCAS0A08630 Chr1 complement(1704322..1706103) [1782 bp, 593 aa]
           {ON} 
          Length = 593

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 65/129 (50%), Gaps = 14/129 (10%)

Query: 142 DQLGRKPLLVFSNVVFSIGCLICGMSTSIWW-VVVGRFVSGIGGCGLTCLASMVISDLVP 200
           D+ GRKP L+    V+ +G +I   S++ W+   VGR VSG+G  G+  L+  +IS++ P
Sbjct: 116 DKWGRKPGLMLVAAVYVVGIIIQITSSTKWYQYFVGRIVSGMGVGGIAVLSPTLISEIAP 175

Query: 201 LRERAVYQGLCNFIFGLGTASGGLVG--AAFQDWRMAFTIQ--CPISLA---SCALIVSY 253
            + R    G C  ++ L    G  +G  A F   R    +Q   P+ L    +  +I+  
Sbjct: 176 KQLR----GTCISLYQLMITGGIFLGYCANFGTKRYNNAVQWRLPLGLGFAWAFFMIIGL 231

Query: 254 LELP--PRH 260
           L +P  PR+
Sbjct: 232 LFVPESPRY 240

>NDAI0F01940 Chr6 (471792..473447) [1656 bp, 551 aa] {ON} 
          Length = 551

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 34/134 (25%), Positives = 64/134 (47%), Gaps = 5/134 (3%)

Query: 90  LGIFLAALDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPL 149
           +G F+A  D         R GS + S  ++  + + + +  +      G+L D +GR+  
Sbjct: 67  IGGFMAQTDFIRRFGSKHRDGSHYLSKVRIGLLVSIFNIGCAIGSVFLGRLGDTIGRRKG 126

Query: 150 LVFSNVVFSIGCLICGMSTSIWW-VVVGRFVSGIGGCGLTCLASMVISDLVPLRERAV-- 206
           +V +  ++ +G +I   S   W+  ++GR +SG+G   +  L+ M+IS++ P   R    
Sbjct: 127 IVVAVSIYMVGIVIQIASVKKWFQYLIGRIISGLGAGCIAVLSPMLISEVSPKHLRGTLV 186

Query: 207 --YQGLCNFIFGLG 218
             YQ +  F   LG
Sbjct: 187 SCYQLMVTFGIFLG 200

>Smik_5.19 Chr5 complement(25102..26805) [1704 bp, 567 aa] {ON}
           YEL069C (REAL)
          Length = 567

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 39/143 (27%), Positives = 68/143 (47%), Gaps = 18/143 (12%)

Query: 137 YGKLSDQLGRKPLLVFSNVVFSIGCLICGMSTSIWW-VVVGRFVSGIGGCGLTCLASMVI 195
           + + +D+LGR+  +V   +V+ +G +I   S   W+   VG+ + G+G  G + L  M++
Sbjct: 129 FARFADKLGRRLAIVIVVLVYMVGAIIQISSNHKWYQYFVGKIIYGLGAGGCSVLCPMLL 188

Query: 196 SDLVPLRER----AVYQGLCNFIFGLGTASGGLVGAAFQDWRMAFTIQCPISLASCAL-- 249
           S++ P   R    ++YQ   N  FG+      + G    D     T Q  + L  C L  
Sbjct: 189 SEIAPKDLRGGLISLYQ--LNMTFGIFLGYCSVYGTRKYD----NTAQWRVPLGLCFLWA 242

Query: 250 ---IVSYLELP--PRHEDDKDRH 267
              I+  L +P  PR+  + +RH
Sbjct: 243 LIIIIGMLLVPESPRYLIECERH 265

>SAKL0D01386g Chr4 (109619..111184) [1566 bp, 521 aa] {ON}
           uniprot|Q875S7 Saccharomyces kluyveri ATR1
          Length = 521

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 101/476 (21%), Positives = 184/476 (38%), Gaps = 64/476 (13%)

Query: 29  VANEVEQQDYNSRTGHDSYGATAVDDRTATSARCDLTFPPSETPEFALXXXXXXXXXXXX 88
           V+++ ++    S T    +    VDD+          +P  + P +              
Sbjct: 10  VSSQSKELGTQSATAFTEHSDVQVDDKK---------WPSIQDPTYFSAPWKEYLFIFAS 60

Query: 89  FLGIFLAALDGTIVSTLLTRIGSEFNS-LDKVSWIATSYLLSSSTCQPLYGKLSDQLGRK 147
            +   L     T   +L+  +   F+S   + +W+  S+ L S +   + GK+ D  G K
Sbjct: 61  MMSQLLNQAGTTQTLSLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLK 120

Query: 148 PLLVFSNVVFSIGCLICGM---STSIWWVVVGRFVSGIGGCGLTCLASMVISDLV---PL 201
             L+   VV  I  LICG+   ++S+ + ++ R   G+G   +      ++ ++      
Sbjct: 121 KTLLVGYVVTIIWSLICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGTT 180

Query: 202 RERAVYQ--GLCNFIFG-LGTASGGLVGAAFQDWR---MAFTIQCPISLASCALIVSYLE 255
           R+  V    G C  I   +G    GL+G   + W     A+TI   I++     ++    
Sbjct: 181 RKNMVISLIGACAPIGATMGVLFSGLIGTLSERWAWTFYAYTITAAINMGLSIWVI---- 236

Query: 256 LPPRHEDDKDRHWTSKLRDLDWAGVVTLVCFLFLFMLVSSLG---GKEIAYDSVLFALLC 312
             P       R        +DW G    +  + LF  V + G   G + AY   +  LL 
Sbjct: 237 --PNTIPTNVRG-----SSMDWIGSGIGLLGMILFNFVWNQGPIVGWDTAY---IIVLLI 286

Query: 313 VTTLVLGSIFAYVELYVAVDPVLPIAFLKYRSVLGSSLANWFAMMSMLTTNYYLPVYWAS 372
           V+   + + F Y   Y A DP++P   +    +L + LA +F   S     +Y   Y+  
Sbjct: 287 VSVAAIVAFFLYETKY-ANDPLIPRPAMHNHRLLMTLLAVFFGWGSFGIWTFY---YFCF 342

Query: 373 VLNMK---PTDIGKRSIPSFFSVAFGSLGAGIYMKRTGK---YYWFLLAF-CGIGILGQL 425
           VLN++   P   G             ++  G  +KR       +  +LAF CG       
Sbjct: 343 VLNLREYTPLWAGGSYFMFLIWGIIAAISVGYTIKRIPPSLILFLSMLAFDCGC------ 396

Query: 426 KINLLTPATPVWQQYL-----LLVVPSFGLSVLITVTLLAMISAVPHEHHAATTSI 476
              ++   TPV Q Y      ++++ SFG+ +    + + +   +P E+     S+
Sbjct: 397 ---IMLSVTPVDQTYFRMILGMMIILSFGMDLSFPASSIILSDELPMENQGMAGSL 449

>Smik_14.401 Chr14 (716260..718170) [1911 bp, 636 aa] {ON} YNR072W
           (REAL)
          Length = 636

 Score = 44.3 bits (103), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 39/143 (27%), Positives = 68/143 (47%), Gaps = 18/143 (12%)

Query: 137 YGKLSDQLGRKPLLVFSNVVFSIGCLICGMSTSIWW-VVVGRFVSGIGGCGLTCLASMVI 195
           + + +D+LGR+  +V   +V+ +G +I   S   W+   VG+ + G+G  G + L  M++
Sbjct: 198 FARFADKLGRRLAIVIVVLVYMVGAIIQISSNHKWYQYFVGKIIYGLGAGGCSVLCPMLL 257

Query: 196 SDLVPLRER----AVYQGLCNFIFGLGTASGGLVGAAFQDWRMAFTIQCPISLASCAL-- 249
           S++ P   R    ++YQ   N  FG+      + G    D     T Q  + L  C L  
Sbjct: 258 SEIAPKDLRGGLISLYQ--LNMTFGIFLGYCSVYGTRKYD----NTAQWRVPLGLCFLWA 311

Query: 250 ---IVSYLELP--PRHEDDKDRH 267
              I+  L +P  PR+  + +RH
Sbjct: 312 LIIIIGMLLVPESPRYLVECERH 334

>YIL121W Chr9 (132244..133872) [1629 bp, 542 aa] {ON}  QDR2Multidrug
           transporter of the major facilitator superfamily,
           required for resistance to quinidine, barban, cisplatin,
           and bleomycin; may have a role in potassium uptake
          Length = 542

 Score = 44.3 bits (103), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 34/148 (22%), Positives = 66/148 (44%), Gaps = 4/148 (2%)

Query: 93  FLAALDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLY-GKLSDQLGRKPLLV 151
           F + + G I   +L+ I  +F+  +++  +            P + G  +D LGR+P+++
Sbjct: 72  FFSTIAGAIYYPVLSVIERKFDIDEELVNVTVVVYFVFQGLAPTFMGGFADSLGRRPVVL 131

Query: 152 FSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQGLC 211
            + V++   C+    + +   ++V R +   G   +  + S ++ D+    ER  Y G  
Sbjct: 132 VAIVIYFGACIGLACAQTYAQIIVLRCLQAAGISPVIAINSGIMGDVTTRAERGGYVGYV 191

Query: 212 NFIFGLGTASGGLVGAAFQD---WRMAF 236
                LG+A G L+GA       WR  F
Sbjct: 192 AGFQVLGSAFGALIGAGLSSRWGWRAIF 219

>TBLA0H00750 Chr8 (171288..172742) [1455 bp, 484 aa] {ON} Anc_2.241
           YIL121W
          Length = 484

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 37/152 (24%), Positives = 69/152 (45%), Gaps = 5/152 (3%)

Query: 89  FLGIFLAALDGTIVSTLLTRIGSEFN-SLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRK 147
           F G+F +++ G I   +L  I   F  + ++V+     Y +       + G L+D +GR+
Sbjct: 9   FTGVF-SSVAGAIYYPVLQVIQGLFEITEEQVNITIVVYFIFQGIAPSIIGNLADSMGRR 67

Query: 148 PLLVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVY 207
           P+++ +  ++   C+      +   +V  R +   G   +  + S ++ D+    ERA Y
Sbjct: 68  PIVIIAVTLYFCACVGLSCCNNYAQLVGLRCLQAAGISPVIAMNSGIMGDVTTRAERAGY 127

Query: 208 QGLCNFIFGLGTASGGLVGAAFQD---WRMAF 236
            G  +    +GTA G L+GA       WR  F
Sbjct: 128 VGYVSGFQIIGTALGALIGARLSSRWGWRGIF 159

>TBLA0B00840 Chr2 complement(188743..190656) [1914 bp, 637 aa] {ON} 
          Length = 637

 Score = 44.3 bits (103), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 37/136 (27%), Positives = 65/136 (47%), Gaps = 8/136 (5%)

Query: 138 GKLSDQLGRKPLLVFSNVVFSIGCLICGMSTSIWW-VVVGRFVSGIGGCGLTC-LASMVI 195
           G+L D  GR+  L+ ++V+F IG +I   S   W+  ++GR ++G+ GCGL   L+ M+I
Sbjct: 139 GRLGDIYGRRIGLIVASVIFIIGTVIQIASVKAWYQYMIGRIIAGL-GCGLIAILSPMLI 197

Query: 196 SDLVPLRERAVYQGLCNFIFGLGTASGGLVGAAFQDWRMAFTIQCPISL--ASCALIVS- 252
           S++ P   R         +  LG   G       + +  +   + P+ L  A C  ++  
Sbjct: 198 SEVSPKNMRGAMVSCYQLMITLGIFLGYCTNYGTKKYHNSRQWRIPLGLQFAWCLFMIGA 257

Query: 253 --YLELPPRHEDDKDR 266
             ++   PR   +K R
Sbjct: 258 MLFVPESPRFLIEKGR 273

>Suva_13.467 Chr13 complement(807375..809006) [1632 bp, 543 aa] {ON}
           YMR279C (REAL)
          Length = 543

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 94/429 (21%), Positives = 171/429 (39%), Gaps = 72/429 (16%)

Query: 104 TLLTRIGSEFNSL-DKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPLLVFSNVVFSIGCL 162
           T++  +   FNS  DK +W+  S+ L + +   + G+L D  G K +L+   V   +  L
Sbjct: 92  TIMNVLSKSFNSESDKQAWLMASFPLVAGSFILISGRLGDIYGLKKMLMIGYVTIIVWSL 151

Query: 163 ICGMSTSIWWVVVGRFVSGIGGCGLTCLA--SMVISDLVPLRERAVYQGLCNFIFGLGTA 220
           ICG+S            S      +TC A   + I+ ++P        GL   ++ +G+ 
Sbjct: 152 ICGLSK----------YSNNDAFFITCRAFQGLGIAFILP-----NVMGLVGHVYKVGST 196

Query: 221 SGGLV----GAAF-------------------QDWR---MAFTIQCPISLASCALIVSYL 254
              LV    GA                     + W     AF I   ++     +I+++ 
Sbjct: 197 RKNLVISFIGACAPAGGMFGGLFGGLIVNEDSEQWPWVFYAFAIAFFLN-----MILAWY 251

Query: 255 ELP---PRHEDDKDRHWTSKLRDLDWAGVVTLVCFLFLFMLVSSLGGKEIAYDSVLFALL 311
            +P   P +       WT  +       V+ L+ F F++    +  G   AY   + ALL
Sbjct: 252 SIPNNIPTNVHGFSMDWTGSV-----LAVIGLILFNFVWNQAPT-AGWGTAY---IIALL 302

Query: 312 CVTTLVLGSIFAYVELYVAVDPVLPIAFLKYRSVLGSSLANWFAMMSMLTTNYYLPVYWA 371
            ++   L + F Y   Y  V P+LP A  K R ++   LA +    S     +Y   +  
Sbjct: 303 IISVFFLVAFFVYEVKYAKV-PLLPHAVTKNRHMIMILLAVFLGWGSFGIWTFYYMSFQL 361

Query: 372 SVLNMKPTDIGKRSIPSFFSVAFGSLGA---GIYMKRTGKYYWFLLAFCGIGI-LGQLKI 427
           ++ +  P   G      F  V FG++ A    + +KR G    FLL F  +   +G +  
Sbjct: 362 NLRHYSPVWTGGT---YFVFVIFGTIAAFMVALSIKRVGPA--FLLCFALVAFDVGSIMF 416

Query: 428 NLLTPATPVWQ-QYLLLVVPSFGLSVLITVTLLAMISAVPHEHHAATTSISYAFRSTGAT 486
           ++L      W+  + +  +  FG+ +    + + +   +P E+     S+     +  A+
Sbjct: 417 SVLPVKQSFWKLNFGMQAILCFGMDLSFPASSIILSDGLPMEYQGMAGSLVNTVINYSAS 476

Query: 487 LGVSIGAAI 495
           L + +GA +
Sbjct: 477 LCLGMGATV 485

>NDAI0G06310 Chr7 (1563437..1565134) [1698 bp, 565 aa] {ON} Anc_8.22
           YFL040W
          Length = 565

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 63/127 (49%), Gaps = 7/127 (5%)

Query: 138 GKLSDQLGRKPLLVFSNVVFSIGCLICGMSTSIWW-VVVGRFVSGIGGCGLTCLASMVIS 196
           G L++++GRK  LV   ++F +G +I   S   W+   +GR +SG+G   ++  + M++S
Sbjct: 129 GDLANRIGRKMALVAVVIIFMVGLVIQIASIDKWYQYFIGRIISGMGVGAISIFSPMLLS 188

Query: 197 DLVPLRER----AVYQGLCNFIFGLGTASGGLVGAAFQDWRMAFTIQCPISLASCALIVS 252
           ++ P   R    ++YQ +  F   LG  +    G    D  + + +   +S A C  +++
Sbjct: 189 EVAPKHLRGTLGSMYQLMVTFGIFLGDCTN--YGTKAYDNSVQWRVPLGLSFAWCLFMIA 246

Query: 253 YLELPPR 259
            +   P 
Sbjct: 247 AMFFVPE 253

>SAKL0F00110g Chr6 (1456..3318) [1863 bp, 620 aa] {ON} similar to
           uniprot|P38724 Saccharomyces cerevisiae YHL047C ARN2
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to the siderophore
           triacetylfusarinine C
          Length = 620

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 100/457 (21%), Positives = 168/457 (36%), Gaps = 67/457 (14%)

Query: 89  FLGIFLAALDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKP 148
           F+  F   LD  I +  +T   + + +   +S +    +  S+  Q  +  LSD  GR  
Sbjct: 79  FICSFSYGLDSIIRNIYMTYAMNNYETHSLLSTVNVISMTISAVAQIFFAGLSDVFGRLS 138

Query: 149 LLVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQ 208
           + + + V + +G +I   +  +     G     IG  G     ++++SD   L+ R  Y 
Sbjct: 139 IFIVTIVFYVVGTIIQSQAYDVQRYAAGSIFYNIGLVGAMFQVTLMLSDSSSLKWRLFY- 197

Query: 209 GLCNFIFGLGTA-----SGGLVGAAF--QDWRMAFTIQCPISLASCALIVSYLELPPRHE 261
              NF+           SG ++  A   Q+W     +   I  A+C  I+  L L  R +
Sbjct: 198 ---NFVPAWPAVVTVWISGDVINVANPKQNWSWGIAMWAFIFPATCLPIIGCL-LHMRWK 253

Query: 262 DDKDRHW---------------TSKLRDLDW----AGV----VTLVCFLFLFMLVSSLGG 298
              D  W                  L+ L W     GV    V+  C L    +    GG
Sbjct: 254 LKNDPEWKDLQEKKTYFQTHGLVQTLKQLFWKLDAVGVLLFSVSTGCILVPLTIA---GG 310

Query: 299 KEIAYDSVLFALLCVTTLVLGSIFAYVELYVAVDPVLPIAFLKYRSVLGSSLANWFAMMS 358
               + S       V   VL  +F Y E  +A+ P+ P   LK R +    L     +M 
Sbjct: 311 VSTQWRSAKIIAPIVLGSVLVLVFIYWESKLALVPLAPFKMLKDRGIWAPLL-----LMF 365

Query: 359 MLTTNYYLP---VYWASVLNMKPTDIGKRSIPSFFS--VAFGSLGAGIYMKRTGKYYWFL 413
           ++   Y +P   +Y   ++    + +    I S +S   A  S  AGI + R  +   F 
Sbjct: 366 LVCFVYVMPADYLYTILLVAGNESSLSATRITSLYSFVTAVLSAAAGILVTRFPRLKPFA 425

Query: 414 LAFCGIGIL----------GQLKINLLTPATPVWQQYLLLVVPSFGLSVLITVTLLAMIS 463
              C +  +          G+     +  A  VW       V S      I +++  + S
Sbjct: 426 FFGCALYFVTMALFYCFRGGEDTGKGVIGAMVVWG------VASCFFDYPINISMQTVTS 479

Query: 464 AVPHEHHAATTSISYAFRSTGATLGVSIGAAIFRSTL 500
              HE+ A  T++  A    G  +G ++  AI+  TL
Sbjct: 480 ---HENMATVTALGLAIFRIGGAVGAAVSGAIWTQTL 513

>TBLA0A03500 Chr1 complement(863154..864875) [1722 bp, 573 aa] {ON} 
          Length = 573

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 43/70 (61%), Gaps = 3/70 (4%)

Query: 138 GKLSDQLGRKPLLVFSNVVFSIGCLICGMSTSIWW-VVVGRFVSGIGGCGLTC-LASMVI 195
           G+L D  GR+  L+ ++V+F IG +I   S   W+  ++GR V+GI GCGL   L+ M+I
Sbjct: 137 GRLGDIYGRRIGLIVASVIFIIGSVIQIASVKAWYQYMIGRIVAGI-GCGLIAILSPMLI 195

Query: 196 SDLVPLRERA 205
           S++ P   R 
Sbjct: 196 SEVSPKNMRG 205

>Smik_13.171 Chr13 (279108..280733) [1626 bp, 541 aa] {ON} YDR345C
           (REAL)
          Length = 541

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 40/152 (26%), Positives = 70/152 (46%), Gaps = 7/152 (4%)

Query: 138 GKLSDQLGRKPLLVFSNVVFSIGCLICGMSTSIWW-VVVGRFVSGIGGCGLTCLASMVIS 196
           G+L D  GR+  L+   +V+ +G +I   S+  W+   +GR VSG+G  G+  L+  +IS
Sbjct: 125 GRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIVSGMGVGGIAVLSPTLIS 184

Query: 197 DLVPLRERAVYQGLCNFIFGLGTASGGLVGAAFQDWRMAFTIQCPISLA---SCALIVSY 253
           +  P   R         +  LG   G       +D+  +   + P+ L    +  +I   
Sbjct: 185 ETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGLNFAFAIFMIAGM 244

Query: 254 LELP--PRHEDDKDRHWTSKLRDLDWAGVVTL 283
           L +P  PR   +K ++  +K R L  +  VT+
Sbjct: 245 LMVPESPRFLVEKGKYEDAK-RSLAKSNKVTV 275

>Suva_9.70 Chr9 (127105..128802) [1698 bp, 565 aa] {ON} YIL120W
           (REAL)
          Length = 565

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/148 (22%), Positives = 66/148 (44%), Gaps = 4/148 (2%)

Query: 93  FLAALDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLY-GKLSDQLGRKPLLV 151
           F + + G I   +L+ I  +F+  +++  +            P + G  +D LGR+P+++
Sbjct: 72  FFSTIAGAIYYPVLSVIEKKFDINEQLVNVTVVVYFVFQGLAPTFMGGFADSLGRRPVVL 131

Query: 152 FSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQGLC 211
            + +++   C+    + +   ++V R +   G   +  + S ++ D+    ER  Y G  
Sbjct: 132 VAILIYLGACVGLACAQTYAQIIVLRCLQAAGISPVIAINSGIMGDITTRAERGGYVGYV 191

Query: 212 NFIFGLGTASGGLVGAAFQD---WRMAF 236
                LG+A G L+GA       WR  F
Sbjct: 192 AGFQVLGSAFGALIGAGLSSRWGWRAIF 219

>YHL047C Chr8 complement(8351..10213) [1863 bp, 620 aa] {ON}
           ARN2Transporter, member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates; responsible for uptake of
           iron bound to the siderophore triacetylfusarinine C
          Length = 620

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 71/286 (24%), Positives = 115/286 (40%), Gaps = 36/286 (12%)

Query: 89  FLGIFLAALDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKP 148
           F+  F   LD +I  T +T   + +++   +S ++   L+ S+  Q ++G LSD  GR  
Sbjct: 77  FICTFAYGLDSSIRGTYMTYAMNSYSAHSLISTVSVIVLMISAVSQVIFGGLSDIFGRLT 136

Query: 149 LLVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQ 208
           L + S V++ +G +I   +  +     G     +G  G+     +++SD   L+ R  Y 
Sbjct: 137 LFLVSIVLYIVGTIIQSQAYDVQRYAAGAVFYYVGLVGVMLQVVLMLSDNSSLKWRLFYT 196

Query: 209 GLCNFIFGLGT-ASGGLVGAA--FQDWRMAFTIQ------CPISLASCAL--------IV 251
            + ++   + T  SG +V AA   ++W     +       C I L  C L         V
Sbjct: 197 LIPSWPSIITTWVSGSVVEAANPLENWSWNIAMWAFIFPLCCIPLILCMLHMRWKVRNDV 256

Query: 252 SYLELPPRHEDDKDRHWTSKLRD--------LDWAGVVTLV----CFLFLFMLVSSLGGK 299
            + EL    +D+K  + T  L          LD  GV+       C L    L    GG 
Sbjct: 257 EWKEL----QDEKSYYQTHGLVQMLVQLFWKLDVVGVLLFTAGVGCILVPLTLA---GGV 309

Query: 300 EIAYDSVLFALLCVTTLVLGSIFAYVELYVAVDPVLPIAFLKYRSV 345
              + +       V   VL   F Y E  +A+ P  P   LK R V
Sbjct: 310 STNWRNSKIIGPFVLGFVLVPGFIYWESRLALVPFAPFKLLKDRGV 355

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.138    0.424 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 56,217,611
Number of extensions: 2218168
Number of successful extensions: 8274
Number of sequences better than 10.0: 728
Number of HSP's gapped: 8018
Number of HSP's successfully gapped: 744
Length of query: 589
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 474
Effective length of database: 40,294,809
Effective search space: 19099739466
Effective search space used: 19099739466
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 69 (31.2 bits)