Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_56.236078.257ON72570336920.0
KLTH0G13794g8.257ON72570233590.0
SAKL0H17160g8.257ON73970827620.0
TDEL0F038408.257ON72670725460.0
KLLA0F19041g8.257ON76375125240.0
ZYRO0C01782g8.257ON73070324090.0
Suva_2.2698.257ON72570922410.0
YDR109C8.257ON71569621990.0
Smik_4.3558.257ON70470121770.0
Skud_4.3708.257ON71470821710.0
NDAI0J014008.257ON58853918610.0
Kpol_392.98.257ON59452318370.0
Ecym_43138.257ON59753117910.0
NCAS0B038708.257ON59651817760.0
KAFR0B055608.257ON60552117630.0
TBLA0E044008.257ON58952217570.0
KNAG0H032608.257ON58052016890.0
CAGL0B01727g8.257ON57752016770.0
AGR092W8.257ON59654016340.0
TPHA0B032408.257ON58551915720.0
Suva_14.931.111ON5435345181e-56
Skud_14.891.111ON5695304962e-53
Smik_14.861.111ON5435464732e-50
YNL249C (MPA43)1.111ON5425494671e-49
TDEL0C059001.111ON5435494442e-46
SAKL0C03432g1.111ON5475274264e-44
KLTH0F03080g1.111ON5335324184e-43
Kwal_33.135301.111ON5345264122e-42
ZYRO0F16016g1.111ON5424774106e-42
KNAG0F006601.111ON5355313921e-39
KLLA0C02937g1.111ON5165003113e-29
NCAS0A007801.111ON5495261672e-11
NCAS0C059004.9ON703122840.21
NDAI0H002204.9ON810120790.80
SAKL0A01254g6.341ON155896752.6
KNAG0B037905.509ON74188724.8
Smik_13.5145.27ON53291708.7
YMR297W (PRC1)5.27ON53291708.9
Suva_13.4875.27ON53279699.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_56.23607
         (725 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_56.23607 s56 complement(618687..620864) [2178 bp, 725 aa] {...  1426   0.0  
KLTH0G13794g Chr7 (1191104..1193281) [2178 bp, 725 aa] {ON} simi...  1298   0.0  
SAKL0H17160g Chr8 (1516854..1519073) [2220 bp, 739 aa] {ON} simi...  1068   0.0  
TDEL0F03840 Chr6 complement(705363..707543) [2181 bp, 726 aa] {O...   985   0.0  
KLLA0F19041g Chr6 complement(1753543..1755834) [2292 bp, 763 aa]...   976   0.0  
ZYRO0C01782g Chr3 (137232..139424) [2193 bp, 730 aa] {ON} simila...   932   0.0  
Suva_2.269 Chr2 complement(467973..470150) [2178 bp, 725 aa] {ON...   867   0.0  
YDR109C Chr4 complement(673520..675667) [2148 bp, 715 aa] {ON} P...   851   0.0  
Smik_4.355 Chr4 complement(634853..636967) [2115 bp, 704 aa] {ON...   843   0.0  
Skud_4.370 Chr4 complement(645143..647287) [2145 bp, 714 aa] {ON...   840   0.0  
NDAI0J01400 Chr10 (321913..323679) [1767 bp, 588 aa] {ON} Anc_8....   721   0.0  
Kpol_392.9 s392 (24389..26173) [1785 bp, 594 aa] {ON} (24389..26...   712   0.0  
Ecym_4313 Chr4 (672950..674743) [1794 bp, 597 aa] {ON} similar t...   694   0.0  
NCAS0B03870 Chr2 (689411..691201) [1791 bp, 596 aa] {ON} Anc_8.257    688   0.0  
KAFR0B05560 Chr2 (1138380..1140197) [1818 bp, 605 aa] {ON} Anc_8...   683   0.0  
TBLA0E04400 Chr5 complement(1119643..1121412) [1770 bp, 589 aa] ...   681   0.0  
KNAG0H03260 Chr8 (607908..609650) [1743 bp, 580 aa] {ON} Anc_8.2...   655   0.0  
CAGL0B01727g Chr2 complement(159373..161106) [1734 bp, 577 aa] {...   650   0.0  
AGR092W Chr7 (908750..910540) [1791 bp, 596 aa] {ON} Syntenic ho...   634   0.0  
TPHA0B03240 Chr2 (743153..744910) [1758 bp, 585 aa] {ON} Anc_8.2...   610   0.0  
Suva_14.93 Chr14 complement(174204..175835) [1632 bp, 543 aa] {O...   204   1e-56
Skud_14.89 Chr14 complement(168159..169868) [1710 bp, 569 aa] {O...   195   2e-53
Smik_14.86 Chr14 complement(158487..160118) [1632 bp, 543 aa] {O...   186   2e-50
YNL249C Chr14 complement(179394..181022) [1629 bp, 542 aa] {ON} ...   184   1e-49
TDEL0C05900 Chr3 (1062033..1063664) [1632 bp, 543 aa] {ON} Anc_1...   175   2e-46
SAKL0C03432g Chr3 complement(325502..327145) [1644 bp, 547 aa] {...   168   4e-44
KLTH0F03080g Chr6 complement(268621..270222) [1602 bp, 533 aa] {...   165   4e-43
Kwal_33.13530 s33 complement(268296..269900) [1605 bp, 534 aa] {...   163   2e-42
ZYRO0F16016g Chr6 (1313995..1315623) [1629 bp, 542 aa] {ON} simi...   162   6e-42
KNAG0F00660 Chr6 complement(114441..116048) [1608 bp, 535 aa] {O...   155   1e-39
KLLA0C02937g Chr3 complement(265205..266755) [1551 bp, 516 aa] {...   124   3e-29
NCAS0A00780 Chr1 complement(152317..153966) [1650 bp, 549 aa] {O...    69   2e-11
NCAS0C05900 Chr3 (1214812..1216923) [2112 bp, 703 aa] {ON} Anc_4...    37   0.21 
NDAI0H00220 Chr8 complement(30959..33391) [2433 bp, 810 aa] {ON}...    35   0.80 
SAKL0A01254g Chr1 (119884..124560) [4677 bp, 1558 aa] {ON} simil...    33   2.6  
KNAG0B03790 Chr2 complement(726484..728709) [2226 bp, 741 aa] {O...    32   4.8  
Smik_13.514 Chr13 (844554..846152) [1599 bp, 532 aa] {ON} YMR297...    32   8.7  
YMR297W Chr13 (861922..863520) [1599 bp, 532 aa] {ON}  PRC1Vacuo...    32   8.9  
Suva_13.487 Chr13 (843662..845260) [1599 bp, 532 aa] {ON} YMR297...    31   9.7  

>Kwal_56.23607 s56 complement(618687..620864) [2178 bp, 725 aa] {ON}
           YDR109C - Hypothetical ORF [contig 176] FULL
          Length = 725

 Score = 1426 bits (3692), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 684/703 (97%), Positives = 684/703 (97%)

Query: 23  TGLSLEQQKMLYYIGVDVGTGSARACIIDSMGNILSLAERPIQREQLKPNFITQSSQEIW 82
           TGLSLEQQKMLYYIGVDVGTGSARACIIDSMGNILSLAERPIQREQLKPNFITQSSQEIW
Sbjct: 23  TGLSLEQQKMLYYIGVDVGTGSARACIIDSMGNILSLAERPIQREQLKPNFITQSSQEIW 82

Query: 83  QAVCHCVKSVVRDSGVPSEKIHGIGFDATCSLVVVEEGSNKEVAVGPDFQNTNQNIILWM 142
           QAVCHCVKSVVRDSGVPSEKIHGIGFDATCSLVVVEEGSNKEVAVGPDFQNTNQNIILWM
Sbjct: 83  QAVCHCVKSVVRDSGVPSEKIHGIGFDATCSLVVVEEGSNKEVAVGPDFQNTNQNIILWM 142

Query: 143 DHRAIEETEQINATGDKCLKYVGGQMSVEMEIPKIKWLKNHLPNNKFDECKFFDLADYLT 202
           DHRAIEETEQINATGDKCLKYVGGQMSVEMEIPKIKWLKNHLPNNKFDECKFFDLADYLT
Sbjct: 143 DHRAIEETEQINATGDKCLKYVGGQMSVEMEIPKIKWLKNHLPNNKFDECKFFDLADYLT 202

Query: 203 FKASGKETRSFCSTVCKQGLLPVGVEGSKEGWSREFLTEIGLEDFIEDDFRKIGGSVKNS 262
           FKASGKETRSFCSTVCKQGLLPVGVEGSKEGWSREFLTEIGLEDFIEDDFRKIGGSVKNS
Sbjct: 203 FKASGKETRSFCSTVCKQGLLPVGVEGSKEGWSREFLTEIGLEDFIEDDFRKIGGSVKNS 262

Query: 263 DKGKNFLSAGEFVGAIDPAVAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPALVK 322
           DKGKNFLSAGEFVGAIDPAVAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPALVK
Sbjct: 263 DKGKNFLSAGEFVGAIDPAVAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPALVK 322

Query: 323 IDQEKVGMDRATGRLAAVAGTSTCHIAMSRDPIFVDGVWGPYRDALATNFWCAEGGQSCT 382
           IDQEKVGMDRATGRLAAVAGTSTCHIAMSRDPIFVDGVWGPYRDALATNFWCAEGGQSCT
Sbjct: 323 IDQEKVGMDRATGRLAAVAGTSTCHIAMSRDPIFVDGVWGPYRDALATNFWCAEGGQSCT 382

Query: 383 GALLAHVMTTHPAYTELSQLADAASVSKFDYLNSRLETLAQQQKSRSVVHLARHLFFYGD 442
           GALLAHVMTTHPAYTELSQLADAASVSKFDYLNSRLETLAQQQKSRSVVHLARHLFFYGD
Sbjct: 383 GALLAHVMTTHPAYTELSQLADAASVSKFDYLNSRLETLAQQQKSRSVVHLARHLFFYGD 442

Query: 443 YHGNRSPIADPSMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVEKMTTSGHDMAA 502
           YHGNRSPIADPSMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVEKMTTSGHDMAA
Sbjct: 443 YHGNRSPIADPSMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVEKMTTSGHDMAA 502

Query: 503 IFMSGGQCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFDLSGTTSELS 562
           IFMSGGQCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFDLSGTTSELS
Sbjct: 503 IFMSGGQCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFDLSGTTSELS 562

Query: 563 VSRKSSIAGHPTDGSQPKKSAVSKLGQFGSDDLXXXXXXXXXXXXXXXXXXXVGFPFPTP 622
           VSRKSSIAGHPTDGSQPKKSAVSKLGQFGSDDL                   VGFPFPTP
Sbjct: 563 VSRKSSIAGHPTDGSQPKKSAVSKLGQFGSDDLPSPYTAPSATASTSQIASTVGFPFPTP 622

Query: 623 DDPYALGEQTEPDADNDNSSELNFKAHSKWKKDMEDRMKGRSSDNGDAMWNVMYNMTGGG 682
           DDPYALGEQTEPDADNDNSSELNFKAHSKWKKDMEDRMKGRSSDNGDAMWNVMYNMTGGG
Sbjct: 623 DDPYALGEQTEPDADNDNSSELNFKAHSKWKKDMEDRMKGRSSDNGDAMWNVMYNMTGGG 682

Query: 683 KVVQPCPEDNPDRKLLDVKYKIFLDMAETQRKYRNLVNEVEKS 725
           KVVQPCPEDNPDRKLLDVKYKIFLDMAETQRKYRNLVNEVEKS
Sbjct: 683 KVVQPCPEDNPDRKLLDVKYKIFLDMAETQRKYRNLVNEVEKS 725

>KLTH0G13794g Chr7 (1191104..1193281) [2178 bp, 725 aa] {ON} similar
           to uniprot|Q04585 Saccharomyces cerevisiae YDR109C
           Hypothetical ORF
          Length = 725

 Score = 1298 bits (3359), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 618/702 (88%), Positives = 646/702 (92%)

Query: 24  GLSLEQQKMLYYIGVDVGTGSARACIIDSMGNILSLAERPIQREQLKPNFITQSSQEIWQ 83
           GLSLEQQKMLYY+GVDVGTGSARACIIDSMGNILSLAERPIQREQLK NFITQSSQEIWQ
Sbjct: 24  GLSLEQQKMLYYVGVDVGTGSARACIIDSMGNILSLAERPIQREQLKANFITQSSQEIWQ 83

Query: 84  AVCHCVKSVVRDSGVPSEKIHGIGFDATCSLVVVEEGSNKEVAVGPDFQNTNQNIILWMD 143
           AVCHCVKSVVRDSGVP+EKIHGIGFDATCSLVVVEE +NKEVAVGPDF NT+QNIILWMD
Sbjct: 84  AVCHCVKSVVRDSGVPAEKIHGIGFDATCSLVVVEEQTNKEVAVGPDFSNTDQNIILWMD 143

Query: 144 HRAIEETEQINATGDKCLKYVGGQMSVEMEIPKIKWLKNHLPNNKFDECKFFDLADYLTF 203
           HRAIEET+ INATGDKCLKYVGGQMSVEMEIPKIKWLKNHLP NKF+ECKFFDLADYLTF
Sbjct: 144 HRAIEETQLINATGDKCLKYVGGQMSVEMEIPKIKWLKNHLPENKFNECKFFDLADYLTF 203

Query: 204 KASGKETRSFCSTVCKQGLLPVGVEGSKEGWSREFLTEIGLEDFIEDDFRKIGGSVKNSD 263
           KASGKETRSFCSTVCKQGLLPVGVEGS EGWSREFLTEIGLE+ IEDDFR+IGGSVKNSD
Sbjct: 204 KASGKETRSFCSTVCKQGLLPVGVEGSAEGWSREFLTEIGLEELIEDDFRRIGGSVKNSD 263

Query: 264 KGKNFLSAGEFVGAIDPAVAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPALVKI 323
           KGKNFLSAGEF+GAID  VAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPALVK 
Sbjct: 264 KGKNFLSAGEFIGAIDATVAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPALVKT 323

Query: 324 DQEKVGMDRATGRLAAVAGTSTCHIAMSRDPIFVDGVWGPYRDALATNFWCAEGGQSCTG 383
           DQEKVGMDRATGRLAAVAGTSTCHIAMSRDPIFVDGVWGPYRDALATNFWCAEGGQSCTG
Sbjct: 324 DQEKVGMDRATGRLAAVAGTSTCHIAMSRDPIFVDGVWGPYRDALATNFWCAEGGQSCTG 383

Query: 384 ALLAHVMTTHPAYTELSQLADAASVSKFDYLNSRLETLAQQQKSRSVVHLARHLFFYGDY 443
           ALLAHV+TTHPAYTELSQLADAASVSKFDYLNSRLETLAQQQK+RSVVHLA+HLFFYGDY
Sbjct: 384 ALLAHVLTTHPAYTELSQLADAASVSKFDYLNSRLETLAQQQKARSVVHLAKHLFFYGDY 443

Query: 444 HGNRSPIADPSMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVEKMTTSGHDMAAI 503
           HGNRSPIADPSMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIV+KM TSGHD++AI
Sbjct: 444 HGNRSPIADPSMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVDKMCTSGHDLSAI 503

Query: 504 FMSGGQCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFDLSGTTSELSV 563
           FMSGGQCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFDLSGT S LSV
Sbjct: 504 FMSGGQCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFDLSGTHSALSV 563

Query: 564 SRKSSIAGHPTDGSQPKKSAVSKLGQFGSDDLXXXXXXXXXXXXXXXXXXXVGFPFPTPD 623
           SRKSSIAG P +  QPKKSAVSK GQ G DDL                   +GFPFPTP+
Sbjct: 564 SRKSSIAGEPANAGQPKKSAVSKFGQLGGDDLPSPYTAPSATASTSQIASTIGFPFPTPE 623

Query: 624 DPYALGEQTEPDADNDNSSELNFKAHSKWKKDMEDRMKGRSSDNGDAMWNVMYNMTGGGK 683
           D YA+ E  E + D   S+ELNFKAHSKWKKDMEDRMKGRSSDNGDAMWNVMYNMTGGGK
Sbjct: 624 DAYAIDEHVEQEKDEGESTELNFKAHSKWKKDMEDRMKGRSSDNGDAMWNVMYNMTGGGK 683

Query: 684 VVQPCPEDNPDRKLLDVKYKIFLDMAETQRKYRNLVNEVEKS 725
           VVQP  E+N DR LL+ KYKIFLDMAETQRKYR +V++  ++
Sbjct: 684 VVQPAAEENADRVLLNAKYKIFLDMAETQRKYRTIVDDAVRN 725

>SAKL0H17160g Chr8 (1516854..1519073) [2220 bp, 739 aa] {ON} similar
           to uniprot|P53583 Saccharomyces cerevisiae YNL249C MPA43
           Mitochondrial protein of unknown function and similar to
           uniprot|Q04585 Saccharomyces cerevisiae YDR109C
           Hypothetical ORF
          Length = 739

 Score = 1068 bits (2762), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 522/708 (73%), Positives = 592/708 (83%), Gaps = 9/708 (1%)

Query: 23  TGLSLEQQKMLYYIGVDVGTGSARACIIDSMGNILSLAERPIQREQLKPNFITQSSQEIW 82
           + LS+EQ KM YY+GVDVGTGSARACIID+MGNILSLAERPIQR++LKP++ITQSSQEIW
Sbjct: 23  SALSMEQNKMTYYVGVDVGTGSARACIIDNMGNILSLAERPIQRQELKPSYITQSSQEIW 82

Query: 83  QAVCHCVKSVVRDSGVPSEKIHGIGFDATCSLVVVEEGSNKEVAVGPDFQNTNQNIILWM 142
            A+C+CVKSVV+DSGV  EKIHGIGFDATCSLVVVE+ S+KEVAVGPDF NT QNIILWM
Sbjct: 83  LAICYCVKSVVKDSGVLPEKIHGIGFDATCSLVVVEDDSDKEVAVGPDFFNTEQNIILWM 142

Query: 143 DHRAIEETEQINATGDKCLKYVGGQMSVEMEIPKIKWLKNHLPNNKFDECKFFDLADYLT 202
           DHRAI+ET++INAT DKCLKYVGGQMSVEMEIPKIKWLKN+LP  KF++CKFFDLADYLT
Sbjct: 143 DHRAIDETKEINATNDKCLKYVGGQMSVEMEIPKIKWLKNNLPREKFEKCKFFDLADYLT 202

Query: 203 FKASGKETRSFCSTVCKQGLLPVGVEGSKEGWSREFLTEIGLEDFIEDDFRKIGGSVK-N 261
           FKA+G ETRS+CSTVCKQGLLPVGVE SK+GWS+EFLT IGLED  +DDFRK+GGS+K +
Sbjct: 203 FKATGLETRSYCSTVCKQGLLPVGVESSKQGWSKEFLTNIGLEDLCQDDFRKLGGSIKSD 262

Query: 262 SDKGKNFLSAGEFVGAIDPAVAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPALV 321
              G  FLSAGE +G++DP+ AEELGL  HCVVGSGVIDAYAGWVGTVAARTDV IP LV
Sbjct: 263 GSGGSTFLSAGECIGSLDPSAAEELGLPAHCVVGSGVIDAYAGWVGTVAARTDVDIPELV 322

Query: 322 KIDQEKVGMDRATGRLAAVAGTSTCHIAMSRDPIFVDGVWGPYRDALATNFWCAEGGQSC 381
           + D EK G+D ATGRLAAVAGTSTCHIAMS+DPIFVDGVWGPYRD +A  FWCAEGGQSC
Sbjct: 323 EADNEKTGIDHATGRLAAVAGTSTCHIAMSKDPIFVDGVWGPYRDVMAPGFWCAEGGQSC 382

Query: 382 TGALLAHVMTTHPAYTELSQLADAASVSKFDYLNSRLETLAQQQKSRSVVHLARHLFFYG 441
           TGALLAHV+T HPAYTELS L+DAASVSKFDYLNSRLE L QQ+ +RSVV LA+HLFFYG
Sbjct: 383 TGALLAHVLTIHPAYTELSHLSDAASVSKFDYLNSRLEVLTQQRGARSVVALAKHLFFYG 442

Query: 442 DYHGNRSPIADPSMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVEKMTTSGHDMA 501
           DYHGNRSPIADPSMRAA+IGQSMDNSIDDLA+MYLGACEFIAQQTRQIVEKM+ SGH +A
Sbjct: 443 DYHGNRSPIADPSMRAAVIGQSMDNSIDDLAIMYLGACEFIAQQTRQIVEKMSVSGHRIA 502

Query: 502 AIFMSGGQCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFDLSGTTSEL 561
           AIFMSGGQCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESF+L+  +  L
Sbjct: 503 AIFMSGGQCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFNLNHKSGSL 562

Query: 562 SVSRKSSIAGHPTDGSQ----PKKSAVSKLGQFGSDDLXXXXXXXXXXXXXXXXXXXV-G 616
           S  RKSS++G   +       PKK+ +SKLG   S DL                   V G
Sbjct: 563 SRRRKSSLSGKYEEFKDSMEIPKKNFLSKLGGTASGDLPSPYTAPSATASTSQIASTVGG 622

Query: 617 FPFP-TPDDPYALGEQTEPDADNDNSSELNFKAHSKWKKDMEDRMKGRSSDNGDAMWNVM 675
           FPFP T DD  A+ E+ +P+  N   S  + KA ++ +  +E   +  +S  GDA+W+VM
Sbjct: 623 FPFPVTSDDSVAIIEEDDPEEANAALSFGSKKATAQEQLALEK--EKSASGKGDALWDVM 680

Query: 676 YNMTGGGKVVQPCPEDNPDRKLLDVKYKIFLDMAETQRKYRNLVNEVE 723
           YNMTGGGKVVQP  +D+PDR LLD KYKIFLDMAETQR+YR  V++VE
Sbjct: 681 YNMTGGGKVVQPSSDDHPDRVLLDAKYKIFLDMAETQRRYREAVDKVE 728

>TDEL0F03840 Chr6 complement(705363..707543) [2181 bp, 726 aa] {ON}
           Anc_8.257 YDR109C
          Length = 726

 Score =  985 bits (2546), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 481/707 (68%), Positives = 559/707 (79%), Gaps = 13/707 (1%)

Query: 24  GLSLEQQKMLYYIGVDVGTGSARACIIDSMGNILSLAERPIQREQLKPNFITQSSQEIWQ 83
            +SLEQ  M+YY+GVDVGTGSARACIID+ GNILSLAE+PIQRE+LKPN+ITQSSQEIWQ
Sbjct: 25  AISLEQ-AMIYYVGVDVGTGSARACIIDNTGNILSLAEKPIQREELKPNYITQSSQEIWQ 83

Query: 84  AVCHCVKSVVRDSGVPSEKIHGIGFDATCSLVVVEEGSNKEVAVGPDFQNTNQNIILWMD 143
           ++CHCVKSVVRDSGVP E+IHGIGFDATCSLVVV++  +KEV VGP F N +QNI+LWMD
Sbjct: 84  SICHCVKSVVRDSGVPVERIHGIGFDATCSLVVVDD-EDKEVGVGPVFANNDQNIVLWMD 142

Query: 144 HRAIEETEQINATGDKCLKYVGGQMSVEMEIPKIKWLKNHLPNNKFDECKFFDLADYLTF 203
           HRAI ET +INAT DKCLKYVGGQMSVEMEIPKIKWLKN+LP  +FD+CKFFDLADYLTF
Sbjct: 143 HRAIAETNEINATNDKCLKYVGGQMSVEMEIPKIKWLKNNLPKEQFDKCKFFDLADYLTF 202

Query: 204 KASGKETRSFCSTVCKQGLLPVGVEGSKEGWSREFLTEIGLEDFIEDDF---RKIGGSVK 260
           KA+ K+TRSFCSTVCKQGL+P+GVEGSKEGWS++FL  I L + +E+ F   R    +  
Sbjct: 203 KATNKDTRSFCSTVCKQGLIPIGVEGSKEGWSKDFLNTINLPELVENVFCQDRWPATATA 262

Query: 261 NSDKGKNFLSAGEFVGAIDPAVAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPAL 320
                 +FLSAGE+VGA+D   AEELGL  HCVVGSGVIDAYAGWVGTVAA+TDV +P L
Sbjct: 263 ADGTTHSFLSAGEYVGALDEEAAEELGLPVHCVVGSGVIDAYAGWVGTVAAQTDVELPDL 322

Query: 321 VKIDQEKVGMDRATGRLAAVAGTSTCHIAMSRDPIFVDGVWGPYRDALATNFWCAEGGQS 380
            + D+ K G+DRATGRLAAVAGTSTCHIA+SRDP+FV+GVWGPYRD +A  FW AEGGQS
Sbjct: 323 AEADRTKKGIDRATGRLAAVAGTSTCHIALSRDPVFVNGVWGPYRDVMAHGFWAAEGGQS 382

Query: 381 CTGALLAHVMTTHPAYTELSQLADAASVSKFDYLNSRLETLAQQQKSRSVVHLARHLFFY 440
           CTGALLAHVM+THPA+TELS L+DAA++SKFDYLNSRLETL QQ+  RSVV LA+HL+FY
Sbjct: 383 CTGALLAHVMSTHPAFTELSHLSDAANISKFDYLNSRLETLVQQRGDRSVVALAKHLYFY 442

Query: 441 GDYHGNRSPIADPSMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVEKMTTSGHDM 500
           GDYHGNRSPIADPSMRAAIIGQSMDNSIDDLA+MYLGACEFIAQQTRQIVEKM  +GH +
Sbjct: 443 GDYHGNRSPIADPSMRAAIIGQSMDNSIDDLAIMYLGACEFIAQQTRQIVEKMCDAGHQI 502

Query: 501 AAIFMSGGQCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFDLSGTTSE 560
           + IFMSGGQCRNGLLMRLLADCTGLPI+IPRYIDAAVVFGSALLGAVASESF+     SE
Sbjct: 503 STIFMSGGQCRNGLLMRLLADCTGLPIIIPRYIDAAVVFGSALLGAVASESFNSHHAKSE 562

Query: 561 LSVSRKSSIAG-HPTD-GSQPKKSAVSKLGQFGSDDLXXXXXXXXXXXXXXXXXXXVGFP 618
           ++  RKSS+    P+   S   K  +S+LG+   D                       FP
Sbjct: 563 ITRRRKSSLTNLDPSSLPSASGKGPLSQLGKMKPDLPSPYTAPHATSSTSQIAATSGSFP 622

Query: 619 FPTPDDPYALGEQTEPDADNDNSSELNFKAHSKWKKDMEDRMKGRSSDNGDAMWNVMYNM 678
           FP       +GE +E   +  N SE             E        +NGDA+W+VMY M
Sbjct: 623 FPV------VGESSEAITEEANDSEGPVSFKPTRATSQEGLATRNPPNNGDALWDVMYQM 676

Query: 679 TGGGKVVQPCPEDNPDRKLLDVKYKIFLDMAETQRKYRNLVNEVEKS 725
           TGGGKVV+P PED+PDR LL+ KYKIFLDMA++QR+YR  +++VEK+
Sbjct: 677 TGGGKVVRPSPEDDPDRVLLNAKYKIFLDMADSQRRYREAIDKVEKA 723

>KLLA0F19041g Chr6 complement(1753543..1755834) [2292 bp, 763 aa]
           {ON} similar to uniprot|Q04585 Saccharomyces cerevisiae
           YDR109C Hypothetical ORF
          Length = 763

 Score =  976 bits (2524), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 500/751 (66%), Positives = 574/751 (76%), Gaps = 61/751 (8%)

Query: 23  TGLSLE-QQKMLYYIGVDVGTGSARACIIDSMGNILSLAERPIQREQLKPNFITQSSQEI 81
           +GLSL+ ++KM+YY+GVDVGTGSARAC+ID++GNILSLAERPIQR +LKPN+ITQSSQEI
Sbjct: 24  SGLSLQNERKMVYYVGVDVGTGSARACVIDNLGNILSLAERPIQRHELKPNYITQSSQEI 83

Query: 82  WQAVCHCVKSVVRDSGVPSEKIHGIGFDATCSLVVVEEGSNKEVAVGPDFQNTNQNIILW 141
           W A+C+CVK+VVRDSGV    IHGIGFDATCSLVVV+  +N++V VGPDF +  QNIILW
Sbjct: 84  WNAICYCVKNVVRDSGVDPRTIHGIGFDATCSLVVVDN-NNEDVGVGPDFTDNLQNIILW 142

Query: 142 MDHRAIEETEQINATGDKCLKYVGGQMSVEMEIPKIKWLKNHLPNNKFDECKFFDLADYL 201
           MDHRAIEETE+INATGDKCLKYVGGQMSVEMEIPKIKWLKN++P  KF +CKFFDLADYL
Sbjct: 143 MDHRAIEETEEINATGDKCLKYVGGQMSVEMEIPKIKWLKNNIPEKKFAQCKFFDLADYL 202

Query: 202 TFKASGKETRSFCSTVCKQGLLPVGVEGSKEGWSREFLTEIGLEDFIEDDFRKIGGSVKN 261
           TFKA+G E RS+CSTVCKQGLLP+GVEGSK GWS+EFL EIGLE+ I DDF K+GGSV  
Sbjct: 203 TFKATGSEIRSYCSTVCKQGLLPLGVEGSKNGWSKEFLQEIGLEELIADDFAKLGGSVTE 262

Query: 262 SDKGKNFLSAGEFVGAIDPAVAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPALV 321
           +     FLSAGE +G +    A ELGLS HCVVGSGVIDAYAGWVGTVAARTDV IPALV
Sbjct: 263 T----TFLSAGECIGTLTEESAAELGLSTHCVVGSGVIDAYAGWVGTVAARTDVEIPALV 318

Query: 322 KIDQEKVGMDRATGRLAAVAGTSTCHIAMSRDPIFVDGVWGPYRDALATNFWCAEGGQSC 381
           K D+ K G+DRATGRLAAVAGTSTCHIAMS+DPIFV GVWGPYRD +A  FW AEGGQSC
Sbjct: 319 KSDEVKHGIDRATGRLAAVAGTSTCHIAMSKDPIFVKGVWGPYRDVMAPGFWLAEGGQSC 378

Query: 382 TGALLAHVMTTHPAYTELSQLADAASVSKFDYLNSRLETLAQQQKSRSVVHLARHLFFYG 441
           TGALLAHV+TTHPAY ELSQL+DAA+VSKFDYLNSRLE LAQQ+K+ SVV LA+HLFFYG
Sbjct: 379 TGALLAHVLTTHPAYAELSQLSDAANVSKFDYLNSRLELLAQQRKASSVVALAKHLFFYG 438

Query: 442 DYHGNRSPIADPSMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVEKMTTSGHDMA 501
           DYHGNRSPIADPSMRAAIIGQSMDNSIDDL++MYLGACEFIAQQTRQIVE+M  SGH++A
Sbjct: 439 DYHGNRSPIADPSMRAAIIGQSMDNSIDDLSIMYLGACEFIAQQTRQIVEQMCNSGHELA 498

Query: 502 AIFMSGGQCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFDLS------ 555
           AIFMSGGQCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESF+        
Sbjct: 499 AIFMSGGQCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFNACAKLEET 558

Query: 556 ----GTTS--ELSVSRKSSIA----------------------GHPTDGSQPKKSAVSKL 587
                TTS  ++S+ RKSS++                      GH    +    ++ +K 
Sbjct: 559 ASDPATTSNKDVSIRRKSSLSRKDAGIIGDGSRSRSGSAASGLGHGGGNTLKPLTSFAKA 618

Query: 588 GQFGSD----DLXXXXXXXXXXXXXXXXXXXVGFPFPTPDDPYALGEQT---EPDADNDN 640
            +  +D    D+                    G+PFP      A  E+    E + +N++
Sbjct: 619 QKKTNDLKFADMPSPYTAPSATSSTAQISTTGGYPFPV----MASNEEAIIDEMEEENED 674

Query: 641 SSELNFKAHSKWKKDMEDRMKGRSSDNG--------DAMWNVMYNMTGGGKVVQPCPEDN 692
            S L F A  K +K  E      + +N         D +W VMYNMTGGGKVV P  ED 
Sbjct: 675 ESLLTFDA--KTEKSKEAATSAANHNNAKVLRDVTKDKLWEVMYNMTGGGKVVWPTEEDA 732

Query: 693 PDRKLLDVKYKIFLDMAETQRKYRNLVNEVE 723
           PDR LL+ KYKIFLDMA TQ+KYR LV+EV+
Sbjct: 733 PDRLLLNAKYKIFLDMAATQQKYRKLVDEVK 763

>ZYRO0C01782g Chr3 (137232..139424) [2193 bp, 730 aa] {ON} similar
           to uniprot|Q04585 Saccharomyces cerevisiae YDR109C
           Hypothetical ORF
          Length = 730

 Score =  932 bits (2409), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 453/703 (64%), Positives = 544/703 (77%), Gaps = 8/703 (1%)

Query: 24  GLSLEQQKMLYYIGVDVGTGSARACIIDSMGNILSLAERPIQREQLKPNFITQSSQEIWQ 83
           GLSLEQ +M+YYIGVDVGTGSARAC+IDSMGNI+SLAE+PIQRE+LKP +ITQSS+EIW 
Sbjct: 24  GLSLEQ-RMIYYIGVDVGTGSARACLIDSMGNIMSLAEKPIQREELKPTYITQSSKEIWS 82

Query: 84  AVCHCVKSVVRDSGVPSEKIHGIGFDATCSLVVVEEGSNKEVAVGPDFQNTNQNIILWMD 143
           A+C+CVK+VVRDSGV  E+IHGIGFDATCSLV V      +V VGPDF+N +QNIILWMD
Sbjct: 83  AICYCVKTVVRDSGVDIERIHGIGFDATCSLVAVNSKDGADVPVGPDFENPDQNIILWMD 142

Query: 144 HRAIEETEQINATGDKCLKYVGGQMSVEMEIPKIKWLKNHLPNNKFDECKFFDLADYLTF 203
           HRA++ET +IN+T    LKYVGGQMS+EMEIPKIKWLKNH+P  KF++  FFDLAD+LT+
Sbjct: 143 HRAVQETAEINSTNHPVLKYVGGQMSIEMEIPKIKWLKNHMPREKFNDTVFFDLADFLTY 202

Query: 204 KASGKETRSFCSTVCKQGLLPVGVEGSKEGWSREFLTEIGLEDFIEDDFRKIGGSVK--N 261
           KA+G  TRSF S+VCKQGLLP+GVEGS  GWS EFL  I L + + +DF K+GGSVK   
Sbjct: 203 KATGLGTRSFNSSVCKQGLLPLGVEGSNNGWSGEFLNLIDLPELVANDFAKLGGSVKPKG 262

Query: 262 SDKGKNFLSAGEFVGAIDPAVAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPALV 321
            D   NFLSAG++VGA+ P  A +LGL++HCVVGSGVIDAYAGWVGTVAA+TD  IP L 
Sbjct: 263 DDHRSNFLSAGQYVGALSPEAAADLGLADHCVVGSGVIDAYAGWVGTVAAQTDEEIPELA 322

Query: 322 KIDQEKVGMDRATGRLAAVAGTSTCHIAMSRDPIFVDGVWGPYRDALATNFWCAEGGQSC 381
           K ++ K+G+D+ATGRLAAVAGTSTCH+A+SRDPIFV GVWGPYRD +A  FWCAEGGQSC
Sbjct: 323 KCEKGKLGVDKATGRLAAVAGTSTCHVALSRDPIFVPGVWGPYRDVMAPGFWCAEGGQSC 382

Query: 382 TGALLAHVMTTHPAYTELSQLADAASVSKFDYLNSRLETLAQQQKSRSVVHLARHLFFYG 441
           TGALLAHV++THPAYT+L  L+++A +SKFDYLNSRLE L   +K RSVV LA+HLFFYG
Sbjct: 383 TGALLAHVLSTHPAYTDLEHLSESAGLSKFDYLNSRLEYLVNARKERSVVALAKHLFFYG 442

Query: 442 DYHGNRSPIADPSMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVEKMTTSGHDMA 501
           DYHGNRSPIAD +MRAAIIGQSMDNS+DDLAL YLGACEFIAQQTRQIVE M  SGH+++
Sbjct: 443 DYHGNRSPIADNTMRAAIIGQSMDNSVDDLALQYLGACEFIAQQTRQIVEIMCKSGHNIS 502

Query: 502 AIFMSGGQCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFDLSGTTSEL 561
           +IFMSGGQCRNGLLMRLLADCTGLPI+IPRYIDAAVVFGSALLGAVASES++   T ++L
Sbjct: 503 SIFMSGGQCRNGLLMRLLADCTGLPIIIPRYIDAAVVFGSALLGAVASESYNAHHTKTDL 562

Query: 562 SVSRKSSIAGHPTDGSQPKKSAVSKLGQFGSDDLXXXXXXXXXXXXXXXXXXXVGFPFPT 621
              R SS+       +   K  +SKL +  +D                       FP   
Sbjct: 563 RKRRASSLGSKDQAIAGLGKGGLSKLSELQTDQPSPYTAPHATSSSHMGGGSY--FPIVG 620

Query: 622 PDDPYALGEQTEPDADNDNSSELNFKA-HSKWKKDMEDRMKGRSSDNGDAMWNVMYNMTG 680
            D    L          D    + FK+  S  ++++ +  K  ++ NG+ +W VMY+MTG
Sbjct: 621 SDAAANLSPGEAIAETEDEEEPVTFKSVKSTTQENLAE--KTDTNSNGEELWKVMYDMTG 678

Query: 681 GGKVVQPCPEDNPDRKLLDVKYKIFLDMAETQRKYRNLVNEVE 723
           GGKVV+P P+ NPDR LL+ KYKIFLDMA TQR+YR+ ++ VE
Sbjct: 679 GGKVVRPNPDTNPDRVLLNAKYKIFLDMANTQRQYRSAIDRVE 721

>Suva_2.269 Chr2 complement(467973..470150) [2178 bp, 725 aa] {ON}
           YDR109C (REAL)
          Length = 725

 Score =  867 bits (2241), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 429/709 (60%), Positives = 522/709 (73%), Gaps = 37/709 (5%)

Query: 26  SLEQQKMLYYIGVDVGTGSARACIIDSMGNILSLAERPIQREQLKPNFITQSSQEIWQAV 85
           SL+  +  +++GVDVGTGS RACIID  G ILSLAE+PI+RE+++ NFITQSS+EIW AV
Sbjct: 35  SLQDSQEKFHVGVDVGTGSTRACIIDQFGKILSLAEKPIKREEVRSNFITQSSKEIWDAV 94

Query: 86  CHCVKSVVRDSGVPSEKIHGIGFDATCSLVVVEEGSNKEVAVGPDFQNTNQNIILWMDHR 145
           CHCVK+V+++S V  +K+HGIGFDATCSLVVV     K +AVGPDF N +QNIILWMDHR
Sbjct: 95  CHCVKAVLQESEVDPKKVHGIGFDATCSLVVVSATDLKGIAVGPDFSNNDQNIILWMDHR 154

Query: 146 AIEETEQINATGDKCLKYVGGQMSVEMEIPKIKWLKNHLPNNKFDECKFFDLADYLTFKA 205
           A++ETE+IN+TGDKCLKYVGGQMSVEM+IPKIKWLKN+L    F +CKFF+L DYLTFKA
Sbjct: 155 AMKETEEINSTGDKCLKYVGGQMSVEMDIPKIKWLKNNLEAEIFKDCKFFNLPDYLTFKA 214

Query: 206 SGKETRSFCSTVCKQGLLPVGVEGSKEGWSREFLTEIGLEDFIEDDFRKIGGSVKNSDKG 265
           +GKE RSF S VCKQG LP GVE SK GWS EFL  IGL +   +DF ++GGS+++    
Sbjct: 215 TGKENRSFASAVCKQGFLPAGVESSKLGWSEEFLNSIGLSELTTNDFERLGGSLRDK--- 271

Query: 266 KNFLSAGEFVGAIDPAVAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPALVKIDQ 325
           KNFLSAGE VG +D   A ELGL+ HC+VGSG+IDAYAGWVGTVAA+   +IP L + + 
Sbjct: 272 KNFLSAGECVGFLDVNSACELGLTQHCIVGSGIIDAYAGWVGTVAAKPSSAIPGLSENEH 331

Query: 326 EKVGMDRATGRLAAVAGTSTCHIAMSRDPIFVDGVWGPYRDALATNFWCAEGGQSCTGAL 385
           EK  ++ A GRLAAVAGTSTCHI +S+DPIFV GVWGPYRD LA NFW AEGGQSCTGAL
Sbjct: 332 EKNDINSAIGRLAAVAGTSTCHILLSKDPIFVHGVWGPYRDVLARNFWTAEGGQSCTGAL 391

Query: 386 LAHVMTTHPAYTELSQLADAASVSKFDYLNSRLETLAQQQKSRSVVHLARHLFFYGDYHG 445
           LAHV+ THPA+TELSQLADAAS+S F+YLNS LETL Q++  RSVV LA+H FFYGDYHG
Sbjct: 392 LAHVIKTHPAFTELSQLADAASISIFEYLNSMLETLVQKRNERSVVSLAKHFFFYGDYHG 451

Query: 446 NRSPIADPSMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVEKMTTSGHDMAAIFM 505
           NRSPIADP+MRA IIGQSMDNS++DLA+ YLGACEFI+QQTRQI+E M  +GH + AIFM
Sbjct: 452 NRSPIADPNMRACIIGQSMDNSVEDLAVTYLGACEFISQQTRQIIEAMLENGHRIDAIFM 511

Query: 506 SGGQCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFDLSGTTSELSVSR 565
           SGGQCRNGLLMRLLADCTGLPI+IPRYIDAAVVFGSALLGA ASE+ DL+   + +  +R
Sbjct: 512 SGGQCRNGLLMRLLADCTGLPIMIPRYIDAAVVFGSALLGAAASEASDLANEKT-ICQTR 570

Query: 566 KSSIAGHPTDGSQPKKSAVSKLGQFGSDDLXXXXXXXXXXXXXXXXXXXVGFPFPTP--- 622
           +SS++      + P K   +  G+                         V  P  TP   
Sbjct: 571 RSSLSQKEKVVNDPYKPIQNLSGE------------------DQNLAFDVSPPNSTPSYI 612

Query: 623 -DDPYALGEQTEPDADNDNSSELNFKAHSKWKKDMEDR-------MKGRSSDNGDAMWNV 674
            + P  L     P  +     +L+    ++ + D +         ++    ++GD +W V
Sbjct: 613 KNIPATLNSHISPIVER----QLHVVVSARNRNDKDTSTSTVTRGLQKERCNSGDLLWKV 668

Query: 675 MYNMTGGGKVVQPCPEDNPDRKLLDVKYKIFLDMAETQRKYRNLVNEVE 723
           M  +TG  KVV P  + +PDR LLD KY+IFLDMAE QRKYRN+V+ VE
Sbjct: 669 MQELTGEAKVVNPNDKTHPDRILLDTKYQIFLDMAENQRKYRNMVDRVE 717

>YDR109C Chr4 complement(673520..675667) [2148 bp, 715 aa] {ON}
           Putative kinase
          Length = 715

 Score =  851 bits (2199), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/696 (60%), Positives = 511/696 (73%), Gaps = 26/696 (3%)

Query: 34  YYIGVDVGTGSARACIIDSMGNILSLAERPIQREQLKPNFITQSSQEIWQAVCHCVKSVV 93
           +Y+GVDVGTGSARAC+ID  GN+LSLAE+PI+REQL  NFITQSS+EIW AVC+CV++VV
Sbjct: 39  FYVGVDVGTGSARACVIDQSGNMLSLAEKPIKREQLISNFITQSSREIWNAVCYCVRTVV 98

Query: 94  RDSGVPSEKIHGIGFDATCSLVVVEEGSNKEVAVGPDFQNTNQNIILWMDHRAIEETEQI 153
            +SGV  E++ GIGFDATCSLVVV   + +E+AVGPDF N +QNIILWMDHRA++ETE+I
Sbjct: 99  EESGVDPERVRGIGFDATCSLVVVSATNFEEIAVGPDFTNNDQNIILWMDHRAMKETEEI 158

Query: 154 NATGDKCLKYVGGQMSVEMEIPKIKWLKNHLPNNKFDECKFFDLADYLTFKASGKETRSF 213
           N++GDKCLKYVGGQMSVEMEIPKIKWLKN+L    F +CKFFDL DYLTFKA+GKE RSF
Sbjct: 159 NSSGDKCLKYVGGQMSVEMEIPKIKWLKNNLEAGIFQDCKFFDLPDYLTFKATGKENRSF 218

Query: 214 CSTVCKQGLLPVGVEGSKEGWSREFLTEIGLEDFIEDDFRKIGGSVKNSDKGKNFLSAGE 273
           CS VCKQG LPVGVEGS  GWS+EFL  IGL +  ++DF ++GGS++   + KNFL+AGE
Sbjct: 219 CSAVCKQGFLPVGVEGSDIGWSKEFLNSIGLSELTKNDFERLGGSLR---EKKNFLTAGE 275

Query: 274 FVGAIDPAVAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPALVKIDQEKVGMDRA 333
            +  +D   A +LGL+ HCVV SG+IDAYAGWVGTVAA+ + ++  L + +  K   + A
Sbjct: 276 CISPLDKKAACQLGLTEHCVVSSGIIDAYAGWVGTVAAKPESAVKGLAETENYKKDFNGA 335

Query: 334 TGRLAAVAGTSTCHIAMSRDPIFVDGVWGPYRDALATNFWCAEGGQSCTGALLAHVMTTH 393
            GRLAAVAGTSTCHI +S++PIFV GVWGPYRD LA  FW AEGGQSCTG LL H++TTH
Sbjct: 336 IGRLAAVAGTSTCHILLSKNPIFVHGVWGPYRDVLARGFWAAEGGQSCTGVLLDHLITTH 395

Query: 394 PAYTELSQLADAASVSKFDYLNSRLETLAQQQKSRSVVHLARHLFFYGDYHGNRSPIADP 453
           PA+TELS +A+ A VSKF+YLN  LETL +++K RSV+ LA+HLFFYGDYHGNRSPIADP
Sbjct: 396 PAFTELSHMANLAGVSKFEYLNKILETLVEKRKVRSVISLAKHLFFYGDYHGNRSPIADP 455

Query: 454 SMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVEKMTTSGHDMAAIFMSGGQCRNG 513
           +MRA IIGQSMDNSI+DLA+MYL ACEFI+QQTRQI+E M  SGH++ AIFMSGGQCRN 
Sbjct: 456 NMRACIIGQSMDNSIEDLAVMYLSACEFISQQTRQIIEVMLKSGHEINAIFMSGGQCRNS 515

Query: 514 LLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFDLSGTTSELSVSRKSSIAGHP 573
           LLMRLLADCTGLPIVIPRY+DAAVVFGSALLGA ASE FD +          K ++ G  
Sbjct: 516 LLMRLLADCTGLPIVIPRYVDAAVVFGSALLGAAASEDFDYT--------REKRTLKG-- 565

Query: 574 TDGSQPKKSAVSKLGQFGSDDLXXXXXXXXXXXXXXXXXXXVGFPFPTPDDPYALGEQTE 633
                 +KS+ +K  +F                              TP  P  +   + 
Sbjct: 566 ------QKSSQTKTERFNDSYSSIQKLSMEDRNSTNGFVSPHNLQLSTPSAPAKINNYSL 619

Query: 634 PDADN---DNSSELNFKAHSKWKKDMEDRMKGRSSDNGDA-MWNVMYNMTGGGKVVQPCP 689
           P       D +SE + K  S      E   +GR   NG + +W VM  +TG  ++V P  
Sbjct: 620 PICTQQPLDKTSEESSKDAS-LTVGQESLGEGRY--NGTSFLWKVMQELTGNARIVNPNE 676

Query: 690 EDNPDRKLLDVKYKIFLDMAETQRKYRNLVNEVEKS 725
           + +PDR LLD KY+IFLDM ETQRKYR +V++VE S
Sbjct: 677 KTHPDRILLDTKYQIFLDMIETQRKYRRMVDKVEGS 712

>Smik_4.355 Chr4 complement(634853..636967) [2115 bp, 704 aa] {ON}
           YDR109C (REAL)
          Length = 704

 Score =  843 bits (2177), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/701 (58%), Positives = 513/701 (73%), Gaps = 20/701 (2%)

Query: 25  LSLEQQKMLYYIGVDVGTGSARACIIDSMGNILSLAERPIQREQLKPNFITQSSQEIWQA 84
           +S  + +  +Y+GVDVGTGS RACIID  GNILSLAE+PI+RE+L  NFITQSS+EIW A
Sbjct: 21  ISQHESETKFYVGVDVGTGSTRACIIDKSGNILSLAEKPIKREELLSNFITQSSREIWNA 80

Query: 85  VCHCVKSVVRDSGVPSEKIHGIGFDATCSLVVVEEGSNKEVAVGPDFQNTNQNIILWMDH 144
           VC+CV+ V++++GV   +IHGIGFDATCSLVVV     KE+AVGPDF N +QNIILWMDH
Sbjct: 81  VCYCVRKVIQEAGVDPARIHGIGFDATCSLVVVSATDFKEIAVGPDFTNNDQNIILWMDH 140

Query: 145 RAIEETEQINATGDKCLKYVGGQMSVEMEIPKIKWLKNHLPNNKFDECKFFDLADYLTFK 204
           RA++ETE+IN +G+ CLKYVGGQMSVEMEIPKIKWLKN+L +  F +CKFFDL DYLTF+
Sbjct: 141 RAMKETEEINFSGNTCLKYVGGQMSVEMEIPKIKWLKNNLESGIFQDCKFFDLPDYLTFR 200

Query: 205 ASGKETRSFCSTVCKQGLLPVGVEGSKEGWSREFLTEIGLEDFIEDDFRKIGGSVKNSDK 264
           A+GKE RSF S VCKQG LP GVEGS  GWS++FL  IGL +  ++DF K+GGS++N   
Sbjct: 201 ATGKENRSFSSVVCKQGFLPEGVEGSNLGWSKQFLDSIGLSELTDNDFEKLGGSLRNQ-- 258

Query: 265 GKNFLSAGEFVGAIDPAVAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPALVKID 324
            KNFLSAGE +G +D   A +LGL+ +CVV SG+IDAYAGWVGTVAA+ +  I  L + +
Sbjct: 259 -KNFLSAGECIGPLDGKAARQLGLTEYCVVSSGIIDAYAGWVGTVAAKPESEIKGLTENE 317

Query: 325 QEKVGMDRATGRLAAVAGTSTCHIAMSRDPIFVDGVWGPYRDALATNFWCAEGGQSCTGA 384
             K   + A GRLAAVAGTSTCHI +S+  IFV G+WGPYRD LA  FW AEGGQSCTG 
Sbjct: 318 DYKHDFNGAIGRLAAVAGTSTCHILLSKSSIFVHGIWGPYRDVLARGFWAAEGGQSCTGV 377

Query: 385 LLAHVMTTHPAYTELSQLADAASVSKFDYLNSRLETLAQQQKSRSVVHLARHLFFYGDYH 444
           LL HV+TTHPA+++LSQLADAA+VSKF+YLNS LE L +++K RSV+ LA+HLFFYGDY 
Sbjct: 378 LLDHVITTHPAFSKLSQLADAANVSKFEYLNSVLENLVEKRKERSVIFLAKHLFFYGDYR 437

Query: 445 GNRSPIADPSMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVEKMTTSGHDMAAIF 504
           GNRSPIADP+MRA IIGQSMDNSIDDLA++YLGACEFI+QQTRQI+E M  SGH + A+F
Sbjct: 438 GNRSPIADPNMRACIIGQSMDNSIDDLAVIYLGACEFISQQTRQIIEVMLKSGHAINAVF 497

Query: 505 MSGGQCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFDLSGTTSELSVS 564
           MSGGQCRNGLLMRLLADCTGLPIVIPRYID AVVFGSALLGA AS+ FDL+     +   
Sbjct: 498 MSGGQCRNGLLMRLLADCTGLPIVIPRYIDGAVVFGSALLGAAASKVFDLNKRRRVIKSK 557

Query: 565 RKSSIAGHPTDGSQPKKSAVSKLGQFGSDDLXXXXXXXXXXXXXXXXXXXVGFPFPTPDD 624
           + S +     +G  P              +L                   +  P  T  D
Sbjct: 558 KSSLVQTEFLEGLYP-----------SIQNLPLENHSTNVVASYKLACSNLNAPARTSSD 606

Query: 625 PYALGEQTEPDADNDNSSELNFKAHSKWKKDMEDRMKGRSSDNGDAMWNVMYNMTGGGKV 684
            + + ++   D  +D SS+    +  K ++++E+    R  D  + +W VM  +TG  KV
Sbjct: 607 LFPISKEQPADMISDKSSK--GISLDKGRENLEEE---RDIDK-NILWKVMQELTGNAKV 660

Query: 685 VQPCPEDNPDRKLLDVKYKIFLDMAETQRKYRNLVNEVEKS 725
           + P  + +PDR LLD KY+IFLDM ETQR YR +V++VE++
Sbjct: 661 ICPNTKTHPDRILLDTKYQIFLDMVETQRNYRRMVDKVEET 701

>Skud_4.370 Chr4 complement(645143..647287) [2145 bp, 714 aa] {ON}
           YDR109C (REAL)
          Length = 714

 Score =  840 bits (2171), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 421/708 (59%), Positives = 514/708 (72%), Gaps = 33/708 (4%)

Query: 25  LSLEQQKMLYYIGVDVGTGSARACIIDSMGNILSLAERPIQREQLKPNFITQSSQEIWQA 84
           + L+  ++ +Y+GVDVGTGSARACIID  GN+LSLAE+PI+RE+L+PNFITQSS+EIW A
Sbjct: 30  IPLKDPEVKFYVGVDVGTGSARACIIDQSGNMLSLAEKPIKREELRPNFITQSSREIWDA 89

Query: 85  VCHCVKSVVRDSGVPSEKIHGIGFDATCSLVVVEEGSNKEVAVGPDFQNTNQNIILWMDH 144
           VCHCVK+V+++S V  +++HG+GFDATCSLVVV     K VAVGPDF   +QNIILWMDH
Sbjct: 90  VCHCVKAVIQESRVDPDRVHGMGFDATCSLVVVSATDAKGVAVGPDFTKNDQNIILWMDH 149

Query: 145 RAIEETEQINATGDKCLKYVGGQMSVEMEIPKIKWLKNHLPNNKFDECKFFDLADYLTFK 204
           RA++ETE+IN++ DKCLKYVGGQMSVEMEIPKIKWLKN+L +  F +CKFFDL DYLTFK
Sbjct: 150 RAMKETEEINSSEDKCLKYVGGQMSVEMEIPKIKWLKNNLRSELFQDCKFFDLPDYLTFK 209

Query: 205 ASGKETRSFCSTVCKQGLLPVGVEGSKEGWSREFLTEIGLEDFIEDDFRKIGGSVKNSDK 264
           A+GKE RSF S VCKQG LP GVEGS  GWS EFL  IGL + IE DF K+GGS+++   
Sbjct: 210 ATGKENRSFSSAVCKQGFLPAGVEGSNLGWSEEFLNTIGLSELIESDFEKLGGSLRHK-- 267

Query: 265 GKNFLSAGEFVGAIDPAVAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPALVKID 324
            KNFLSAGE +G++D   A ELGL+ +CVV SG+IDAYAGWVGTVAA+ +  I  L + +
Sbjct: 268 -KNFLSAGECIGSLDWKAARELGLTENCVVSSGLIDAYAGWVGTVAAKPESPIRGLAENE 326

Query: 325 QEKVGMDRATGRLAAVAGTSTCHIAMSRDPIFVDGVWGPYRDALATNFWCAEGGQSCTGA 384
                 + A GRLAAVAGTSTCHI +S+DPIFV G+WGPYRD LA  FW AEGGQSCTG 
Sbjct: 327 DNTYNYNGAIGRLAAVAGTSTCHILLSKDPIFVHGIWGPYRDVLARGFWAAEGGQSCTGV 386

Query: 385 LLAHVMTTHPAYTELSQLADAASVSKFDYLNSRLETLAQQQKSRSVVHLARHLFFYGDYH 444
           LL HV+  HPAYTELSQL +AA VSKF+YLNS LET+ +++  RSV+ LARHLFFYGDYH
Sbjct: 387 LLDHVIKIHPAYTELSQLTNAAGVSKFEYLNSMLETMVKKRNERSVISLARHLFFYGDYH 446

Query: 445 GNRSPIADPSMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVEKMTTSGHDMAAIF 504
           GNRSPIAD +MRA IIGQSMDNS++DLA+ YL ACEFI+QQTRQIVE M  SGH + AIF
Sbjct: 447 GNRSPIADSNMRACIIGQSMDNSVEDLAITYLSACEFISQQTRQIVEVMLKSGHKIDAIF 506

Query: 505 MSGGQCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFDLSGTTSELSVS 564
           MSGGQCRN LL RLLADC+GLPIVIPRYID AVVFGSALLGA ASE+FDL+     L+  
Sbjct: 507 MSGGQCRNDLLTRLLADCSGLPIVIPRYIDGAVVFGSALLGAAASEAFDLAKGRRTLTTK 566

Query: 565 RKSS-----IAGHPTDGSQPKKSAVSKLGQFGSDDLXXXXXXXXXXXXXXXXXXXVGFPF 619
           + SS     I  +P+    P+ SA+    Q  + D+                      P 
Sbjct: 567 KSSSAQEFFINSYPS----PQNSAMRH--QNLASDVTCSYNLPNSISSA---------PD 611

Query: 620 PTPDDPYALGEQTEPDADNDNSSE--LNFKAHSKWKKDMEDRMKGRSSDNGDAMWNVMYN 677
                   + +Q+  D  ++ SS+  LN  A    +   E R +G        +W VM  
Sbjct: 612 TMNRHSSTISKQSRGDMSSEESSKGTLNTVALRSLE---EKRYRGTG-----ILWKVMQE 663

Query: 678 MTGGGKVVQPCPEDNPDRKLLDVKYKIFLDMAETQRKYRNLVNEVEKS 725
           +TG  K V P    +PDR LLD KY+IFLDMAETQ++YR++V+ +E+S
Sbjct: 664 LTGDAKAVNPNKATHPDRILLDTKYQIFLDMAETQKRYRHMVDNLEES 711

>NDAI0J01400 Chr10 (321913..323679) [1767 bp, 588 aa] {ON} Anc_8.257
          Length = 588

 Score =  721 bits (1861), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/539 (61%), Positives = 431/539 (79%), Gaps = 7/539 (1%)

Query: 29  QQKMLYYIGVDVGTGSARACIIDSMGNILSLAERPIQREQLKPNFITQSSQEIWQAVCHC 88
           ++ + YYIGVDVGTGS RACIID +G I S AE  I R++LK + ITQSSQEIW+AVC C
Sbjct: 2   EKDIYYYIGVDVGTGSVRACIIDDLGTIKSQAELSIHRQELKTDCITQSSQEIWRAVCFC 61

Query: 89  VKSVVRDSGVPSEKIHGIGFDATCSLVVVEEGSNKEVAVGPDFQNTNQNIILWMDHRAIE 148
           VK VV + G   +++ GIGFDATCSLVVV++ +N+ VAVGPDF ++NQ+IILWMDHRA++
Sbjct: 62  VKKVVNELGCTRDQVKGIGFDATCSLVVVDKVTNRGVAVGPDFNDSNQDIILWMDHRALK 121

Query: 149 ETEQINATGDKCLKYVGGQMSVEMEIPKIKWLKNHLPNNKFDECKFFDLADYLTFKASGK 208
           ET++IN+T D+CLKYVGGQMS+EME+PKIKWLK H+  + F  C+F+DLADYLTFKA+G+
Sbjct: 122 ETKEINSTNDECLKYVGGQMSIEMELPKIKWLKRHMSKDVFARCEFYDLADYLTFKATGR 181

Query: 209 ETRSFCSTVCKQGLLPVGVEGSKEGWSREFLTEIGLEDFIEDDFRKIGGSVKNSDKGKNF 268
           +TRSFCS VCKQG++P+GVEGSK GWS++FL  I LE+   +D+ K+GGSV  S  G+NF
Sbjct: 182 KTRSFCSVVCKQGMVPMGVEGSKLGWSKDFLRNIDLEELTYNDYAKLGGSVSGS-HGRNF 240

Query: 269 LSAGEFVGAIDPAVAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPALVKIDQEKV 328
           L+AGE++  ++    EEL LS  C+VGSG+IDAYAGW+GTV + T V +  L +     V
Sbjct: 241 LTAGEYIAPLNDQAIEELELSKECIVGSGIIDAYAGWLGTVGSGT-VDLEQLFR-----V 294

Query: 329 GMDRATGRLAAVAGTSTCHIAMSRDPIFVDGVWGPYRDALATNFWCAEGGQSCTGALLAH 388
           GM  A GRLAAVAGTSTCHI +S+DPIFV GVWGPY+D +   +WC EGGQSCTGALL H
Sbjct: 295 GMANAIGRLAAVAGTSTCHIVLSKDPIFVPGVWGPYKDTITKGYWCTEGGQSCTGALLQH 354

Query: 389 VMTTHPAYTELSQLADAASVSKFDYLNSRLETLAQQQKSRSVVHLARHLFFYGDYHGNRS 448
           V+ THP+Y EL ++++   ++KFDYLN+RL  +A++   RSV+ LA+H+FFYGD HGNRS
Sbjct: 355 VLQTHPSYKELEEISEKNGMNKFDYLNTRLAEMAKRSNERSVLCLAKHIFFYGDLHGNRS 414

Query: 449 PIADPSMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVEKMTTSGHDMAAIFMSGG 508
           P+ADPSM+ AI+G SMD S+D+LA  YL ACEFIAQQ RQI+E M  +GH+++AI+MSGG
Sbjct: 415 PLADPSMKGAIVGLSMDTSLDNLAKTYLAACEFIAQQNRQIIEAMCDAGHEISAIYMSGG 474

Query: 509 QCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFDLSGTTSELSVSRKS 567
           QCRN LLM+LLADC+GL ++IP YID+AVVFG+A+LGA AS+ + L+G+ S+  ++ ++
Sbjct: 475 QCRNSLLMKLLADCSGLSVIIPEYIDSAVVFGAAILGASASKLYQLNGSESDTVINTEN 533

 Score = 70.1 bits (170), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 29/55 (52%), Positives = 40/55 (72%)

Query: 669 DAMWNVMYNMTGGGKVVQPCPEDNPDRKLLDVKYKIFLDMAETQRKYRNLVNEVE 723
           + +W+ M  MT  G  + P P+D+PDR LLD KYKIFLDMA+ Q++YR +V+ VE
Sbjct: 533 NILWSTMNKMTKVGSYIMPVPKDHPDRILLDAKYKIFLDMADRQKRYRAIVDAVE 587

>Kpol_392.9 s392 (24389..26173) [1785 bp, 594 aa] {ON}
           (24389..26173) [1785 nt, 595 aa]
          Length = 594

 Score =  712 bits (1837), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/523 (61%), Positives = 412/523 (78%), Gaps = 1/523 (0%)

Query: 32  MLYYIGVDVGTGSARACIIDSMGNILSLAERPIQREQLKPNFITQSSQEIWQAVCHCVKS 91
           M +YIGVDVGTGS RAC+I+  G ILSL  + I +E+LKPN+ITQSS+EIWQ +C CV  
Sbjct: 1   MNHYIGVDVGTGSVRACVINDKGEILSLRSKDITKEELKPNYITQSSREIWQCICECVNY 60

Query: 92  VVRDSGVPSEKIHGIGFDATCSLVVVEEGSNKEVAVGPDFQNTNQNIILWMDHRAIEETE 151
           V+++S +    + GIGFDATCSLVV+++ + +EV VGP+F++ N+NIILWMDHRA++ET+
Sbjct: 61  VLQESQIIPSSVLGIGFDATCSLVVIDKETQQEVGVGPNFEDDNRNIILWMDHRAVKETD 120

Query: 152 QINATGDKCLKYVGGQMSVEMEIPKIKWLKNHLPNNKFDECKFFDLADYLTFKASGKETR 211
           +INATGDKCLKYVGG+MSVEME+PKIKWLKN+L +  F  CKFFDL DYLT+KA+ K+ R
Sbjct: 121 EINATGDKCLKYVGGKMSVEMELPKIKWLKNNLADGVFSNCKFFDLVDYLTYKATDKDVR 180

Query: 212 SFCSTVCKQGLLPVGVEGSKEGWSREFLTEIGLEDFIEDDFRKIGGSVKNSDKGKNFLSA 271
           SF STVCKQGLLP+GVEGS  GWS+EF T+I L++   D+F  IGGS+ +     N  S 
Sbjct: 181 SFSSTVCKQGLLPLGVEGSDIGWSKEFFTKIDLDELSSDNFSAIGGSIHSEQLENNIRSV 240

Query: 272 GEFVGAIDPAVAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPALVKIDQEKVGMD 331
           GE+VG +    A+ELGL   C+VGSG+IDAYAGWVGTVAA+ +  I  +   D     +D
Sbjct: 241 GEYVGHLSEISAKELGLPTTCIVGSGIIDAYAGWVGTVAAKVE-EIGTINNDDDASSKLD 299

Query: 332 RATGRLAAVAGTSTCHIAMSRDPIFVDGVWGPYRDALATNFWCAEGGQSCTGALLAHVMT 391
            + G LA +AGTSTCHI +S  PIFV+G+WGPYRD L+ NFWCAEGGQSCTGALL H++T
Sbjct: 300 SSIGNLAVIAGTSTCHITLSSKPIFVNGIWGPYRDVLSHNFWCAEGGQSCTGALLEHILT 359

Query: 392 THPAYTELSQLADAASVSKFDYLNSRLETLAQQQKSRSVVHLARHLFFYGDYHGNRSPIA 451
           THPAY EL +  +  SV  F++LN+RL  L ++  +RS++ L +H F YGDYHGNRSPI+
Sbjct: 360 THPAYPELHEQCEKHSVGSFEFLNNRLAELQKENSARSIISLGKHFFLYGDYHGNRSPIS 419

Query: 452 DPSMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVEKMTTSGHDMAAIFMSGGQCR 511
           D SMRAAIIGQSMD SID LA+MYL ACEFI+QQ+RQI+ ++  +GH +  I+MSGGQ R
Sbjct: 420 DESMRAAIIGQSMDTSIDSLAIMYLSACEFISQQSRQIISELVKAGHTIKKIYMSGGQAR 479

Query: 512 NGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFDL 554
           N LLMRLLADCTGLP+VIPRYIDA+V+FGSA+LGAVA +++++
Sbjct: 480 NQLLMRLLADCTGLPVVIPRYIDASVIFGSAILGAVAVDAYNI 522

 Score = 75.1 bits (183), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 45/63 (71%)

Query: 663 RSSDNGDAMWNVMYNMTGGGKVVQPCPEDNPDRKLLDVKYKIFLDMAETQRKYRNLVNEV 722
           ++ D+G  +WN M  +T  G V+ P   ++PDR LL+ KYKIFLDMAETQRKYR  ++E+
Sbjct: 529 KNWDHGKTLWNKMCKLTPPGTVINPNAVNHPDRVLLNAKYKIFLDMAETQRKYRRQIDEI 588

Query: 723 EKS 725
           E S
Sbjct: 589 EAS 591

>Ecym_4313 Chr4 (672950..674743) [1794 bp, 597 aa] {ON} similar to
           Ashbya gossypii AGR092W
          Length = 597

 Score =  694 bits (1791), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/531 (60%), Positives = 415/531 (78%), Gaps = 11/531 (2%)

Query: 34  YYIGVDVGTGSARACIIDSMGNILSLAERPIQREQLKPNFITQSSQEIWQAVCHCVKSVV 93
           +YIGVDVGT S RAC++D  G ILSLA +PI R++++PN++TQSS EIW+A+C C++ ++
Sbjct: 4   HYIGVDVGTESVRACVVDVHGTILSLASKPISRQEIQPNYLTQSSNEIWRAICFCIRKII 63

Query: 94  RDSGVPSEKIHGIGFDATCSLVVVEEGSNKEVAVGPDFQNTNQNIILWMDHRAIEETEQI 153
            DS V  + I GIGFDATCSLVV+EE +NK VAVGP+F +  Q+IILWMDHRAI+E  +I
Sbjct: 64  CDSQVVKDSIIGIGFDATCSLVVLEEVTNKGVAVGPNFDDFEQDIILWMDHRAIDEVNEI 123

Query: 154 NATGDKCLKYVGGQMSVEMEIPKIKWLKNHLPNNKFDECKFFDLADYLTFKASGKETRSF 213
           N+TG +CLKYVGG+MS+EM+IPKIKWLKN+LP  KFD+C+F+DL D+LT++A+G + RSF
Sbjct: 124 NSTGHRCLKYVGGKMSIEMQIPKIKWLKNNLPQGKFDKCEFYDLPDFLTYRATGNKCRSF 183

Query: 214 CSTVCKQGLLPVGVEGSKEGWSREFLTEIGLEDFIEDDFRKIGGSVKNSDKGKNFLSAGE 273
           CSTVCK GLLP+GV+GS +GW ++   +IGL +    +F K+GG V  S    NFLSAG+
Sbjct: 184 CSTVCKMGLLPLGVDGSTKGWPQDLFEDIGLAELCRREFSKLGGVV--SSTASNFLSAGD 241

Query: 274 FVGAIDPAVAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPALVKIDQEKVGMDRA 333
           +VG +    A +LGL+  C+V SG+IDAYAGWVGT+AA         + +  +    + A
Sbjct: 242 YVGHLSDEAAADLGLTTKCIVASGLIDAYAGWVGTIAAG--------ITLGSDGQESELA 293

Query: 334 TGRLAAVAGTSTCHIAMSRDPIFVDGVWGPYRDALATNFWCAEGGQSCTGALLAHVMTTH 393
           + RLA VAGTSTCHI +S+ P F+DGVWGPYRDAL   +W  EGGQSCTGALLAHV+ +H
Sbjct: 294 SSRLATVAGTSTCHITISKCPHFMDGVWGPYRDALMPGYWVTEGGQSCTGALLAHVLKSH 353

Query: 394 PAYTELSQLADAASVSKFDYLNSRLETLAQQQKSRSVVHLARHLFFYGDYHGNRSPIADP 453
           PAY  L +LA    +SKFD++N+RLE L +++ ++SV  L +HLFFYGDYHGNRSPIADP
Sbjct: 354 PAYDTLCKLAKNQGISKFDFINNRLEELKEERGAQSVAALGKHLFFYGDYHGNRSPIADP 413

Query: 454 SMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVEKMTTSGHDMAAIFMSGGQCRNG 513
           +MRA IIGQSMD S+DDLA+M LGACEFIAQQTRQIVE +  SGH++ +I+MSGGQCRN 
Sbjct: 414 NMRATIIGQSMDVSVDDLAIMTLGACEFIAQQTRQIVEHIKQSGHEITSIYMSGGQCRNL 473

Query: 514 LLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFDLSGTTSELSVS 564
           +L++LLA+CT LPIV+P+YIDAAVVFGSALLG  ASE + L G +   SVS
Sbjct: 474 VLIKLLANCTKLPIVLPKYIDAAVVFGSALLGVAASEKY-LHGCSDTASVS 523

 Score = 65.1 bits (157), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 28/69 (40%), Positives = 43/69 (62%)

Query: 657 EDRMKGRSSDNGDAMWNVMYNMTGGGKVVQPCPEDNPDRKLLDVKYKIFLDMAETQRKYR 716
           + R+          +W VM N+TG G++++P    + + +LLD KY+IFLDM ETQ++YR
Sbjct: 528 QQRITSELKPKQSILWTVMANLTGIGQIIEPSNMLDSEIRLLDQKYEIFLDMIETQKRYR 587

Query: 717 NLVNEVEKS 725
           +LV   E S
Sbjct: 588 DLVTRAENS 596

>NCAS0B03870 Chr2 (689411..691201) [1791 bp, 596 aa] {ON} Anc_8.257
          Length = 596

 Score =  688 bits (1776), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/518 (60%), Positives = 408/518 (78%), Gaps = 4/518 (0%)

Query: 34  YYIGVDVGTGSARACIIDSMGNILSLAERPIQREQLKPNFITQSSQEIWQAVCHCVKSVV 93
           YY+G+DVGTGS RAC++DS GN+LSL E+ I RE+LKPNFITQS++EIWQA C CVK+ +
Sbjct: 16  YYVGIDVGTGSVRACVVDSCGNMLSLVEKSINREELKPNFITQSTREIWQACCFCVKTAI 75

Query: 94  RDSGVPSEKIHGIGFDATCSLVVVEEGSNKEVAVGPDFQNTNQNIILWMDHRAIEETEQI 153
               V    + GIGFDATCSLV +E+G++K+V VGP+F+N + N+ILWMDHRA++E  +I
Sbjct: 76  EQCKVDKSLVLGIGFDATCSLVAIEKGTDKQVGVGPNFENRDMNVILWMDHRAVKEANEI 135

Query: 154 NATGDKCLKYVGGQMSVEMEIPKIKWLKNHLPNNKFDECKFFDLADYLTFKASGKETRSF 213
           NAT DKCLKYVGG MSVEM+IPKIKWLKN++  N F +C+FF+LADYLTFKA+GK TRSF
Sbjct: 136 NATNDKCLKYVGGAMSVEMDIPKIKWLKNNMDPNMFKKCEFFELADYLTFKATGKRTRSF 195

Query: 214 CSTVCKQGLLPVGVEGSKEGWSREFLTEIGLEDFIEDDFRKIGGSVKNSDKGKNFLSAGE 273
           CS VCKQG LP GVEGS EGWS+EFL+ IGLED   + +  +GG++KN D   NF S+G+
Sbjct: 196 CSVVCKQGFLPNGVEGSSEGWSKEFLSSIGLEDLAGNSYDSLGGALKN-DSQDNFQSSGK 254

Query: 274 FVGAIDPAVAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPALVKIDQEKVGMDRA 333
            +G +      ELGLS +CVVG+G+IDAYAG +GT+AA ++ S    +K D   +G+  A
Sbjct: 255 CLGPLSNEAVIELGLSENCVVGAGIIDAYAGLIGTIAATSEGS--HQIKNDSS-IGLQNA 311

Query: 334 TGRLAAVAGTSTCHIAMSRDPIFVDGVWGPYRDALATNFWCAEGGQSCTGALLAHVMTTH 393
            GRLA+VAGTSTCH+ +S+DP+FV GVWGPYRD +A  +WCAEGGQ+CTG LL++V++ H
Sbjct: 312 IGRLASVAGTSTCHLLLSKDPVFVPGVWGPYRDVVADGYWCAEGGQTCTGELLSYVLSIH 371

Query: 394 PAYTELSQLADAASVSKFDYLNSRLETLAQQQKSRSVVHLARHLFFYGDYHGNRSPIADP 453
           PA+ EL   +  A + KF YLN+ L+ L  + K  S + LA+H+FFYGDY GNRSP ADP
Sbjct: 372 PAFKELINASGVAKIDKFQYLNNMLDELTIKHKVNSKLQLAKHIFFYGDYRGNRSPYADP 431

Query: 454 SMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVEKMTTSGHDMAAIFMSGGQCRNG 513
            M AAIIGQSM++++++LA+ YL ACEFIAQQTRQIVE +  +G  ++ I+MSGGQCRN 
Sbjct: 432 MMSAAIIGQSMNHNLENLAVTYLAACEFIAQQTRQIVETIRKAGTHVSYIYMSGGQCRNK 491

Query: 514 LLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASES 551
           LLM+LL+DCTGLPI++P+Y+DAAVVFG+A+LGA A  S
Sbjct: 492 LLMKLLSDCTGLPIMLPKYVDAAVVFGAAILGATADAS 529

 Score = 72.8 bits (177), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 44/58 (75%)

Query: 666 DNGDAMWNVMYNMTGGGKVVQPCPEDNPDRKLLDVKYKIFLDMAETQRKYRNLVNEVE 723
           D G  +W  M  MT  G +++P   ++PDRKLLDVKY+IFLDMAETQRKYR +V++++
Sbjct: 538 DFGFMLWETMDRMTPHGTLLEPNDVNHPDRKLLDVKYQIFLDMAETQRKYRQMVDDID 595

>KAFR0B05560 Chr2 (1138380..1140197) [1818 bp, 605 aa] {ON}
           Anc_8.257 YDR109C
          Length = 605

 Score =  683 bits (1763), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/521 (60%), Positives = 402/521 (77%), Gaps = 5/521 (0%)

Query: 33  LYYIGVDVGTGSARACIIDSMGNILSLAERPIQREQLKPNFITQSSQEIWQAVCHCVKSV 92
            ++IGVDVGTGS RAC+ID  G+IL+L ++PI RE+LKP FITQSS+EIW ++C CV+ V
Sbjct: 19  FHFIGVDVGTGSVRACVIDRKGDILALVDKPISREELKPGFITQSSEEIWDSICFCVRKV 78

Query: 93  VRDSGVPSEKIHGIGFDATCSLVVVEEGSNKEVAVGPDFQNTNQNIILWMDHRAIEETEQ 152
           + D+ +P+ K+ GIGFDATCSL VV++ + + +AVGP F   +QNII+WMDHRA +ET++
Sbjct: 79  IADAKIPANKVIGIGFDATCSLAVVDKDTLEGLAVGPQFSKNDQNIIMWMDHRASQETDE 138

Query: 153 INATGDKCLKYVGGQMSVEMEIPKIKWLKNHLPNNKFDECKFFDLADYLTFKASGKETRS 212
           IN+  D  LKYVGG+MS+EME+PKIKWLKNH+P   F +  FFDL DYLTFKA+G + RS
Sbjct: 139 INSIYDAPLKYVGGKMSIEMEMPKIKWLKNHMPRETFRKAVFFDLPDYLTFKATGMQNRS 198

Query: 213 FCSTVCKQGLLPVGVEGSKEGWSREFLTEIGLEDFIEDDFRKIGGSVKNSDKGKNFLSAG 272
            CS VCKQGLLP+GVEGS EGWSR FL+  GL + IE++F +IGG   NS   +NFLSAG
Sbjct: 199 LCSAVCKQGLLPIGVEGSTEGWSRTFLSNTGLPELIENEFERIGGPGNNS---RNFLSAG 255

Query: 273 EFVGAIDPAVAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPALVKIDQEKVGMDR 332
           E+V  +  +  E+LGL+  CVVGSG+IDAYAG +GT+AAR D S  A  + D     +  
Sbjct: 256 EYVSTLSKSSGEQLGLTESCVVGSGLIDAYAGLIGTIAARIDES--ARTQDDANGQDLQN 313

Query: 333 ATGRLAAVAGTSTCHIAMSRDPIFVDGVWGPYRDALATNFWCAEGGQSCTGALLAHVMTT 392
           A GRLAAVAGTSTCHI +S  PIFV+GVWGPY+D LA ++WCAEGGQSCTG LL HV+TT
Sbjct: 314 AIGRLAAVAGTSTCHITLSDKPIFVNGVWGPYKDILAKDYWCAEGGQSCTGELLKHVITT 373

Query: 393 HPAYTELSQLADAASVSKFDYLNSRLETLAQQQKSRSVVHLARHLFFYGDYHGNRSPIAD 452
           HPAY EL   A  + +  F+ LN  +  LA+Q+ + +++ L + LF YGDYHGNRSPIAD
Sbjct: 374 HPAYEELKIKAAKSKLDLFECLNEIIRDLAEQKGTCTILELTKGLFLYGDYHGNRSPIAD 433

Query: 453 PSMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVEKMTTSGHDMAAIFMSGGQCRN 512
           P MRA+IIGQSMD +++ LAL+YL ACEFIA QTR I+ KM  +GH + +I+MSGGQCRN
Sbjct: 434 PRMRASIIGQSMDTTVESLALIYLAACEFIAHQTRHIITKMNEAGHSIRSIYMSGGQCRN 493

Query: 513 GLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFD 553
            +LM LLAD TGLP+VIP+YIDAAVVFG+AL+GA A + F+
Sbjct: 494 NILMELLADFTGLPVVIPKYIDAAVVFGAALIGATAWDVFN 534

 Score = 59.3 bits (142), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 36/51 (70%)

Query: 671 MWNVMYNMTGGGKVVQPCPEDNPDRKLLDVKYKIFLDMAETQRKYRNLVNE 721
           +WN M  MTG G  + P    +  + LL+ KYKI++DMA+TQ+KYR+L+++
Sbjct: 550 LWNAMVKMTGNGTTIAPKVNRHASQALLNTKYKIYMDMAKTQKKYRSLIDD 600

>TBLA0E04400 Chr5 complement(1119643..1121412) [1770 bp, 589 aa]
           {ON} Anc_8.257 YDR109C
          Length = 589

 Score =  681 bits (1757), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/522 (60%), Positives = 405/522 (77%), Gaps = 3/522 (0%)

Query: 32  MLYYIGVDVGTGSARACIIDSMGNILSLAERPIQREQLKPNFITQSSQEIWQAVCHCVKS 91
           M YYIGVDVGTGSARAC+ID  G+ILS+ E  I R++LKP +ITQS+ +IW  +C C+++
Sbjct: 1   MSYYIGVDVGTGSARACLIDLNGDILSIKELAIDRQELKPGYITQSTNQIWNNICICIRN 60

Query: 92  VVRDSGVP--SEKIHGIGFDATCSLVVVEEGSNKEVAVGPDFQNTNQNIILWMDHRAIEE 149
           ++++S V   S KI GIGFDATCSLVV+   +++EVAVGP+F++ +QN+ILWMDHRA+ E
Sbjct: 61  ILQESNVDDISSKIKGIGFDATCSLVVLNSKTDQEVAVGPNFEDNDQNVILWMDHRALIE 120

Query: 150 TEQINATGDKCLKYVGGQMSVEMEIPKIKWLKNHLPNNKFDECKFFDLADYLTFKASGKE 209
           T +IN+T  KCLKYVGGQMSVEMEIPKIKWLKN++    + +CKF DL D+LT+KA+G  
Sbjct: 121 TVEINSTDSKCLKYVGGQMSVEMEIPKIKWLKNNMNPAVYKDCKFLDLPDFLTYKATGNS 180

Query: 210 TRSFCSTVCKQGLLPVGVEGSKEGWSREFLTEIGLEDFIEDDFRKIGGSVKNSDKGK-NF 268
            RSFCS VCKQGLLP+GVEGS +GW+ EFL  IGLED +ED+F K+GG VK   +GK +F
Sbjct: 181 IRSFCSAVCKQGLLPLGVEGSTKGWTEEFLLNIGLEDLMEDNFVKLGGPVKQDSQGKVSF 240

Query: 269 LSAGEFVGAIDPAVAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPALVKIDQEKV 328
            +AGEF+G +    ++ +G+S+ C V SG+IDAYAGW+GT+AA T   I  L        
Sbjct: 241 STAGEFIGYLSDKSSKIMGISSKCAVSSGIIDAYAGWIGTIAASTKEPIEQLNNFQDNLN 300

Query: 329 GMDRATGRLAAVAGTSTCHIAMSRDPIFVDGVWGPYRDALATNFWCAEGGQSCTGALLAH 388
           GM  ++GRLA VAGTSTCHI+++  PIFV GVWGPYRD L  NFWCAEGGQSCTGALL H
Sbjct: 301 GMICSSGRLAVVAGTSTCHISLTNKPIFVPGVWGPYRDVLGHNFWCAEGGQSCTGALLQH 360

Query: 389 VMTTHPAYTELSQLADAASVSKFDYLNSRLETLAQQQKSRSVVHLARHLFFYGDYHGNRS 448
           V+ THPAY EL  ++    +S F+ LN+++  L  Q+     VHL ++LFFYGD+HGNRS
Sbjct: 361 VLETHPAYKELCAISKQQDISVFEVLNNKIRELTHQRDLIDEVHLIKNLFFYGDFHGNRS 420

Query: 449 PIADPSMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVEKMTTSGHDMAAIFMSGG 508
           P+AD +MR  IIG SMD+S++DL  MYLGACEFIAQQTR IV+ MT SG+++ +++MSGG
Sbjct: 421 PVADEAMRGNIIGLSMDSSLNDLCRMYLGACEFIAQQTRHIVDIMTKSGYNLHSLYMSGG 480

Query: 509 QCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASE 550
           QCRN LLM+L+++C GLP+VIP+ ID AVVFGSAL+GA ASE
Sbjct: 481 QCRNELLMQLISNCVGLPVVIPKNIDTAVVFGSALMGACASE 522

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 35/50 (70%)

Query: 671 MWNVMYNMTGGGKVVQPCPEDNPDRKLLDVKYKIFLDMAETQRKYRNLVN 720
           +W+VM  MTG G VV P    +   KLL VKY+I+LDM  TQ++YR++VN
Sbjct: 538 LWDVMCKMTGQGIVVSPQDPSSQVCKLLTVKYQIYLDMIATQKRYRSMVN 587

>KNAG0H03260 Chr8 (607908..609650) [1743 bp, 580 aa] {ON} Anc_8.257
           YDR109C
          Length = 580

 Score =  655 bits (1689), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/520 (59%), Positives = 387/520 (74%), Gaps = 11/520 (2%)

Query: 34  YYIGVDVGTGSARACIIDSMGNILSLAERPIQREQLKPNFITQSSQEIWQAVCHCVKSVV 93
           YYIGVDVGTGSARA ++   G  L+L E PI+R++L+ +FITQSS EIW AVCHCV+ VV
Sbjct: 6   YYIGVDVGTGSARAVMLQHDGAALALEEHPIKRQELRVDFITQSSSEIWSAVCHCVRGVV 65

Query: 94  RDSGVPSEKIHGIGFDATCSLVVVEEGSNKEVAVGPDFQNTNQNIILWMDHRAIEETEQI 153
             SGV    + GIGFDATCSLV V+  +   V VGP+F ++ QNIILWMDHRA  ET+ I
Sbjct: 66  TKSGVNPRLVKGIGFDATCSLVAVDAVTGDAVPVGPNFDDSTQNIILWMDHRATRETDAI 125

Query: 154 NATGDKCLKYVGGQMSVEMEIPKIKWLKNHLPNNKFDECKFFDLADYLTFKASGKETRSF 213
           NATGD+CLKYVGGQMSVEME+PKIKWLK H+P  +F +CKFFDL DYLTF A+ K+ RSF
Sbjct: 126 NATGDRCLKYVGGQMSVEMELPKIKWLKGHMPRGQFTKCKFFDLPDYLTFMATAKDRRSF 185

Query: 214 CSTVCKQGLLPVGVEGSKEGWSREFLTEIGLEDFIEDDFRKIGGSVKNSDKGKNFLSAGE 273
           CS VCKQGLLP GV+GS+  WS EFL  +GL + I+ +F ++GG+ ++  K   FL+AG+
Sbjct: 186 CSAVCKQGLLPPGVDGSEGHWSPEFLEAVGLSELIDTNFVQLGGTSESKPK---FLTAGQ 242

Query: 274 FVGAIDPAVAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPALVKIDQEKVGMDRA 333
            VG +    +E+ GLS  C+V SGVIDAYAGW+G+V A+ D S         +  G+D A
Sbjct: 243 PVGQLTLEASEQFGLSTSCIVASGVIDAYAGWIGSVGAKFDQS--------HKSSGLDVA 294

Query: 334 TGRLAAVAGTSTCHIAMSRDPIFVDGVWGPYRDALATNFWCAEGGQSCTGALLAHVMTTH 393
             RLA +AGTSTCHI +S+ P FV GVWGPYRD L   +WCAEGGQSCTGALLAH++ TH
Sbjct: 295 ITRLALIAGTSTCHIMLSKGPQFVPGVWGPYRDVLIPGYWCAEGGQSCTGALLAHILETH 354

Query: 394 PAYTELSQLADAASVSKFDYLNSRLETLAQQQKSRSVVHLARHLFFYGDYHGNRSPIADP 453
           PA+ EL +LA    VS F+YL   L+TL  +++ R+V+ L+R  F YGD+HGNRSP+ADP
Sbjct: 355 PAHEELVRLAAKQQVSHFEYLGLMLDTLMMKRQVRNVLELSRSFFLYGDFHGNRSPLADP 414

Query: 454 SMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVEKMTTSGHDMAAIFMSGGQCRNG 513
           SMRA +IGQSMD SI+ LA+ YL ACEFIA QTRQIVE M  +GH +  ++MSGGQCRN 
Sbjct: 415 SMRATVIGQSMDVSIESLAVEYLAACEFIALQTRQIVETMVRNGHVVECVYMSGGQCRNS 474

Query: 514 LLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFD 553
           LLM+L+AD  G+P+V+P+Y D  VVFG+ALL   AS+  D
Sbjct: 475 LLMQLIADSVGVPVVLPKYTDCCVVFGAALLACCASKGCD 514

 Score = 53.9 bits (128), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 39/64 (60%)

Query: 662 GRSSDNGDAMWNVMYNMTGGGKVVQPCPEDNPDRKLLDVKYKIFLDMAETQRKYRNLVNE 721
           G  +D    +W++M  MT  G  V P  + + +RK +D KY IFLDM E Q+ YR+ +++
Sbjct: 515 GIEADQSTRLWDIMTAMTPMGTRVLPNDDSSFERKYMDAKYGIFLDMIERQKLYRSQMDQ 574

Query: 722 VEKS 725
           V +S
Sbjct: 575 VFRS 578

>CAGL0B01727g Chr2 complement(159373..161106) [1734 bp, 577 aa] {ON}
           similar to uniprot|Q04585 Saccharomyces cerevisiae
           YDR109c
          Length = 577

 Score =  650 bits (1677), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/520 (58%), Positives = 389/520 (74%), Gaps = 9/520 (1%)

Query: 32  MLYYIGVDVGTGSARACIIDSMGNILSLAERPIQREQLKPNFITQSSQEIWQAVCHCVKS 91
           M YYIGVDVG+GS RAC++D  G +LS+A R I +E+  P  +TQSS EIW AVC+CVKS
Sbjct: 1   MGYYIGVDVGSGSVRACVVDDQGAMLSMATRDISKEEKLPGHVTQSSNEIWDAVCYCVKS 60

Query: 92  VVRDSGVPSEKIHGIGFDATCSLVVVEEGSNKEVAVGPDFQNTNQNIILWMDHRAIEETE 151
            + +S V +  I GIGFDATCSLVV+ + S + VA GP+F N NQNII+WMDHRAIEET+
Sbjct: 61  AIGNSNVNNGDILGIGFDATCSLVVLNKDSFEPVAAGPNFDNNNQNIIMWMDHRAIEETK 120

Query: 152 QINATGDKCLKYVGGQMSVEMEIPKIKWLKNHLPNNKFDECKFFDLADYLTFKASGKETR 211
           +IN +GD CLKYVGGQMSVEMEIPKIKWLKNH+   +F +  F DL DYLTF ASG  TR
Sbjct: 121 EINRSGDPCLKYVGGQMSVEMEIPKIKWLKNHMAPEEFKKLVFMDLPDYLTFMASGVNTR 180

Query: 212 SFCSTVCKQGLLPVGVEGSKEGWSREFLTEIGLEDFIEDDFRKIGGSVKNSDKGKNFLSA 271
           S+CS VCKQG LP GVEGS +GWS EFLT+IGLE+  + +F  +GG     ++  NF  A
Sbjct: 181 SYCSAVCKQGFLPKGVEGSSKGWSTEFLTKIGLEEISQSNFNALGG----PNESGNFTYA 236

Query: 272 GEFVGAIDPAVAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPALVKIDQEKVGMD 331
           G  +  +  +  +   ++  C+VGSG+IDAYAGW+GTVA+ T + +P     ++E V ++
Sbjct: 237 GNQLSTVSESFIKSTNINPGCIVGSGIIDAYAGWIGTVASST-IEVPN----NKEVVDIE 291

Query: 332 RATGRLAAVAGTSTCHIAMSRDPIFVDGVWGPYRDALATNFWCAEGGQSCTGALLAHVMT 391
              GRLAAVAGTSTCHI +S+  IFV GVWGPYRD L  ++WCAEGGQS TGALLAH+++
Sbjct: 292 ECAGRLAAVAGTSTCHIVLSKTSIFVPGVWGPYRDVLVPDYWCAEGGQSFTGALLAHILS 351

Query: 392 THPAYTELSQLADAASVSKFDYLNSRLETLAQQQKSRSVVHLARHLFFYGDYHGNRSPIA 451
            HP+  ELS L    +V KF +LN+ +  L+++    + + L +  F YGDYHGNRSPIA
Sbjct: 352 IHPSANELSNLVKQRNVDKFSFLNNYILELSRKNNLETPLLLTKDFFLYGDYHGNRSPIA 411

Query: 452 DPSMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVEKMTTSGHDMAAIFMSGGQCR 511
           DP+MRAAIIGQSMD S+DDLA  YL ACEFIA QT+ I++ +  +GH + AI+MSGGQCR
Sbjct: 412 DPNMRAAIIGQSMDTSMDDLARTYLAACEFIAHQTKHIIDTLMNAGHTIKAIYMSGGQCR 471

Query: 512 NGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASES 551
           N +LM+L+A+CTGLP++IP+YID+AVVFGSA+LGA+A  S
Sbjct: 472 NNILMQLIANCTGLPLIIPKYIDSAVVFGSAILGAMAYSS 511

 Score = 65.9 bits (159), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 42/59 (71%), Gaps = 2/59 (3%)

Query: 663 RSSDNG--DAMWNVMYNMTGGGKVVQPCPEDNPDRKLLDVKYKIFLDMAETQRKYRNLV 719
            +SD G  D +W+ M NMT  G  V P  ED+ +RKL++VK+KIFLDMA+TQ+ YR LV
Sbjct: 514 NNSDKGGADLLWSTMSNMTPDGTTVFPATEDSIERKLINVKHKIFLDMAKTQQTYRQLV 572

>AGR092W Chr7 (908750..910540) [1791 bp, 596 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR109C and
           Non-syntenic homolog of Saccharomyces cerevisiae YNL249C
           (MPA43)
          Length = 596

 Score =  634 bits (1634), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/540 (57%), Positives = 389/540 (72%), Gaps = 11/540 (2%)

Query: 34  YYIGVDVGTGSARACIIDSMGNILSLAERPIQREQLKPNFITQSSQEIWQAVCHCVKSVV 93
           YY+GVDVGT  ARACIID  G IL+  + PI R Q K + ITQSS EIW AVC  V++ V
Sbjct: 9   YYVGVDVGTEFARACIIDKSGAILATTQNPISRSQPKHDHITQSSSEIWGAVCKSVRAAV 68

Query: 94  RDSGVPSEKIHGIGFDATCSLVVVEEGSNKEVAVGPDFQNTNQNIILWMDHRAIEETEQI 153
            +S V  +++ GI FDATCSLVV++E S+ EVAVGPDF +  QN+ILWMDHRA+ E  +I
Sbjct: 69  AESQVAVDEVAGINFDATCSLVVLDEDSDGEVAVGPDFSDNRQNVILWMDHRAVAEASEI 128

Query: 154 NATGDKCLKYVGGQMSVEMEIPKIKWLKNHLPNNKFDECKFFDLADYLTFKASGKETRSF 213
           N+TG   L+YVGG+MSVEM++PKIKWL+ H+P  +F +CKF+DL D+LT++A+G E+RSF
Sbjct: 129 NSTGHSVLRYVGGKMSVEMQMPKIKWLQRHMPRGEFAKCKFYDLPDFLTYQATGIESRSF 188

Query: 214 CSTVCKQGLLPVGVEGSKEGWSREFLTEIGLEDFIEDDFRKIGGSVKNSDKGKNFLSAGE 273
           CSTVCK GL+P GV+ S  GWSREFL +IGLE+  ED FR++GG++   + G  F SAGE
Sbjct: 189 CSTVCKMGLVPNGVDSSTSGWSREFLEQIGLEELCEDGFRRLGGALD--EPGSEFRSAGE 246

Query: 274 FVGAIDPAVAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPALVKIDQEKVGMDRA 333
            VG +  A A  LGL+  CVVGSGVIDAYAGWVGTV A  D +        +E  G++  
Sbjct: 247 PVGLLSEAAAASLGLTPRCVVGSGVIDAYAGWVGTVGASPDGA--------RESGGVEEL 298

Query: 334 TGRLAAVAGTSTCHIAMSRDPIFVDGVWGPYRDALATNFWCAEGGQSCTGALLAHVMTTH 393
            GRLAAVAGTSTC I +S+ P FV+GVWGPYRD LA  +WC EGGQSCTGALLAH + TH
Sbjct: 299 AGRLAAVAGTSTCLIMLSQTPHFVEGVWGPYRDVLARGYWCTEGGQSCTGALLAHTLHTH 358

Query: 394 PAYTELSQLADAASVSKFDYLNSRLETLAQQQKSRSVVHLARHLFFYGDYHGNRSPIADP 453
           PAYTEL Q A    ++ FDY+N RL+ L  +  +RS+  LA+H F YGDYHGNRSP+ADP
Sbjct: 359 PAYTELHQAAQQRGLTDFDYINWRLDKLRAETGARSIRALAKHRFLYGDYHGNRSPLADP 418

Query: 454 SMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVEKMTTSGHDMAAIFMSGGQCRNG 513
           SMRAA++G SMD S DDLAL  L A EFIA Q R I++ M  +G  +  +++SGGQ RN 
Sbjct: 419 SMRAAMVGLSMDVSQDDLALAVLTAFEFIALQARHILDHMAAAGLHVDTVYLSGGQARNP 478

Query: 514 LLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFDLSGTTSELSVSRKSSIAGHP 573
           LL +LLAD    P+V PR++ AAVVFGSALL A A E++ L+ T +  S    SS +  P
Sbjct: 479 LLTQLLADAVRRPVVTPRHVGAAVVFGSALLAAAAVENY-LANTNATASSILPSSASRAP 537

 Score = 68.2 bits (165), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 40/55 (72%)

Query: 671 MWNVMYNMTGGGKVVQPCPEDNPDRKLLDVKYKIFLDMAETQRKYRNLVNEVEKS 725
           +W +M  +T  G VV P P+ +PD +LL+ KYK+FL+MAE Q+ YR LV++VE +
Sbjct: 541 LWQIMSRLTVPGNVVSPSPDADPDIRLLEAKYKVFLEMAEAQKLYRKLVDDVENT 595

>TPHA0B03240 Chr2 (743153..744910) [1758 bp, 585 aa] {ON} Anc_8.257
           YDR109C
          Length = 585

 Score =  610 bits (1572), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/519 (56%), Positives = 380/519 (73%), Gaps = 4/519 (0%)

Query: 32  MLYYIGVDVGTGSARACIIDSMGNILSLAERPIQREQLKPNFITQSSQEIWQAVCHCVKS 91
           M  YIGVDVGTGSARACI +  G IL++  + I +++L+  FITQSS EIW A+   +K 
Sbjct: 1   MSNYIGVDVGTGSARACITNKNGEILAVEVKDISKQELQLGFITQSSNEIWDAILDIIKR 60

Query: 92  VVRDSGVPSEKIHGIGFDATCSLVVVEEGSNKEVAVGPDFQNTNQNIILWMDHRAIEETE 151
           V+  S V    I GI FDATCSLVV ++ S + +AVGP+F ++NQNIILWMDHRA  ET+
Sbjct: 61  VIDISNVDPSSIDGIAFDATCSLVVFDKNSLEPIAVGPNFDDSNQNIILWMDHRAASETD 120

Query: 152 QINATGDKCLKYVGGQMSVEMEIPKIKWLKNHLPNNKFDECKFFDLADYLTFKASGKETR 211
            IN+T DK LKYVGG+MSVE E+PKIKWLK+HL    F  C F DLAD+LT+KA+GK   
Sbjct: 121 LINSTNDKRLKYVGGKMSVEFELPKIKWLKDHLSPETFHRCVFLDLADFLTYKATGKIVH 180

Query: 212 SFCSTVCKQGLLPVGVEGSKEGWSREFLTEIGLEDFIEDDFRKIGGSVKNSDKGKNFLSA 271
           SF S VCKQGLLP GVEGSK GWS+EFL +IGLE+   ++F K+GGS+ N  +G NFL  
Sbjct: 181 SFSSAVCKQGLLPTGVEGSKLGWSKEFLEKIGLEELSTNNFEKLGGSI-NLKEG-NFLIP 238

Query: 272 GEFVGAIDPAVAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPALVKIDQEKVGMD 331
           G+ VG +D   A    L NHCVVG+GVIDAY+GWVGTVA  +DVS        QE   ++
Sbjct: 239 GDLVGHVDKKFAGLANLPNHCVVGTGVIDAYSGWVGTVA--SDVSDRVCSDSPQELNKIE 296

Query: 332 RATGRLAAVAGTSTCHIAMSRDPIFVDGVWGPYRDALATNFWCAEGGQSCTGALLAHVMT 391
            + GR+A V+GTSTCHI +S+ P+F+ GVWGPYRD LA N W  EGGQS TGALL +++ 
Sbjct: 297 GSLGRIAVVSGTSTCHIVLSKQPLFISGVWGPYRDVLAENMWATEGGQSFTGALLDNIIE 356

Query: 392 THPAYTELSQLADAASVSKFDYLNSRLETLAQQQKSRSVVHLARHLFFYGDYHGNRSPIA 451
           THPAY EL ++    + + F YL+ +LE L   +K  SV +L +++F YGDY+GNRSP+A
Sbjct: 357 THPAYQELERITSRQNKNIFVYLDEKLEELRVNRKLDSVFYLTKNMFIYGDYYGNRSPLA 416

Query: 452 DPSMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVEKMTTSGHDMAAIFMSGGQCR 511
           DP M   IIGQ+MD+SI+DLA+ YL ACEFIA QTR I++ + T GH + AI+MSGG C+
Sbjct: 417 DPLMSGMIIGQTMDSSINDLAIKYLAACEFIALQTRHIIDTLVTHGHGITAIYMSGGHCK 476

Query: 512 NGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASE 550
           N LLM L+++C  LP+V+ +YID++VVFG+A+LG+VA++
Sbjct: 477 NKLLMELISNCCVLPLVLSKYIDSSVVFGAAILGSVAAK 515

 Score = 48.1 bits (113), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 33/56 (58%)

Query: 669 DAMWNVMYNMTGGGKVVQPCPEDNPDRKLLDVKYKIFLDMAETQRKYRNLVNEVEK 724
           D +W+ M  MT  G ++ P  E +  RK L  KY+++LDM +T  KYR  + EV K
Sbjct: 530 DVLWSQMKLMTPKGTLMMPKSEKSVLRKYLQAKYEVYLDMIDTNIKYRKKMEEVYK 585

>Suva_14.93 Chr14 complement(174204..175835) [1632 bp, 543 aa] {ON}
           YNL249C (REAL)
          Length = 543

 Score =  204 bits (518), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 157/534 (29%), Positives = 251/534 (47%), Gaps = 86/534 (16%)

Query: 36  IGVDVGTGSARACIIDSMGNIL-SLAERPI---QREQLKPNFITQSSQEIWQAVCHCVKS 91
           IG+D+G+ SAR  I D   ++L ++A+ P+        K     Q S EI +A+ +C + 
Sbjct: 9   IGIDIGSSSARVGIYDYYNDVLLAMAQEPVPYYHDSSKKSWKFWQKSTEIIKALQNCFQE 68

Query: 92  VVRDSGVPSEKIHGIGFDATCSLVVVEEGSNKEVAVGPDFQNTNQ-NIILWMDHRAIEET 150
           +     +    +   G  ATCSL + +    K++  G      N+ N+I WMD  A++E 
Sbjct: 69  L----KITQYNVRSCGVSATCSLAIFQ----KDLTNGNLIPYPNEDNVIFWMDSSAVDEC 120

Query: 151 EQINATGDKC----LKYVGGQMSVEMEIPKIKWLKNHLPNNKFDECKFFDLADYLTFKAS 206
           E +N   +KC    L Y+GG+   EM IPK+K+  N   +N+  +   FDL  Y+ ++  
Sbjct: 121 EWLN---EKCSQQLLDYLGGKFIPEMGIPKLKYFLNEHSHNQEKQFHIFDLHQYIAYELG 177

Query: 207 GKETRSFCSTVCKQGLLPVGVEGSKEGWSREFLTEIGLEDFIEDDFRKIGGSVKNSDKGK 266
                +      ++ +  +G +G   GWS  F           +D  K+  +V       
Sbjct: 178 RLYRWNTDELSARENINGIGNDGEASGWSSSFY----------NDIMKLPSNVT------ 221

Query: 267 NFLSAGEFVGAIDPAVAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPALVKIDQE 326
                   +G            +  C      ID+YA W         VS P L      
Sbjct: 222 --------IGLTGLNSNNSSSTTTVC----SCIDSYASWFA-------VSSPNL------ 256

Query: 327 KVGMDRATGRLAAVAGTSTCHIAMSRDPIF---VDGVWGPYRDALATN--FWCAEGGQSC 381
                     L  +AGTSTC+  M   P+    + GVWGP+   L TN  +     GQSC
Sbjct: 257 -------EASLFMIAGTSTCY--MYGSPVTTTKIPGVWGPFDTILETNGNYSVYTAGQSC 307

Query: 382 TGALLAHVMTTHPAYTELSQLADAASVSKFDYLNSRLETLAQQQKSRSVVH-LARHLFFY 440
           TG L+ H+  +HPA  ++ +  +      ++ L + ++ +  ++K+R  +H LA+H+FFY
Sbjct: 308 TGKLIEHLFKSHPAARKIQRSGEDI----YEVLENSIQDI--EKKNRKSIHILAKHMFFY 361

Query: 441 GDYHGNRSPIADPSMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVEKM--TTSGH 498
           GDY GNR+P AD  MR + IG+S D SI +L   Y+   EF++ QT+ I++      SG 
Sbjct: 362 GDYEGNRTPFADSQMRGSFIGESTDTSILNLTYKYVSMLEFLSFQTKLIIDTFQGQNSGA 421

Query: 499 DMAAIFMSGGQCRNGLLMRLLADCT-GLPIVIP-RYIDAAVVFGSALLGAVASE 550
            +  + +SG Q +NG L+ L++    G+ I  P   ID   V G+ +LG  A+E
Sbjct: 422 RIEELRVSGSQAKNGRLLSLISLVNDGIKIKRPNENIDLMGVMGAYMLGKSANE 475

 Score = 37.0 bits (84), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 22/27 (81%)

Query: 695 RKLLDVKYKIFLDMAETQRKYRNLVNE 721
           ++LL VKY+I LDMA+ Q++Y  LV+E
Sbjct: 511 KRLLSVKYRIHLDMAKQQQQYHRLVDE 537

>Skud_14.89 Chr14 complement(168159..169868) [1710 bp, 569 aa] {ON}
           YNL249C (REAL)
          Length = 569

 Score =  195 bits (496), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 153/530 (28%), Positives = 247/530 (46%), Gaps = 78/530 (14%)

Query: 36  IGVDVGTGSARACIIDSMGN-ILSLAERPIQREQLKPNFITQSSQEIWQAVCHCVKSV-- 92
           IG+DVG+ SAR  I +   + +L +A+ P+   Q      +++S + WQ     +K++  
Sbjct: 34  IGIDVGSSSARVGIYNYENDALLGMAQEPVPYYQDS----SRTSWKFWQRSTEIIKALQK 89

Query: 93  -VRDSGVPSEKIHGIGFDATCSLVVVE-EGSNKEVAVGPDFQNTNQNIILWMDHRAIEET 150
            ++   +    +   G  ATCSL + E +  N  +   P+      N+I WMD  AI+E 
Sbjct: 90  CLQKLKITEYNVKSCGVSATCSLAIFEKDKRNGSLIPYPN----EDNVIFWMDSSAIDEC 145

Query: 151 EQINA-TGDKCLKYVGGQMSVEMEIPKIKWLKNHLPNNKFDECKFFDLADYLTFKASGKE 209
           +Q+NA    + L ++GG    EM IPK+K+  N   +N+  +   FDL  Y+ ++ S   
Sbjct: 146 KQLNAECSQQLLDFLGGSFVPEMGIPKLKYFLNEYSHNQDKQFHIFDLHQYIAYELSHLY 205

Query: 210 TRSFCSTVCKQGLLPVGVEGSKEGWSREFLTEIGLEDFIEDDFRKIGGSVKNSDKGKNFL 269
             +    + ++    VGV+G   GWS  F   I                          L
Sbjct: 206 QWNNEVLLKRENNKMVGVDGEASGWSPSFYENIM------------------------HL 241

Query: 270 SAGEFVGAIDPAVAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPALVKIDQEKVG 329
            +   +G+ + A  +++  S    +    ID+YA W    +   + S             
Sbjct: 242 PSNVIIGS-NGATCKKIASS---AIVRSCIDSYASWFAVSSPHLETS------------- 284

Query: 330 MDRATGRLAAVAGTSTCHIAMSRDPIF---VDGVWGPYRDALATN--FWCAEGGQSCTGA 384
                  L  +AGTSTC+  M   PI    + GVWGP+   L +N  F     GQSCTG 
Sbjct: 285 -------LFMIAGTSTCY--MYGTPITDIKIPGVWGPFDSILDSNSHFSVYAAGQSCTGK 335

Query: 385 LLAHVMTTHPAYTELSQLADAASVSKFDYLNSRLETLAQQQKSRSVVHLARHLFFYGDYH 444
           L+ H+  THP   E+  L   A +  +  L   +  + ++Q  +SV    + +FFYGDY 
Sbjct: 336 LIEHLFVTHPCAKEI--LKRGADI--YQVLERTIHDI-EKQNGQSVHVFTKDIFFYGDYE 390

Query: 445 GNRSPIADPSMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVE--KMTTSGHDMAA 502
           GNR+P ADP M+ + IG++ D SI +L   Y+   EF++ QTR I++  K    G  +  
Sbjct: 391 GNRTPFADPRMKGSFIGETTDTSILNLIHKYICILEFLSFQTRLIIDTFKRQNIGMCIQE 450

Query: 503 IFMSGGQCRNGLLMRLLADC-TGLPIVIPR-YIDAAVVFGSALLGAVASE 550
           + +SG Q +N  L+ L++    G+ I  P+  +D   V G+ LL   A+E
Sbjct: 451 LRISGSQAKNKRLLSLISLVNNGITINKPKDNVDLMGVRGAYLLAKSANE 500

 Score = 37.0 bits (84), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 22/28 (78%)

Query: 695 RKLLDVKYKIFLDMAETQRKYRNLVNEV 722
           R+LL  KY+I LDMA+ Q++Y  L++EV
Sbjct: 536 RRLLWAKYRIHLDMAKQQQRYHKLIDEV 563

>Smik_14.86 Chr14 complement(158487..160118) [1632 bp, 543 aa] {ON}
           YNL249C (REAL)
          Length = 543

 Score =  186 bits (473), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 154/546 (28%), Positives = 248/546 (45%), Gaps = 84/546 (15%)

Query: 36  IGVDVGTGSARACIIDSMGN-ILSLAERPIQREQLKPNFITQSSQEIWQA---VCHCVKS 91
           IG+D+G+ SAR  I     + +L +A+ P+   Q   +F T+ S + WQ    +   ++ 
Sbjct: 9   IGIDLGSSSARVGIYSYYNDALLGMAQEPVPYYQ---DF-TKKSWKFWQKSTEIIEALQK 64

Query: 92  VVRDSGVPSEKIHGIGFDATCSLVVVEEGSNKEVAVGPDFQNTNQNIILWMDHRAIEETE 151
             +   +    +   G  ATCSL + E     E  +   + N N N+I WMD  A +E E
Sbjct: 65  CFQKLKITEYNVKSCGVSATCSLAIFERVHTSEALI--PYPNEN-NVIFWMDSSATDECE 121

Query: 152 QINATGDK-CLKYVGGQMSVEMEIPKIKWLKNHLPNNKFDECKFFDLADYLTFKASGKET 210
            +NA   K  L Y+GG+   EM IPK+K+  N   + +      FDL  Y+ ++      
Sbjct: 122 WLNAECSKQLLDYLGGRFVPEMGIPKLKYFLNEYSHRQDKRFHIFDLHQYIAYELGRLYQ 181

Query: 211 RSFCSTVCKQGLLPVGVEGSKEGWSREFLTEIGLEDFIEDDFRKIGGSVKNSDKGKNFLS 270
            +    +  + +  +G +G   GWS  F                           KN ++
Sbjct: 182 WNIDGLLRGENINGIGNDGEASGWSSSFY--------------------------KNIMN 215

Query: 271 AGEFVGAIDPAVAEELGLSNHCVVGSGV----IDAYAGWVGTVAARTDVSIPALVKIDQE 326
               V  I P     +GL +  V+ + V    ID+YA W         VS P L +    
Sbjct: 216 IPSNV-IIGP-----VGLVSKKVISTTVVRSCIDSYASWFA-------VSPPFLER---- 258

Query: 327 KVGMDRATGRLAAVAGTSTCHIAMSRDPIF---VDGVWGPYRDAL--ATNFWCAEGGQSC 381
                     L  +AGTS+C+  M   P+    + GVWGP+ + L    +F     GQSC
Sbjct: 259 ---------SLFMIAGTSSCY--MYGTPVSNTKIPGVWGPFNNILDDKGDFSVYAAGQSC 307

Query: 382 TGALLAHVMTTHPAYTELSQLADAASVSKFDYLNSRLETLAQQQKSRSVVHLARHLFFYG 441
           TG L+ H+  +HP   ++  L   A +  +  L   +  + +++K  S+  LA+ +FFYG
Sbjct: 308 TGKLIEHLFESHPCARKI--LKSGADI--YQVLEQTIHGI-EKKKGLSIHILAKDMFFYG 362

Query: 442 DYHGNRSPIADPSMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVEKMTTSGH--D 499
           DY GNR+P ADP M+ + IG++ D SI +L   Y+   EF++ QT+ I++   +      
Sbjct: 363 DYEGNRTPFADPRMKGSFIGETTDTSILNLTYKYISILEFLSFQTKLIIDTFQSQKACIR 422

Query: 500 MAAIFMSGGQCRNGLLMRLLADC-TGLPIVIPR-YIDAAVVFGSALLGAVASESFDLSGT 557
           +  + +SG Q RN  L+ L++    G+ I  PR  +D   + G+ +L   A+E   L   
Sbjct: 423 IQELRISGSQARNERLLSLISLVNNGMSINRPRDNVDMMGIKGAYILAKSANEKKQLVDV 482

Query: 558 TSELSV 563
             E  V
Sbjct: 483 IRERDV 488

 Score = 35.4 bits (80), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 21/28 (75%)

Query: 695 RKLLDVKYKIFLDMAETQRKYRNLVNEV 722
           + LL VKY+I LDMA+ Q+ Y  LV+EV
Sbjct: 511 KNLLCVKYRIHLDMAKQQKYYYKLVDEV 538

>YNL249C Chr14 complement(179394..181022) [1629 bp, 542 aa] {ON}
           MPA43Putative protein of unknown function; the
           authentic, non-tagged protein is detected in highly
           purified mitochondria in high-throughput studies
          Length = 542

 Score =  184 bits (467), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 147/549 (26%), Positives = 248/549 (45%), Gaps = 82/549 (14%)

Query: 36  IGVDVGTGSARACIIDSMGN-ILSLAERPI---QREQLKPNFITQSSQEIWQAVCHCVKS 91
           IG+DVG+ SAR  + +   + +L +A+ P+   Q    K     Q S EI +A+  C++ 
Sbjct: 9   IGIDVGSSSARIGVYNYYNDALLEMAQEPVPYYQDSSKKSWKFWQKSTEIIKALQKCLQK 68

Query: 92  V-VRDSGVPSEKIHGIGFDATCSLVVVEEGSNKEVAVGPDFQNTNQNIILWMDHRAIEET 150
           + +R+  V S      G  ATCSL + E      + +   + N + N+I WMD  A+ E 
Sbjct: 69  LNIREYEVKS-----CGVSATCSLAIFERDRTSNMLI--PYPNED-NVIFWMDSSAVNEC 120

Query: 151 EQINAT-GDKCLKYVGGQMSVEMEIPKIKWLKNHLPNNKFDECKFFDLADYLTFKASGKE 209
           + +N     + L Y+GG+   EM +PK+K+  +   + +      FDL  Y+ ++ S   
Sbjct: 121 QWLNMQCPQQLLDYLGGKFVPEMGVPKLKYFLDEYSHLRDKHFHIFDLHQYIAYELSRLY 180

Query: 210 TRSFCSTVCKQGLLPVGVEGSKEGWSREFLTEIGLEDFIEDDFRKIGGSVKNSDKGKNFL 269
             +    + ++ L  +G +G   GWS  F             ++ I     N   G   L
Sbjct: 181 EWNIEGLLGRENLNGIGNDGEVSGWSSSF-------------YKNIINLPSNVSIGTTSL 227

Query: 270 SAGEFVGAIDPAVAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPALVKIDQEKVG 329
            A + +                  V    ID+YA W    +   + S             
Sbjct: 228 VANKHIST---------------TVVRSCIDSYASWFAVASPHLETS------------- 259

Query: 330 MDRATGRLAAVAGTSTCH-----IAMSRDPIFVDGVWGPYRDALAT--NFWCAEGGQSCT 382
                  L  +AGTS+C+     I+ +R P    GVWGP+   L    +F     GQSCT
Sbjct: 260 -------LFMIAGTSSCYMYGTTISDTRIP----GVWGPFDTILDNRGDFSVYAAGQSCT 308

Query: 383 GALLAHVMTTHPAYTELSQLADAASVSKFDYLNSRLETLAQQQKSRSVVHLARHLFFYGD 442
           G L+ H+  +HP   ++  L D A +  +  L   +  + ++    S+  L + +FFYGD
Sbjct: 309 GKLIEHLFESHPCARKI--LKDGADI--YQVLEQTIRDI-EKNNGLSIHILTKDMFFYGD 363

Query: 443 YHGNRSPIADPSMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVEKMT--TSGHDM 500
           Y GNR+P ADP ++ + IG+S D S+ +L   Y+   EF++ QT+ I++      S   +
Sbjct: 364 YEGNRTPFADPRIKGSFIGESTDTSMLNLTYKYICILEFLSFQTKLIIDTFQNENSNIHI 423

Query: 501 AAIFMSGGQCRNGLLMRLLADC-TGLPIVIPR-YIDAAVVFGSALLGAVASESFDLSGTT 558
             + +SG Q +N  L+ L++    G+ I+ P+  +D   + G+ +L   A E   L+   
Sbjct: 424 KELRISGSQAKNERLLSLISLVNNGVAIIKPKENVDMMGIKGAYVLAKSAKEKKQLADVI 483

Query: 559 SELSVSRKS 567
           +E  +S  S
Sbjct: 484 TERDISNDS 492

 Score = 39.3 bits (90), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 22/28 (78%)

Query: 695 RKLLDVKYKIFLDMAETQRKYRNLVNEV 722
           RKLL VKY I LDMA+ Q++Y  LV+EV
Sbjct: 511 RKLLCVKYHIHLDMAKQQKRYHKLVDEV 538

>TDEL0C05900 Chr3 (1062033..1063664) [1632 bp, 543 aa] {ON}
           Anc_1.111 YNL249C
          Length = 543

 Score =  175 bits (444), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 147/549 (26%), Positives = 245/549 (44%), Gaps = 113/549 (20%)

Query: 36  IGVDVGTGSARACIIDSMGNILSLAERPIQREQLKPNFI----------TQSSQEIWQAV 85
           IG+D+G+ S R  +     +++      +Q  + K ++           TQS+ EI + +
Sbjct: 6   IGIDLGSSSVRVGLFTLEDDLM------VQCVKQKISYYYHGDSALWEYTQSTDEIMKVI 59

Query: 86  CHCVKSVVRDSGVPSEKIHGIGFDATCSLVVVEEGSNKEVAVGPDFQNTNQNIILWMDHR 145
             C+     D  +    I   G  ATCS+ +  +  N          +  QN+I WMD+ 
Sbjct: 60  ERCL----HDLKIDEYNIKSCGVSATCSMALFIKEHNHLEPFNTISGSHRQNVIFWMDNS 115

Query: 146 AIEETEQINATGDKCLK-YVGGQMSVEMEIPKIKWLKNHLPNNKFDECKFF-----DLAD 199
           +  E + +N   +K L+ ++GG+   EM IPKI  L N+L ++  D+ +       DL  
Sbjct: 116 SKTECKLLNNLCEKRLRDFMGGKFIPEMGIPKINRLINYLKSS--DDLQNLSVVAMDLHR 173

Query: 200 YLTFKASGKETRSFCSTVCKQGLLPVGVEGSKEGWSREFLTE---------IGLEDFIED 250
           YL ++ + +   +F   +       +G +G   GWS +F  +         IG E  +ED
Sbjct: 174 YLAYEIAKRFKWNFDRLLNTTNFNEIGHDGELSGWSSKFYIDTLKIPSNITIGPEPPLED 233

Query: 251 DFRKIGGSVKNSDKGKNFLSAGEFVGAIDPAVAEELGLSNHCVVGSGVIDAYAGWVGTVA 310
           DF    G V                                    +  ID Y+ W+   +
Sbjct: 234 DFEYCKGIV------------------------------------ASCIDCYSSWLSLCS 257

Query: 311 ARTDVSIPALVKIDQEKVGMDRATGRLAAVAGTSTCHIAMSRDPIFVDGVWGPYRDAL-- 368
              + S                    L  V GTSTC++  +     + GVWGP+ D L  
Sbjct: 258 PTPEES--------------------LFIVGGTSTCYLYATTRMKTIPGVWGPFTDILDN 297

Query: 369 ATNFWCAEGGQSCTGALLAHVMTTHPAYTELSQLADAASVSKFDY--LNSRLE---TLAQ 423
           +  +   EGGQSCTG L+ H++ THPA         ++S++K D+  L  ++E   +  +
Sbjct: 298 SNTYAVYEGGQSCTGKLIEHLLQTHPA---------SSSIAKDDWPLLLEKIEQEISAIE 348

Query: 424 QQKSRSVVHLARHLFFYGDYHGNRSPIADPSMRAAIIGQSMDNSIDDLALMYLGACEFIA 483
           +Q  RS+    +H+FFYGD+ GNR+P ADP M    IG++ D S ++L L Y+   EF+A
Sbjct: 349 EQTGRSIHFKTKHMFFYGDFQGNRTPYADPEMSGMTIGETTDVSFNNLILRYICILEFLA 408

Query: 484 QQTRQIVEKMTTS-GHD-MAAIFMSGGQCRNGLLMRLLADC-TGLPIVIPRY-IDAAVVF 539
            Q + ++     + G D +  I + G Q +N  L+ L++    G  I +P+  ++ + V 
Sbjct: 409 FQIKYMISIFNKAQGQDKITEIRICGSQAKNKRLLSLISLLHEGGTIKLPKTDVELSGVS 468

Query: 540 GSALLGAVA 548
           G+ LLG  A
Sbjct: 469 GAFLLGKSA 477

 Score = 35.4 bits (80), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 23/36 (63%)

Query: 687 PCPEDNPDRKLLDVKYKIFLDMAETQRKYRNLVNEV 722
           P   + P   LL+ KY+I LDMA+ Q  YR ++N++
Sbjct: 502 PSSINQPLSMLLEAKYEIHLDMAKQQLIYREMINKI 537

>SAKL0C03432g Chr3 complement(325502..327145) [1644 bp, 547 aa] {ON}
           similar to uniprot|P53583 Saccharomyces cerevisiae
           YNL249C MPA43 Mitochondrial protein of unknown function
          Length = 547

 Score =  168 bits (426), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 154/527 (29%), Positives = 238/527 (45%), Gaps = 81/527 (15%)

Query: 36  IGVDVGTGSARACIIDSMGN--ILSLAERPIQREQL-KPNFITQSSQEIWQAVCHCVKSV 92
           +GVD+G+ S R  I  S+ N  +L + ERP++          TQS+ EI  A+  C+  +
Sbjct: 13  VGVDLGSSSVRVGIY-SLENDSLLHVVERPVRYYSCGSSGRFTQSTGEIMAALQECLDEL 71

Query: 93  -VRDSGVPSEKIHGIGFDATCSLVV--VEEGSNKEVAV---GPDFQNTNQNIILWMDHRA 146
            +R  G     I   G  ATCS+ V  VE G      +   G D  ++++N++ WMD  A
Sbjct: 72  GLRPGG---RSIVSCGVAATCSMAVFTVEAGDGSLAPLDMSGLD-GSSDKNVVFWMDSVA 127

Query: 147 IEETEQINATGDKCLKY-VGGQMSVEMEIPKIKWLKNHLPNNKFDECKFFDLADYLTFKA 205
            E  + ++      +K  + G    EM +PK+  L    P    +    FDL  Y+ +  
Sbjct: 128 SEACDALDKRVSTHVKAALCGGFIPEMGVPKLLHLVGQFPGRSLE---VFDLHKYIAYDL 184

Query: 206 SGKETRSFCSTVCKQGLLPVGVEGSKEGWSREFLTEIGLEDFIEDDFRKIGGSVKNSDKG 265
           + +      +   +     +G +G   GW +EF                     +N  K 
Sbjct: 185 ARRYGWDMAALANRPNSNGIGHDGEVGGWPQEFY--------------------RNVLK- 223

Query: 266 KNFLSAGEFVGAIDPAVAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPALVKIDQ 325
              L A   VG       + +G+++        ID YA W G  + + + S         
Sbjct: 224 ---LPATVAVGPASTFKGQRVGVAS-------CIDCYASWFGVCSTQPEQS--------- 264

Query: 326 EKVGMDRATGRLAAVAGTSTCHI-AMSRDPIFVDGVWGPYRDAL---ATNFWCAEGGQSC 381
                      L  VAGTSTC++ A +     + G+WGP+ + L      +   E GQS 
Sbjct: 265 -----------LFLVAGTSTCYLYASAASKTVLPGMWGPFTNLLDGEEARWSVYEAGQST 313

Query: 382 TGALLAHVMTTHPAYTELSQLADAASVSKFDYLNSRLETLAQQQKSRSVVHLARHLFFYG 441
           TG LL H+  THPA  + +   D   +  F  L  R+  + +     S+ HLARH+F YG
Sbjct: 314 TGRLLEHLFETHPAARDYA--GDTGRL--FKDLEDRIADM-EADSGCSIHHLARHMFLYG 368

Query: 442 DYHGNRSPIADPSMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVEKMTT-SGHDM 500
           +  GNR+P ADP M    +G++ D S  +LAL Y+   EF+A QTRQIVE   T +   +
Sbjct: 369 ELQGNRTPYADPRMCGMFVGETTDTSFANLALKYVVVLEFLAFQTRQIVEGFRTGAAAAI 428

Query: 501 AAIFMSGGQCRNGLLMRLLADCTG-LPIVIP-RYIDAAVVFGSALLG 545
             + ++G Q RN  L+ L++   G +P+ +P R    A V G+ LLG
Sbjct: 429 GELRVAGSQARNRRLLSLMSLVNGNMPVRVPARAAPLAGVRGAYLLG 475

 Score = 37.0 bits (84), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 22/28 (78%)

Query: 695 RKLLDVKYKIFLDMAETQRKYRNLVNEV 722
           R+LL+ KY I LDMA+ Q++YR+ ++ V
Sbjct: 517 RRLLEAKYAIHLDMAQVQQRYRSEIDAV 544

>KLTH0F03080g Chr6 complement(268621..270222) [1602 bp, 533 aa] {ON}
           similar to uniprot|P53583 Saccharomyces cerevisiae
           YNL249C MPA43
          Length = 533

 Score =  165 bits (418), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 145/532 (27%), Positives = 231/532 (43%), Gaps = 79/532 (14%)

Query: 36  IGVDVGTGSARACIID-SMGNILSLAERPIQREQLKPNFITQSSQEIWQAVCHCVKSVVR 94
           +G+D+G+ + R  I D     ++ +  +P+       N +TQSS +I  A+  C++ +  
Sbjct: 11  LGIDLGSTAVRVGIYDLKTDKLIDIVAKPVPYTNHGGNRVTQSSTDIMSAIHGCIQDLNP 70

Query: 95  DSGVPSEKIHGIGFDATCSLVVVEEGSN--KEVAVGPDFQNTNQNIILWMDHRAIEETEQ 152
           D     + +   G  ATCSL V  +     K + +    Q    N++ WMD  A  E E 
Sbjct: 71  DL----KSVLSCGVAATCSLAVFTQDIEDLKPLDIHGVKQEPCHNVVFWMDSSATLECEI 126

Query: 153 INATGDKCLKYVGGQMSVEMEIPKIKWLKNHLPNNKFDECKFFDLADYLTFKASGKETRS 212
           +N T  +  +++GG    EM IPK+  +    P  +  + + FDL  Y+ ++ + K    
Sbjct: 127 VNKTAGRLKEFMGGSFVPEMGIPKLASIFKK-PEAEGHKLEVFDLHSYIAYELAIKYGWD 185

Query: 213 FCSTVCKQGLLPVGVEGSKEGWSREFLTEIGLEDFIEDDFRKIGGSVKNSDKGKNFLSAG 272
               + K     +G +G  +GW   F           +D  K+  +VK            
Sbjct: 186 TSRIINKPNENRIGHDGELKGWDAGFY----------NDVLKLPANVK------------ 223

Query: 273 EFVGAIDPAVAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPALVKIDQEKVGMDR 332
             +G I     E       C      ID Y+ W    ++  + S                
Sbjct: 224 --IGPIHALNTESPVRVASC------IDCYSNWFSMCSSSPNNS---------------- 259

Query: 333 ATGRLAAVAGTSTCHI-AMSRDPIFVDGVWGPYRDAL----ATNFWCAEGGQSCTGALLA 387
               L   AGTSTC++ A + +   + GVWGP+ + L    A  +   E GQS TG L+ 
Sbjct: 260 ----LFMAAGTSTCYLYANTENKGCIPGVWGPFTNILDGSEAKEWSVYEAGQSTTGKLIE 315

Query: 388 HVMTTHPAYTELSQLADAASVSK---FDYLNSRLETLAQQQKSRSVVHLARHLFFYGDYH 444
           H+  THPA       A A S+ K   F  + S +E L +Q    SV   ++H+F YG+  
Sbjct: 316 HLFETHPA-------ARAYSMDKSKLFSAIESAIEKL-EQDFGESVHFRSKHMFTYGELQ 367

Query: 445 GNRSPIADPSMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVEKMTTSGHDMAAIF 504
           GNR+P  D SM    IG++ D S  DL L Y+   EF+A Q + I E       D   I 
Sbjct: 368 GNRTPYCDSSMSGMFIGETTDTSFQDLVLKYVTILEFLAFQVKHIKECFKAEIKD---IR 424

Query: 505 MSGGQCRNGLLMRLLADCTG-LPIVIP-RYIDAAVVFGSALLGAVASESFDL 554
           ++G Q +N  L+ L +     + + IP +  D   V G+ LLG  A ++ ++
Sbjct: 425 IAGSQAKNTRLLTLFSLVNDQITVKIPAQRTDYMGVEGAYLLGKAAHKNINI 476

 Score = 41.2 bits (95), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 24/28 (85%)

Query: 695 RKLLDVKYKIFLDMAETQRKYRNLVNEV 722
           ++LL+ KYKI+LDMA+TQ +YR +V+ V
Sbjct: 506 KQLLEAKYKIYLDMAQTQMRYRAMVDSV 533

>Kwal_33.13530 s33 complement(268296..269900) [1605 bp, 534 aa] {ON}
           YNL249C (MPA43) - Overexpression leads to increased
           levels of the lyase PDC1 [contig 116] FULL
          Length = 534

 Score =  163 bits (412), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 149/526 (28%), Positives = 226/526 (42%), Gaps = 83/526 (15%)

Query: 36  IGVDVGTGSARACIID-SMGNILSLAERPIQREQLKPNFITQSSQEIWQAVCHCVKSVVR 94
           +G+D+G+   R    +      +++  R +   + +    TQSS EI +A+  C +S+  
Sbjct: 8   LGIDLGSTGVRVGAYNLETDEPIAVVSRTVNYYEQEKGRYTQSSAEIMRAIVECFESLNI 67

Query: 95  DSGVPSEKIHGIGFDATCSLVVVEEGSNK---EVAVGPDFQNTN-QNIILWMDHRAIEET 150
           D       +   G  ATCSL V    S K      V  D +  N QN++ WMD  AIEE 
Sbjct: 68  DIWA----VQSCGVAATCSLAVFIRNSTKGLQPFGVYEDLRPLNDQNVVFWMDSNAIEEC 123

Query: 151 EQINATGDKCLKYVGGQMSVEMEIPKI-KWLKNHLPNNKFDECKFFDLADYLTFKASGKE 209
             IN        Y GG    EM +PK+  +LK+   NN   + + FDL  Y+ +  + + 
Sbjct: 124 SNINDLAINEKAYFGGSFIPEMGVPKLASFLKSCSKNN--SDFEVFDLHTYVAYDLANRY 181

Query: 210 TRSFCSTVCKQGLLPVGVEGSKEGWSREFLTEIGLEDFIEDDFRKIGGSVKNSDKGKNFL 269
                  + +     +G +G  +GW  EF  +            K+  +V+         
Sbjct: 182 GWDASFLINRPNHNGIGHDGEIKGWKDEFYEKT----------LKLPPNVR--------- 222

Query: 270 SAGEFVGAIDPAVAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPALVKIDQEKVG 329
                   I P     +      V  +  ID Y+ W    ++  + S             
Sbjct: 223 --------IGPLC---INRRFSPVKVASCIDCYSSWFSMFSSTPERS------------- 258

Query: 330 MDRATGRLAAVAGTSTCHIAMSRDPI-FVDGVWGPYRDALAT----NFWCAEGGQSCTGA 384
                  L   AGTSTC++  +  P   + G+WGP+ D L +    ++   E GQS TG 
Sbjct: 259 -------LFMAAGTSTCYLYANNKPSECLPGIWGPFTDILDSKDPPSWSVYEAGQSTTGK 311

Query: 385 LLAHVMTTHPAYTELSQLADAASVSKFDYLNSRLET---LAQQQKSRSVVHLARHLFFYG 441
           L+ H+  +HPA      L D       + L +RLET   L +QQ + SV    +H+F YG
Sbjct: 312 LIEHLFESHPAAKPY--LEDR------NVLFNRLETEINLIEQQSAESVHFKTKHMFNYG 363

Query: 442 DYHGNRSPIADPSMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVEKMTTSGHDMA 501
           +  GNR+P  DP M    IG+S D S  DL L Y+   EF+A Q R I E +   G  + 
Sbjct: 364 ELQGNRTPYCDPEMSGMFIGESADTSFRDLTLKYVTVLEFLAFQVRHIKECL---GAPIN 420

Query: 502 AIFMSGGQCRNGLLMRLLADCT-GLPIVIP-RYIDAAVVFGSALLG 545
            I ++G Q +N  L+ L++    G  + IP    D   V G+ LLG
Sbjct: 421 DIRVAGSQAKNNRLLSLISFVNHGSRVRIPATRADYVGVQGAYLLG 466

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 26/31 (83%)

Query: 690 EDNPDRKLLDVKYKIFLDMAETQRKYRNLVN 720
           E+N  R L ++KYKI+L+MA+TQR+YR +VN
Sbjct: 500 EENKLRALFEIKYKIYLNMAQTQRQYREMVN 530

>ZYRO0F16016g Chr6 (1313995..1315623) [1629 bp, 542 aa] {ON} similar
           to uniprot|P53583 Saccharomyces cerevisiae YNL249C MPA43
           Mitochondrial protein
          Length = 542

 Score =  162 bits (410), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 128/477 (26%), Positives = 209/477 (43%), Gaps = 75/477 (15%)

Query: 36  IGVDVGTGSARACIIDSMGNIL---SLAERPIQREQLKPNF-ITQSSQEIWQAVCHCVKS 91
           IG+D+G+ S R  + +   + +    +   P        N+  TQSS+EI  A+  C + 
Sbjct: 10  IGIDLGSSSVRVSLFNFQNDQIIAYKIKTVPYYFTPESTNWKYTQSSREILTAIDQCFQE 69

Query: 92  VVRDSGVPSEKIHGIGFDATCSLVVVEEGSNKEVAVGPDFQNTNQNIILWMDHRAIEETE 151
           +     +   +I   G  ATCSL + +   N  +    D  + ++N++ WMD  AI+ET+
Sbjct: 70  L----NIDKHEIKSCGVGATCSLAIFQTKDNALIPWNLD--DPDKNVVFWMDSIAIKETQ 123

Query: 152 QINATGDKCLK-YVGGQMSVEMEIPKIKW----LKNHLPNNKFDECKFFDLADYLTFKAS 206
           ++N      ++ ++GG    EM +PK++     LKN   N+ F+     DL  Y+    +
Sbjct: 124 EVNKLATPEVQAHMGGSFVPEMAVPKLRHFIDILKNTDNNSTFE---IIDLHRYIAMSLA 180

Query: 207 GKETRSFCSTVCKQGLLPVGVEGSKEGWSREFLTEIGLEDFIEDDFRKIGGSVKNSDKGK 266
            +    + +      L  +G +G   GWS  F      E+ ++     + G  K+S    
Sbjct: 181 QQNGWDYTNVCNFPNLNEIGHDGELAGWSSAFY-----ENVLQLPPNIVIGPTKHSQHS- 234

Query: 267 NFLSAGEFVGAIDPAVAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPALVKIDQE 326
                                 S   +  S  ID Y+ W   + +    S          
Sbjct: 235 ----------------------SKQGLKVSSCIDCYSNWFALLPSNLQNS---------- 262

Query: 327 KVGMDRATGRLAAVAGTSTCHI-AMSRDPIFVDGVWGPYRDAL--ATNFWCAEGGQSCTG 383
                     L  V GTSTC++ A S     + GVWGP+ +    +  F   E GQSCTG
Sbjct: 263 ----------LFIVGGTSTCYLYASSEFSHHIPGVWGPFSNIFDRSDQFSIYEAGQSCTG 312

Query: 384 ALLAHVMTTHPAYTELSQLADAASVSKFDYLNSRLETLAQQQKSRSVVHL-ARHLFFYGD 442
            L+ H+  THPA + +    D   +  F  +N  +E +  +Q ++  +H+  +H+FFYGD
Sbjct: 313 KLIEHLFKTHPASSHIDT-RDWPHL--FSQINDFIEKV--EQNTQDSIHMQTKHMFFYGD 367

Query: 443 YHGNRSPIADPSMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVEKMTTSGHD 499
             GNR+P ADPSM    IG++ D S  +L   Y+   EFIA Q + ++    T   D
Sbjct: 368 LDGNRTPYADPSMSGMFIGETTDTSFRNLVYKYVSILEFIAFQIKHMLAIFNTLNGD 424

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 37/63 (58%), Gaps = 2/63 (3%)

Query: 660 MKGRSSDNGDAMWNVMYNMTGGGKVVQPCPEDNPDRKLLDVKYKIFLDMAETQRKYRNLV 719
           + G++S +  ++  V +N T   +   P   D    +LL+VKY+I+ +MAE QRKYR  V
Sbjct: 472 LMGKASTSDKSIVEVAHNQTYSYR--PPEKTDGLLVELLEVKYQIYFNMAEQQRKYRKQV 529

Query: 720 NEV 722
           N V
Sbjct: 530 NNV 532

>KNAG0F00660 Chr6 complement(114441..116048) [1608 bp, 535 aa] {ON}
           Anc_1.111 YNL249C
          Length = 535

 Score =  155 bits (392), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 151/531 (28%), Positives = 235/531 (44%), Gaps = 91/531 (17%)

Query: 36  IGVDVGTGSARACII----DSMGNILSLAERPIQREQLKPNF--ITQSSQEIWQAVCHCV 89
           IG+D+G+ S R  I     DS+  + S    P   E  + +    TQ S EI  A+  C 
Sbjct: 8   IGIDLGSSSVRVGIYSLHDDSLLGVFS-KPVPYYYESNRTSLWEYTQDSAEILTAIKECF 66

Query: 90  KSVVRDSGVPSEKIHGIGFDATCSLVVVEEGSNKEVAVGPDFQNT---NQNIILWMDHRA 146
                 + +    +   G  ATCSLV+ E   +        FQ+    ++N++ WMD  A
Sbjct: 67  DM----ADLQKYDVKSCGVAATCSLVLCERSGDDT------FQHCEGDSRNVVFWMDSMA 116

Query: 147 IEETEQINATGDK-CLKYVGGQMSVEMEIPKI-KWLKNHLPNNKFD-ECKFFDLADYLTF 203
            EET  +NA   +  L ++GG    EM IPK+ ++LK+     K + + + FDL  Y+ +
Sbjct: 117 KEETNSLNARCPQDILGHMGGGFIPEMGIPKLSRFLKSISDEPKGNIQWEVFDLHKYVAY 176

Query: 204 KASGKETRSFCSTVCKQGLLP----VGVEGSKEGWSREFLTEIGLEDFIEDDFRKIGGSV 259
           K +    + +C    +    P    +G +G   GWS+ F  +I                V
Sbjct: 177 KLA----QEYCWNTERLSNHPNSNGIGHDGELAGWSKSFYDKI----------------V 216

Query: 260 KNSDKGKNFLSAGEFVGAIDPAVAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPA 319
           +        L     +G   P   E     +  V+    ID Y+ W   + +        
Sbjct: 217 R--------LPPNVTIGC--PKTIEN---EDSLVIVDSCIDCYSSWFSPLQS-------- 255

Query: 320 LVKIDQEKVGMDRATGRLAAVAGTSTCHI---AMSRDPIFVDGVWGPYRDALATNFWCAE 376
                     +++ T  L  VAGTSTC+I      +    V G+WGP+ D L  N    E
Sbjct: 256 ----------LNKNT--LFLVAGTSTCYIYSPGTMKTETSVKGIWGPFTDILGANKVVYE 303

Query: 377 GGQSCTGALLAHVMTTHPAYTELSQLADAASVSKFDYLNSRLETLAQQQKSRSVVHLARH 436
            G SC+G L+ H+ T+HP+   L+ L+    +SK +   +  ET    Q + S+   A +
Sbjct: 304 SGSSCSGKLIEHLFTSHPSAISLN-LSTGQLISKLEEEINIWET----QNATSIHFEACN 358

Query: 437 LFFYGDYHGNRSPIADPSMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVEKMTTS 496
            F YGD  GNR+P  DP MR   IG+S D S  DL + Y+   E +A QT+ +V+     
Sbjct: 359 NFLYGDLDGNRTPFGDPYMRGMFIGESPDTSFRDLLVKYVCILECLAFQTKLMVDNFEKL 418

Query: 497 GHDMAAIFMSGGQCRNGLLMRL--LADCTGLPIVIPRYIDAAVVFGSALLG 545
            + +  +F+ G Q +N  L++L  L +   L +V     D   V G+ LLG
Sbjct: 419 -NSINELFICGSQAKNTRLLKLISLINDNALILVPKEKEDLMGVEGAYLLG 468

>KLLA0C02937g Chr3 complement(265205..266755) [1551 bp, 516 aa] {ON}
           similar to uniprot|P53583 Saccharomyces cerevisiae
           YNL249C MPA43 Mitochondrial protein of unknown function
           and similar to uniprot|Q04585 Saccharomyces cerevisiae
           YDR109C Hypothetical ORF
          Length = 516

 Score =  124 bits (311), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 125/500 (25%), Positives = 207/500 (41%), Gaps = 86/500 (17%)

Query: 36  IGVDVGTGSARACIIDSMGN-ILSLAERPIQREQLKPNFITQSSQEIWQAVCHCVKSVVR 94
           IGVD+G+   R  I D   + ++   +  +   +     ITQ + +I  AV     ++  
Sbjct: 6   IGVDLGSTEFRIGIFDYYTDSLVKETKEKVPYFRHGNGIITQCTSDILTAVEKAFNTLY- 64

Query: 95  DSGVPSEKIHGIGFDATCSLVVVEEGSNKEVAVGP-----DFQNTNQNIILWMDHRAIEE 149
              +    I  +G  ATCS+VV   G  K+  + P     D      +II WM   AIEE
Sbjct: 65  ---IQEYNICSLGVGATCSMVV---GKQKDENLIPFNLIHDKNGRYHDIIFWMHSAAIEE 118

Query: 150 TEQIN-ATGDKCLKYVGGQMSVEMEIPKIKWLKNHLPNNKFDECKFFDLADYLTFKASGK 208
           TE +N  T +  L + GG+   EM IPK+  L N L  +  D     DL  +L +K S K
Sbjct: 119 TEYLNNITDESILCHFGGKFFPEMAIPKLLHL-NKLYKD--DGLTVLDLHIWLLWKISLK 175

Query: 209 ETRSFCSTVCKQGLLPVGVEGSKEGWSREFLTEIGLEDFIEDDFRKIGGSVKNSDKGKNF 268
                   V +     +G +G   GWS+EF   + L       F      +K +++    
Sbjct: 176 LGHKELMPVQEPNSNGIGHDGELFGWSKEFYEHLQLNKI----FIGNNAVIKKNEQ---- 227

Query: 269 LSAGEFVGAIDPAVAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPALVKIDQEKV 328
                                     G   ID YA W    +                  
Sbjct: 228 -------------------------FGDSCIDCYASWFQCWSTAM--------------- 247

Query: 329 GMDRATGRLAAVAGTSTCHIAMSR-DPIFVDGVWGPYRDALAT--------NFWCAEGGQ 379
            ++R    L  VAGTSTC +  S     F+ G+WGP++D L          N+   E G 
Sbjct: 248 -LNRT---LFVVAGTSTCFLYASDCFESFIPGIWGPFKDILVNRKHISKHDNYSVYEAGI 303

Query: 380 SCTGALLAHVMTTHPAYTELSQLADAASVSKFDYLNSRLETLAQQQKSRSVVHLARHLFF 439
           S TG LL  +++THPA  +       + V+  + +  +++ L +Q  ++S+  + ++ FF
Sbjct: 304 SRTGVLLEKLLSTHPAVKD-------SDVNFLETVEHKID-LIEQSDTQSIHLMIKNTFF 355

Query: 440 YGDYHGNRSPIADPSMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVEKMTTSGHD 499
           + DY    S         +I+ +  + ++ DLAL Y+   E +A Q   ++         
Sbjct: 356 HEDYEEFESSFVQKDTSGSILKEGYNPTLKDLALKYVVIIETLAFQIVDVINAFEEGHIT 415

Query: 500 MAAIFMSGGQCRNGLLMRLL 519
           ++ + ++G Q +N  L+++L
Sbjct: 416 ISKLLITGSQAKNSRLLQIL 435

>NCAS0A00780 Chr1 complement(152317..153966) [1650 bp, 549 aa] {ON}
           Anc_1.111 YNL249C
          Length = 549

 Score = 68.9 bits (167), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 115/526 (21%), Positives = 196/526 (37%), Gaps = 109/526 (20%)

Query: 36  IGVDVGTGSARACIIDSMGNILSLAERPIQREQLKPNFITQSSQEIWQAVCHCVKSVVRD 95
           IG+DVG+ S R  I +          + I +E L  +   +   ++W    +    V+RD
Sbjct: 5   IGIDVGSTSVRIGIFNYEDGT---TIKTIVKEMLYKH---EPDSKLWHYTQNAF--VMRD 56

Query: 96  S--------GVPSEKIHGIGFDATCSLVVVEEGSN----KEVAVGPDFQNTNQNIILWMD 143
           S         V S  +   G  ATCS+V ++  S     + + +  +  N   +II W D
Sbjct: 57  SIFTALEELHVNSYIVKICGVSATCSMVFLQRDSPADHLRPLTIIHEETNNTDSIIFWKD 116

Query: 144 HRAIEETEQIN-----------ATGDKCLKYVGGQMSV--EMEIPKIKWLKNHLPNNKFD 190
           H A  E +++N              +K L  +G +     EM IPK+  L N +    ++
Sbjct: 117 HTAQPEAQRLNNKLRTANEGLSGKENKILSTLGSRSGFIGEMAIPKLSRLINLIKEGFYE 176

Query: 191 ECKFFDLADYLTFKASGKETRSFCSTVCKQ---GLLPVGVEGSKEGWSREFLTEIGLEDF 247
                ++ D   + A     +   +TV  Q    +  +G++G  +GW   F         
Sbjct: 177 TPHILEVYDLHVYIAQTLAQKYDWNTVHLQNKPNVNGIGIDGELQGWDLSFYVWA----- 231

Query: 248 IEDDFRKIGGSVKNSDKGKNFLSAGEFVGAIDPA-VAEELGLSNHCVVGSGVIDAYAGWV 306
                                L    F   I P+ V  E  +    V     ID YA W 
Sbjct: 232 ---------------------LPETSFPICIGPSKVINETSI----VRPKSCIDCYASWF 266

Query: 307 GTVAARTDVSIPALVKIDQEKVGMDRATGRLAAVAGTSTCHI-AMSRDPIFVDG------ 359
            T A   D                      L   AGTSTC + AM R  +   G      
Sbjct: 267 STDACTKD--------------------DTLFMAAGTSTCCLYAMPRSALEYFGEQQQPL 306

Query: 360 --VWGPYRDALATNFWCA-EGGQSCTGALLAHVMTTHPAYTELSQLADAASVSK-FDYLN 415
              WGP+ + L  +   + E G S TG LL  +   H       Q+  + SV++  +Y+ 
Sbjct: 307 SLFWGPFTNVLDKDKKSSFEIGFSETGILLEKLFNKH-------QITASWSVAESINYVE 359

Query: 416 SRLETLAQQQKSRSVVHLARHLFFYGDYHGNRSPIA--DPSMRAAIIGQSMDNSIDDLAL 473
           +++  + +++KS S ++L   ++ +  Y     P     P          + +S   L  
Sbjct: 360 NQI-AIYERKKSHS-IYLEPEIYLFLKYLTLNKPSGRDTPDTPDLFGNDGVTDSTLGLIF 417

Query: 474 MYLGACEFIAQQTRQIVEKMTTSGHDMAAIFMSGGQCRNGLLMRLL 519
            Y+   E++A Q   ++ +       +  + +SG Q +N  L+ L+
Sbjct: 418 KYIAILEYLAYQVSNLILQFQKEKIIINHLVLSGSQAQNKRLLDLI 463

>NCAS0C05900 Chr3 (1214812..1216923) [2112 bp, 703 aa] {ON} Anc_4.9
           YHL032C
          Length = 703

 Score = 37.0 bits (84), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 57/122 (46%), Gaps = 15/122 (12%)

Query: 437 LFFYGDYHGNRSPIADPSMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVEKMTT- 495
           + F   ++G  +P  DP  RA I+G S   +   +A     A E +  Q R I++ M + 
Sbjct: 503 VVFVPAFNGLFAPYWDPDTRATIMGISQSTTASHIA---RAAIEGVCFQVRAILKAMGSD 559

Query: 496 --------SGHDMAAIFMSGGQCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAV 547
                      ++A + + GG  ++  +M++ AD  G  I + R   + +V  +AL  A+
Sbjct: 560 EVYGDSAYEKKNLATLAVDGGMSKSNEVMQIQADILGPCIKLRR---SPIVECTALGAAI 616

Query: 548 AS 549
           A+
Sbjct: 617 AA 618

>NDAI0H00220 Chr8 complement(30959..33391) [2433 bp, 810 aa] {ON}
           Anc_4.9 YHL032C
          Length = 810

 Score = 35.0 bits (79), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 31/120 (25%), Positives = 57/120 (47%), Gaps = 13/120 (10%)

Query: 437 LFFYGDYHGNRSPIADPSMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVEKMT-- 494
           + F   ++G  +P  DP  RA I+G S   +   +A     A E +  Q R I++ M+  
Sbjct: 610 VVFVPAFNGLFAPYWDPDTRATIMGISQSTTASHIA---RAAIEGVCFQVRAILKAMSGD 666

Query: 495 --TSGHDMAAIF---MSGGQCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVAS 549
               G++   +    + GG  ++  +M++ AD  G  I + R   + +V  +AL  A+A+
Sbjct: 667 KIEDGYEKGTVVTLSVDGGMSKSDEVMQIQADILGPCIKLRR---SPIVECTALGAAIAA 723

>SAKL0A01254g Chr1 (119884..124560) [4677 bp, 1558 aa] {ON} similar to
            uniprot|P53599 Saccharomyces cerevisiae YNR031C SSK2
            Suppressor of Sensor Kinase (SLN1) A MAP kinase kinase
            kinase activator of Pbs2p
          Length = 1558

 Score = 33.5 bits (75), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 47/96 (48%), Gaps = 9/96 (9%)

Query: 500  MAAIFMSGGQCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFDLSGTTS 559
            +A +  SG   R+     +L D  G    I +Y+D    FG+A L A  S   ++  T+S
Sbjct: 1374 LAYLHQSGVVHRDIKPENILLDFNG----IIKYVD----FGAAKLLAKNSTKGNIDATSS 1425

Query: 560  ELSVSRKSSIAGHPTDGSQPKKSAVSKLGQFGSDDL 595
            E    R +++ G P   S P+    +  G+FGSDD+
Sbjct: 1426 EAKQDRINTMMGTPMYMS-PESITGTIKGKFGSDDI 1460

>KNAG0B03790 Chr2 complement(726484..728709) [2226 bp, 741 aa] {ON}
           Anc_5.509 YOR156C
          Length = 741

 Score = 32.3 bits (72), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 41/88 (46%), Gaps = 8/88 (9%)

Query: 72  NFITQSSQEIWQAVCHC---VKSVVRDSGVPSEKIHGIGFDATCSLVVVEEGSNKEVAVG 128
           + +  SS+E+ Q         K ++ +   PSE  +G G + T SLV  E G+  +    
Sbjct: 401 DILKNSSEEVEQVELSADGSWKPILEEEPAPSEAQNGKG-EGTGSLVKTEGGNQTKSIPL 459

Query: 129 PDFQNTNQNIILWMD----HRAIEETEQ 152
           P   NTN N+++ +D        E TEQ
Sbjct: 460 PATSNTNDNMVISLDSDGEESGTEPTEQ 487

>Smik_13.514 Chr13 (844554..846152) [1599 bp, 532 aa] {ON} YMR297W
           (REAL)
          Length = 532

 Score = 31.6 bits (70), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 43/91 (47%), Gaps = 8/91 (8%)

Query: 232 EGWSREFLTEIGLEDFIEDDFRK--IGGSVK-----NSDKGKNFLSAGEFVGAIDPAVAE 284
           EG +  + T   ++D++  D+ K  +G  V      N D  +NFL AG+++     AV +
Sbjct: 374 EGGNLCYPTLQDIDDYLNQDYVKEAVGAEVDHYESCNFDINRNFLFAGDWMKPYHTAVTD 433

Query: 285 ELGLSNHCVVGSGVIDAYAGWVGTVAARTDV 315
            L      +V +G  D    W+G   A TDV
Sbjct: 434 LLNQDLPILVYAGDKDFICNWLGN-KAWTDV 463

>YMR297W Chr13 (861922..863520) [1599 bp, 532 aa] {ON}  PRC1Vacuolar
           carboxypeptidase Y (proteinase C; CPY),
           broad-specificity C-terminal exopeptidase involved in
           non-specific protein degradation in the vacuole; member
           of the serine carboxypeptidase family
          Length = 532

 Score = 31.6 bits (70), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 43/91 (47%), Gaps = 8/91 (8%)

Query: 232 EGWSREFLTEIGLEDFIEDDFRK--IGGSVK-----NSDKGKNFLSAGEFVGAIDPAVAE 284
           EG +  + T   ++D++  D+ K  +G  V      N D  +NFL AG+++     AV +
Sbjct: 374 EGGNLCYPTLQDIDDYLNQDYVKEAVGAEVDHYESCNFDINRNFLFAGDWMKPYHTAVTD 433

Query: 285 ELGLSNHCVVGSGVIDAYAGWVGTVAARTDV 315
            L      +V +G  D    W+G   A TDV
Sbjct: 434 LLNQDLPILVYAGDKDFICNWLGN-KAWTDV 463

>Suva_13.487 Chr13 (843662..845260) [1599 bp, 532 aa] {ON} YMR297W
           (REAL)
          Length = 532

 Score = 31.2 bits (69), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 38/79 (48%), Gaps = 8/79 (10%)

Query: 244 LEDFIEDDFRK--IGGSVK-----NSDKGKNFLSAGEFVGAIDPAVAEELGLSNHCVVGS 296
           ++D++  D+ K  +G  V      N D  +NFL AG+++     AV + L      +V +
Sbjct: 386 IDDYLNQDYVKEAVGAEVDHYESCNFDINRNFLFAGDWMKPYHTAVTDLLNQDLPILVYA 445

Query: 297 GVIDAYAGWVGTVAARTDV 315
           G  D    W+G   A TDV
Sbjct: 446 GDKDFICNWLGN-RAWTDV 463

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.133    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 71,574,302
Number of extensions: 3012217
Number of successful extensions: 7489
Number of sequences better than 10.0: 40
Number of HSP's gapped: 7615
Number of HSP's successfully gapped: 73
Length of query: 725
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 608
Effective length of database: 40,065,477
Effective search space: 24359810016
Effective search space used: 24359810016
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)