Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_56.23599na 1ON64864833190.0
KLTH0G13816gna 1ON65566315140.0
Ecym_4314na 2ON9302434859e-51
AGR094Wna 1ON1381344074e-46
SAKL0H17182gna 1ON6851603993e-40
KLLA0F18997gna 1ON4001353513e-35
AGR093Wna 2ON6131941941e-14
Kwal_23.55935.277ON3501121581e-10
KLTH0G06908g5.277ON3611691572e-10
AER235C5.277ON3241091534e-10
Ecym_73645.277ON3301091482e-09
TDEL0E034905.277ON3451091357e-08
SAKL0G10912g5.277ON3371091358e-08
NDAI0D015805.277ON299961294e-07
NCAS0A066405.277ON2701401187e-06
KLLA0F21824g5.277ON2761001081e-04
KAFR0D050205.277ON25787930.008
Smik_12.1na 3ON32474770.85
ZYRO0G14960g6.148ON83165752.2
Skud_12.4na 3ON32574732.7
Ecym_22882.612ON26646705.0
TDEL0C009608.68ON122274716.4
TBLA0B00430singletonON35038697.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_56.23599
         (648 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_56.23599 s56 complement(615840..617786) [1947 bp, 648 aa] {...  1283   0.0  
KLTH0G13816g Chr7 (1194256..1196223) [1968 bp, 655 aa] {ON} cons...   587   0.0  
Ecym_4314 Chr4 (675795..678587) [2793 bp, 930 aa] {ON} similar t...   191   9e-51
AGR094W Chr7 (913067..913483) [417 bp, 138 aa] {ON} NOHBY739; No...   161   4e-46
SAKL0H17182g Chr8 (1520135..1522192) [2058 bp, 685 aa] {ON} some...   158   3e-40
KLLA0F18997g Chr6 complement(1747295..1748497) [1203 bp, 400 aa]...   139   3e-35
AGR093W Chr7 (911047..912888) [1842 bp, 613 aa] {ON} NOHBY738; N...    79   1e-14
Kwal_23.5593 s23 complement(1230110..1231162) [1053 bp, 350 aa] ...    65   1e-10
KLTH0G06908g Chr7 (550439..551524) [1086 bp, 361 aa] {ON} conser...    65   2e-10
AER235C Chr5 complement(1073608..1074582) [975 bp, 324 aa] {ON} ...    64   4e-10
Ecym_7364 Chr7 complement(760757..761749) [993 bp, 330 aa] {ON} ...    62   2e-09
TDEL0E03490 Chr5 (652306..653343) [1038 bp, 345 aa] {ON} Anc_5.277     57   7e-08
SAKL0G10912g Chr7 (922534..923547) [1014 bp, 337 aa] {ON} conser...    57   8e-08
NDAI0D01580 Chr4 (377632..378531) [900 bp, 299 aa] {ON} Anc_5.277      54   4e-07
NCAS0A06640 Chr1 (1311768..1312580) [813 bp, 270 aa] {ON} Anc_5....    50   7e-06
KLLA0F21824g Chr6 complement(2031719..2032549) [831 bp, 276 aa] ...    46   1e-04
KAFR0D05020 Chr4 (987269..988042) [774 bp, 257 aa] {ON} Anc_5.277      40   0.008
Smik_12.1 Chr12 complement(885..1859) [975 bp, 324 aa] {ON} YLL0...    34   0.85 
ZYRO0G14960g Chr7 (1201495..1203990) [2496 bp, 831 aa] {ON} simi...    33   2.2  
Skud_12.4 Chr12 complement(4676..5653) [978 bp, 325 aa] {ON} YLL...    33   2.7  
Ecym_2288 Chr2 complement(561508..562308) [801 bp, 266 aa] {ON} ...    32   5.0  
TDEL0C00960 Chr3 (153572..157240) [3669 bp, 1222 aa] {ON} Anc_8....    32   6.4  
TBLA0B00430 Chr2 (81867..82919) [1053 bp, 350 aa] {ON}                 31   7.6  

>Kwal_56.23599 s56 complement(615840..617786) [1947 bp, 648 aa] {ON}
           [contig 176] FULL
          Length = 648

 Score = 1283 bits (3319), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 621/648 (95%), Positives = 621/648 (95%)

Query: 1   MEEDVQAKKIVQHISPLPMELEPDNEGLQSVVEEAARQTEGGPLAVPSSMRQHNQAQHVE 60
           MEEDVQAKKIVQHISPLPMELEPDNEGLQSVVEEAARQTEGGPLAVPSSMRQHNQAQHVE
Sbjct: 1   MEEDVQAKKIVQHISPLPMELEPDNEGLQSVVEEAARQTEGGPLAVPSSMRQHNQAQHVE 60

Query: 61  STLFVLQDVLWNLLVHFRNHGTLQASYEMAKHRCEGHYPSILSVECIFKVLMDYPAELLS 120
           STLFVLQDVLWNLLVHFRNHGTLQASYEMAKHRCEGHYPSILSVECIFKVLMDYPAELLS
Sbjct: 61  STLFVLQDVLWNLLVHFRNHGTLQASYEMAKHRCEGHYPSILSVECIFKVLMDYPAELLS 120

Query: 121 AIYVPMILRFFKWSFSVQQHSQELKWSRAIITTKRGMAFLVANFHEFSYNAATXXXXXXX 180
           AIYVPMILRFFKWSFSVQQHSQELKWSRAIITTKRGMAFLVANFHEFSYNAAT       
Sbjct: 121 AIYVPMILRFFKWSFSVQQHSQELKWSRAIITTKRGMAFLVANFHEFSYNAATLYQASQS 180

Query: 181 XXXXXXXEMALLPQKPVLGDDSEDEEAMDPTWTPLNSEQLESLIKSLTKDASTLPQVESA 240
                  EMALLPQKPVLGDDSEDEEAMDPTWTPLNSEQLESLIKSLTKDASTLPQVESA
Sbjct: 181 LKLLQSLEMALLPQKPVLGDDSEDEEAMDPTWTPLNSEQLESLIKSLTKDASTLPQVESA 240

Query: 241 PVLPEIAPASISEFLPFTRPSQSPPMNMSYVTALQHQPTVYGVQQVPIPSAFSDLPEPFT 300
           PVLPEIAPASISEFLPFTRPSQSPPMNMSYVTALQHQPTVYGVQQVPIPSAFSDLPEPFT
Sbjct: 241 PVLPEIAPASISEFLPFTRPSQSPPMNMSYVTALQHQPTVYGVQQVPIPSAFSDLPEPFT 300

Query: 301 TLPSGHSNESLSHQSSDKLFSQTFPNIFHRINALEVANERLTQDNDALFKDMEKLKSQLQ 360
           TLPSGHSNESLSHQSSDKLFSQTFPNIFHRINALEVANERLTQDNDALFKDMEKLKSQLQ
Sbjct: 301 TLPSGHSNESLSHQSSDKLFSQTFPNIFHRINALEVANERLTQDNDALFKDMEKLKSQLQ 360

Query: 361 NLEKSVENTSLQRQNVTSPKVVHTGFXXXXXXXXXXXXXYPMETSDLAISGVKLEGDLSS 420
           NLEKSVENTSLQRQNVTSPKVVHTGF             YPMETSDLAISGVKLEGDLSS
Sbjct: 361 NLEKSVENTSLQRQNVTSPKVVHTGFPSSASANVVVPSSYPMETSDLAISGVKLEGDLSS 420

Query: 421 QPVNQAQQLATGYESLMPFNPGTSEFIPDTRLRGAGQFIHGETMSTISSRGDSIASTSPV 480
           QPVNQAQQLATGYESLMPFNPGTSEFIPDTRLRGAGQFIHGETMSTISSRGDSIASTSPV
Sbjct: 421 QPVNQAQQLATGYESLMPFNPGTSEFIPDTRLRGAGQFIHGETMSTISSRGDSIASTSPV 480

Query: 481 GLLATSDFHSPAKKPKPVSYNYEGAKLTKGETYHPPQAPDGKRYLLDEEGKLAIVMAPVQ 540
           GLLATSDFHSPAKKPKPVSYNYEGAKLTKGETYHPPQAPDGKRYLLDEEGKLAIVMAPVQ
Sbjct: 481 GLLATSDFHSPAKKPKPVSYNYEGAKLTKGETYHPPQAPDGKRYLLDEEGKLAIVMAPVQ 540

Query: 541 SSVYGVYNEYYQSLRPQVDAYAEDYGKKSIGHFRKKRTFQKKKAFVQWVERLSDLNGIPP 600
           SSVYGVYNEYYQSLRPQVDAYAEDYGKKSIGHFRKKRTFQKKKAFVQWVERLSDLNGIPP
Sbjct: 541 SSVYGVYNEYYQSLRPQVDAYAEDYGKKSIGHFRKKRTFQKKKAFVQWVERLSDLNGIPP 600

Query: 601 ELVLDMIDDVRVREKKSVVWACNNLGSCRTALGHYNPELKDRGLSDVE 648
           ELVLDMIDDVRVREKKSVVWACNNLGSCRTALGHYNPELKDRGLSDVE
Sbjct: 601 ELVLDMIDDVRVREKKSVVWACNNLGSCRTALGHYNPELKDRGLSDVE 648

>KLTH0G13816g Chr7 (1194256..1196223) [1968 bp, 655 aa] {ON}
           conserved hypothetical protein
          Length = 655

 Score =  587 bits (1514), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/663 (48%), Positives = 417/663 (62%), Gaps = 23/663 (3%)

Query: 1   MEEDVQAKKIVQHISPLPMELEPDNEGLQSVVEEAARQTE--GGP----LAVPSSMRQHN 54
           MEE+ Q ++  Q  SPL   LE    G  +   E    T+  G P    L+     R+ +
Sbjct: 1   MEEEPQTRRAAQRASPLVGALE---RGYTTSGAEGHPVTDPSGAPSGQSLSDSPGTRRSS 57

Query: 55  QA----QHVESTLFVLQDVLWNLLVHFRNHGTLQASYEMAKHRCEGHYPSILSVECIFKV 110
           QA      V+STL +LQDVLWN+LVH R HGT ++ Y +AK R E HY S++SVECIFK 
Sbjct: 58  QAAELTNSVDSTLNLLQDVLWNVLVHIRGHGTFESCYSLAKRRYEAHYQSLVSVECIFKT 117

Query: 111 LMDYPAELLSAIYVPMILRFFKWSFSVQQHSQELKWSRAIITTKRGMAFLVANFHEFSYN 170
           L +YPAE+LSA+Y+P+ILRFFKW  SV+Q   E K SR +ITTK+G+ FL+ N  E SYN
Sbjct: 118 LANYPAEILSAMYIPVILRFFKWCSSVRQLPPEFKGSRFLITTKKGITFLMTNLSECSYN 177

Query: 171 AATXXXXXXXXXXXXXXEMALLPQKPVLGDDSEDEEAMDPTWTPLNSEQLESLIKSLTKD 230
           AAT              E+AL PQKP L  D EDEEA DP W PL+  QLE LI S+TK 
Sbjct: 178 AATLYQAFRALKLLQSLEIALFPQKPALYHDPEDEEADDPNWKPLDDSQLEVLISSVTKG 237

Query: 231 ASTLPQVESAPVLPEIAPASISEFLPFTRPSQSP--PMNMSYVTALQHQPTVYGVQQVPI 288
              +    SAP  PE   A + E    +   QSP  P           Q   YG  Q P 
Sbjct: 238 DFRI--GASAPPQPEPTNAGMFEGSALSHAGQSPNPPAPFPVTQQPPQQAAFYGAAQQPP 295

Query: 289 PSAFSDLP-EPFTTLPSGHSNESLSHQSSDKLFSQTFPNIFHRINALEVANERLTQDNDA 347
                 +P +P+  L SGH N++  +Q+ + LFS T P+IFHR+NALE AN+ L+++ND+
Sbjct: 296 FGGLVPMPQDPYAPLFSGHGNDNFMYQNPEMLFSHTIPSIFHRMNALEAANQELSRENDS 355

Query: 348 LFKDMEKLKSQLQNLEKSVENTSLQRQNVTSPKVVHTGFXXXXXXXXXXXXXYPMETSDL 407
           L + +  LKS+LQ+ +++V+      Q +TSP+  H+ +               ++TSD+
Sbjct: 356 LSQSLNDLKSELQSFKRNVDTAIPGVQILTSPRATHSRYPSPTPPNIILSSSNAIDTSDI 415

Query: 408 AISGVKLEGDLSSQPVNQAQQLATGYESLMPFN--PGTSEFIPDTRLRGAGQFIHGETMS 465
           A S  KL+ DL +    Q + L + YE+++P+   PG   +IPD  L+   +    + + 
Sbjct: 416 AASVQKLDTDLCNSSATQTRSLISNYENMVPYGAAPG---YIPDAELKSLERLKQEDALV 472

Query: 466 TISSRGDSIASTSPVGLLATSDFHSPAKKPKPVSYNYEGAKLTKGETYHPPQAPDGKRYL 525
           ++S  G SI + S    L T++  SPAK+PK  +   EGAKL+KGETY PPQAP+GK YL
Sbjct: 473 SLSGTGGSIVTPSSGIFLTTAELQSPAKRPKHRNRRIEGAKLSKGETYQPPQAPNGKNYL 532

Query: 526 LDEEGKLAIVMAPVQSSVYGVYNEYYQSLRPQVDAYAEDYGKKSIGHFRKKRTFQKKKAF 585
           LD EG+LAIVMA  QSSVYGVYNEYYQSLRPQVD+YA+D+GKKS+GHFRKKRTFQKKKAF
Sbjct: 533 LDNEGRLAIVMATEQSSVYGVYNEYYQSLRPQVDSYADDFGKKSMGHFRKKRTFQKKKAF 592

Query: 586 VQWVERLSDLNGIPPELVLDMIDDVRVREKKSVVWACNNLGSCRTALGHYNPELKDRGLS 645
           VQWVER+S LN +PPELVLD++D+VR++EKKSVVWACNNLG  R  L  Y P+LKD  LS
Sbjct: 593 VQWVERISQLNNMPPELVLDIVDEVRLKEKKSVVWACNNLGRFRLVLNRYKPDLKDTALS 652

Query: 646 DVE 648
           DVE
Sbjct: 653 DVE 655

>Ecym_4314 Chr4 (675795..678587) [2793 bp, 930 aa] {ON} similar to
           Ashbya gossypii AGR093W +AGR094W
          Length = 930

 Score =  191 bits (485), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 109/243 (44%), Positives = 148/243 (60%), Gaps = 20/243 (8%)

Query: 418 LSSQPVNQAQQLATGYESLMPFN--PGTSEFIPDTRLRGA----GQFIHGETMSTI--SS 469
           LS  P+  A   AT Y +++P +  P  +  IP  R R A           T STI  S+
Sbjct: 682 LSYHPITFADS-ATSYSNILPRSMPPSGTVSIPLKRGRMATLMSSALPQDSTSSTICYSN 740

Query: 470 RGDSIASTSPVGLLATSDFHSPAK--------KPKPVSYNYE---GAKLTKGETYHPPQA 518
              +I + +  G L +S+  S           K K +   Y+   G+KL+KG  Y PP  
Sbjct: 741 STSNIHNNAKEGQLVSSEVASNTNNLSSSTEHKLKKLRSRYKESSGSKLSKGVQYQPPLT 800

Query: 519 PDGKRYLLDEEGKLAIVMAPVQSSVYGVYNEYYQSLRPQVDAYAEDYGKKSIGHFRKKRT 578
            +GKRY+L E+GK +IVM+  Q S+Y +YNE+YQSL+ QVD++ +DYGK  +  FRKKRT
Sbjct: 801 SEGKRYMLGEDGKFSIVMSSDQDSIYSIYNEFYQSLKLQVDSFVQDYGKSKLTQFRKKRT 860

Query: 579 FQKKKAFVQWVERLSDLNGIPPELVLDMIDDVRVREKKSVVWACNNLGSCRTALGHYNPE 638
           FQKKKAFV  VE++S  + +PPE VLD++DDVR++E KSVVW CNNLGS + AL  Y P+
Sbjct: 861 FQKKKAFVYLVEKISYFSKLPPEQVLDIVDDVRIKEGKSVVWVCNNLGSLKYALVKYRPK 920

Query: 639 LKD 641
           LKD
Sbjct: 921 LKD 923

 Score = 86.3 bits (212), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 48/169 (28%), Positives = 84/169 (49%), Gaps = 5/169 (2%)

Query: 63  LFVLQDVLWNLLVHFRNHGTLQASYEMAKHRCEGHYPS----ILSVECIFKVLMDYPAEL 118
           L+    +L N+L+  RNH  L   Y + K +C  +        + V+ +FK+LM    EL
Sbjct: 12  LYCYHQMLSNMLMRIRNHEDLYQFYTVTKEQCLSYAQDGNNVCIDVDALFKLLMSSTPEL 71

Query: 119 LSAIYVPMILRFFKWSFSVQQHSQELKWSRAIITTKRGMAFLVANFHEFSYNAATXXXXX 178
           L+ + +P +LRF +WS      S ++K +R+IIT  R + FL  + H F +++ T     
Sbjct: 72  LNLVSLPAMLRFIEWSRQTPSISSDVKKARSIITPTRCLNFLKNDVHAFKHSSETCKGIL 131

Query: 179 XXXXXXXXXEMALLPQKPVLGDDSEDEEAMDPTWTPLNSEQLESLIKSL 227
                    +M +  +KP+L +D+ D ++    W PL++      + SL
Sbjct: 132 GALKLLQKLQMIMFAEKPML-NDTNDPDSESVVWKPLDTAIAIQFLNSL 179

 Score = 37.4 bits (85), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 33/64 (51%)

Query: 319 LFSQTFPNIFHRINALEVANERLTQDNDALFKDMEKLKSQLQNLEKSVENTSLQRQNVTS 378
           LF Q  P I  R++ L V N +L Q +  L + +  L+  + +L+K+V + SL     T 
Sbjct: 513 LFQQGIPEINQRLHHLTVQNNKLKQQDTILMQQINNLRQIVTSLQKTVTSISLTNSVSTK 572

Query: 379 PKVV 382
            KV 
Sbjct: 573 GKVT 576

>AGR094W Chr7 (913067..913483) [417 bp, 138 aa] {ON} NOHBY739; No
           homolog in Saccharomyces cerevisiae
          Length = 138

 Score =  161 bits (407), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 73/134 (54%), Positives = 100/134 (74%)

Query: 513 YHPPQAPDGKRYLLDEEGKLAIVMAPVQSSVYGVYNEYYQSLRPQVDAYAEDYGKKSIGH 572
           Y PP   DGK YL+D+EGK +I+M+  Q S+Y +YNE+YQSL+ QV+A+ +D+GK  +  
Sbjct: 3   YQPPLTADGKNYLVDDEGKFSIIMSNDQDSIYSIYNEFYQSLKLQVEAFVQDFGKSKLVQ 62

Query: 573 FRKKRTFQKKKAFVQWVERLSDLNGIPPELVLDMIDDVRVREKKSVVWACNNLGSCRTAL 632
           FRKKRTFQKKKAFV  VE+++    + PE VLD+ D+VR++E+KSVVW CNNLG+ + AL
Sbjct: 63  FRKKRTFQKKKAFVYLVEKIAYFTKLSPEQVLDIADNVRLKEEKSVVWVCNNLGALKCAL 122

Query: 633 GHYNPELKDRGLSD 646
             Y P+L D  +SD
Sbjct: 123 VKYRPDLHDIIMSD 136

>SAKL0H17182g Chr8 (1520135..1522192) [2058 bp, 685 aa] {ON} some
           similarities with uniprot|Q74ZV5 Ashbya gossypii AGR094W
           AGR094Wp
          Length = 685

 Score =  158 bits (399), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 80/160 (50%), Positives = 117/160 (73%)

Query: 489 HSPAKKPKPVSYNYEGAKLTKGETYHPPQAPDGKRYLLDEEGKLAIVMAPVQSSVYGVYN 548
           ++ +KK +P   +  G++L+KG+TYHPP +  GK YL+DE+G+LAIVM+  Q S+Y +YN
Sbjct: 526 YTESKKARPKYKDTPGSQLSKGKTYHPPVSITGKNYLVDEDGRLAIVMSNDQDSIYSIYN 585

Query: 549 EYYQSLRPQVDAYAEDYGKKSIGHFRKKRTFQKKKAFVQWVERLSDLNGIPPELVLDMID 608
           E+YQSL+PQV+++ +D+GK  +  F+KKRTFQKKKAFV   E+++ +  +P E VL +ID
Sbjct: 586 EFYQSLKPQVESFVKDFGKSRLVQFKKKRTFQKKKAFVYLAEKIAYMQNMPVETVLGIID 645

Query: 609 DVRVREKKSVVWACNNLGSCRTALGHYNPELKDRGLSDVE 648
            +R RE+KSVVWACNNL   +  L  + P+L+D   SD E
Sbjct: 646 QIRHREEKSVVWACNNLNLLKDMLVKHRPDLRDTVFSDTE 685

 Score =  125 bits (314), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 92/347 (26%), Positives = 163/347 (46%), Gaps = 47/347 (13%)

Query: 48  SSMRQHNQAQHVESTLFVLQDVLWNLLVHFRNHGTLQASYEMAKHRCEGHY--PSILSVE 105
           SS   +N    V+S L++L+D+L ++L   RN   L   Y  A+ +C  +   P  +SV+
Sbjct: 41  SSEESNNGDGQVDSALWLLRDILQSVLTKIRNQKNLYQFYTTAREQCLSYSQSPGHVSVD 100

Query: 106 --CIFKVLMDYPAELLSAIYVPMILRFFKWSFSVQQHSQELKWSRAIITTKRGMAFLVAN 163
              IFK LM YP E+LSAIY+P+ +RF  W+ +  +   +    R I+T+KR + FL  +
Sbjct: 101 PDSIFKNLMAYPTEVLSAIYIPVTIRFLDWANATHRIPAQCTSGRGIVTSKRCLGFLKDD 160

Query: 164 FHEFSYNAATXXXXXXXXXXXXXXEMALLPQKPVLGDDSEDEEAMDPTWTPLNSEQLESL 223
            +  S+ + T              +M + P+KPV  +D  D++A++  W PL S ++   
Sbjct: 161 SNVLSHTSGTAQRIVEGLKLLQRLQMIIFPEKPVFYNDPGDDQALNSVWQPLESREVYEF 220

Query: 224 IKSLTKDASTLPQV-----------------ESAPVLPEIAPASISEFLPFTRPSQS--- 263
           ++SL+   + L                        + P++AP+  +  LP   P  S   
Sbjct: 221 LESLSSHRNELEMSPTSPSSTTSMNPRSSISRRGNLYPQLAPSPHATSLPPNVPMPSLAF 280

Query: 264 PPMNMSYVTALQHQPTVYGVQQVPIPSAFSDLPEPFTTLPSGHSNESLSHQSSDK----L 319
            P++ S +T  +                 +DL  P  T P   S ++L++   D     +
Sbjct: 281 EPLHPSSITDQRD----------------ADLLNPHVTFP---SQQTLTNSDLDMKLAPI 321

Query: 320 FSQTFPNIFHRINALEVANERLTQDNDALFKDMEKLKSQLQNLEKSV 366
           F+Q  P++  R++ L + N+ L + N  L +++  L+SQ+  L+  V
Sbjct: 322 FNQIIPDMEQRLHYLALENKSLREQNMVLLQNVSSLESQIAQLQNFV 368

>KLLA0F18997g Chr6 complement(1747295..1748497) [1203 bp, 400 aa]
           {ON} some similarities with uniprot|Q74ZV5 Ashbya
           gossypii AGR094W AGR094Wp
          Length = 400

 Score =  139 bits (351), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 58/135 (42%), Positives = 89/135 (65%)

Query: 505 AKLTKGETYHPPQAPDGKRYLLDEEGKLAIVMAPVQSSVYGVYNEYYQSLRPQVDAYAED 564
           A ++KG+ + PP + DGK YL+ ++G L+IVM     SVY +YNE+ QSL+PQ+D++ +D
Sbjct: 264 ASVSKGQQFKPPLSEDGKNYLVTDDGSLSIVMKNDLDSVYSIYNEFMQSLKPQIDSFVQD 323

Query: 565 YGKKSIGHFRKKRTFQKKKAFVQWVERLSDLNGIPPELVLDMIDDVRVREKKSVVWACNN 624
           +G+  +  F+KKRTFQK+KAF  +VE + +      E +LD+ID +R +   SV+W CNN
Sbjct: 324 HGRSKLAKFQKKRTFQKRKAFCSFVETIVNSTSFTSEEILDIIDGIRAQNDHSVIWVCNN 383

Query: 625 LGSCRTALGHYNPEL 639
           L   +  L    P+L
Sbjct: 384 LNQLKMDLLKQRPDL 398

>AGR093W Chr7 (911047..912888) [1842 bp, 613 aa] {ON} NOHBY738; No
           homolog in Saccharomyces cerevisiae
          Length = 613

 Score = 79.3 bits (194), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 51/194 (26%), Positives = 91/194 (46%), Gaps = 7/194 (3%)

Query: 44  LAVPSSMRQHNQAQHVESTLFVLQDVLWNLLVHFRNHGTLQASYEMAKHRC----EGHYP 99
           + + S   +   + H+E  L V+Q ++ ++LV  R    L   Y   K +C    +    
Sbjct: 1   MNIASGADERGTSGHIEGRLLVVQQLVRSMLVRLRQQEDLYQLYTATKEQCLSFSQEDPG 60

Query: 100 SILSVECIFKVLMDYPAELLSAIYVPMILRFFKWSFSVQQHSQELKWSRAIITTKRGMAF 159
             + V+ +F++LM    ELL  + +P ++RFF+W+   +  + E   +RA+IT  R   F
Sbjct: 61  GGIDVDSMFELLMMRTPELLGLVSLPAMVRFFEWAQRTETIAAE--TTRAVITPTRCYNF 118

Query: 160 LVANFHEFSYNAATXXXXXXXXXXXXXXEMALLPQKPVLGDDSEDEEAMDPTWTPLNSEQ 219
           L  +   F++ A                +M +  +KP+L  D  D ++  P W PL+S  
Sbjct: 119 LKEDVGTFAHGAEVVGGVFEALQLLQQLQMIVFREKPML-HDRNDPDSASPMWKPLDSPT 177

Query: 220 LESLIKSLTKDAST 233
              L+ SL  D++T
Sbjct: 178 TLQLLHSLVHDSAT 191

 Score = 38.5 bits (88), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 32/56 (57%)

Query: 316 SDKLFSQTFPNIFHRINALEVANERLTQDNDALFKDMEKLKSQLQNLEKSVENTSL 371
           S  LF Q+ P+I  RI  L + N +L Q +  L + +  LK  + +L+K+V + SL
Sbjct: 402 SSPLFQQSIPDINQRIYHLTLENNKLKQQDTVLMQHINSLKQLVSSLQKTVTSMSL 457

>Kwal_23.5593 s23 complement(1230110..1231162) [1053 bp, 350 aa]
           {ON} [contig 11] FULL
          Length = 350

 Score = 65.5 bits (158), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 61/112 (54%), Gaps = 4/112 (3%)

Query: 518 APDGKR--YLLD--EEGKLAIVMAPVQSSVYGVYNEYYQSLRPQVDAYAEDYGKKSIGHF 573
           A D K+  YL D  +  +  + M+   ++V+ +Y+E+  SL PQ+  Y + YGK      
Sbjct: 231 ATDTKKLQYLKDWVDISEFTLQMSNQPTTVFALYSEFETSLGPQMLEYEKRYGKGQSSRL 290

Query: 574 RKKRTFQKKKAFVQWVERLSDLNGIPPELVLDMIDDVRVREKKSVVWACNNL 625
            + RTFQ+++A V  +++ S   G P E  +   + +R R ++SV W  NNL
Sbjct: 291 PRIRTFQRRRALVSEIDKFSRRTGRPIEEAIAYFELIRTRNRRSVAWLYNNL 342

>KLTH0G06908g Chr7 (550439..551524) [1086 bp, 361 aa] {ON} conserved
           hypothetical protein
          Length = 361

 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 48/169 (28%), Positives = 79/169 (46%), Gaps = 14/169 (8%)

Query: 466 TISSRGDSIASTSPVGLLATSDFHSPAKKPKPVSYNYEGAK------LTKGETYHPPQAP 519
           TI+   D+   T  +GL       +P+K P+  ++     K      L  G+T   P + 
Sbjct: 192 TINDENDA---TEYLGLSKLIGVETPSKNPREKTHGKLQMKPLNSSLLKSGQT---PCSS 245

Query: 520 DGKRYLLDEEGKLAIV--MAPVQSSVYGVYNEYYQSLRPQVDAYAEDYGKKSIGHFRKKR 577
              RY  D +   A V  M+    +V  +Y EY   LRPQ+  + + YGK  I    K R
Sbjct: 246 RHLRYAKDAKDISAYVLKMSGNPKTVGDMYYEYEHQLRPQILEFEKRYGKGQISRLPKVR 305

Query: 578 TFQKKKAFVQWVERLSDLNGIPPELVLDMIDDVRVREKKSVVWACNNLG 626
           T+Q+++A +  +E+ +   G   E  +   +++R + KK+V W  NNL 
Sbjct: 306 TYQRRRALINEIEKFARREGKSIEEAVQYFEEIRTQNKKTVPWLYNNLN 354

>AER235C Chr5 complement(1073608..1074582) [975 bp, 324 aa] {ON}
           NOHBY524; No homolog in Saccharomyces cerevisiae'
          Length = 324

 Score = 63.5 bits (153), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 57/109 (52%), Gaps = 5/109 (4%)

Query: 528 EEGKLAIVMAPVQSSVYGVYNEYYQSLRPQVDAYAEDYGKKSIGHFRKKRTFQKKKAFVQ 587
           E+ +L ++ +P    V  +Y E+  SL+ Q+  + + YGK  +    K RT+Q+++A V 
Sbjct: 219 EDYELQMIDSP--KDVNELYREFDTSLKLQIMEFEKRYGKGQLSRIPKIRTYQRRRALVS 276

Query: 588 WVERLSDLNGIPPELVLDMIDDVRVREKKSVVWACNNLGSCRTALGHYN 636
            ++R +       E  +   DD+R+ + K+V W  NNLG     L  YN
Sbjct: 277 EIDRYARFTNKSTEEAIQFFDDIRMEKNKTVAWLYNNLGKI---LAEYN 322

>Ecym_7364 Chr7 complement(760757..761749) [993 bp, 330 aa] {ON}
           similar to Ashbya gossypii AER235C
          Length = 330

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 56/109 (51%), Gaps = 5/109 (4%)

Query: 528 EEGKLAIVMAPVQSSVYGVYNEYYQSLRPQVDAYAEDYGKKSIGHFRKKRTFQKKKAFVQ 587
           E+ +L ++ +P    V  +Y E+  SL+ Q+  + + YGK  +    K RT+Q+++A V 
Sbjct: 225 EDYELQMIDSP--KDVNELYREFDTSLKLQIMEFEKRYGKGQLSRIPKIRTYQRRRALVS 282

Query: 588 WVERLSDLNGIPPELVLDMIDDVRVREKKSVVWACNNLGSCRTALGHYN 636
            ++R +       E  +   D +RV + K+V W  NNLG     L  YN
Sbjct: 283 EIDRYARFTNKSTEEAIQFFDTIRVEKNKTVAWLYNNLGKI---LAEYN 328

>TDEL0E03490 Chr5 (652306..653343) [1038 bp, 345 aa] {ON} Anc_5.277
          Length = 345

 Score = 56.6 bits (135), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 55/109 (50%), Gaps = 2/109 (1%)

Query: 528 EEGKLAIVMAPVQSSVYGVYNEYYQSLRPQVDAYAEDYGKKSIGHFRKKRTFQKKKAFVQ 587
           E   L I+  P   SV  VY+EY  SL+ Q++ +   +GK  +    K RT+Q+++A V 
Sbjct: 235 ENYDLQIIDNP--RSVAEVYHEYENSLKSQIEEFERLFGKGQLSKLPKIRTYQRRRALVT 292

Query: 588 WVERLSDLNGIPPELVLDMIDDVRVREKKSVVWACNNLGSCRTALGHYN 636
            +++ +          ++  + VR+ +K++V    NNLG     LG  N
Sbjct: 293 EIDKYATSYNKTTHEAIEFFEKVRIAKKRTVPGLYNNLGKILKELGESN 341

>SAKL0G10912g Chr7 (922534..923547) [1014 bp, 337 aa] {ON} conserved
           hypothetical protein
          Length = 337

 Score = 56.6 bits (135), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 57/109 (52%), Gaps = 5/109 (4%)

Query: 528 EEGKLAIVMAPVQSSVYGVYNEYYQSLRPQVDAYAEDYGKKSIGHFRKKRTFQKKKAFVQ 587
           E+ +L ++  P   SV  +Y+E+  SL+ Q+  + + +GK  +    K RT+Q+++A V 
Sbjct: 233 EDYELQMIDNP--KSVAELYDEFDNSLKLQILEFEKKFGKGQLSRIPKIRTYQRRRALVS 290

Query: 588 WVERLSDLNGIPPELVLDMIDDVRVREKKSVVWACNNLGSCRTALGHYN 636
            +++ +       E  +   +++R  + K+V W  NNLG     L  YN
Sbjct: 291 EIDKYARFTNKSTEDAIHFFENIRNEKNKTVAWLYNNLGRV---LAEYN 336

>NDAI0D01580 Chr4 (377632..378531) [900 bp, 299 aa] {ON} Anc_5.277
          Length = 299

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 51/96 (53%)

Query: 531 KLAIVMAPVQSSVYGVYNEYYQSLRPQVDAYAEDYGKKSIGHFRKKRTFQKKKAFVQWVE 590
           K+ + MA   +S+  ++ EY   L P+V    + YGKK +      RT Q++KA V  ++
Sbjct: 193 KIQLAMAVKPNSITELFYEYENVLTPKVKDIQKKYGKKCLKQITNIRTLQRRKALVSEIK 252

Query: 591 RLSDLNGIPPELVLDMIDDVRVREKKSVVWACNNLG 626
           + +  N    +  L++ + +R++  +SV W  NN+ 
Sbjct: 253 KFAKQNRKSIKETLEVAEYIRLKNNRSVPWLYNNIS 288

>NCAS0A06640 Chr1 (1311768..1312580) [813 bp, 270 aa] {ON} Anc_5.277
          Length = 270

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 33/140 (23%), Positives = 66/140 (47%), Gaps = 2/140 (1%)

Query: 485 TSDFHSPAKKPKPVSYNYEGAKLTKGETYHPPQAPDGKRYLLDEEGKLAIVMAPVQSSVY 544
           ++D      + +P + N+ G + T+        A   K    D+  K+ I +    S++ 
Sbjct: 120 STDIDQDIVQTRP-TKNFHGVRHTENNRRSKKYAF-QKNIACDQRDKIVIDLVEYPSTIK 177

Query: 545 GVYNEYYQSLRPQVDAYAEDYGKKSIGHFRKKRTFQKKKAFVQWVERLSDLNGIPPELVL 604
            +  ++   + PQ+       GKK++ +  K RT Q++K+ V+ +  +S L  +  E V+
Sbjct: 178 DLVVDFETVVFPQLKYLQRSMGKKALRNIAKLRTVQRRKSLVRAIHDISTLYNLSLEEVI 237

Query: 605 DMIDDVRVREKKSVVWACNN 624
           ++ + +R    KSV W  NN
Sbjct: 238 NIFETIRENGGKSVAWMYNN 257

>KLLA0F21824g Chr6 complement(2031719..2032549) [831 bp, 276 aa]
           {ON} conserved hypothetical protein
          Length = 276

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/100 (23%), Positives = 45/100 (45%)

Query: 534 IVMAPVQSSVYGVYNEYYQSLRPQVDAYAEDYGKKSIGHFRKKRTFQKKKAFVQWVERLS 593
           ++M     SV+ +Y+E+Y   + Q+  + E +G   +    K RT+Q++ A V  + + +
Sbjct: 174 LIMTDCPKSVHDLYHEFYTDTKLQILHFEEKHGAGQLSKLPKLRTYQRRSALVNAINKYA 233

Query: 594 DLNGIPPELVLDMIDDVRVREKKSVVWACNNLGSCRTALG 633
               I  E  ++    +     K++ W  NNL       G
Sbjct: 234 KGKNITVEQSIEHFQGIVEENDKTIPWLYNNLAKILEQYG 273

>KAFR0D05020 Chr4 (987269..988042) [774 bp, 257 aa] {ON} Anc_5.277
          Length = 257

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 47/87 (54%), Gaps = 6/87 (6%)

Query: 542 SVYGVYNEYYQSLRPQVDAYAEDYGKKSIGHFRKK---RTFQKKKAFVQWVERLSDLNGI 598
           +V+ +Y ++   ++  V    E YGK    +FRK    R++Q+++A V  +++LS+   I
Sbjct: 152 TVHELYYDFQNCVKETVRELKEKYGK---SYFRKATNIRSYQRRRALVSEIQKLSEEYDI 208

Query: 599 PPELVLDMIDDVRVREKKSVVWACNNL 625
             E  L   +++R    K+V W  +NL
Sbjct: 209 DIEEALQCFEELRKENYKTVPWLYSNL 235

>Smik_12.1 Chr12 complement(885..1859) [975 bp, 324 aa] {ON} YLL062C
           (REAL)
          Length = 324

 Score = 34.3 bits (77), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 36/74 (48%), Gaps = 4/74 (5%)

Query: 522 KRYLLDEEGKLAIVMAPVQSSVYGVYNE---YYQSLRPQVDAYAEDYGKKSIGHFRKKRT 578
           +RYL+   G  A  ++   +  YG + E   YY+  RPQ+D + E+     IG F     
Sbjct: 118 ERYLIGSIGPWAAHVSSEYTGNYGPHPEDIDYYEFFRPQLDTFNENEDIDLIG-FETIPN 176

Query: 579 FQKKKAFVQWVERL 592
           F + KA + W E +
Sbjct: 177 FHELKAILSWGEDI 190

>ZYRO0G14960g Chr7 (1201495..1203990) [2496 bp, 831 aa] {ON} similar
           to uniprot|P21372 Saccharomyces cerevisiae YBR237W PRP5
           RNA helicase in the DEAD-box family
          Length = 831

 Score = 33.5 bits (75), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 33/65 (50%), Gaps = 13/65 (20%)

Query: 319 LFSQTFPN--------IFHR-----INALEVANERLTQDNDALFKDMEKLKSQLQNLEKS 365
           LFS TFPN        + HR     IN+  + NE +TQ  D    D EK  + L+ LEK 
Sbjct: 429 LFSATFPNKLRNFAMRVLHRPLSITINSKSLVNENVTQRFDIANSDEEKFNTLLRILEKH 488

Query: 366 VENTS 370
            E+++
Sbjct: 489 EESSN 493

>Skud_12.4 Chr12 complement(4676..5653) [978 bp, 325 aa] {ON}
           YLL062C (REAL)
          Length = 325

 Score = 32.7 bits (73), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 36/74 (48%), Gaps = 4/74 (5%)

Query: 522 KRYLLDEEGKLAIVMAPVQSSVYGVYNE---YYQSLRPQVDAYAEDYGKKSIGHFRKKRT 578
           +RYL+   G  A  ++   +  YG + E   YY   +PQ+D++ E+     IG F     
Sbjct: 118 ERYLVGSIGPWAAHVSSEYTGNYGPHPEDIDYYNFFKPQLDSFNENKDIDLIG-FETVPN 176

Query: 579 FQKKKAFVQWVERL 592
           F + KA + W E +
Sbjct: 177 FHELKAILSWGEDI 190

>Ecym_2288 Chr2 complement(561508..562308) [801 bp, 266 aa] {ON}
           similar to Ashbya gossypii ABR100W
          Length = 266

 Score = 31.6 bits (70), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 24/46 (52%), Gaps = 2/46 (4%)

Query: 280 VYGVQQVPIPSAFSDL--PEPFTTLPSGHSNESLSHQSSDKLFSQT 323
           V G++QV  PS F D+  PE      SG   E LS  SSD L + T
Sbjct: 168 VGGLKQVSGPSTFGDIEVPEGLHEGCSGRPVEGLSKGSSDSLTADT 213

>TDEL0C00960 Chr3 (153572..157240) [3669 bp, 1222 aa] {ON} Anc_8.68
           YFL008W
          Length = 1222

 Score = 32.0 bits (71), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 39/74 (52%), Gaps = 5/74 (6%)

Query: 306 HSNESLSHQSSDKLFSQTFPNIFHRINALEVANERLTQDNDALFK---DMEKLKSQLQNL 362
           HS ++   QS  K   Q    I +  N LE   ERLT  ++ L K   DM+K+  +LQ+L
Sbjct: 803 HSGDAKRQQS--KELQQLQKQILNVENKLEFEKERLTSTSNRLEKTETDMKKVFIELQSL 860

Query: 363 EKSVENTSLQRQNV 376
           +K  E+  +Q + V
Sbjct: 861 QKQEEDVGVQTKKV 874

>TBLA0B00430 Chr2 (81867..82919) [1053 bp, 350 aa] {ON} 
          Length = 350

 Score = 31.2 bits (69), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 19/38 (50%)

Query: 540 QSSVYGVYNEYYQSLRPQVDAYAEDYGKKSIGHFRKKR 577
           +  +YG YNE Y +L PQ+    +       GHF K R
Sbjct: 282 KDGIYGAYNELYAALSPQLTTENQGSYIVPFGHFEKPR 319

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.130    0.378 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 66,443,653
Number of extensions: 2842703
Number of successful extensions: 8418
Number of sequences better than 10.0: 68
Number of HSP's gapped: 8727
Number of HSP's successfully gapped: 73
Length of query: 648
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 532
Effective length of database: 40,180,143
Effective search space: 21375836076
Effective search space used: 21375836076
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 69 (31.2 bits)