Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_56.235898.256ON1213121360090.0
KLTH0G13838g8.256ON1214121729720.0
SAKL0H17204g8.256ON1211122222150.0
Smik_12.1438.256ON1220124418350.0
Skud_12.1528.256ON1220123518250.0
YLR084C (RAX2)8.256ON1220124018250.0
ZYRO0C01804g8.256ON1209123517940.0
Suva_10.1688.256ON1220122417870.0
NDAI0B023808.256ON1219124317430.0
KLLA0F18975g8.256ON1200124117360.0
NCAS0B049808.256ON1204123017320.0
TDEL0F038308.256ON1195122317210.0
Kpol_392.108.256ON1226123616670.0
TPHA0B032508.256ON1215123916420.0
TBLA0E043908.256ON1278127515570.0
KAFR0B026908.256ON1210123215440.0
AGR095W8.256ON1201123514690.0
Ecym_43158.256ON1212123314670.0
KNAG0G020008.256ON1202123414551e-180
CAGL0L12144g8.256ON1156119814271e-177
Kpol_1054.402.29ON74486772.1
YJL045W5.253ON63475753.7
YGR196C (FYV8)5.145ON81774754.1
NDAI0J00920singletonON610160745.2
Skud_4.538.454ON39473728.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_56.23589
         (1213 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_56.23589 s56 complement(610601..614242) [3642 bp, 1213 aa] ...  2319   0.0  
KLTH0G13838g Chr7 (1197919..1201563) [3645 bp, 1214 aa] {ON} sim...  1149   0.0  
SAKL0H17204g Chr8 (1522944..1526579) [3636 bp, 1211 aa] {ON} sim...   857   0.0  
Smik_12.143 Chr12 complement(276428..280090) [3663 bp, 1220 aa] ...   711   0.0  
Skud_12.152 Chr12 complement(279947..283609) [3663 bp, 1220 aa] ...   707   0.0  
YLR084C Chr12 complement(296589..300251) [3663 bp, 1220 aa] {ON}...   707   0.0  
ZYRO0C01804g Chr3 (140029..143658) [3630 bp, 1209 aa] {ON} simil...   695   0.0  
Suva_10.168 Chr10 complement(301631..305293) [3663 bp, 1220 aa] ...   692   0.0  
NDAI0B02380 Chr2 complement(595444..599103) [3660 bp, 1219 aa] {...   676   0.0  
KLLA0F18975g Chr6 complement(1739543..1743145) [3603 bp, 1200 aa...   673   0.0  
NCAS0B04980 Chr2 complement(912114..915728) [3615 bp, 1204 aa] {...   671   0.0  
TDEL0F03830 Chr6 complement(701362..704949) [3588 bp, 1195 aa] {...   667   0.0  
Kpol_392.10 s392 (27006..30686) [3681 bp, 1226 aa] {ON} (27006.....   646   0.0  
TPHA0B03250 Chr2 (745716..749363) [3648 bp, 1215 aa] {ON} Anc_8....   637   0.0  
TBLA0E04390 Chr5 complement(1115294..1119130) [3837 bp, 1278 aa]...   604   0.0  
KAFR0B02690 Chr2 complement(539470..543102) [3633 bp, 1210 aa] {...   599   0.0  
AGR095W Chr7 (914098..917703) [3606 bp, 1201 aa] {ON} Syntenic h...   570   0.0  
Ecym_4315 Chr4 (679627..683265) [3639 bp, 1212 aa] {ON} similar ...   569   0.0  
KNAG0G02000 Chr7 complement(443631..447239) [3609 bp, 1202 aa] {...   565   e-180
CAGL0L12144g Chr12 complement(1304574..1308044) [3471 bp, 1156 a...   554   e-177
Kpol_1054.40 s1054 complement(93513..95747) [2235 bp, 744 aa] {O...    34   2.1  
YJL045W Chr10 (356024..357928) [1905 bp, 634 aa] {ON} Minor succ...    33   3.7  
YGR196C Chr7 complement(889733..892186) [2454 bp, 817 aa] {ON}  ...    33   4.1  
NDAI0J00920 Chr10 complement(203498..205330) [1833 bp, 610 aa] {...    33   5.2  
Skud_4.53 Chr4 (91849..93033) [1185 bp, 394 aa] {ON} YDL204W (REAL)    32   8.3  

>Kwal_56.23589 s56 complement(610601..614242) [3642 bp, 1213 aa] {ON}
            YLR084C (RAX2) - YLR084C [contig 176] FULL
          Length = 1213

 Score = 2319 bits (6009), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1151/1213 (94%), Positives = 1151/1213 (94%)

Query: 1    MLTKSWLATSFLVVAKLCSGTHLNTIESALGVKNFEVPSLDLSGSNNEEIQLLGNFQNLN 60
            MLTKSWLATSFLVVAKLCSGTHLNTIESALGVKNFEVPSLDLSGSNNEEIQLLGNFQNLN
Sbjct: 1    MLTKSWLATSFLVVAKLCSGTHLNTIESALGVKNFEVPSLDLSGSNNEEIQLLGNFQNLN 60

Query: 61   YYRYTGQDNFTGISDEKARESLIYHSNGTLLELSSPQYSNESFSVDHVIPLRDDSFILSG 120
            YYRYTGQDNFTGISDEKARESLIYHSNGTLLELSSPQYSNESFSVDHVIPLRDDSFILSG
Sbjct: 61   YYRYTGQDNFTGISDEKARESLIYHSNGTLLELSSPQYSNESFSVDHVIPLRDDSFILSG 120

Query: 121  TGAISGAVLDHQVVFNLSDLSYTAIFNQSLSPVNAITVNGNKAYFGGSFKFKGPDQDTHG 180
            TGAISGAVLDHQVVFNLSDLSYTAIFNQSLSPVNAITVNGNKAYFGGSFKFKGPDQDTHG
Sbjct: 121  TGAISGAVLDHQVVFNLSDLSYTAIFNQSLSPVNAITVNGNKAYFGGSFKFKGPDQDTHG 180

Query: 181  LIVWDFVKNEVETLPFGGLGKDSNVNSILVLDDNNILFAGNFSTIDEKSALNSTLGINST 240
            LIVWDFVKNEVETLPFGGLGKDSNVNSILVLDDNNILFAGNFSTIDEKSALNSTLGINST
Sbjct: 181  LIVWDFVKNEVETLPFGGLGKDSNVNSILVLDDNNILFAGNFSTIDEKSALNSTLGINST 240

Query: 241  SDSAPELSHKIPLKTAKWTSDGSLQKDDLVCPSNSATSAWLGTGTTGQFELSIAHTIRPS 300
            SDSAPELSHKIPLKTAKWTSDGSLQKDDLVCPSNSATSAWLGTGTTGQFELSIAHTIRPS
Sbjct: 241  SDSAPELSHKIPLKTAKWTSDGSLQKDDLVCPSNSATSAWLGTGTTGQFELSIAHTIRPS 300

Query: 301  KLRLHNARTLDEEVSLFRVITTPSNGIMNLTYLDPSSGELRTCDAWCPLLSTQNLTAAKS 360
            KLRLHNARTLDEEVSLFRVITTPSNGIMNLTYLDPSSGELRTCDAWCPLLSTQNLTAAKS
Sbjct: 301  KLRLHNARTLDEEVSLFRVITTPSNGIMNLTYLDPSSGELRTCDAWCPLLSTQNLTAAKS 360

Query: 361  KAASTDQVEFLNNQTTVQWSESYQDFAFVNSVPVTSITFMALDSYGSSVGVNGFELYEDD 420
            KAASTDQVEFLNNQTTVQWSESYQDFAFVNSVPVTSITFMALDSYGSSVGVNGFELYEDD
Sbjct: 361  KAASTDQVEFLNNQTTVQWSESYQDFAFVNSVPVTSITFMALDSYGSSVGVNGFELYEDD 420

Query: 421  FSVYANDSFNVPDCSSTSNYSKASLSASQWDQGSSDEDYVYTLVENSQEAPSVTFYPQIV 480
            FSVYANDSFNVPDCSSTSNYSKASLSASQWDQGSSDEDYVYTLVENSQEAPSVTFYPQIV
Sbjct: 421  FSVYANDSFNVPDCSSTSNYSKASLSASQWDQGSSDEDYVYTLVENSQEAPSVTFYPQIV 480

Query: 481  YSGLYTINVLTPGCLADGSCQSRSVVNASLWDSNNGTLLSSITIYQNNDYEKYDNLYSGY 540
            YSGLYTINVLTPGCLADGSCQSRSVVNASLWDSNNGTLLSSITIYQNNDYEKYDNLYSGY
Sbjct: 481  YSGLYTINVLTPGCLADGSCQSRSVVNASLWDSNNGTLLSSITIYQNNDYEKYDNLYSGY 540

Query: 541  LENEVKVVLEYEGAIGNTEGSPMMVAGQISVNTDEFDSSVFTDKYKTGKXXXXXXXXXXX 600
            LENEVKVVLEYEGAIGNTEGSPMMVAGQISVNTDEFDSSVFTDKYKTGK           
Sbjct: 541  LENEVKVVLEYEGAIGNTEGSPMMVAGQISVNTDEFDSSVFTDKYKTGKLNGLLHYSLSN 600

Query: 601  XXXXXQNFKSNNSTDLAQYSVSNFAKNSNFFVDKFKNYIMLFASSGKVSKLEIDQQFDVR 660
                 QNFKSNNSTDLAQYSVSNFAKNSNFFVDKFKNYIMLFASSGKVSKLEIDQQFDVR
Sbjct: 601  SSSYLQNFKSNNSTDLAQYSVSNFAKNSNFFVDKFKNYIMLFASSGKVSKLEIDQQFDVR 660

Query: 661  TVTTEEVGDEVSGVFAFSEGLGVIGTFDGSTKGAKFYNGSFFDIPLSHSNVTTFTNFTLD 720
            TVTTEEVGDEVSGVFAFSEGLGVIGTFDGSTKGAKFYNGSFFDIPLSHSNVTTFTNFTLD
Sbjct: 661  TVTTEEVGDEVSGVFAFSEGLGVIGTFDGSTKGAKFYNGSFFDIPLSHSNVTTFTNFTLD 720

Query: 721  GAELVSLGNYYAINTTTDTLFRNSSKMTLTARSAGLNNLGETVFYGSLTRNEYTDLXXXX 780
            GAELVSLGNYYAINTTTDTLFRNSSKMTLTARSAGLNNLGETVFYGSLTRNEYTDL    
Sbjct: 721  GAELVSLGNYYAINTTTDTLFRNSSKMTLTARSAGLNNLGETVFYGSLTRNEYTDLNGSF 780

Query: 781  XXXXXXXXXXXXXXXXXXXWYDATYIDNSTTGYAFYDPSSTNGSYGVSIYKDMAKERDLS 840
                               WYDATYIDNSTTGYAFYDPSSTNGSYGVSIYKDMAKERDLS
Sbjct: 781  FISSNSQSSSRLRGSQGRIWYDATYIDNSTTGYAFYDPSSTNGSYGVSIYKDMAKERDLS 840

Query: 841  YRWTNMVGSMLYSKNSSLLALGMKNETRSPQLLLTNLTTGEDTATFEWKTNVSINSLIFF 900
            YRWTNMVGSMLYSKNSSLLALGMKNETRSPQLLLTNLTTGEDTATFEWKTNVSINSLIFF
Sbjct: 841  YRWTNMVGSMLYSKNSSLLALGMKNETRSPQLLLTNLTTGEDTATFEWKTNVSINSLIFF 900

Query: 901  DQNTSVLVGGDFNESESNCSGLCLFDYERKHWSPFFDNMINGSIHSMKIFNKSSLVLGGF 960
            DQNTSVLVGGDFNESESNCSGLCLFDYERKHWSPFFDNMINGSIHSMKIFNKSSLVLGGF
Sbjct: 901  DQNTSVLVGGDFNESESNCSGLCLFDYERKHWSPFFDNMINGSIHSMKIFNKSSLVLGGF 960

Query: 961  FDINDTKQVNLASMSLTDGSYNILHQGTETILDFIFVDGKVDNLVAVSANDLFRLTNNNW 1020
            FDINDTKQVNLASMSLTDGSYNILHQGTETILDFIFVDGKVDNLVAVSANDLFRLTNNNW
Sbjct: 961  FDINDTKQVNLASMSLTDGSYNILHQGTETILDFIFVDGKVDNLVAVSANDLFRLTNNNW 1020

Query: 1021 ESISAQFDDSSVFGGLSEFPIQQGGQNKKREEEKNSLLITGDLLHKTYGKISAALYDFND 1080
            ESISAQFDDSSVFGGLSEFPIQQGGQNKKREEEKNSLLITGDLLHKTYGKISAALYDFND
Sbjct: 1021 ESISAQFDDSSVFGGLSEFPIQQGGQNKKREEEKNSLLITGDLLHKTYGKISAALYDFND 1080

Query: 1081 WIPYFSTTPATSTDGLGQSRIYSNKDISSAFNYQGVLQXXXXXXXXXXXXXXXXXXXXXX 1140
            WIPYFSTTPATSTDGLGQSRIYSNKDISSAFNYQGVLQ                      
Sbjct: 1081 WIPYFSTTPATSTDGLGQSRIYSNKDISSAFNYQGVLQSSRGGNSSSVPSGTSSPTSSSP 1140

Query: 1141 XQLGAKKNKIARGFVVLIGLALAMGTLAVMGVIGIALTFFFGKSSDKYQSLEPRADESEM 1200
             QLGAKKNKIARGFVVLIGLALAMGTLAVMGVIGIALTFFFGKSSDKYQSLEPRADESEM
Sbjct: 1141 SQLGAKKNKIARGFVVLIGLALAMGTLAVMGVIGIALTFFFGKSSDKYQSLEPRADESEM 1200

Query: 1201 IDTVPPEKLMRFI 1213
            IDTVPPEKLMRFI
Sbjct: 1201 IDTVPPEKLMRFI 1213

>KLTH0G13838g Chr7 (1197919..1201563) [3645 bp, 1214 aa] {ON} similar
            to uniprot|Q12465 Saccharomyces cerevisiae YLR084C RAX2
            N-glycosylated protein involved in the maintenance of bud
            site selection during bipolar budding localization
            requires Rax1p
          Length = 1214

 Score = 1149 bits (2972), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 588/1217 (48%), Positives = 815/1217 (66%), Gaps = 7/1217 (0%)

Query: 1    MLTKSWLATSFLVVAKLCSGTHLNTIESALGVKNFEVPSLDLSGSNNEEIQLLGNFQNLN 60
            M   + LATS L +AK CSG+HL+ +ES LGV+ +++P+LDLS S N E+QLLGNF+++N
Sbjct: 1    MRATTCLATSVLALAKFCSGSHLDALESKLGVEVYDIPNLDLSKSKNNEVQLLGNFKDIN 60

Query: 61   YYRYTGQDNFTGISDEKARESLIYHSNGTLLELSSPQYSNESFSVDHVIPLRDDSFILSG 120
              +Y+GQ NFTG        +LIY+SN T LE+ S   S+E FSVDH++P +DD+FILSG
Sbjct: 61   ILKYSGQKNFTGEVSGNPENALIYYSNETFLEIYSSSDSSEVFSVDHIVPFKDDAFILSG 120

Query: 121  TGAISGAVLDHQVVFNLSDLSYTAIFNQSLSPVNAITVNGNKAYFGGSFKFKGPDQDTHG 180
             G+ISG  L  Q++FNLS L +  IF Q L+ VN IT NG+K +FGGSF+++  +Q  H 
Sbjct: 121  AGSISGHQLSRQLLFNLSSLEFREIFGQDLAQVNTITANGDKVFFGGSFEYEMSNQTIHS 180

Query: 181  LIVWDFVKNEVETLPFGGLGKDSNVNSILVLDDNNILFAGNFSTIDEKSALNSTLGINST 240
            L+VWD +K+ VE LPFGG GK+S VNSIL LD++NILFAGNFS +D    LN+    N++
Sbjct: 181  LLVWDSIKDGVEVLPFGGFGKNSTVNSILNLDNSNILFAGNFSAVDNTQQLNNINVSNTS 240

Query: 241  SDSAPELSHKIPLKTAKWTSDGSLQKDDLVCPSNSATSAWLGTGTT-GQFELSIAHTIRP 299
            + S PEL H+I L++A W SDG+L K  + CPS  +T  WL TG+T GQFEL +    RP
Sbjct: 241  NTSVPELGHQISLQSAAWVSDGTLDKSAIKCPSTEST-GWLKTGSTQGQFELYMPEETRP 299

Query: 300  SKLRLHNARTLDEEVSLFRVITTPSNGIMNLTYLDPSSGELRTCDAWCPLLSTQNLTAAK 359
            SKLR+ NAR  DE+VSLFR++TTPSNGIMNLTYLDP++GEL +CDAWCPLLS+QNLT   
Sbjct: 300  SKLRVFNARDSDEQVSLFRIVTTPSNGIMNLTYLDPTTGELASCDAWCPLLSSQNLTDIS 359

Query: 360  SKAASTDQVEFLNNQTTVQWSESYQDFAFVNSVPVTSITFMALDSYGSSVGVNGFELYED 419
            SK+   DQV++  N+TT+QWSES+QDFAFVN+VPV+ +TF+ALDSYGSSVG+ G ELYE 
Sbjct: 360  SKSYPGDQVQYFENRTTLQWSESFQDFAFVNNVPVSDLTFIALDSYGSSVGLAGIELYES 419

Query: 420  DFSVYANDSFNVPDCSSTSNYSKASLS-ASQWDQGSSDEDYVYTLVENSQEAPSVTFYPQ 478
             +SVYAN++ N P+C+  S  S A LS +S WD GSS+ +Y+ T V++S+  P V FYP 
Sbjct: 420  AYSVYANNTLNAPNCAQGSATSNALLSNSSAWDSGSSEGNYLSTSVQDSETNPFVIFYPS 479

Query: 479  IVYSGLYTINVLTPGCLADGSCQSRSVVNASLWDSNNGTLLSSITIYQNNDYEKYDNLYS 538
            I+Y G+YTI+VLTPGCL D SCQ+R ++NA++ D  N TLL SI IYQNNDYEK+D LYS
Sbjct: 480  IIYPGVYTIDVLTPGCLEDSSCQTRGIINATIRDVQNNTLLDSIEIYQNNDYEKFDTLYS 539

Query: 539  GYLENEVKVVLEYEGAIGNTEGSPMMVAGQISVNTDEFDSSVFTDKYKTGKXXXXXXXXX 598
            G+L++EVKV LE++GAI +    P+MVA +I VN ++FD SVF +   +G          
Sbjct: 540  GFLDSEVKVTLEFDGAINSGTEVPVMVASKIVVNIEDFDQSVFENN-TSGFINGLLHYST 598

Query: 599  XXXXXXXQNFKSNNSTDLAQYSVSNFAKNSNFFVDKFKNYIMLFASSGKVSKLEIDQQFD 658
                       S ++TDLA YSVS   K+SN F + F++ ++LF + G++++L++     
Sbjct: 599  SNTSSFLSELGSYSATDLAHYSVSKLPKHSNIFANMFEDDLVLFTTDGEMARLKLANNLS 658

Query: 659  VRTVTTEEVGDEVSGVFAFSEGLGVIGTFDGSTK-GAKFYNGSFFDIPLSHSNVTTFTNF 717
            +   T E +G ++S +  +S GL ++GTF+GS++  A+ +NG+FF++   +S V TF+N 
Sbjct: 659  IEEYTFETIGKDISTISEYSGGLIIVGTFNGSSEPAARGFNGTFFNLTEFNSTVRTFSNL 718

Query: 718  TLDGAELVSLGNYYAINTTTDTLFRNSSKMTLTARSAGLNNLGETVFYGSLTRNEYTDLX 777
            TL   E++       +N TT     ++SK+TL   SAG N   +T+F G + +N+YT+L 
Sbjct: 719  TLGQTEMLIFDKNIILNGTTGEKIYDTSKLTLEVASAGRNPYNDTLFQGYVLQNDYTNLN 778

Query: 778  XXXXXXXXXXXXXXXXXXXXXXW-YDATYIDNSTTGYAFYDPSSTNGSYGVSIYKDMAKE 836
                                    YDA ++DNSTT YA+Y+P +T+ S+GVS+  D    
Sbjct: 779  GSFFISTNSEEVSQNFWALGGKLPYDAAFVDNSTTAYAYYNPDNTSNSFGVSVMNDSGST 838

Query: 837  RDLSYRWTNMVGSMLYSKNSSLLALGMKNETRSPQLLLTNLTTGEDTATFEWKTNVSINS 896
              LS  W+  VG+M  SKN SLLA+G K++    QLL+TN ++GE  A+++W + +S+NS
Sbjct: 839  VQLS-AWSGKVGAMASSKNDSLLAIGGKDQHTDSQLLVTNSSSGESLASYKWDSEISLNS 897

Query: 897  LIFFDQNTSVLVGGDFNESESNCSGLCLFDYERKHWSPFFDNMINGSIHSMKIFNKSSLV 956
            +IFF +N SVLVGG F  + + CSGLCLF+Y+ K WSPF +N I G I+ M+IFN S+L+
Sbjct: 898  IIFFARNNSVLVGGSFRVNNTQCSGLCLFNYQDKKWSPFLNNSIRGVINRMEIFNNSNLL 957

Query: 957  LGGFFDINDTKQVNLASMSLTDGSYNILHQGTETILDFIFVDGKVDNLVAVSANDLFRLT 1016
            + G F +N+T  V+LAS+ L D S  ILH+G  T+  F+ +DG  +N+VA S   L +L 
Sbjct: 958  IAGSFRLNETDGVSLASICLKDSSSEILHEGNITLNGFVSMDGSSNNVVAFSDTSLLQLE 1017

Query: 1017 NNNWESISAQFDDSSVFGGLSEFPIQQGGQNKKREEEKNSLLITGDLLHKTYGKISAALY 1076
            +  W+ IS  F ++S F GL  FP++   + +KR+     LLITG L H  +G I+AA Y
Sbjct: 1018 SGKWQQISTNFTENSKFKGLDVFPLKDTTRKQKRDSSSKVLLITGSLQHAKFGSINAAFY 1077

Query: 1077 DFNDWIPYFSTTPATSTDGLGQSRIYSNKDISSAFNYQGVLQXXXXXXXXXXXXXXXXXX 1136
            D  +W P+ S+  ATS+  L  S ++ N+D+S   +Y+G LQ                  
Sbjct: 1078 DSGEWTPFLSSNQATSSSDLETSHVFLNRDLSDFLDYKGYLQGTFSSNTSSGTSGTPSPS 1137

Query: 1137 XXXXXQLGAKKNKIARGFVVLIGLALAMGTLAVMGVIGIALTFFFGKSSDKYQSLEPRAD 1196
                  L  KK KI RGF+VLI LALA+GTLAV+G++G+  ++FFG S D YQ  +PR D
Sbjct: 1138 GSSPSNLQRKKKKIDRGFIVLISLALALGTLAVLGLLGVIFSYFFGDSGDGYQLSKPRTD 1197

Query: 1197 ESEMIDTVPPEKLMRFI 1213
            E+EMIDTVPPEKLMRFI
Sbjct: 1198 ENEMIDTVPPEKLMRFI 1214

>SAKL0H17204g Chr8 (1522944..1526579) [3636 bp, 1211 aa] {ON} similar
            to uniprot|Q12465 Saccharomyces cerevisiae YLR084C RAX2
            N-glycosylated protein involved in the maintenance of bud
            site selection during bipolar budding localization
            requires Rax1p
          Length = 1211

 Score =  857 bits (2215), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 472/1222 (38%), Positives = 725/1222 (59%), Gaps = 32/1222 (2%)

Query: 7    LATSFLVVAKLCSGTHLNTIESALGVKNFEVPSLDLSGSNNEEIQLLGNFQNLNYYRYTG 66
            + T+   + +L +G+ L++++  L +++  +P +DLS S N+E+ LLG+F++L +YRYTG
Sbjct: 7    ILTATYALCQLVTGSQLSSLKEKLNIQDLSIPQIDLSSSVNDEMALLGDFEDLTFYRYTG 66

Query: 67   QDNFTGISDEKARESLIYHSNGTLLELSSPQYSNESFSVDHVIPLRDDSFILSGTGAISG 126
            Q+NFTG   E  ++ LIY+SNGT ++L S    N +  ++H+IP  DDSFILSGTG + G
Sbjct: 67   QENFTGSITETEKD-LIYYSNGTFIKLDSLSDENATADINHIIPFGDDSFILSGTGTLPG 125

Query: 127  AV-LDHQVVFNLSDLSYTAIFNQSLSPVNAITVNGNKAYFGGSFKFKGPDQDTHGLIVWD 185
               L+ Q+++NLS L YTAIFNQS+S VN I  +    YFGG F++   +   H +++W+
Sbjct: 126  GHNLEQQLLYNLSSLEYTAIFNQSISTVNDILADDEIVYFGGEFQYTLGNSTGHSVVLWN 185

Query: 186  FVKNEVETLPFGGLGKDSNVNSILVLDDNNILFAGNFSTIDEKSALNSTLGINSTSDSAP 245
               NE++ LPF G G DS VNSIL LD++NI+FAG F+T+D+ + L    G NS+ ++  
Sbjct: 186  STTNEIQLLPFKGFGLDSVVNSILRLDNDNIVFAGKFNTLDDNTLLKQIRGSNSSKNATD 245

Query: 246  -ELSHKIPLKTAKWTSDGSLQKDDLVCPSNSATSAWLGTGT-TGQFELSIAHTIRPSKLR 303
             E    IPLK A W+S GSL+   L+CPS+ +   W   GT TG F +S+   +RPSKLR
Sbjct: 246  IEFDQLIPLKHAGWSSQGSLEHSSLICPSDDS-DGWFQEGTATGDFTVSLLTDLRPSKLR 304

Query: 304  LHNARTLDEEVSLFRVITTPSNGIMNLTYLDPSSGELRTCDAWCPLLSTQNLTAAKSKAA 363
            ++NA   D +VSLFR+IT+P+NGIMNLTYLDP +GEL  CDAWCPLLST+ L  A++   
Sbjct: 305  IYNAFDSDYQVSLFRIITSPANGIMNLTYLDPQTGELSYCDAWCPLLSTELLEQAEANVT 364

Query: 364  -STDQVEFL-NNQTTVQWSESYQDFAFVNSVPVTSITFMALDSYGSSVGVNGFELYEDDF 421
             S+D V ++ NN T ++W+ +YQ+FAFVN V V S+TF+ALDSYGSSVG++GFE+Y++ +
Sbjct: 365  ISSDSVAYIGNNNTNIKWTSAYQEFAFVNEVSVESLTFLALDSYGSSVGLDGFEMYQNGY 424

Query: 422  SVYANDSFNVPDCSSTSNYSKASLSA-SQWDQGSSDEDYVYTLVENSQEAPSVTFYPQIV 480
              +AND+ N P+C + ++YS A  S+  QW QGS D  Y+ +  + + + PSV FYP I 
Sbjct: 425  PTFANDTLNQPNCDNINSYSHAVTSSKQQWTQGSMDSSYILSTYDGTGDLPSVNFYPNIT 484

Query: 481  YSGLYTINVLTPGCLADGSCQSRSVVNASLWDSNNGTLLSSITIYQNNDYEKYDNLYSGY 540
            Y+G YT+N++TPGC  DGSC SR +VN ++WD  N T+LS+  IYQNN+ EKYD LYSGY
Sbjct: 485  YAGDYTLNMVTPGCTGDGSCSSRGIVNVTVWDQINDTVLSTKLIYQNNNDEKYDLLYSGY 544

Query: 541  LENEVKVVLEYEGAIGNTEGSPMMVAGQISVNTDEFDSSVFTDKYKTGKXXXXXXXXXXX 600
            LE+  K+ L++  +I     + +MVA ++ V  D  D S    K                
Sbjct: 545  LESAPKITLKFYESINTDSSTSIMVADRVDVIIDSIDQSKIGLKTINETLNGLFQYQISN 604

Query: 601  XXXXXQNFKSNNSTDLAQYSVSNFAKNSNFFVDKFKNYIMLFASSGKVSKLEIDQQFDVR 660
                  +     +T + +YS+ N   NS  F   + N +++  +   ++ L+++   ++ 
Sbjct: 605  FTTISNDSLKIGNTTINRYSIENVPSNSELFAGYYNNTLLVDGAFNGIAVLQLNDDLNII 664

Query: 661  TVTTEEVGDEVSGVFAFSEGLGVIGTFDGSTKGAKF--YNGSFFDIPLSHSNVTTFTNFT 718
            +      G    G+  +S GL  +G F+ S++      YNG+F       +N+T F N T
Sbjct: 665  SEQRMGTGGPTEGINTYSNGLLFLGDFNLSSQQISTLSYNGTFSSFGNLRTNITRFNNIT 724

Query: 719  LDGAELVSLGNYYAINTTTDTLFRNSSKMTLTARSAGLNNLGETVFYGSLTRNEYTDLXX 778
            +D +EL+   N Y  N +++   RN+S   L+  SAG N+  + +  G++++ +YT+L  
Sbjct: 725  IDDSELLVFNNRYIFNVSSNEYIRNTSSFALSLWSAGSNSKEDGILVGAVSQRQYTELNG 784

Query: 779  XXXXXXXXXXXXXXXXX-XXXXWYDATYIDNSTTGYAFYDPSSTNGSYGVSIYKDMAKER 837
                                   Y ATYI++S+T YA+   SS N S    +     +  
Sbjct: 785  AVYINDANSISTIGLPSFDGKRVYTATYINDSSTAYAY---SSKNDSTHHVLIARGNRSE 841

Query: 838  DLSYRWTNMVGSMLYSKNSSLLALGMK-NETRSPQLLLTNLTTGEDTATFEWKTNVSINS 896
            DL   W++ V +M+Y+K+ SLLA+G    +T    L L N++  +           S+N+
Sbjct: 842  DLPVSWSHAVNTMIYNKDDSLLAVGTNAGDTNGTSLSLFNISNSKMIGEENLGAKSSVNA 901

Query: 897  LIFFDQNTSVLVGGDF--NESESNCSGLCLFDYERKHWSPFFDNMINGSIHSMKIFNKSS 954
            ++ F++N+S+LVGGDF  ++ +++CSGLCL++Y    WS F++N I+G+I  ++ FN + 
Sbjct: 902  IVAFNKNSSLLVGGDFTIDKDDTSCSGLCLYNYNASKWSNFYNNSISGNITDLQFFNGTQ 961

Query: 955  LVLGGFFDINDTKQVNLASMSLTDGSYNILHQGTETILDFIFVDGKVDNLVAVSANDLFR 1014
            L++ G     +   +NLA +++      IL  G+  +  F+  D   D L+  S N++  
Sbjct: 962  LLISGNLYTENETGINLAKLNMASNEVTILRHGSTMVQSFVTFDHTTDELITQSDNEISY 1021

Query: 1015 LTNNNWESISAQFDDSSVFGGLSEFPIQQGGQNKKREEEKNSLLITGDLLHKTYGKISAA 1074
             TN  W++++++  + S++ G    P++Q   + KR+    +LL+ GDL H TYG +SA 
Sbjct: 1022 YTNGEWKNLTSEDFNDSLYMGAQLIPLKQ--TSSKRDVSNRALLVNGDLKHSTYGSVSAM 1079

Query: 1075 LYDFNDWIPYFSTTPATSTDGLGQSR---IYSNKDISSAFNYQGVLQXXXXXXXXXXXXX 1131
            LYDF DW+PYF        DG    R   I+ NKD+SS +  Q +LQ             
Sbjct: 1080 LYDFEDWMPYF------IVDGENAGRASNIFMNKDLSSLYTTQTILQGSNTSTSTTSSNM 1133

Query: 1132 XXXXXXXXXXQLGAKKNKIARGFVVLIGLALAMGTLAVMGVIGIALTFFFGKSSDKYQSL 1191
                         +  +KI RGFVVLIGLALA+GT+AV+G  G  + +FF  +  +Y+ L
Sbjct: 1134 PSETSDKNE----SSSDKIDRGFVVLIGLALAIGTVAVLGGAGAIIAYFFAGNKGQYEPL 1189

Query: 1192 EPRADESEMIDTVPPEKLMRFI 1213
            +PR DE +MIDTVPPEKLM+F+
Sbjct: 1190 KPRVDEGDMIDTVPPEKLMKFV 1211

>Smik_12.143 Chr12 complement(276428..280090) [3663 bp, 1220 aa] {ON}
            YLR084C (REAL)
          Length = 1220

 Score =  711 bits (1835), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 426/1244 (34%), Positives = 694/1244 (55%), Gaps = 55/1244 (4%)

Query: 1    MLTKSWLATSFLVVAKLCSGTHLNTIESALGVKNFEVPSLDLSGSNNEEIQLLGNFQNLN 60
            M        +FL +A+    + L  I+S L +++  +P+L++S +N+  +Q+LG    ++
Sbjct: 1    MFVHRLWTLAFLFLAQASKASQLQNIKSLLDIEDNVLPNLNISQNNSNAVQILGGVDAIS 60

Query: 61   YYRYTGQDNFT-GISDEKARESLIYHSNGTLLELSSPQYSNESFSVDHVIPLRDDSFILS 119
            +Y+YTGQ NFT GIS       L+Y+SN T ++L     +++   +D + P  DDSFILS
Sbjct: 61   FYKYTGQQNFTKGISPGTNSHGLVYYSNNTYIQLED---ASDDTRIDKITPFGDDSFILS 117

Query: 120  GTGAISGAVLDHQVVFNLSDLSYTAIFNQSLSPVNAITVNGNKAYFGGSFKFKGPDQDTH 179
            G+G I+   + +Q+++NLS LS   IFNQSL  V  + VN    YFGG+F +       H
Sbjct: 118  GSGTINNISVGNQILYNLSTLSMAPIFNQSLGDVETVLVNDTSVYFGGNFSYNNGSMIGH 177

Query: 180  GLIVWDFVKNEVETLPFGGLGKDSNVNSILVLDDNNILFAGNFSTIDEKSAL-------- 231
              +VWD + +  + LPFGG G++SNVNSIL L+D+NI+FAG F T+D+ S L        
Sbjct: 178  SALVWDAMSDTAQLLPFGGFGENSNVNSILKLNDDNIVFAGKFYTLDDSSVLITSSNNGT 237

Query: 232  NSTLGINSTSDSAPELSHKIPLKTAKWTSDGS--LQKDDLVCPSNSATSAWLGTGTTGQF 289
            NST  +N+T     EL  +I L+ A W S GS  L  + LVCP+++  +AWL   T+G  
Sbjct: 238  NSTFSLNAT---KLELGQRISLRYASWDSQGSTTLASNSLVCPNDNG-NAWLYPATSGSL 293

Query: 290  ELSIAHTIRPSKLRLHNARTLDEEVSLFRVITTPSNGIMNLTYLDPSSGELRTCDAWCPL 349
              ++ + + P+K+RL+N++    E++LF+++T PS+ IMNLTYLDP SGEL+ CD +CPL
Sbjct: 294  VCNLPYEVSPTKIRLYNSQDAGSEIALFQILTNPSSSIMNLTYLDPLSGELKNCDEFCPL 353

Query: 350  LSTQNLTAAKSKAAST-DQVEFLN-NQTTVQWSESYQDFAFVNSVPVTSITFMALDSYGS 407
             S   L AA   A+S+ D + F++ N T V+WS  +QDFAF N +PVTS+  +AL+SYG 
Sbjct: 354  YSRATLLAASQNASSSMDMITFIDGNNTDVKWSSDFQDFAFANELPVTSLKLIALNSYGD 413

Query: 408  SVGVNGFELYEDDFSVYANDSFNVPDCSS-TSNYSKASLSASQWDQGSSDEDYVYT--LV 464
            S+G++G ELY++ FS YAN+S N   CS+  ++ S + LS + W  G + E Y+ T  + 
Sbjct: 414  SIGLSGLELYQNTFSTYANNSLNEYGCSALVNDSSSSILSNNSWYNGLTGESYIATNYIP 473

Query: 465  ENSQEAPSVTFYPQIVYSGLYTINVLTPGCLADGSCQSRSVVNASLWDSNNGTLLSSITI 524
            + ++  P V FYP I++SG YTIN  TPGC+ D +C SR +VN ++W+  N T++ + TI
Sbjct: 474  DQNEPIPRVKFYPNIIHSGHYTINTYTPGCVQDNTCSSRGIVNVTVWNPQNNTMMKTYTI 533

Query: 525  YQNNDYEKYDNLYSGYLENEVKVVLEYEGAIGNTEGSPMMVAGQISVNTDEFD-----SS 579
            YQNND  KYD ++SGYL+   ++VLEY   I ++  + ++VA +++V T   D     S 
Sbjct: 534  YQNNDNLKYDQIFSGYLDFSPEIVLEYISGIYSSNTATVVVADRVNVITVSLDTFNALSE 593

Query: 580  VFTDKYKTGKXXXXXXXXXXXXXXXXQNFKSNNSTDLAQYSVSNFAKNSNFFVDKFKNYI 639
            +   K +T                     K  N+T L  + V+N+ KN++  V+ + + +
Sbjct: 594  INNVKRQTPLNGIFQYQKSNFTGTTSNKTKVGNTT-LNLFPVNNYPKNASLLVEIYNDKL 652

Query: 640  MLFASSGKVSKLEIDQQFDVRTVTTEEVGDEVSGVFAFSEGLGVIGTFDGSTKGAK--FY 697
            ++   S ++S +++++ F++++     +  +V G+    +GL + G    S   +    +
Sbjct: 653  IVGGVSNRISTIDLNENFEIKSSENRTIQGDVYGITKTGQGLLIYGDLRSSDNQSTVLLF 712

Query: 698  NGSFFDIPLSHSNVTTFTNFTLDGAELVSLGNYYAINTTTDTLFRNSSKMTLTARSAGLN 757
            N SF  +P     V + TN ++   EL    N Y IN +++    NS+  +L+  +AG N
Sbjct: 713  NESFGKVPNYSKRVNSATNISIADNELFVFDNNYIINASSNAQISNSTSFSLSLWAAGNN 772

Query: 758  NLGETVFYGSLTRNEYTDLXXXXXXXXXXXXXXXXXXXXXXXWYDATYIDNSTTGYAFYD 817
              G+ +F G+++  E+++L                       ++ A Y++ S + YA Y+
Sbjct: 773  GNGDVLFSGTVSHMEFSNLNGSASFKNEDQVQALNIGRGIVPYFGA-YLNESVSAYA-YE 830

Query: 818  PSSTNGSYGVSIYKDMAKERDLSYRWTNMVGSMLYSKNSSLLALGMKNETRSPQLLLTNL 877
              + N  Y        + + + S+ W+N +  MLY+ N ++L +  +  + +  L + NL
Sbjct: 831  TDALNKIY-------FSNKVNPSWNWSNTITRMLYANNQTMLVVSSE-SSSTADLTIFNL 882

Query: 878  TTGEDTATFEWKTNVSINSLIFFDQNTSVLVGGDFNESESNCSGLCLFDYERKHWSPFFD 937
                  A     +N  +++L+ F++N+S+LVGGDF  ++ NCSGLCL++YE K WS FF+
Sbjct: 883  RNMTTIANETLGSNAKVSALVNFEKNSSILVGGDFQITKPNCSGLCLYNYETKSWSTFFN 942

Query: 938  NMINGSIHSMKIFNKSSLVLGGFFDINDTKQVNLASMSLTDGSYNILHQGTETILD-FIF 996
            N I G +  + + N S L++ G F+  + + + L S +L + +   L  G+E  L+ F+ 
Sbjct: 943  NTIFGEVTQLSLANSSELIISGLFNTREHQSIRLGSFNLNNFTMVPLLSGSEGKLNSFVV 1002

Query: 997  VDGKVDNLVAVSANDLFRLTNNNWESISAQFDDSSVFGGLSEFPIQQGGQNKKREEEKNS 1056
             D   ++LVA +   LF   N  W   S   DD S+ G +S            +    N+
Sbjct: 1003 TD---NSLVAWNDTSLFIYGNQKWNITSLPSDD-SLIGSVSTISTNTKSDTLNKRATNNA 1058

Query: 1057 -----LLITGDLLHKTYGKISAALYDFNDWIPYFSTTPATSTDGLGQSRIYSNKDISSAF 1111
                 LL+ G+     YG + + L+DF  W PYF +  + S++       + N+D+S+ F
Sbjct: 1059 HDGSILLLNGNFTMPQYGNLQSLLFDFQAWTPYFISEISNSSN--YNPTFFINRDVSTEF 1116

Query: 1112 NYQGVLQ--XXXXXXXXXXXXXXXXXXXXXXXQLGAKKNKIARGFVVLIGLALAMGTLAV 1169
            N Q  L                          +  ++K KI RGFVVLIGLALA+GT++V
Sbjct: 1117 NSQITLPNLNITVTNPQSTSSQSPSTSATSESKSKSEKKKIDRGFVVLIGLALALGTVSV 1176

Query: 1170 MGVIGIALTFFFGKSSDKYQSLEPRADESEMIDTVPPEKLMRFI 1213
            +G++G+ L + F      Y+ ++PR DE+EM+DTVPPEKLM+F+
Sbjct: 1177 LGIVGVILAYVFKDPEGDYKPIKPRIDENEMLDTVPPEKLMKFV 1220

>Skud_12.152 Chr12 complement(279947..283609) [3663 bp, 1220 aa] {ON}
            YLR084C (REAL)
          Length = 1220

 Score =  707 bits (1825), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 440/1235 (35%), Positives = 677/1235 (54%), Gaps = 57/1235 (4%)

Query: 11   FLVVAKLCSGTHLNTIESALGVKNFEVPSLDLSGSNNEEIQLLGNFQNLNYYRYTGQDNF 70
            F  +A+    + L  I+S L +++  +P+L++S  N+  +Q+LG    L+ Y YTGQ NF
Sbjct: 11   FPFLAQASKASQLQNIKSLLDIEDNVLPNLNISQDNSNAVQILGGVDALSLYEYTGQQNF 70

Query: 71   TG-ISDEKARESLIYHSNGTLLELSSPQYSNESFSVDHVIPLRDDSFILSGTGAISGAVL 129
            T  IS       L+Y+SN T +++     +++   +D + P   DSFILSG+G I+   +
Sbjct: 71   TKEISPGTNSRGLVYYSNNTYIQVED---ASDDTRIDKITPFGADSFILSGSGTINNMPI 127

Query: 130  DHQVVFNLSDLSYTAIFNQSLSPVNAITVNGNKAYFGGSFKFKGPDQDTHGLIVWDFVKN 189
             +Q+++NLS LS   IF+Q L  V ++ +NG   YFGG+F +       H  ++WD + N
Sbjct: 128  GNQILYNLSTLSMAPIFDQPLGSVESVLINGTSVYFGGNFSYNNGSMTGHSALIWDSISN 187

Query: 190  EVETLPFGGLGKDSNVNSILVLDDNNILFAGNFSTIDEKSALNSTLGINSTSDSAP---- 245
            + + LPFGG G++SNVNSI+ L+D+NILFAG F T+D+ SAL  T G N+T++S      
Sbjct: 188  KTQLLPFGGFGENSNVNSIIKLNDDNILFAGKFYTLDDSSAL-ITAGSNNTTNSTSLLNA 246

Query: 246  ---ELSHKIPLKTAKWTSDGS--LQKDDLVCPSNSATSAWLGTGTTGQFELSIAHTIRPS 300
               EL  +IPL+ A W   GS   + + LVCP N+   AW+   T+G     + + + P+
Sbjct: 247  TKLELGQRIPLRYATWDFQGSTTFESNSLVCP-NANEDAWVYPATSGTLVCKLPYEVSPT 305

Query: 301  KLRLHNARTLDEEVSLFRVITTPSNGIMNLTYLDPSSGELRTCDAWCPLLSTQNLTAAKS 360
            K+RL+N++  D E+S+F+++T PSN IMNLTYLDP SG+L+ CD +CPL S   L +A  
Sbjct: 306  KVRLYNSQDSDGEISVFQILTNPSNSIMNLTYLDPLSGKLKNCDEFCPLYSRATLLSASQ 365

Query: 361  KAAS-TDQVEFL-NNQTTVQWSESYQDFAFVNSVPVTSITFMALDSYGSSVGVNGFELYE 418
              +S  D + FL NN T V+WS  +QDFAF N +PVT + F A++SYG SVG++G ELY+
Sbjct: 366  NVSSPMDMISFLDNNNTDVKWSSDFQDFAFANELPVTLLKFTAINSYGKSVGLSGLELYQ 425

Query: 419  DDFSVYANDSFNVPDCSSTSN-YSKASLSASQWDQGSSDEDYVYT-LVENSQEA-PSVTF 475
            D FS YAN+S N   CS+ +N  S ++LS++ W  G   E Y+ T  V N  E  P V F
Sbjct: 426  DTFSTYANNSLNEYGCSALANDSSSSTLSSNSWYNGLGGESYIATEYVPNQDEPTPRVNF 485

Query: 476  YPQIVYSGLYTINVLTPGCLADGSCQSRSVVNASLWDSNNGTLLSSITIYQNNDYEKYDN 535
            YP IV+ G Y IN  TPGC+ D +C SR +VN ++W+  N T++ + TIYQNND  KYD 
Sbjct: 486  YPNIVHPGHYIINTYTPGCVQDHTCSSRGIVNVTMWNPQNKTMMKTYTIYQNNDNLKYDQ 545

Query: 536  LYSGYLENEVKVVLEYEGAIGNTEGSPMMVAGQISVNTDEFDS-SVFTDKYKTGKXXXXX 594
            +YSGYL+   +++LEY   I  +  + ++VA Q++V T   D+ S  ++   T +     
Sbjct: 546  IYSGYLDFSPEIILEYVSGIHTSNTATVVVADQVNVITVLLDAFSTLSESANTKE----Y 601

Query: 595  XXXXXXXXXXXQNFKSNNS-------TDLAQYSVSNFAKNSNFFVDKFKNYIMLFASSGK 647
                        NF S  S       T L  ++V N+  NS+ F D   + ++L  ++  
Sbjct: 602  IPLNGVLQYQKSNFTSTTSNETKIGNTTLNVFAVDNYPNNSSLFADTNGDRLILGGTNNH 661

Query: 648  VSKLEIDQQFDVRTVTTEEVGDEVSGVFAFSEGLGVIGTFDGSTKGAK--FYNGSFFDIP 705
            +S + ++   +V     + +  +V G+   S+GL + G    S   +    +NGSF ++ 
Sbjct: 662  ISIIGLNDNLEVVLSEKQIIQGDVHGMTQTSQGLLIFGDLLSSNNQSSVLLFNGSFENVF 721

Query: 706  LSHSNVTTFTNFTLDGAELVSLGNYYAINTTTDTLFRNSSKMTLTARSAGLNNLGETVFY 765
                 V +  N +L   +L+   N Y +NT++     NS+  +L+  SAG N   + +F 
Sbjct: 722  NYSRTVNSAINISLANNDLIVFDNDYIVNTSSSAQILNSTSFSLSLWSAGSNGNDDVLFS 781

Query: 766  GSLTRNEYTDLXXXXXXXXXXXXXXXXXXXXXXXWYDATYIDNSTTGYAFYDPSSTNGSY 825
            G+++R ++  L                        Y A Y++ STT YA Y+ +  N  Y
Sbjct: 782  GAVSRMQFGGLNGSARFLSEDKVQALNLDNAVVP-YLAAYLNESTTAYA-YETNLLNKIY 839

Query: 826  GVSIYKDMAKERDLSYRWTNMVGSMLYSKNSSLLALGMKNETRSPQLLLTNLTTGEDTAT 885
                    +   D S+ W+  +  MLY+ N SLL +G ++ T + +L + NL      A 
Sbjct: 840  -------FSNNVDPSWNWSTSITRMLYANNQSLLTVGSESSTTA-ELSIFNLKNFTMIAN 891

Query: 886  FEWKTNVSINSLIFFDQNTSVLVGGDFNESESNCSGLCLFDYERKHWSPFFDNMINGSIH 945
                +N  IN+L+ F++N+S+LVGG+F  S+ NCSGLCL++YE K WS FF+N   G I 
Sbjct: 892  ETMGSNAKINALVNFEKNSSLLVGGNFQMSKPNCSGLCLYNYESKSWSTFFNNTFFGEIT 951

Query: 946  SMKIFNKSSLVLGGFFDINDTKQVNLASMSLTDGSYNILHQGTE-TILDFIFVDGKVDNL 1004
             +     S LV+ G FD  + + V LAS +LT+ +   L  G E  I  F+  +   +++
Sbjct: 952  QLSFSAASQLVISGLFDTEEYQSVRLASFNLTNSTMIPLLTGAEGKINSFVVTE---ESI 1008

Query: 1005 VAVSANDLFRLTNNNWESISAQFDDSSVFGGLSEFPIQQGGQNKKREEEKNS-----LLI 1059
            VA +   L    +  W   S   +DSS+ G +S      G     R    N+     LL+
Sbjct: 1009 VAWNDTSLLIYRDQEWNITSVPGNDSSI-GSVSTINTNAGPGTLNRRATNNAENGTILLL 1067

Query: 1060 TGDLLHKTYGKISAALYDFNDWIPYFSTTPATSTDGLGQSRIYSNKDISSAFNYQGVLQX 1119
            +G+     YG +   L+DF  W PYF +  + +++      I+ N+D+S+ FN Q  L  
Sbjct: 1068 SGNFSIPDYGNLQGLLFDFETWSPYFVSESSNTSN--RNPTIFINRDVSTEFNSQIPLSN 1125

Query: 1120 XXXXXXXXXXXXXXXXXXXXXXQLGAK-KNKIARGFVVLIGLALAMGTLAVMGVIGIALT 1178
                                  +L  K K +I RGFVVLIGLALA+GT++V+G+ G+ L 
Sbjct: 1126 LNVTETGPQSASSQFPSSSASSELKPKSKKRIDRGFVVLIGLALALGTVSVLGIAGVILA 1185

Query: 1179 FFFGKSSDKYQSLEPRADESEMIDTVPPEKLMRFI 1213
            + F      Y+ ++PR DE+EM+DTVPPEKLM+F+
Sbjct: 1186 YVFKDPEGDYKPIKPRIDENEMLDTVPPEKLMKFV 1220

>YLR084C Chr12 complement(296589..300251) [3663 bp, 1220 aa] {ON}
            RAX2N-glycosylated protein involved in the maintenance of
            bud site selection during bipolar budding; localization
            requires Rax1p; RAX2 mRNA stability is regulated by Mpt5p
          Length = 1220

 Score =  707 bits (1825), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 443/1240 (35%), Positives = 703/1240 (56%), Gaps = 54/1240 (4%)

Query: 4    KSW-LATSFLVVAKLCSGTHLNTIESALGVKNFEVPSLDLSGSNNEEIQLLGNFQNLNYY 62
            + W LA  FLV  ++   + L  I+S L +++  +P+L++S +N+  +Q+LG    L++Y
Sbjct: 5    RLWTLAFPFLV--EISKASQLENIKSLLDIEDNVLPNLNISQNNSNAVQILGGVDALSFY 62

Query: 63   RYTGQDNFTG-ISDEKARESLIYHSNGTLLELSSPQYSNESFSVDHVIPLRDDSFILSGT 121
             YTGQ NFT  I  E +   L+Y+SN T ++L     +++   +D + P   DSFILSG+
Sbjct: 63   EYTGQQNFTKEIGPETSSHGLVYYSNNTYIQLED---ASDDTRIDKITPFGVDSFILSGS 119

Query: 122  GAISGAVLDHQVVFNLSDLSYTAIFNQSLSPVNAITVNGNKAYFGGSFKFKGPDQDTHGL 181
            G I+   + +Q+++NLS LS T IFNQSL  V A+  + +  YFGG+F +       +  
Sbjct: 120  GTINNISVGNQILYNLSTLSMTPIFNQSLGAVQAVLADNSSIYFGGNFSYNNGSMTGYSA 179

Query: 182  IVWDFVKNEVETLPFGGLGKDSNVNSILVLDDNNILFAGNFSTIDEKSAL--NSTLGINS 239
            ++WD + N  + LPFGG G++S+VNSI+ L+++NILFAG F T+D+ SAL  +S  G NS
Sbjct: 180  LIWDSISNTTQLLPFGGFGENSSVNSIVKLNNDNILFAGQFYTLDDPSALISSSNNGTNS 239

Query: 240  TSD---SAPELSHKIPLKTAKWTSDGS--LQKDDLVCPSNSATSAWLGTGTTGQFELSIA 294
            TS    +  EL  +IPL+ A W S GS     D LVCP N+   AWL   T+G    ++ 
Sbjct: 240  TSSLNATTLELGQRIPLRYASWDSQGSTTFASDSLVCP-NTNEDAWLYPDTSGSLVCNLP 298

Query: 295  HTIRPSKLRLHNARTLDEEVSLFRVITTPSNGIMNLTYLDPSSGELRTCDAWCPLLSTQN 354
            + + P+K+RL+N++  D E+S+F+++T PS+ IMNLTYLDP SGEL+ C  +CPL S   
Sbjct: 299  YEVSPTKIRLYNSQRSDSEISVFQILTDPSSSIMNLTYLDPLSGELKNCGEFCPLYSRAT 358

Query: 355  -LTAAKSKAASTDQVEFL-NNQTTVQWSESYQDFAFVNSVPVTSITFMALDSYGSSVGVN 412
             L+A+++ ++S D + F+ NN+T V+W+  +QDFAFVN +PV+S+ F+AL+SYG SVG++
Sbjct: 359  LLSASQNVSSSMDMITFIDNNKTDVKWTSDFQDFAFVNELPVSSLKFVALNSYGGSVGLS 418

Query: 413  GFELYEDDFSVYANDSFNVPDCSS-TSNYSKASLSASQWDQGSSDEDYVYT--LVENSQE 469
            G ELY+D FS YANDS N   CS+ T++ S ++LS++ W  G + E Y+    + + ++ 
Sbjct: 419  GLELYQDTFSTYANDSLNEYGCSALTNDSSSSTLSSNDWYNGLTGESYIAAKYVPDQNEP 478

Query: 470  APSVTFYPQIVYSGLYTINVLTPGCLADGSCQSRSVVNASLWDSNNGTLLSSITIYQNND 529
             P V FYP I++ G YTIN+ TPGCL D +C +R +VN ++W+  N T++ +  IYQNND
Sbjct: 479  IPRVKFYPNIIHPGHYTINMYTPGCLQDNTCSARGIVNVTMWNQQNNTIMKTYLIYQNND 538

Query: 530  YEKYDNLYSGYLENEVKVVLEYEGAIGNTEGSPMMVAGQISVNTDEFDS-SVFTDKYKTG 588
              KYD +YSGYL+   ++VLEY   I  T  + ++VA Q++V T   D+ +  +D     
Sbjct: 539  NLKYDQIYSGYLDFSPEIVLEYVSGIYTTNTATVVVADQVNVITVSLDAFNTLSDSSNAK 598

Query: 589  KXXXXXXXXXXXXXXXXQNFKSNN-------STDLAQYSVSNFAKNSNFFVDKFKNYIML 641
            K                 NF S         +T L  + V N+ KNS+ + D + N +++
Sbjct: 599  K----ETLLNGILQYQKSNFTSTRLNETKVGNTTLNLFPVKNYPKNSSLYADIYDNKLVI 654

Query: 642  FASSGKVSKLEIDQQFDVRTVTTEEVGDEVSGVFAFSEGLGVIG-TFDGSTKGAKF-YNG 699
               S ++S ++++  F+V +   + +  +V G+   ++GL + G     + + A F +NG
Sbjct: 655  GGVSNRISIVDLNDDFEVTSSKNQTIQGDVHGITKTNQGLLIFGDILSSNNQSAVFLFNG 714

Query: 700  SFFDIPLSHSNVTTFTNFTLDGAELVSLGNYYAINTTTDTLFRNSSKMTLTARSAGLNNL 759
            SF ++      V +  N +L   + + L N Y +N +++ L RNSS  +L+  +AG N  
Sbjct: 715  SFENVFNQSRTVNSALNISLANNDFIVLDNDYVVNASSNALIRNSSSFSLSLWAAGNNGD 774

Query: 760  GETVFYGSLTRNEYTDLXXXXXXXXXXXXXXXXXXXXXXXWYDATYIDNSTTGYAFYDPS 819
            G+ +F G+++  +Y +L                       +  A Y++ S T YA Y+  
Sbjct: 775  GDVLFSGAVSHMQYGNLNGSVRFLNENEIEPLNLEGGIVPYLGA-YLNESATAYA-YEVD 832

Query: 820  STNGSYGVSIYKDMAKERDLSYRWTNMVGSMLYSKNSSLLALGMKNETRSPQLLLTNLTT 879
            S N  Y        + E   S+ W++ +  MLY+ N +LLA+   + T + +L + +L  
Sbjct: 833  SLNKIY-------FSNEVYPSWNWSSGITQMLYADNQTLLAVSAGSSTTA-ELSIFDLRN 884

Query: 880  GEDTATFEWKTNVSINSLIFFDQNTSVLVGGDFNESESNCSGLCLFDYERKHWSPFFDNM 939
                A     +N  IN+L+ F++N S+LVGGDF  +E NC+GLCL++YE K WS F +N 
Sbjct: 885  LTMIANETLGSNARINALVNFEKNCSMLVGGDFQMTEPNCTGLCLYNYESKTWSTFLNNT 944

Query: 940  INGSIHSMKIFNKSSLVLGGFFDINDTKQVNLASMSLTDGSYNILHQGTETILDFIFVDG 999
            I G I  +   N S L++ G F+  + + + L S +LT+ +   L  G+E  L+   V  
Sbjct: 945  IFGEITQLSFTNSSELIISGLFETKEYQSIRLGSFNLTNSTMIPLLSGSEGKLNSFTV-- 1002

Query: 1000 KVDNLVAVSANDLFRLTNNNWESISAQFDDSSVFGGLSEFP-IQQGGQNKKREEEKNS-- 1056
              D++VA +   LF   N  W   S   + SS+    + +  I+    NK+     N+  
Sbjct: 1003 TEDSIVAWNDTSLFIYRNQEWNITSLPGNASSISSVSAIYTDIESNTLNKRGINNVNNGS 1062

Query: 1057 -LLITGDLLHKTYGKISAALYDFNDWIPYFSTTPATSTDGLGQSRIYSNKDISSAFNYQG 1115
             LL+ G+     YG + + L+DF  W PYF +    +++      I+ N+D+S+ FN Q 
Sbjct: 1063 ILLLNGNFNISQYGYLQSLLFDFQKWTPYFISETTNTSN--YNPIIFINRDVSTEFNSQS 1120

Query: 1116 VLQXX--XXXXXXXXXXXXXXXXXXXXXQLGAKKNKIARGFVVLIGLALAMGTLAVMGVI 1173
             L                          +  +KK KI RGFVVLIGLALA+GT++V+G+ 
Sbjct: 1121 PLANVNITVTSPQSTSSQPPSSSASSESKSKSKKKKIGRGFVVLIGLALALGTVSVLGIA 1180

Query: 1174 GIALTFFFGKSSDKYQSLEPRADESEMIDTVPPEKLMRFI 1213
            G+ L + F      Y+ ++PR DE+EM+DTVPPEKLM+F+
Sbjct: 1181 GVILAYVFKDPEGDYKPIKPRIDENEMLDTVPPEKLMKFV 1220

>ZYRO0C01804g Chr3 (140029..143658) [3630 bp, 1209 aa] {ON} similar to
            uniprot|Q12465 Saccharomyces cerevisiae YLR084C RAX2
            N-glycosylated protein involved in the maintenance of bud
            site selection during bipolar budding localization
            requires Rax1p
          Length = 1209

 Score =  695 bits (1794), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/1235 (35%), Positives = 679/1235 (54%), Gaps = 64/1235 (5%)

Query: 10   SFLVVAKLCSGTHLNTIESALGVKNFEVPSLDLSGSNNEEIQLLGNFQNLNYYRYTGQDN 69
            SF  +  + +G+ L+ ++  L   N +VP LDL+ S N+ ++LLG+FQ+L +Y+YTGQ+N
Sbjct: 8    SFYFLLAITNGSQLSHLQQLLNASNIQVPKLDLTSSRNQALELLGDFQDLTFYKYTGQEN 67

Query: 70   FTG-ISDEKARESLIYHSNGTLLELSSPQYSNESFSVDHVIPLRDDSFILSGTGAISGAV 128
            FT  ++       LIY+SN T L+L++   SN++  +  ++PL +DSFILSG+G I G  
Sbjct: 68   FTSPLNSSTDSHGLIYYSNDTFLQLANG--SNDT-DIKQIVPLGEDSFILSGSGHIDGYN 124

Query: 129  LDHQVVFNLSDLSYTAIFNQSLSPVNAITVNGNKAYFGGSFKFKGPDQDTHGLIVWDFVK 188
            L  Q+ +NL+DLS+  IF + L+ VN+I V+    YFGG+F F    Q  H +++W+  K
Sbjct: 125  LQRQLHYNLTDLSFKPIFQEGLTEVNSILVDQPLVYFGGNFTFSNGSQTGHSVVLWNSEK 184

Query: 189  NEVETLPFGGLGKDSNVNSILVLDDNNILFAGNFSTIDEKSAL-NSTLGINSTSDSAP-- 245
            N    LPF G G++S VNSI+ LD +NILFAGNF  +D+   L N  LG N++S  +   
Sbjct: 185  NSTSLLPFIGFGQNSTVNSIIRLDRDNILFAGNFYELDDVKLLENHILGSNNSSSKSNWT 244

Query: 246  --ELSHKIPLKTAKWTSDGS-LQKDDLVCPSNSATSAWLGTGTTGQFELSIAHTIRPSKL 302
              EL   IPL+ A WTS  S    DD +CP +    +WL +GT+G    S+     P K+
Sbjct: 245  DVELGLAIPLQNANWTSSSSQFDADDFICP-DPERESWLQSGTSGSLACSLPQETTPYKI 303

Query: 303  RLHNARTLDEEVSLFRVITTPSNGIMNLTYLDPSSGELRTCDAWCPLLSTQNLTAAKSKA 362
            R++N+   D EVSLFR++  P+ GI+NL+Y+DP  GELR CDA+CPL + Q L  A S +
Sbjct: 304  RIYNSPVEDNEVSLFRILAEPTKGILNLSYVDPEEGELRYCDAFCPLYNRQRLEEASSNS 363

Query: 363  ASTDQVEFL--NNQTTVQWSESYQDFAFVNSVPVTSITFMALDSYGSSVGVNGFELYEDD 420
            +S + +     NN T ++W   +Q+FAFVN+VP++S+ F+AL SYGS+VG++ ++ ++  
Sbjct: 364  SSVENMTTFSDNNTTDIKWGRDFQEFAFVNNVPISSVEFVALSSYGSNVGLSSWQFFQSR 423

Query: 421  FSVYANDSFNVPDCSSTSNYSKASLSASQWDQGSSDEDYVYT-LVENSQEAPSVTFYPQI 479
             S+YAN+S N P C    +YS A++S + W QG + + Y+ T  VE+    P VTF+PQI
Sbjct: 424  ASIYANNSLNQPACGKMQSYSNATISNNDWRQGLNGQTYLSTSYVEDQGNIPRVTFHPQI 483

Query: 480  VYSGLYTINVLTPGCLADGSCQSRSVVNASLWDSNNGTLLSSITIYQNNDYEKYDNLYSG 539
             Y G Y+I + TPGCL DG+C  R++VN +LWD ++   LSS  IY+NN+  KYD L+ G
Sbjct: 484  QYPGNYSIKLYTPGCLGDGTCNQRAIVNVTLWDGDSNEPLSSEVIYENNNELKYDELWDG 543

Query: 540  YLENEVKVVLEYEGAIGNTEGSPMMVAGQISVNTDEFDSSVFTDKYKTGKXXXXXXXXXX 599
            +L++  KV LEY   I     + ++VA  IS+    FD     +K+K             
Sbjct: 544  HLKSSPKVTLEYHSPIYPNNPTSVVVADYISLEAKSFDH---FEKHKKDITLNGIFQYQI 600

Query: 600  XXXXXXQNFKSNNSTDLAQYSVSNFAKNSNFFVDKFKNYIMLFA-SSGKVSKLEIDQQFD 658
                     +S  +T L  + +S F+ NS+ F   ++N  +L A S  K +++++D+ + 
Sbjct: 601  SNFTKNITKESIGNTSLDVFPLSYFSNNSSLFASLYENDTLLLADSKSKAAEIKLDKNWS 660

Query: 659  VRTVTTEEVGDEVSGVFAFSEGLGVIGTFDGSTKG--AKFYNGSFFDIPLSHSNVTTFTN 716
            V +  +  +  +V G+ ++S+GL + G ++ S +   A  +NGSF      + +V  FTN
Sbjct: 661  VDSSKSFNLASQVRGIGSYSDGLILFGDYNSSQRQPLALSFNGSFNSYDKINRSVERFTN 720

Query: 717  FTLDGAELVSLGNYYAINTTTDTLFRNSSKMTLTARSAGLNNLGETVFYGSLTRNEYTDL 776
              L G EL+   N +  N ++ +   N+++ +L+  SAG N  G+ +F G+++ N+Y +L
Sbjct: 721  IDLKGTELLVFDNEFFYNVSSQSYVSNTTRFSLSVWSAGQNTNGDLIFSGAVSDNDYENL 780

Query: 777  XXXXXXXXXXXXXXXXXXXXXXXWYDATYIDNSTTGYAFYDPSS-----TNGSYGVSIYK 831
                                    Y   Y++++ T YA+ D S      +NG  G     
Sbjct: 781  QGPVSLFQNGSAVSSNIKDNINP-YMGAYLNDTLTAYAYKDGSDSRIVFSNGDEG----- 834

Query: 832  DMAKERDLSYRWTNMVGSMLYSKNSSLLALGMKNETRSPQLLLTNLTTGEDTATFEWKTN 891
                     +RWTN + +M+Y    +LLALG  +    PQL + NLTT E  A       
Sbjct: 835  --------PWRWTNSIETMIYRNRDALLALGTSSSPSLPQLSVLNLTTSEVLANETLDKG 886

Query: 892  VSINSLIFFDQNTSVLVGGDFNESESNCSGLCLFDYERKHWSPFFDNMINGSIHSMKIFN 951
              +NS+I F +N+++L+GG+F+ S+++C+GLCL++Y+ K WS F ++ I G +  +++ N
Sbjct: 887  AEVNSMILFGKNSTLLIGGNFSFSDAHCNGLCLYNYKNKRWSTFANDSITGQVTQVQLRN 946

Query: 952  KSSLVLGGFFDINDTKQVNLASMSLTDGSYNILHQGTETILDFIFVDGKVDNLVAVSAND 1011
             S L++ G   +N T  VNL S+++T      L +G E  L    V    D LV  +   
Sbjct: 947  SSELLIAGSLRVNGTSDVNLVSVNITGQGMKTLLRGWEGPLRSFVV--SEDRLVVWNDTS 1004

Query: 1012 LFRLTNNNWESISAQFDDSSVFGGLSEFPIQQGGQNKKREEEKNS--------LLITGDL 1063
            L    N +W  IS    +S+ F  L +  I Q       E+  NS        LL+ G+ 
Sbjct: 1005 LMAYDNTSWRHISTS--NSTSFTKLQD--IHQVSLEHSLEKRANSSSNSNLDGLLVYGN- 1059

Query: 1064 LHKTYG-KISAALYDFNDWIPYFSTTPATSTDGLGQSRIYSNKDISSAFNYQGVLQXXXX 1122
              KT G    A++YD+  W P F     +     G + I+ N+D+S  F  + +L     
Sbjct: 1060 -DKTQGDSYQASIYDYYSWTPLFIANSKSENSNSGPN-IFMNQDVSDFFISEQMLP---N 1114

Query: 1123 XXXXXXXXXXXXXXXXXXXQLGAKK----NKIARGFVVLIGLALAMGTLAVMGVIGIALT 1178
                                 G KK    +K+ RG+VVLIGLALA+GT+ V+GV GI + 
Sbjct: 1115 PTNHTSSRSSSSSSSAVTSNSGDKKHRASHKVDRGYVVLIGLALAIGTVVVIGVFGILIA 1174

Query: 1179 FFFGKSSDKYQSLEPRADESEMIDTVPPEKLMRFI 1213
            + FG+    Y+ L P A+ ++  +T PP K  +F+
Sbjct: 1175 YMFGEDIGGYEFLSPPAEGTKAAETAPPAKSSKFL 1209

>Suva_10.168 Chr10 complement(301631..305293) [3663 bp, 1220 aa] {ON}
            YLR084C (REAL)
          Length = 1220

 Score =  692 bits (1787), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 429/1224 (35%), Positives = 679/1224 (55%), Gaps = 53/1224 (4%)

Query: 20   GTHLNTIESALGVKNFEVPSLDLSGSNNEEIQLLGNFQNLNYYRYTGQDNFTG-ISDEKA 78
             + L +I++ L +++  +PSL++S  N+  IQ+LG    L++Y YTGQ NFT  I  E  
Sbjct: 20   ASQLQSIKALLDIEDNVLPSLNISQDNDNAIQILGGVDALSFYEYTGQQNFTKEIGSETN 79

Query: 79   RESLIYHSNGTLLELSSPQYSNESFSVDHVIPLRDDSFILSGTGAISGAVLDHQVVFNLS 138
               L+Y+SN T + L   + ++E   +D + P   DSFILSG+G+I+G  L +QV++NLS
Sbjct: 80   SRGLVYYSNNTYILL---EEADEDTRIDKITPFGADSFILSGSGSINGVPLGNQVLYNLS 136

Query: 139  DLSYTAIFNQSLSPVNAITVNGNKAYFGGSFKFKGPDQDTHGLIVWDFVKNEVETLPFGG 198
             LS   IF QSL  V A+ VN    YFGG+F +       HG +VWD   N  + LPFGG
Sbjct: 137  TLSMARIFTQSLGSVEAVLVNDTSVYFGGNFSYNNGSMTGHGALVWDSTSNTTQLLPFGG 196

Query: 199  LGKDSNVNSILVLDDNNILFAGNFSTIDE--------KSALNSTLGINSTSDSAPELSHK 250
             G+DSNVNSI+ L+D+NILFAG F T+D+         +  N++  +N+T+    EL  +
Sbjct: 197  FGEDSNVNSIVKLNDDNILFAGKFYTLDDSSILTTSSTNTTNASSTLNATT---LELGQR 253

Query: 251  IPLKTAKWTSDGS--LQKDDLVCPSNSATSAWLGTGTTGQFELSIAHTIRPSKLRLHNAR 308
            IPL+ A W S GS   +   LVCP +++  AWL  GT+G    ++ + + P+K+RL+N+ 
Sbjct: 254  IPLRYASWDSQGSTTFESSYLVCP-DTSKDAWLYPGTSGSLVCTLPYEVAPTKIRLYNSP 312

Query: 309  TLDEEVSLFRVITTPSNGIMNLTYLDPSSGELRTCDAWCPLLSTQN-LTAAKSKAASTDQ 367
              D ++SLF+++T PS  IMNLTYLDP SGEL++CD +CPL S    L+A+++ ++S D 
Sbjct: 313  NSDNDISLFQILTNPSGSIMNLTYLDPISGELQSCDEFCPLYSRDTLLSASQNVSSSLDM 372

Query: 368  VEFL-NNQTTVQWSESYQDFAFVNSVPVTSITFMALDSYGSSVGVNGFELYEDDFSVYAN 426
            + F+ NN T V+WS  +QDFAF N + VTS+ F AL+SYG+ VG++G ELY+D FS YAN
Sbjct: 373  ISFIDNNNTDVKWSSDFQDFAFANELSVTSLKFTALNSYGNKVGLSGLELYQDTFSTYAN 432

Query: 427  DSFNVPDCSSTSNYSKAS-LSASQWDQGSSDEDYVYT--LVENSQEAPSVTFYPQIVYSG 483
            +S N   CS+ +N S +S LS ++W  G + + Y+    +   ++  P+VTFYP I++ G
Sbjct: 433  NSLNEYGCSALANDSSSSILSDNKWYDGLTGQSYIAIDYVPNQTKPTPTVTFYPSIIHPG 492

Query: 484  LYTINVLTPGCLADGSCQSRSVVNASLWDSNNGTLLSSITIYQNNDYEKYDNLYSGYLEN 543
             YTIN  TPGC+ D +C SR +VN ++W+  N T++ +  IYQNN+  KYD +YSGYL+ 
Sbjct: 493  HYTINTYTPGCVQDNTCSSRGIVNVTMWNPQNNTMMETYLIYQNNNNLKYDKIYSGYLDF 552

Query: 544  EVKVVLEYEGAIGNTEGSPMMVAGQISVNTDEFDSSVFTDKYKTGKXXXXXXXXXXXXXX 603
              ++V++Y   I  +  + +MVA Q+++ TD  DS     +  + K              
Sbjct: 553  SPEIVMKYVSGIYASNTATIMVADQVNIITDSLDSFSSLSETTSVKRHTPLNGILQYQRS 612

Query: 604  XXQNFKSNNS----TDLAQYSVSNFAKNSNFFVDKFKNYIMLFASSGKVSKLEIDQQFDV 659
                  SN +    T L  +SV N+ KNS+ F D +   ++L      +S ++ +   +V
Sbjct: 613  NFTATTSNGTKIANTTLNLFSVDNYPKNSSMFADVYDKKLILGGKDNHISVIDFNDNLEV 672

Query: 660  RTVTTEEVGDEVSGVFAFSEGLGVIGTFDGSTKGAK--FYNGSFFDIPLSHSNVTTFTNF 717
             +   + +  +V G+   ++GL + G    S   +    +NGSF  +      V    N 
Sbjct: 673  TSSENKTIQGDVYGMTQTNQGLLIFGDVRSSDNKSTVLMFNGSFESVSNYSKAVENAINI 732

Query: 718  TLDGAELVSLGNYYAINTTTDTLFRNSSKMTLTARSAGLNNLGETVFYGSLTRNEYTDLX 777
            TL   +L+   N Y  N ++++   NS+  +L+  SAG N+  + +F G++++ +++DL 
Sbjct: 733  TLANNDLIVFNNDYIFNASSNSQISNSTSFSLSLWSAGNNDNDDVLFSGAVSQMQFSDLS 792

Query: 778  XXXXXXXXXXXXXXXXXXXXXXWYDATYIDNSTTGYAFYDPSSTNGSYGVSIYKDMAKER 837
                                  +  A Y++ ST  YA+     TN    +    +++   
Sbjct: 793  GSARFLNESTVEALNLNKGIVPYLGA-YLNESTIAYAY----KTNSLSKIYFSNNVSP-- 845

Query: 838  DLSYRWTNMVGSMLYSKNSSLLALGMKNETRSPQLLLTNLTTGEDTATFEWKTNVSINSL 897
              S+ W+N +  M+Y+ N +LL +G ++ T + +L + NL      A     +N  IN+ 
Sbjct: 846  --SWNWSNNITKMVYANNQTLLVIGSESSTTA-ELSILNLRNFTTIANETLGSNAKINAF 902

Query: 898  IFFDQNTSVLVGGDFNESESNCSGLCLFDYERKHWSPFFDNMINGSIHSMKIFNKSSLVL 957
            + F++N+S+LVGGDF  S+ NC+GLC+++YE K WS FF+N I G I  +   N+S L++
Sbjct: 903  VNFEKNSSLLVGGDFQMSKPNCTGLCVYNYESKSWSTFFNNTIVGEITQLAFNNESELII 962

Query: 958  GGFFDINDTKQVNLASMSLTDGSYNILHQGTETILDFIFVDGKVDNLVAVSANDLFRLTN 1017
             G F     + + L S +LT+ +   L  G+   L+   V    +++VA +   L    +
Sbjct: 963  SGLFATEKQQSIRLGSFNLTNSTMVPLLTGSGGKLNSFTV--TEESIVAWNDTSLLIYKD 1020

Query: 1018 NNWESISAQFDDSSVFGGLSEFPIQQGGQNKKR---EEEKNS-LLITGDLLHKTYGKISA 1073
              W + S   + SSV    +          +KR   + EK S LL+ G+     YG +  
Sbjct: 1021 QKWNTTSLPGNGSSVSSVTTIDTNTDSYALRKRATTDAEKGSILLLNGNFSIPQYGNLQG 1080

Query: 1074 ALYDFNDWIPYFS--TTPATSTDGLGQSRIYSNKDISSAFNYQGVLQXXXXXXXXXXXXX 1131
             L+D  +W PYF+  T  A+S +      I+ N+D+S+ FN Q  L              
Sbjct: 1081 LLFDSQNWTPYFTSETLEASSYN----PTIFINRDVSADFNSQIPLSNSNMTVTSPQSTS 1136

Query: 1132 XXXXXXXXXXQLG--AKKNKIARGFVVLIGLALAMGTLAVMGVIGIALTFFFGKSSDKYQ 1189
                      +    +KK  + RGFVVLIGLALA+GT++V+G++G+ L + F      Y+
Sbjct: 1137 PLSPSSSASSEPNKKSKKKNMDRGFVVLIGLALALGTVSVLGIVGVILAYVFKDPEGDYR 1196

Query: 1190 SLEPRADESEMIDTVPPEKLMRFI 1213
             ++PR DE+EM+DTVPPEKLM+F+
Sbjct: 1197 PIKPRIDENEMLDTVPPEKLMKFV 1220

>NDAI0B02380 Chr2 complement(595444..599103) [3660 bp, 1219 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1219

 Score =  676 bits (1743), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 424/1243 (34%), Positives = 688/1243 (55%), Gaps = 61/1243 (4%)

Query: 5    SWLATSFLVVAKLCSGTHLNTIESALGVKNFEVPSLDLSGSNNEEIQLLGNFQNLNYYRY 64
            SW+  +FL++  +   + L+ I++ L V N  +P+L+L+ SN++  QLLG+   L++YRY
Sbjct: 4    SWVF-NFLLLIHILQASQLSNIKNILNVTNVNIPTLNLTASNDDTFQLLGDIDGLSFYRY 62

Query: 65   TGQDNFT-GISDEKARESLIYHSNGTLLELSSPQYSNESFSVDHVIPLRDDSFILSGTGA 123
             GQ NFT GI        LIY+SN TL++L  P  SN+++ +  + P   DSFILSGTG+
Sbjct: 63   KGQQNFTTGIIPGSNSNGLIYYSNNTLIQLEEP--SNDTY-IAKITPFGSDSFILSGTGS 119

Query: 124  ISGAVLDHQVVFNLSDLSYTAIFNQSLSPVNAITVNGNKAYFGGSFKFKGPDQDTHGLIV 183
            +SG  L +Q+++NL+ LS   IFN S+  V  I ++ +  YFGG+F       + H LI+
Sbjct: 120  LSGYSLTNQLLYNLTTLSIEPIFNTSIEEVKTILIDDSLVYFGGNFTVLNGTSNIHSLIM 179

Query: 184  WDFVKNEVETLPFGGLGKDSNVNSILVLDDNNILFAGNFSTIDEKSAL--NSTLGINSTS 241
            WD   +  E L FGG G++S +NSI+ L+D+NILFAG F T+DE   L  N+T   N+  
Sbjct: 180  WDSTSSSTEFLNFGGFGENSIINSIVKLNDDNILFAGEFYTLDEPDFLIQNTTSSQNNIF 239

Query: 242  DSAP-ELSHKIPLKTAKW-TSDGSLQKDDLVCPSNSATSAWLGTGTTGQFELSIAHTIRP 299
            +S   ++   +PL  + W T + +   D  VCP ++   +W+ +GTTG     +   + P
Sbjct: 240  NSTTVDIGQLVPLSASTWDTGESTFDSDTFVCP-DTTEESWIQSGTTGSLTCKLPFEVAP 298

Query: 300  SKLRLHNARTLDEEVSLFRVITTPSNGIMNLTYLDPSSGELRTCDAWCPLLSTQNLTAAK 359
            +K+R++N+   D +VSLFR++T  + GIMNLTY+DP S EL+ CDA+CPL S   L+ A 
Sbjct: 299  TKIRIYNSPNEDNQVSLFRILTNEAQGIMNLTYIDPISHELKHCDAFCPLYSKAILSQAY 358

Query: 360  SKAAS-TDQVEFL-NNQTTVQWSESYQDFAFVNSVPVTSITFMALDSYGSSVGVNGFELY 417
            +   S +D +  L +N T ++W++ +Q+FAF+N + V+S+ F+ALDSYG++V ++ F+LY
Sbjct: 359  ANTTSPSDTIHLLADNTTDIKWTQEFQEFAFINQISVSSVQFVALDSYGNNVALSSFQLY 418

Query: 418  EDDFSVYANDSFNVPDCSSTSNYSKASLSASQWDQGSSDEDYV-YTLVENSQEAPSVTFY 476
            ++ ++V+AND+ N P+C+S  + S +SLSA+ W+ G + + Y+  T   N    P V+F 
Sbjct: 419  QNAYAVFANDTLNEPNCNSIESSSSSSLSANDWEMGLTGQTYISTTYTPNQDPVPYVSFS 478

Query: 477  PQIVYSGLYTINVLTPGCLADGSCQSRSVVNASLWDSNNGTLLSSITIYQNNDYEKYDNL 536
            PQI Y G Y+IN+ TPGC  D +C SR++VN ++WDS+  ++L++  IYQNN   KYD L
Sbjct: 479  PQIKYPGQYSINIYTPGCTQDDTCSSRAIVNVTVWDSDGTSILATELIYQNNKELKYDEL 538

Query: 537  YSGYLENEVKVVLEYEGAIGNTEGSPMMVAGQISVNTDEFDSSVFTDKYKTGKXXXXXXX 596
            YSGYL +  +V +EY   +  +     +VA +++V  D  +    T     G        
Sbjct: 539  YSGYLSSSPRVTIEYVSGLYASNTVATVVADRLNVLIDSLEVPGLTSN---GTNNTEIMN 595

Query: 597  XXXXXXXXXQNFKSNNS---------TDLAQYSVSNFAKNSNFFVDKF-KNYIMLFASSG 646
                      NF +++S         T L Q S+  F+KN++ + D +  N ++L  S+G
Sbjct: 596  LNGLLQYQISNFSTSSSETTDVKITNTSLNQLSLEQFSKNTSMYADLYDDNTLLLGNSNG 655

Query: 647  KVSKLEIDQQFDVRTVTTEEVGDEVSGVFAFSEGLGVIGTFDGSTKGAKF--YNGSFFDI 704
             +  +++++  D+ +     +    +G  ++S G+   G ++ S+K      YNG+F +I
Sbjct: 656  GIKVVKLNENMDIESSNEASLTGNTAGFSSYSGGILAYGEYNLSSKITYLVNYNGTFNEI 715

Query: 705  P--LSHSNVTTFTNFTLDGAELVSLGNYYAINTTTDTLFRNSSKMTLTARSAGLNNLGET 762
            P    +S++T   N T+   EL+ + N    N ++ +   NSS + L+  S+G N   +T
Sbjct: 716  PNFNKNSSITNVVNLTIHDTELLVIDNQAIYNVSSSSTITNSSALQLSLWSSGSNLNRDT 775

Query: 763  VFYGSLTRNEYTDLXXXXXXXXX-XXXXXXXXXXXXXXWYDATYIDNSTTGYAFYDPSST 821
            VF G++   +YTDL                         Y   ++++S + YA    S T
Sbjct: 776  VFSGAIALLDYTDLNGSIAIGNNFTVTNITNNVSSTNSLYTGLFLNDSLSIYA----SKT 831

Query: 822  NGSYGVSIYKDMAKERDLSYRWTNMVG--SMLYSKNSSLLALGMKNETRSPQLLLTNLTT 879
            +       Y ++      S  W+   G   M+YS + ++LA+   +  ++ +L + NLTT
Sbjct: 832  DS------YSELLFSNGYSAPWSFFEGINYMVYSSHQTMLAVASSDFNKNSELSILNLTT 885

Query: 880  GEDTATFEWKTNVSINSLIFFDQNTSVLVGGDFNESESNCSGLCLFDYERKHWSPFFDNM 939
             E  A      N  IN LI F+ N++++VGG+F   +SNCSGLCL++Y+   W  F ++ 
Sbjct: 886  FETIANETLNVNSKINGLINFEHNSTLIVGGNFTILQSNCSGLCLYNYDSNEWLTFANHS 945

Query: 940  INGSIHSMKIFNKSSLVLGGFFDINDTKQVNLASMSLTDGSYNILHQGTETILDFIFVDG 999
            ING+I  M++ N + L+L G F+  +   VNLA M L+  + + +  G   IL      G
Sbjct: 946  INGTIAQMELINGTQLLLSGLFNAQNISSVNLAIMDLSTYAVSSIKMGDANILQSFATIG 1005

Query: 1000 KVDNLVAVSANDLFRLTNNNWESISAQFDDSSVFGGLSEFPIQQGGQNKKRE--EEKNSL 1057
              D ++  +   L    N  W +I + F+ S+    +   PI  G   +KR+     +  
Sbjct: 1006 --DKIITWNGIMLESYENGAWSTIQSNFNSSTTIRSIE--PIGFGPTLQKRDGTGSADGF 1061

Query: 1058 LITGDLLHKTYGKISAALYDFNDWIPYFSTTPATSTDGLGQSRIYSNKDISSAFNYQGVL 1117
            +I G++    YG I A +Y+F +W PY+     +ST+     +I+ N+D S+ +N Q VL
Sbjct: 1062 IINGNIYDTEYGTIQAMIYNFKEWRPYY---IISSTNSQIAGQIFMNRDDSALYNSQSVL 1118

Query: 1118 Q-------XXXXXXXXXXXXXXXXXXXXXXXQLGAKKNKIARGFVVLIGLALAMGTLAVM 1170
            Q                              Q+G K  KI RGFVVLIGLALA+GT++++
Sbjct: 1119 QNPNNATVTTPSSTSSGTPSATHSSQPHHQKQVGRK--KIDRGFVVLIGLALALGTVSLL 1176

Query: 1171 GVIGIALTFFFGKSSDKYQSLEPRADESEMIDTVPPEKLMRFI 1213
            G+IG+ L + F      + +L PR +E EM++TVPPEKLM+F+
Sbjct: 1177 GIIGLVLAYIFKDGDGSHDALNPRTNEDEMLETVPPEKLMKFL 1219

>KLLA0F18975g Chr6 complement(1739543..1743145) [3603 bp, 1200 aa]
            {ON} similar to uniprot|Q12465 Saccharomyces cerevisiae
            YLR084C RAX2 N-glycosylated protein involved in the
            maintenance of bud site selection during bipolar budding
            localization requires Rax1p
          Length = 1200

 Score =  673 bits (1736), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 416/1241 (33%), Positives = 670/1241 (53%), Gaps = 69/1241 (5%)

Query: 1    MLTKSWLATSFLVVAKLCSGTHLNTIESALGVKNFEVPSLDLSGSNNEEIQLLGNFQNLN 60
            M + + L    LV+A +  G+ L+ IE  L +  +E P+ D     + ++  + NF+ L 
Sbjct: 1    MFSINPLIYVLLVLAGMVRGSQLSNIEKLLNISRYEAPNWD-----SPDLTYMNNFEELT 55

Query: 61   YYRYTGQDNFTGISDEKARESLIYHSNGTLLEL--SSPQYSNESFSVDHVIPLRDDSFIL 118
               YTGQ NFT  ++E    SL+Y+SN T ++L  +SP+ +     V  ++PL +DSFIL
Sbjct: 56   VISYTGQQNFTVQANES---SLLYYSNDTFVKLFETSPETT-----VTMIVPLFEDSFIL 107

Query: 119  SGTGAISGAVLDHQVVFNLSDLSYTAIFNQSLSPVNAITVNGNKAYFGGSFKFKGPDQDT 178
            SGTG I+G  L+ Q++ NL+ L+ + IF  ++  V  I        F G+F     ++  
Sbjct: 108  SGTGQINGVALEQQILLNLTSLTTSPIFPSAVENVMDILTVNETVIFVGNFSMSVSNETG 167

Query: 179  HGLIVWDFVKNEVETLPFGGLGKDSNVNSILVLDDNNILFAGNFSTIDEKSALNSTLGIN 238
            HG ++WD V N  E  PF G G++S VNS++ L+ +NILFAG+F  I   S L    G N
Sbjct: 168  HGAVLWDVVANTTELFPFKGFGENSIVNSVVKLNSDNILFAGSFQEIQNASLLQE-FG-N 225

Query: 239  STSDSAPELS-----HKIPLKTAKWTSDGSLQKDDLVCPSNSAT--SAWLGTGTTGQFEL 291
            +T+ S  +L+       +PLK +  T + ++Q D L+CPS      SA     +T QF+L
Sbjct: 226  ATNSSHEDLTSLQFDQSVPLKLSSITGE-NVQSDILLCPSGGQNGWSASEAVQSTLQFDL 284

Query: 292  SIAHTIRPSKLRLHNARTLDEEVSLFRVITTPSNGIMNLTYLDPSSGELRTCDAWCPLLS 351
               + I PSK+R++N+   + E+SLFR+IT PSNGIMNLTYLDP+SGEL+ CDAWCPLLS
Sbjct: 285  --KNEIHPSKVRIYNSVEENSEISLFRIITGPSNGIMNLTYLDPASGELKQCDAWCPLLS 342

Query: 352  TQNLTA-AKSKAASTDQVEFLNNQTTVQWSESYQDFAFVNSVPVTSITFMALDSYGSSVG 410
             ++LT  +++  A+   V   NN T ++WSESYQ+FAFVN +PVT + F+AL SYGS+  
Sbjct: 343  IEDLTQISQNSTAAPKSVGINNNSTNLKWSESYQEFAFVNDIPVTMLQFVALASYGSNAA 402

Query: 411  VNGFELYEDDFSVYANDSFNVPDCSSTSNYSKASLSASQWDQGSSDEDYVYTLVENSQEA 470
            ++  E++E +F VYAN+S+N P+C S + YSKA LS+  W      + Y+ T ++++   
Sbjct: 403  LHSIEIFETEFMVYANNSYNEPNCESVTEYSKAELSSDNWYTTDESDTYISTNIDDN--I 460

Query: 471  PSVTFYPQIVYSGLYTINVLTPGCLADGSCQSRSVVNASLWDSNNGTLLSSITIYQNNDY 530
            P VTF+P I Y G YT N+ TPGCL D SC  R +VN ++ D +   +L+S+ IYQ N+ 
Sbjct: 461  PYVTFHPNITYPGRYTFNIYTPGCLQDNSCSKRGIVNVTMIDRSINEVLASVLIYQTNNE 520

Query: 531  EKYDNLYSGYLENEVKVVLEYEGAIGNTEGSPMMVAGQISVNTDEFDSSVFTDKYKTGKX 590
            +K+D LY+G L +  ++++ ++ AIG  E   +MV  ++ V T+  D+   +    T   
Sbjct: 521  DKFDPLYTGSLGSAPEIIVTWDKAIG--ESDSVMVVDRLGVITEYIDTISISSNDTTFHL 578

Query: 591  XXXXXXXXXXXXXXXQNFKSNNSTDLAQYSVSNFAKNSNFFVDKFKNYIMLFASSGKVSK 650
                             F +N++     Y++ NF  ++N +     N I++  +   ++K
Sbjct: 579  NGLFQYNTANVTASI--FSTNDT--FNDYALYNFPLDANLYAASLNNDILIGGNFNGIAK 634

Query: 651  LEIDQQFDVRTVTTEEVGDEVSGVFAFSEGLGVIGTF---DGSTKGAKFYNGSFF----- 702
            +E++ +  + +          +G+F +S GL + GT+   + S      Y+G+ F     
Sbjct: 635  VELNDEALISSSQKLGTSGYTTGIFEYSNGLLLSGTYQVENDSRHEILSYDGNAFNSFGQ 694

Query: 703  -DIPLSHSNVTTFTNFTLDGAELVSLGNYYAINTTTDTLFRNSSKMTLTARSAGLNNLGE 761
             D P+         NFT+DG EL+   N Y  N + +    NSS   +T +SAG+N+  +
Sbjct: 695  LDEPIDR-----IVNFTIDGHELLLFDNAYIFNVSANMYVSNSSTFEITGQSAGINSGND 749

Query: 762  TVFYGSLTRNEYTDLXXXXXXXX--XXXXXXXXXXXXXXXWYDATYIDNSTTGYAFYDPS 819
            ++ +GS  +    +L                          Y A YI++++  YA  + S
Sbjct: 750  SLLFGSFLKRSVGELNGLASLSSDGQVSSPTLPELPTDVQPYKAAYINDTSAAYALQEGS 809

Query: 820  STNGSYGVSIYKDMAKERDLSYRWTNMVGSMLYSKNSSLLALGMKNETRSP----QLLLT 875
            + N  + V I    +    L  +W+  + + LY    ++LA+G      S     Q  + 
Sbjct: 810  TDNVQHRVLITNTNSSSHMLQIQWSAPINAFLYDNVPNILAIGTNGSNSSSQYDVQFSIL 869

Query: 876  NLTTGEDTATFEWKTNVSINSLIFFDQNTSVLVGGDFNESESNCSGLCLFDYERKHWSPF 935
            NLT  E+ A   + TN  +NS++ F  N S+LVGG +     NC+ LCL++Y+ K W+ F
Sbjct: 870  NLTGYENVARVNFSTNERVNSMVSFSSNNSILVGGSY--EIDNCNDLCLYNYQTKEWTSF 927

Query: 936  FDNMINGSIHSMKIFNK-SSLVLGGFFDINDTKQVNLASMSLTDGSYNILHQGTETILDF 994
             ++ I G I  M+  ++  +L++GG    N+   + L S+ +    ++ +  GTE +L F
Sbjct: 928  LNDSITGDIRQMQFADEGKTLLVGGLIKTNNESNIQLLSVEVGSNIFSTVKSGTEPLLSF 987

Query: 995  IFVDGKVDNLVAVSANDLFRLTNNNWESISAQFDDSSVFGGLSEFPIQQGGQNKKREEEK 1054
            + +D   DN++A   +++ RL +  W S   Q ++ S+  G   F +  G ++KKR+E  
Sbjct: 988  VPIDDSTDNIIAQMNSEILRLESGTWSSFGPQLNNDSIVSG---FKVLSGTESKKRDEGS 1044

Query: 1055 NSLLITGDLLHKTYGKISAALYD--FNDWIPYFSTTPATSTDGLGQSRIYSNKDISSAFN 1112
            + +L+ G L    +G +++ +YD     W PYF  +     + L  S  + N +     +
Sbjct: 1045 HIVLLEGTLNSSEWGNLTSVVYDGSTQKWQPYFVISDPKEQESLPSSSFFQNVNDLYLSS 1104

Query: 1113 YQGVLQXXXXXXXXXXXXXXXXXXXXXXXQLGAKKNKIARGFVVLIGLALAMGTLAVMGV 1172
             Q VLQ                           K  KI RGF+VLIGLALA+ T+AV+G+
Sbjct: 1105 SQTVLQSNNSDTSASSTPTPSTTSSSHS----TKDKKIDRGFIVLIGLALALATVAVIGL 1160

Query: 1173 IGIALTFFFGKSSDKYQSLEPRADESEMIDTVPPEKLMRFI 1213
            IG  + +FF  +++ Y+SL+PR ++ EM+DTVPPEKLM+FI
Sbjct: 1161 IGALICYFF-INNNGYESLKPRINQDEMLDTVPPEKLMKFI 1200

>NCAS0B04980 Chr2 complement(912114..915728) [3615 bp, 1204 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1204

 Score =  671 bits (1732), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 423/1230 (34%), Positives = 681/1230 (55%), Gaps = 43/1230 (3%)

Query: 1    MLTKSWLATSFLVVAKLCSGTHLNTIESALGVKNFEVPSLDLSGSNNEEIQLLGNFQNLN 60
            ML K  L    L+     S   L++++  L + +  +P+L+L+  +N   +LLG   +L+
Sbjct: 1    MLIKILLGALLLIPQIYAS--QLSSLQENLNITHINIPNLNLTTDDNS-FELLGGIDSLS 57

Query: 61   YYRYTGQDNFT-GISDEKARESLIYHSNGTLLELSSPQYSNESFSVDHVIPLRDDSFILS 119
            +YRYTGQ NFT GI        L Y+SN T ++L  P   +    ++ +IP   DSFILS
Sbjct: 58   FYRYTGQQNFTSGILPNSNSNGLTYYSNNTFIQLYEPSLDSR---IERIIPFGSDSFILS 114

Query: 120  GTGAISGAVLDHQVVFNLSDLSYTAIFNQSLSPVNAITVNGNKAYFGGSFKFKGPDQDTH 179
            G G++ G  L +Q++FNLS  S   IFNQ+L  VN+I V+G    FGG+F       + H
Sbjct: 115  GKGSLGGYSLSNQLLFNLSSFSLKQIFNQTLDSVNSILVDGTVVCFGGNFTLSTNSLNGH 174

Query: 180  GLIVWDFVKNEVETLPFGGLGKDSNVNSILVLDDNNILFAGNFSTIDEKSALNSTLGINS 239
             + +W++  N    LPF G G++S +NSI  L+D+NILFAG F T+D  + LN    +N 
Sbjct: 175  SVALWNYTANSTSLLPFVGFGENSLINSITKLNDDNILFAGKFYTLDNSTLLNV---VND 231

Query: 240  TSDSAPE--LSHKIPLKTAKWTSDGS-LQKDDLVCPSNSATSAWLGTGTTGQFELSIAHT 296
            T  +  +  L   IPL  A W+S GS   ++  VCP +    AW   GT+G    ++   
Sbjct: 232  TMRNISDINLGQLIPLSAATWSSTGSFFDEETFVCP-DPTIEAWFQNGTSGTLNCNLPFD 290

Query: 297  IRPSKLRLHNARTLDEEVSLFRVITTPSNGIMNLTYLDPSSGELRTCDAWCPLLSTQNL- 355
            + P+K+R++N+   D E+SLFR+ + PS  IMNLTY+DP  G+L+ CDA+CPL + Q L 
Sbjct: 291  VAPTKIRIYNSPDPDNEISLFRIFSDPSESIMNLTYIDPVLGQLKHCDAFCPLYTKQVLK 350

Query: 356  TAAKSKAASTDQVEFLNNQTT-VQWSESYQDFAFVNSVPVTSITFMALDSYGSSVGVNGF 414
            +A+++   S++ +E LN+ T+ ++WS+ +Q+FAFVN +  +S+ F+AL+SYG++VG++ F
Sbjct: 351  SASENVTLSSEMIELLNDNTSDIRWSQDFQEFAFVNQLSASSLRFLALNSYGTNVGLSSF 410

Query: 415  ELYEDDFSVYANDSFNVPDCSSTSNYSKASLSASQWDQGSSDEDYVY-TLVENSQEAPSV 473
            ++Y+D ++++AN+S N P C+S  ++S + LS + W +G  D++YV  T + +    P V
Sbjct: 411  QIYQDAYAIFANNSLNEPSCNSLESFSSSDLSNNTWTRGMDDQNYVKTTYIPHQGVLPEV 470

Query: 474  TFYPQIVYSGLYTINVLTPGCLADGSCQSRSVVNASLWDSNNGTLLSSITIYQNNDYEKY 533
            TF+P + YSG Y+I + TPGC  D +C SR +VN ++W++NN ++LS+  IYQNND  KY
Sbjct: 471  TFHPDLKYSGQYSIELYTPGCQQDNTCSSRGIVNVTVWNTNNNSILSTTLIYQNNDQLKY 530

Query: 534  DNLYSGYLENEVKVVLEYEGAI--GNTEGSPMMVAGQISVNTDEFDSSVF--TDKYKTGK 589
            D LYSGYL    K+ + Y   I  G T G+ ++    I +N+ +  + +   T+  +   
Sbjct: 531  DELYSGYLNYSPKITVTYHSGIYSGTTAGTVVVDRLNIMINSLDILNEIHNSTNSLELNG 590

Query: 590  XXXXXXXXXXXXXXXXQNFKSNNSTDLAQYSVSNFAKNSNFFVDKFKNYIMLFASSGKVS 649
                               +  N T + Q +++ F+ N +     + + +++ A    +S
Sbjct: 591  LFQYQLSNFSTSSKDSSIARVAN-TSINQLTLTGFSSNVSLSASLYNDTLLVGAGDDGLS 649

Query: 650  KLEIDQQFDVRTVTTEEVGDEVSGVFAFSEGLGVIGTFDGSTKGAKF--YNGSFFDIPLS 707
              E+++   +++ + + +  +++G+ ++S G+ V G F+ S + +    +NGSF  I   
Sbjct: 650  IYELNKDLAIQSSSQQGIEGKITGLKSYSNGVLVYGDFNSSKESSNVLSFNGSFDSIGNI 709

Query: 708  HSNVTTFTNFTLDGAELVSLGNYYAINTTTDTLFRNSSKMTLTARSAGLNNLGETVFYGS 767
             S +T F N T+D +EL+   N    N ++ +   N+S  +L+  S+G N+ G+T+F G+
Sbjct: 710  TSPITNFANITIDDSELLVFDNNLIFNVSSSSQISNTSSFSLSLWSSGSNSNGDTLFSGA 769

Query: 768  LTRNEYTDLXXXXXXXXXXXXXXXXXXXXXXXWYDATYIDNSTTGYAFYDPSSTNGSYGV 827
            L++ ++T+L                        Y A ++++S TGY   + SST+     
Sbjct: 770  LSQVQFTNLSGSVSIANNLSATSLRSIGSP---YAAIFLNDSVTGYVLKNDSSTSE---- 822

Query: 828  SIYKDMAKERDLSYRWTNMVGSMLYSKNSSLLALGMKNETRSPQLLLTNLTTGEDTATFE 887
             I+ D +K     +RWT  V SMLY  N S+LA+G  +     +L + NL + +  A   
Sbjct: 823  MIFSDGSKA---PWRWTGYVDSMLYLTNQSMLAVGSSSSVNG-ELSILNLDSFKVLANET 878

Query: 888  WKTNVSINSLIFFDQNTSVLVGGDFNESESNCSGLCLFDYERKHWSPFFDNMINGSIHSM 947
               N S+ +++ F++N+S+LVGG+F+ S + C GLCL++Y    W  F +  ING+I  +
Sbjct: 879  LNQNSSVKTMVHFERNSSILVGGNFSISNTECFGLCLYNYTGNQWYTFLNGTINGTITKL 938

Query: 948  KIFNKSSLVLGGFFDINDTKQVNLASMSLTDGSYNILHQG-TETILDFIFVDGKVDNLVA 1006
            +IFN S L++ G FD      VNLA M+LTD    ++  G  E + DFI +D   DN+ A
Sbjct: 939  QIFNDSQLIIAGVFDTKSQSSVNLALMNLTDNKLVLIRWGFKEPVKDFITID---DNIFA 995

Query: 1007 VSANDLFRLTNNNWESISAQFDDSSVFGGLSEFPIQQGGQNKKR---EEEKNSLLITGDL 1063
             +   LF  T+N+W  I     +SS       +        KKR   E   N L++ G +
Sbjct: 996  WNETSLFEYTSNSWVDIPISNSNSSTTIDSIGWTTTTDNNLKKRDNSETSNNVLIVKGQI 1055

Query: 1064 LHKTYGKISAALYDFNDWIPYFSTTPATSTDGLGQSRIYSNKDISSAFNYQGVLQXXXXX 1123
                YG I A +Y+F +WIPY S     S+     + ++ ++D+S  F+ Q  LQ     
Sbjct: 1056 YDNVYGHIQAMIYNFEEWIPYLSINSLVSSAN-QPAELFIDRDVSKLFDSQLALQVSNTT 1114

Query: 1124 XXXXXXXXXXXXXXXXXXQLGAKKNKIARGFVVLIGLALAMGTLAVMGVIGIALTFFFGK 1183
                              +L   K KI RGFVVLIGLALA+GT+ V+G++G+ L + F  
Sbjct: 1115 ASITASSSTPTPTSSPKKKLHQSKKKIDRGFVVLIGLALALGTMTVLGIVGVILAYAFRD 1174

Query: 1184 SSDKYQSLEPRADESEMIDTVPPEKLMRFI 1213
                Y  + PR +E EM+ TVPPEKLM FI
Sbjct: 1175 DDGDYDVITPRVNEDEMLKTVPPEKLMEFI 1204

>TDEL0F03830 Chr6 complement(701362..704949) [3588 bp, 1195 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1195

 Score =  667 bits (1721), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 426/1223 (34%), Positives = 668/1223 (54%), Gaps = 53/1223 (4%)

Query: 11   FLVVAKLCS--GTHLNTIESALGVKNFEVPSLDLSGSNNEEIQLLGNFQNLNYYRYTGQD 68
            FL+   +C    + L  +++  G+ N   P LD  G   E +QL G F  L + +Y GQ+
Sbjct: 6    FLLFQSVCLSLASQLENLKNKHGIVNIGTPRLDFPG---EALQLFGGFNALTFPQYEGQE 62

Query: 69   NFTG-ISDEKARESLIYHSNGTLLELSSPQYSNESFSVDHVIPLRDDSFILSGTGAISGA 127
            NFTG I++      ++Y+SN T ++L +   S++S+ V+ ++P   +SFIL G+G++ G 
Sbjct: 63   NFTGTINNNTDSRGIVYYSNDTFIKLING--SSDSY-VEKIVPFGSESFILGGSGSLLGY 119

Query: 128  VLDHQVVFNLSDLSYTAIFNQSLSPVNAITVNGNKAYFGGSFKFKGPDQDTHGLIVWDFV 187
             L  Q+++NLSDLS   IF  SL+ V  I  +   AYFGG+F F       H +  W+  
Sbjct: 120  ELGRQLLYNLSDLSLRPIFENSLTDVRVILEDYPVAYFGGNFSFDNGSTVGHSVATWNSS 179

Query: 188  KNEVETLPFGGLGKDSNVNSILVLDDNNILFAGNFSTIDEKSALNSTLGINSTSDS-APE 246
             N    LPFGG G++S VNSI+ LD +NILF G F T+D+++ L +    + T+ S + E
Sbjct: 180  SNTTSLLPFGGFGEESIVNSIIKLDSDNILFTGEFYTLDDQTLLITNENTSKTNHSQSIE 239

Query: 247  LSHKIPLKTAKWTSDGSLQKDD--LVCPSNSATSAWLGTGTTGQFELSIAHTIRPSKLRL 304
            ++  +PL+ A W +D     D    +CP NS   AW    T+G  E S+ +   P K+R+
Sbjct: 240  INELLPLRAATWNTDSDSSFDSSAFICP-NSQKEAWSVPSTSGSLEASLPYESYPKKVRI 298

Query: 305  HNARTLDEEVSLFRVITTPSNGIMNLTYLDPSSGELRTCDAWCPLLSTQNLTAAKSKAAS 364
            +N+      VSLFR+IT PSNGIMNLTY+DP SGEL  CDA+CPL+   +L AA +   +
Sbjct: 299  YNSPEEHNAVSLFRIITKPSNGIMNLTYVDPLSGELLNCDAFCPLMLQDSLKAAVANGNT 358

Query: 365  TDQVEFLNNQTTVQWSESYQDFAFVNSVPVTSITFMALDSYGSSVGVNGFELYEDDFSVY 424
            +  V   NN T +QWS  YQDFAFVN + VT + F+AL SYG +VG++ F+LY+D  + Y
Sbjct: 359  SQVVRLDNNLTDIQWSYDYQDFAFVNKIAVTDLQFLALSSYGDAVGLSSFQLYQDTLTTY 418

Query: 425  ANDSFNVPDCSSTSNYSKASLSASQWDQGSSDEDYVYTLVENSQEA-PSVTFYPQIVYSG 483
            AN+S N   C S    S ++LS S+W QG   + Y+       QE  P VTFYP I Y+G
Sbjct: 419  ANNSLNEVGCESNDIASTSALSDSEWQQGLFGQSYLVADFRTGQETLPKVTFYPAINYAG 478

Query: 484  LYTINVLTPGCLADGSCQSRSVVNASLWDSNNGTLLSSITIYQNNDYEKYDNLYSGYLEN 543
             YT+N+ TPGC +D +C SRS+VN ++W    G++LSSI ++QNN+  KYD +YSG+LE 
Sbjct: 479  QYTMNLYTPGCSSDQTCTSRSIVNVTMWSEVGGSILSSILLHQNNEAMKYDQVYSGHLET 538

Query: 544  EVKVVLEYEGAIGNTEGSPMMVAGQISVNTDEFDSSVFTDKYKTGKXXXXXXXXXXXXXX 603
               + LEY   I     S ++VA ++ V  +  D      K +T +              
Sbjct: 539  APVLTLEYYSPISPNNPSNVVVADRLEVIVESVD----ILKNQTDETIPLNGMFQYQLSN 594

Query: 604  XXQNFKSNNS---TDLAQYSVSNFAKNSNFFVDKFKNYIMLFASSGKVSKLEIDQQFDVR 660
               +  S  S   T L  Y+V NF KN++ F   + N + +  S   V+ +E+D+   V 
Sbjct: 595  FTNSTDSKPSIANTTLNSYTVQNFPKNASLFSSMYNNTLWVGGSVSGVAAVELDEDLHVS 654

Query: 661  TVTTEEVGDEVSGVFAFSEGLGVIGTFDGSTKGAK--FYNGSFFDIPLSHSNVTTFTNFT 718
            +      G  V G+ ++S+G+ + GTF+ S++      +NG F       + + T+TN +
Sbjct: 655  STAKYATGGTVEGISSYSDGIILFGTFNLSSQPVSTLTFNGVFGSFGNLETTLRTYTNVS 714

Query: 719  LDGAELVSLGNYYAINTTTDTLFRNSSKMTLTARSAGLNNLGETVFYGSLTRNEYTDLXX 778
                EL+   N Y  N ++++   NSS   L+  SAG N   +T+F G++T+N++  L  
Sbjct: 715  FQQDELLVFNNEYVFNLSSNSYISNSSTFGLSLWSAGRNQFDDTLFSGAVTKNQFPGLYG 774

Query: 779  XXXXXXXXXXXXXXXXXXXXXWYDATYIDNSTTGYAFYDPSSTNGSYG--VSIYKDMAKE 836
                                  Y A ++++S T YA+         YG    +Y D  KE
Sbjct: 775  SASIYSNSSVAHFSLQNGAQP-YAACHLNDSVTAYAY--------RYGSVSQLYFDNGKE 825

Query: 837  RDLSYRWTNMVGSMLYSKNSSLLALGMKNETRSPQLLLTNLTTGEDTATFEWKTNVSINS 896
                + W   + SM YSKNS++LA+G    T  P L L NLT+ +  A      N +I+S
Sbjct: 826  G--PWTWFGTINSMRYSKNSTILAIGTDGSTDEPILSLFNLTSFDVLANTTISENGTISS 883

Query: 897  LIFFDQNTSVLVGGDFNESESNCSGLCLFDYERKHWSPFFDNMINGSIHSMKIFNKSSLV 956
            ++FFD+N+S+LVGGD++ S+++CSGLCL++Y++K W+ F +N I G+I  M++     L+
Sbjct: 884  MVFFDRNSSLLVGGDYHISDADCSGLCLYNYDQKQWTKFANNSITGNITEMQLSESYDLL 943

Query: 957  LGGFFDINDTKQVNLASMSLTDGSYN-ILHQGTETILDFIFVDGKVDNLVAVSANDLFRL 1015
            + G  ++ +   VNL S ++++   N ++      I  FI  D   ++++  +   L   
Sbjct: 944  ISGAMNVANKTSVNLLSFNMSNYEVNPLVWDSNGPIKSFIAED---NDIITWNETSLSGY 1000

Query: 1016 TNNNWESISAQFDDSSVFGGLSEFPIQQGGQNKKRE---EEKNSLLITGDLLHKTYGKI- 1071
            ++ +W+++  +FD+SS+   +    ++      KR+      +++L+ G    + Y +  
Sbjct: 1001 SDGDWQNL--EFDNSSLISIVDVIAVKTEPALDKRQTFSSTFDAILVAG----QNYAEYP 1054

Query: 1072 SAALYDFNDWIPYFSTTPATSTDGLGQSRIYSNKDISSAFNYQGVLQXXXXXXXXXXXXX 1131
             A++Y+F  W+PY+    A   D   ++  ++N+D S  ++ Q +L              
Sbjct: 1055 QASIYNFQRWLPYYVANKADDEDP-SRTTFFTNQDDSQLYDSQNLLSDPTRTTTSSSSST 1113

Query: 1132 XXXXXXXXXX-QLGAKKNKIARGFVVLIGLALAMGTLAVMGVIGIALTFFFGKSSDKYQS 1190
                        L  K  KI RGFVVLIGLALA+GT+ ++G+ G+ L   F   S  Y+ 
Sbjct: 1114 TSSSQTSPSKGSLVRKSGKINRGFVVLIGLALALGTVVIIGITGVLLALVFNGHS-GYEQ 1172

Query: 1191 LEPRADESEMIDTVPPEKLMRFI 1213
            ++PRADESEMIDTVPPEKL++F+
Sbjct: 1173 VDPRADESEMIDTVPPEKLLKFL 1195

>Kpol_392.10 s392 (27006..30686) [3681 bp, 1226 aa] {ON}
            (27006..30686) [3681 nt, 1227 aa]
          Length = 1226

 Score =  646 bits (1667), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 415/1236 (33%), Positives = 666/1236 (53%), Gaps = 54/1236 (4%)

Query: 12   LVVAKLCSGTHLNTIESALGVKNFEVPSLDLSGSNNEEIQLLGNFQNLNYYRYTGQDNFT 71
            L +  +   + L  ++ +LG+    +P ++  G+ N EIQ+L N + L +Y+Y GQ NFT
Sbjct: 11   LGIIGVSQASQLTNVKDSLGINTVNIPQINF-GNTNNEIQILSNIEGLTFYQYQGQQNFT 69

Query: 72   GISDEKAR-ESLIYHSNGTLLELSSPQYSNESFSVDHVIPLRDDSFILSGTGAISGAVLD 130
            G  D  +    LIY+SN TL++L      +++  +D ++PL +D+FILSG+G + G  L+
Sbjct: 70   GSIDTNSNTHGLIYYSNDTLIKLLE---GSDNTKIDQIVPLDEDAFILSGSGTLGGFQLE 126

Query: 131  HQVVFNLSDLSYTAIFNQSLSPVNAITVNGNKAYFGGSFKFKGPDQDTHGLIVWDFVKNE 190
            +Q+++NLSDLS   +FN  L  + +I V+ +  YFGG+F +   ++  + +I W+ V   
Sbjct: 127  NQLLYNLSDLSIIPLFNNQLQNIKSILVDKDIVYFGGNFSYTSNNKTANSIISWNKVTKN 186

Query: 191  VETLPFGGLGKDSNVNSILVLDDNNILFAGNFSTIDEKSALNSTL--------GINSTSD 242
            V+ LPF G GK+S VNSIL LD++N+LF G+FST+D+KS L S +          +S+++
Sbjct: 187  VDMLPFIGFGKNSTVNSILKLDEDNLLFFGDFSTLDDKSLLVSNITTYTQQNSTSSSSTE 246

Query: 243  SAPELSHKIPLKTAKWTSDGSLQKD-DLVCPSNSATSAWLGTGTTGQFELSIAHTIRPSK 301
            +  EL  +I LK A W S G L+     +CP N    AW   GTTG+   ++A     SK
Sbjct: 247  TNLELEQQISLKYASWASLGDLKSSTQFICP-NGQNEAWSSAGTTGEITCNLAFEASLSK 305

Query: 302  LRLHNARTLDEEVSLFRVITTPSNGIMNLTYLDPSSGELRTCDAWCPLLSTQNLTAAKSK 361
            +R+ N+    ++++ FR++T PSNGIMNLTYLDP + E++ CDA+CPL S+  L A+   
Sbjct: 306  IRIFNSPYEQDQIASFRIVTAPSNGIMNLTYLDPLTSEVKYCDAFCPLYSSNALQASSEN 365

Query: 362  A-ASTDQVEFLN-NQTTVQWSESYQDFAFVNSVPVTSITFMALDSYGSSVGVNGFELYED 419
            A  S     F+N N+T + WS  YQ+FAFVN VPVT++  +AL SYG +VG++GF+LY++
Sbjct: 366  ATTSASTSAFINGNKTNIGWSTDYQEFAFVNQVPVTALQVIALTSYGDNVGLSGFQLYQN 425

Query: 420  DFSVYANDSFNVPDCSSTSNYSKAS-LSASQWDQGSSDEDYVYT-LVENSQEAPSVTFYP 477
             +S++AN+S N P C S +    +S LS + W QG + + Y+ T        +P V FYP
Sbjct: 426  SYSIFANNSLNEPACDSPNTVIPSSYLSNNIWYQGLNSQSYIATKYTPGDDPSPLVNFYP 485

Query: 478  QIVYSGLYTINVLTPGCLADGSCQSRSVVNASLWDSNNGTLLSSITIYQNNDYEKYDNLY 537
             I   G YT+N+ TPGC  DG+C  R +VN +LWD+    L+S+  IYQNN+  KYD L+
Sbjct: 486  SINRIGNYTVNIYTPGCTGDGTCSFRGIVNVTLWDTATNDLISTTLIYQNNNEMKYDQLF 545

Query: 538  SGYLENEVKVVLEYEGAIGNTEGSPMMVAGQ------ISVNTDEFDSSVF--TDKYKTGK 589
             G+L+   KV LEY   I N E SP++V         I++  DE   +V   T++ K   
Sbjct: 546  EGFLDYAPKVTLEYYSGI-NDENSPVVVVADNVDLVPINIELDETIGNVTSSTEELKVPL 604

Query: 590  XXXXXXXXXXXXXXXXQNFKSNNSTDLAQYSVSNFAKNSNFFVDKFKNYIMLFASSGKVS 649
                             +    ++T L  + VS F+ + + +  ++   ++L  S   V 
Sbjct: 605  NGMFQYQLSNFTSSNNNSTLKVDNTSLNLFPVSRFSSSVSLYGVEYNETLLLGGSIAGVY 664

Query: 650  KLEIDQQFDVRTVTTEEVGDEVSGVFAFSEGLGVIGTFDGSTK--GAKFYNGSFFDIPLS 707
             L +    ++R+    E G EV+G  A++ G+ + G F+ S +   +  YNG+F      
Sbjct: 665  ALSLSNYTNIRSTRIVETGGEVTGTGAYAGGVVLFGNFNISNRIVSSLSYNGTFDSFGNV 724

Query: 708  HSNVTTFTNFTLDGAELVSLGNYYAINTTTDTLFRNSSKMTLTARSAGLNNLGETVFYGS 767
            +SN+ TF+N T   +E+++  N Y  NT+T +   N+S ++L+  SAG N+ G+T+F G 
Sbjct: 725  NSNIATFSNLTFGESEILAFNNEYFFNTSTSSYIFNTSALSLSIWSAGSNDFGDTLFSGL 784

Query: 768  LTRNEYTDLXXXXXXXXXXXXXXXXXXXXXXXWYDATYIDNSTTGYAFYDPSSTNGSYGV 827
            +TRNE+ +L                        Y   Y+++S T Y +   S++N  +  
Sbjct: 785  ITRNEFPNLNNSAVLTGNGTAQSLQLRNGIQP-YLGVYLNDSLTAYLYDSSSNSNILFSN 843

Query: 828  SIYKDMAKERDLSYRWTNMVGSMLYSKNSSL-LALGMKNETRSPQLLLTNLTTGEDTATF 886
             +  +    R +S        S  YS N ++ +   + N     +L + N TT +     
Sbjct: 844  GLQGNWNLPRSVS--------SAYYSDNETMFVGSSLSNGDSGAELFVLNFTTMDLLYNE 895

Query: 887  EWKTNVSINSLIFFDQNTSVLVGGDFNESESNCSGLCLFDYERKHWSPFFDNMINGSIHS 946
             +  N SINS++ F +N+S+LVGGDF    +NCS LCL +     WS  F N  +G+I  
Sbjct: 896  TFDVNSSINSIVSFGRNSSLLVGGDFTAPNTNCSNLCLLNLGNNQWSS-FSNKFDGTITG 954

Query: 947  MKIFNKSSLVLGGFFDINDTKQVNLASMSLTDGSYNILHQGTETILDFIFVDGKVDNLVA 1006
            ++  N S L++ G +   +   ++L  + L +  +  L   ++ +  F + +G +   VA
Sbjct: 955  LEFANDSRLLISGSYRFENQSGISLGYIDLNNQEFKSLLSDSQKVNSFNYNNGTI---VA 1011

Query: 1007 VSANDLFRLTNNNWESISAQFDDSSV----FGGLSEFPIQQGGQNKKREEEKNSLLITGD 1062
              ++ ++    ++W +      +SS        +S+        N         +L+ G+
Sbjct: 1012 WDSSTIYSYRGDSWSNHQIPNTNSSTSIKNVQIVSKLNNSLSTNNTSNNLNDELILVFGE 1071

Query: 1063 LLHKTYGKISAALYDFNDWIPYFSTTPATSTDGLGQSRIYSNKDISSAFNYQGVLQXXXX 1122
            L  + YG + A  YDF +WIPY+ T P +S +   ++ ++ NKDIS  +  Q VLQ    
Sbjct: 1072 LYSEDYGFVQAMFYDFQNWIPYYITQPYSSLN-TSKNSLFMNKDISLLYESQVVLQNPNS 1130

Query: 1123 XXXXXXXXXXXXXXXXXXXQLGAKKN-----KIARGFVVLIGLALAMGTLAVMGVIGIAL 1177
                                  + KN     KI RG+VVLIGLALA+GT+A++G+ G+ +
Sbjct: 1131 TISISSTSSSSATTRSSSTSSTSLKNGNIESKIHRGYVVLIGLALAIGTVAILGIFGVTM 1190

Query: 1178 TFFFGKSSDKYQSLEPRADESEMIDTVPPEKLMRFI 1213
             + F     +Y  ++PR DE EM+DTVPPEKLM+FI
Sbjct: 1191 AYIFSDDKGEYVRIKPRIDEHEMLDTVPPEKLMKFI 1226

>TPHA0B03250 Chr2 (745716..749363) [3648 bp, 1215 aa] {ON} Anc_8.256
            YLR084C
          Length = 1215

 Score =  637 bits (1642), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/1239 (33%), Positives = 668/1239 (53%), Gaps = 78/1239 (6%)

Query: 14   VAKLCSGTHLNTIESALGVKNFEVPSLDLSGSNNEEIQLLGNFQNLNYYRYTGQDNFT-- 71
            +A   + + L+ I   L ++ FE+P+L+ + ++N  IQLLG+ +NL +Y Y GQ NFT  
Sbjct: 16   LANNATASSLSNILKLLNIQEFELPNLNFNNTSNS-IQLLGDVENLQFYHYEGQQNFTDD 74

Query: 72   GISDEKARESLIYHSNGTLLELSSPQYSNESFSVDHVIPLRDDSFILSGTGAISGAVLDH 131
            G S   +  +LIY+S+  L++L   +  +    +  +IP+ DDSF+LSG+G ++G  L  
Sbjct: 75   GNSGISSTNNLIYYSDDVLIQL---EVGSNDTDIQKIIPVGDDSFVLSGSGHLNGYALGR 131

Query: 132  QVVFNLSDLSYTAIFNQSLSPVNAITVNGNKAYFGGSFKFKGPDQDTHGLIVWDFVKNEV 191
            Q+++NL+ LS   IF+Q L  + +I V+    YFGG F ++   Q++  +I W+   +EV
Sbjct: 132  QLLYNLTTLSIKPIFDQDLGNITSILVDEEIVYFGGEFTYQTRSQNSSSVISWNMTSDEV 191

Query: 192  ETLPFGGLGKDSNVNSILVLDDNNILFAGNFSTIDEKSAL--NSTLGI----NSTSDSAP 245
              LPF G G DS VNSIL L+D+NILF G F T+   S L  N+T       NST +S+ 
Sbjct: 192  IELPFQGFGSDSKVNSILKLNDDNILFVGMFDTLGNSSLLTYNTTSNFSNFTNSTENSST 251

Query: 246  -ELSHKIPLKTAKWTSDGS-LQKDDLVCPSNSATSAWLGTGTTGQFELSIAHTIRPSKLR 303
             +L  +I LK A W +  +   +++ VC + S+  AW+  G +G  +L+  +T+ PSK+R
Sbjct: 252  IQLEQQISLKYATWDAGTAYFDQNNFVCEAGSS-EAWIVEGRSGNLQLNFPNTVSPSKIR 310

Query: 304  LHNARTLDEEVSLFRVITTPSNGIMNLTYLDPSSGELRTCDAWCPLLSTQNLTAAKSKAA 363
            ++NA T ++ VSLFR++T+PSNGIMNLTY+DP +G+L+ CDA+CPLL++  L  A S + 
Sbjct: 311  IYNANTAEDGVSLFRIVTSPSNGIMNLTYVDPLTGQLKYCDAFCPLLNSSGLETASSNST 370

Query: 364  S-TDQVEFLNNQTT-VQWSESYQDFAFVNSVPVTSITFMALDSYGSSVGVNGFELYEDDF 421
            S T Q  F+NN TT V WSESYQ+FAF+N++ V+++T +A DSYGS   ++G EL++D  
Sbjct: 371  SETRQRVFINNNTTSVTWSESYQEFAFINNIDVSALTLIAQDSYGSKTALSGIELFQDSH 430

Query: 422  SVYANDSFNVPDC--SSTSNYSKASLSASQWDQGSSDEDYVYTLVE-NSQEAPSVTFYPQ 478
            + YAN++ N P C   STS +S + LS + W +G   + Y+    + +S   P+V FYP 
Sbjct: 431  TAYANNTLNQPGCDTESTSLFSSSVLSDNGWYKGLDSDSYIAANYQSDSSPLPTVQFYPN 490

Query: 479  IVYSGLYTINVLTPGCLADGSCQSRSVVNASLWDSNNGTLLSSITIYQNNDYEKYDNLYS 538
            I   G ++I + TPGCLADG+C+SRS+VN ++ D  +GT+LS+  IYQNN+  KYD +++
Sbjct: 491  IQAVGDFSIKMYTPGCLADGTCESRSIVNVTVLDPTDGTVLSTQLIYQNNNEMKYDEIFN 550

Query: 539  GYLENEVKVVLEYEGAIGNTEGSPMMVAGQIS-----VNTDE--FDSSVFTDKYKTGKXX 591
            G L    ++ L +   I     S ++VA ++      +N D+   DS++ +   K     
Sbjct: 551  GKLTVSPEITLTFYSTILPDLDSAIIVADRVDLTPTYINVDDILLDSNLKSTSLKLNG-- 608

Query: 592  XXXXXXXXXXXXXXQNFKSNNSTDLA-----QYSVSNFAKNSNFFVDKFKNYIMLFASSG 646
                           NF S+  T +      Q ++S F  + +   + F N I L  S+ 
Sbjct: 609  --------LFQYQLSNFTSDTKTKVGNNSIHQLALSQFPSSVSLIGNTFNNSIFLAGSTS 660

Query: 647  KVSKLEIDQQFDVRTVTTEEVGDEVSGVFAFSEGLGVIGTFDGSTKGAK---FYNGSFFD 703
             + +L+++   ++R     + G E + +  +S+GL   G ++ S+        +NG+F  
Sbjct: 661  NIVQLQLNSDLELRNTVVVDNGGETTRIENYSQGLLFFGQYNISSTNVVDNLSFNGTFSS 720

Query: 704  IPLSHSNVTTFTNFTLDGAELVSLGNYYAINTTTDTLFRNSSKMTLTARSAGLNNLGETV 763
                  NVTTF NFT +G+EL+   N Y  N ++++   N++  T +  + G N+  +T+
Sbjct: 721  FSQLGDNVTTFANFTYEGSELLFFNNDYLYNVSSESYIYNNTMFTASVLATGANSNNDTL 780

Query: 764  FYGSLTRNEYTDLXXXXXXXXXXXXXXXXXXXXXXXWYDATYIDNSTTGYAFYDPSSTNG 823
              G++ R+EY++                         Y A +++++   YA+ D  ++  
Sbjct: 781  LLGNIVRSEYSNFNEPLKLYGNSSLESLTFSSSIVP-YAAVFLNDTANLYAYKDGENSKI 839

Query: 824  SYGVSIYKDMAKERDLSYRWTNMVGSMLYSKNSSLLALGMKNETRSPQLLLTNLTTGEDT 883
             YG     +M    D S      +  + +S NSSLL         S  L+++N++ G   
Sbjct: 840  IYG----NNMTTSLDFS----GTLNKLSFSNNSSLLFANAITNNGSSSLVISNISDGMSL 891

Query: 884  ATFEWKTNVSINSLIFFDQNTSVLVGGDFNESESNCSGLCLFDYERKHWSPFFDNMINGS 943
            A+        I S+I F+ N ++LV G+F   + +C G+CL++Y  K WS F ++ I GS
Sbjct: 892  ASENLNNYGYITSMIDFNSNNTILVSGNFTLDDVDCHGICLYNYFTKKWSAFANSTIKGS 951

Query: 944  IHSMKIFNKSSLVLGGFFDINDTKQVNLASMSLTDGSYNILHQGTETILDFIFVDGKVDN 1003
            I  M+++N   +++ G F   +   + LAS+ +   + ++L   ++  +     DG+   
Sbjct: 952  IVEMQLWNSDQILISGLFSAQNYSSITLASLDIKGYNISVLSDDSKIEISSFIHDGQS-- 1009

Query: 1004 LVAVSAND-LFRLTNNNWESISAQFDDSSVFGGLSEFPIQQGGQNKKREEEKNSLLITGD 1062
             + V +ND +    +  W  IS     S     +    I    QN      K  L   G+
Sbjct: 1010 -ITVWSNDTIMEYKSEKWNEISFPNTTSKYIESVEAVSIDL--QNSTSNVSK-ILFAYGE 1065

Query: 1063 LLHKTYGKISAALYDFNDWIPYFSTT-------PATSTDGLGQSRIYSNKDISSAFNYQG 1115
                 YG+++A L+   DW PYFS         PA +        ++ N+D+SS FN + 
Sbjct: 1066 FNSTLYGRLNAMLFRAGDWKPYFSINNFQVNEDPAIT--------LFENRDLSSLFNSKN 1117

Query: 1116 VLQX-XXXXXXXXXXXXXXXXXXXXXXQLGAKKNKIARGFVVLIGLALAMGTLAVMGVIG 1174
             L                         ++  K +KI RGFVVLI LALA+GT+A++G+ G
Sbjct: 1118 SLPANITSAETSSRSTVSSATATTVVNKIEGKHSKIDRGFVVLIALALAVGTVALLGLFG 1177

Query: 1175 IALTFFFGKSSDKYQSLEPRADESEMIDTVPPEKLMRFI 1213
            + + + F +   KY+S++PR D  EM+DTVPPEKLM+FI
Sbjct: 1178 VTIAYIF-RDEQKYESIKPRIDGQEMLDTVPPEKLMKFI 1215

>TBLA0E04390 Chr5 complement(1115294..1119130) [3837 bp, 1278 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1278

 Score =  604 bits (1557), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/1275 (32%), Positives = 656/1275 (51%), Gaps = 101/1275 (7%)

Query: 20   GTHLNTIESALGVKNFEVPSLDLSGSNNEEIQLL--GNFQNLNYYRYTGQDNFTGISDEK 77
               LN ++  L ++N   P  +L  S N+ +QLL    F  LN+  Y GQ NFT      
Sbjct: 23   ANQLNHLKDILEIENIPAPQFNLQDSTNQSLQLLTSNGFDTLNFVHYNGQQNFTQPIISS 82

Query: 78   ARESLIYHSNGTLLELSSPQYSNESFSVDHVIPLRDDSFILSGTGAISGAVLDHQVVFNL 137
            ++  LIY+SN T + L    YS     + H+IP   D+FILSGTG+++G  L +Q+V+NL
Sbjct: 83   SQNHLIYYSNDTYIRLLDIPYSTR---IQHIIPYGQDAFILSGTGSLNGFELSNQLVYNL 139

Query: 138  SDLSYTAIFNQSLSP-VNAI--TVNGNKAYFGGSFKFKGPDQD-THGLIVWDFVKNEVET 193
            +DLS T IF   L P V  I    + N  YFGG+F +  PD + ++GLI+WD   N+  +
Sbjct: 140  TDLSLTPIFENKLVPEVRTIFKDPDTNLVYFGGNFSYLLPDSNISNGLIIWDSSSNDTIS 199

Query: 194  LPFGGLGKDSNVNSILVLDDNNILFAGNFSTIDEKSALNSTLGI---NSTSD-------S 243
              FGG G +S +N+IL L+ N++LF+G F T+D+ S L+    I   N+TS        S
Sbjct: 200  YEFGGFGSNSVINNILKLNSNDLLFSGQFYTLDDPSILHIPYNITFPNNTSSLLSQQNVS 259

Query: 244  APELSHKIPLKTAKWTSDGS---LQKDDLVCPSNSATSAWLGTGTTGQFELSIAHTIRPS 300
              EL+ +IPL   K+++  +   + K+ L+CP+ S   AW      G  ++++  +IRPS
Sbjct: 260  TFELNQRIPLTFGKFSTADTNDYINKNQLICPT-SEIEAWASDSKAGSLQITLPFSIRPS 318

Query: 301  KLRLHNARTLDEEVSLFRVITTPSNGIMNLTYLDPSSGELRTCDAWCPLLSTQNLTAAKS 360
            K+R+ N+   D+EV+ FR+     N IM+L YLDP  G+L+ C  +CPL +   L    S
Sbjct: 319  KIRIFNSPDPDDEVATFRINPGNQNSIMSLAYLDPLDGQLKYCSEFCPLYNRNQLKLFNS 378

Query: 361  KAASTDQVEFL--NNQTTVQWSESYQDFAFVNSVPVTSITFMALDSYGSSVGVNGFELYE 418
                   V  L  NN T ++WS +YQ+FAFVN   +T++ F AL SYGS VG++G  L++
Sbjct: 379  NDNLKSHVITLLDNNTTDIKWSTTYQEFAFVNQFDLTTLEFQALSSYGSRVGLSGLSLFQ 438

Query: 419  DDFSVYANDSFNVPDCSSTSNY----------------SKASLSASQWDQGSSDEDYV-Y 461
             D +V+AN+S+N P C+  + Y                S + LS + W     + DY+  
Sbjct: 439  SDIAVFANESYNKPSCNDQTAYDNEDLIKAALPRVMGSSYSILSDNDWYTPLPNSDYLAC 498

Query: 462  TLVENSQEAPSVTFYPQIVYSGLYTINVLTPGCLADGSCQSRSVVNASLWDSNNGTLLSS 521
            T + +S+  P+VTFYP ++Y+G YT++++TPGC AD SC SR +VN ++W+  + ++L +
Sbjct: 499  TYLSSSKLIPTVTFYPNLLYAGNYTVDMITPGCTADNSCDSRGIVNVTMWNQTDSSILQT 558

Query: 522  ITIYQNNDYEKYDNLYSGYLENEVKVVLEYEGAIGNTEGSPMMVAGQISVNTDEFD---- 577
              IYQ N+  K+D +++GYL+  VK+ + +   + +  G+  +VA +I++  +  D    
Sbjct: 559  SLIYQTNENYKFDQIFNGYLDPLVKITMSFYSGVYSNTGNFTIVADRINLIINSLDFVTT 618

Query: 578  -SSVFTDKYKTGKXXXXXXXXXXXXXXXXQNFKSNNSTDLAQYSVSNFAKNSNFFVDKF- 635
             SS   D Y                    +N+   NST + QY+ SN+  N +     + 
Sbjct: 619  TSSNEIDIYNVTLNGLFQYPEYNSVNNLNENYT--NST-INQYAYSNYPANVSLIAAAYD 675

Query: 636  KNYIMLFASSGKVSKLEIDQQ-FDVRTVTTEEVGDEVSGVFAFSEGL---GVIGTFDGST 691
            K+ +++  S  K+ + +I++   ++    T +  + V+G+  +S+GL   G I    GS 
Sbjct: 676  KDTLLVGGSINKLQEFQIEKNGQNISLQNTFKDLNSVTGIVPYSDGLIAYGDIMDSSGSY 735

Query: 692  KGAKFYNGSFFDIPLSHSNVTTFTNFTLDGA-ELVSLGNYYAINTTTDTLFRNSSKMTLT 750
            K   F N  F  +      + +F+N +L  + E++S  N Y  N +    F+N+S   L+
Sbjct: 736  KAITFTNNKFGTLGNFTDEIQSFSNISLTTSWEILSFNNKYFYNQSNMEDFKNTSTFELS 795

Query: 751  ARSAGLNNLGETVFYGSLTRNEYTDLXXXXXXXXXXXXXXXXXXXXXXXWYDATYIDNST 810
              SAG N   + +F G ++ NE  +L                        Y A ++++S+
Sbjct: 796  LWSAGKNAQNDLIFSGLVSENENVNLTGVVSINANEQIKELNLGNNIYP-YSAVFLNDSS 854

Query: 811  TGYAFYDPSSTNGSYGVSIYKDMAKERDLSYRWTNMVGSMLYSKNSSLLALG-MKNETRS 869
            T YA+ +P   N      I+   +    +S+ W N + SM +  N SLL++G + ++   
Sbjct: 855  TIYAYMEP---NTRLNRLIH---SNGEQISWSWKNKISSMAFFPNESLLSVGTISDKDVF 908

Query: 870  PQLLLTNLTTGEDTATFEWKTNVSINSLIFFDQNTSVLVGGDFNESESNCSGLCLFDYER 929
            P   + NLT+ +  A      N  I+SL++F +N+SVLVGG+F  S+  CSGLCLF+YE 
Sbjct: 909  PSFSILNLTSNKVIANETLNKNSQISSLLYFTKNSSVLVGGNFTFSDYQCSGLCLFNYET 968

Query: 930  KHWSPFFDNMINGSIHSMKIFNKSSLVLGGFFDINDTKQVNLASMSLTDGSYNILHQGTE 989
            K+WS F +N + G++  +++ N S++++ G    N +  ++LA ++L   + +IL Q T 
Sbjct: 969  KNWSTFMNNTLEGTVSKLELKNNSNILISGTLSTNKSANIDLALLNLNTYNVSILLQNTN 1028

Query: 990  TILDFIFVDGKVDNLVAVSANDLFRLTNNNWESI-------SAQFDDSSVFGGLSEFPIQ 1042
             +  F F   ++    A +++ LF+  N  W  I       S + D  S+F   ++    
Sbjct: 1029 -LTSFEFTGNQI---AAWNSSTLFQYNNEAWSQILLPNGTESLKLDSISIFDITNKN--S 1082

Query: 1043 QGGQNKKREEEKNSLLITGDLLHKTYGKISAALYDFNDWIPYFSTTPATSTDGLGQSRIY 1102
                 K+   + N ++ TG    K  G + A  Y  + WIPYF      + D      I+
Sbjct: 1083 SSILEKRALRDTNIMVATGQFYSKGLGTVQALYYTSDTWIPYFYGNLTNNMDTSNSINIF 1142

Query: 1103 SNKDISSAFNYQGVLQ------------------------XXXXXXXXXXXXXXXXXXXX 1138
             NKDISS      VL+                                            
Sbjct: 1143 PNKDISSKIISDFVLKNWNFNLSDVGNSTNTTNSTNTTSTTNLTSPSNTTSPQPSSSIIP 1202

Query: 1139 XXXQLGAKKNKIARGFVVLIGLALAMGTLAVMGVIGIALTFFFGKSSDKYQSLEPRADES 1198
               +   KK+KI RGFVVLIGLAL++ T+A++G+ GI L+F F  S   Y+SL+PR  E 
Sbjct: 1203 IIGKQQNKKHKIQRGFVVLIGLALSLATVALLGIFGILLSFIFRDSRGDYESLKPRTTEH 1262

Query: 1199 EMIDTVPPEKLMRFI 1213
            EM D VPPEKLM F+
Sbjct: 1263 EMFDAVPPEKLMPFV 1277

>KAFR0B02690 Chr2 complement(539470..543102) [3633 bp, 1210 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1210

 Score =  599 bits (1544), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 416/1232 (33%), Positives = 655/1232 (53%), Gaps = 41/1232 (3%)

Query: 1    MLTKSWLATSFLVVAKLCSGTHLNTIESALGVKNFEVPSLDLSGSNNEEIQLLGNFQNLN 60
            M T   L  S  +   L   + L+ +E++LG++ F  P+L  S +N+  +QLLG++  L+
Sbjct: 1    MRTHHKLIKSLSLFTTLSLASQLSQLENSLGIQTFAPPALIFSSNNDSSLQLLGSYDALS 60

Query: 61   YYRYTGQDNFT-GISDEKARESLIYHSNGTLLELSSPQYSNESFSVDHVIPLRDDSFILS 119
             Y YTGQ NF+  I+ +     L+Y+SN TL++L+      +   +++++P+  DSFILS
Sbjct: 61   LYTYTGQQNFSYQITPDTNSNGLVYYSNNTLIQLNQGL---DDTRINNIVPIGSDSFILS 117

Query: 120  GTGAISGAVLDHQVVFNLSDLSYTAIFNQSLSPVNAITVNGNKAYFGGSFKFKGPDQDTH 179
            G+G+++   L++Q+ +NLS LS   IFN +L  V +I V+ +  YFGG+F F     D H
Sbjct: 118  GSGSLNEYSLENQLFYNLSSLSVYPIFNTTLEQVESILVDEDLVYFGGNFTFSNGTDDGH 177

Query: 180  GLIVWDFVKNEVETLPFGGLGKDSNVNSILVLDDNNILFAGNFSTIDEKSALNSTLGINS 239
             + VW+   N    LPF G G++S++N+IL L+D+NILFAG F T+D+ S L S     +
Sbjct: 178  SVAVWNITSNSTGLLPFLGFGENSSINNILRLNDDNILFAGEFYTLDDASLLTSNTSNAT 237

Query: 240  TSDSAPELSHKIPLKTAKWTSDGS-LQKDDLVCPSNSATSAWLGTGTTGQFELSIAHTIR 298
            T+    ELS  +PL  A W+SD S       +C  N  + AW  +GTTG    S+ +   
Sbjct: 238  TNIYDLELSPLLPLNEATWSSDVSDFDASSFIC-VNPDSDAWFVSGTTGTLACSLPYDSA 296

Query: 299  PSKLRLHNARTLDEEVSLFRVITTPSNGIMNLTYLDPSSGELRTCDAWCPLLSTQNLTAA 358
             +K+R++N+     ++S FR+I+ PS  IMN+TY+DP +G L  CD++CPLLS   L++A
Sbjct: 297  LTKIRIYNSPDSQNQISEFRLISDPSGSIMNMTYIDPRTGNLEHCDSYCPLLSRDTLSSA 356

Query: 359  KSKAASTDQVEFL-NNQTTVQWSESYQDFAFVNSVPVTSITFMALDSYGSSVGVNGFELY 417
               A+ ++    L +N T ++WS  YQ+F FVN V  T + F+AL+SYGS+V + G+ LY
Sbjct: 357  SDAASVSEMARLLSDNATVIKWSAEYQEFGFVNVVSTTLLQFLALNSYGSNVALAGYSLY 416

Query: 418  EDDFSVYANDSFNVPDCSS-TSNYSKASLSASQWDQGSSDEDYVYTL-VENSQEAPSVTF 475
            +D+++V+AN+S N   C+S  S+Y+ ++LS + W  G+S + YV T   E     P VTF
Sbjct: 417  QDEYAVFANNSLNGASCTSNNSDYTSSTLSDNDWVFGASGQTYVTTFYTEGDDPIPQVTF 476

Query: 476  YPQIVYSGLYTINVLTPGCLADGSCQSRSVVNASLWDSNNGTLLSSITIYQNNDYEKYDN 535
               + YSG Y IN+ TPGC  DG+C +R +VN +++D ++ ++LS++ IYQNN+  KYD 
Sbjct: 477  NANLPYSGDYVINLYTPGCSDDGTCSTRGLVNVTVYDESDDSILSTVEIYQNNEALKYDE 536

Query: 536  LYSGYLENEVKVVLEYEGAIGNTEGSPMMVAGQISVNTDEFDSSVFTDKYKTGKXXXXXX 595
            L+SGYL+N V++VLEY   I +      +VA + ++     D        K G       
Sbjct: 537  LFSGYLKNSVRIVLEYVSGISSDSTGTTVVADRSNIYVTSLDILGQISSSKNGSTVALNG 596

Query: 596  XXXXXXXXXXQNFKSNNS----TDLAQYSVSNFAKNSNFFVDKFKNYIMLFASSGKVSKL 651
                        F S+++    T L QY +  F  NS+ F   + NY+++  +   V  L
Sbjct: 597  LFQYQLSNFSSTFNSSSAKVGKTFLNQYPLDIFNTNSSLFASTYDNYLLVGGAEQSVYAL 656

Query: 652  EIDQQFDVRTVTTEEVGDEVSGVFAFSEGLGVIGTFD--GSTKGAKFYNGSFFDI-PLSH 708
            E     +  T     V  +   +  FSEG+ + G F+  G T+GA  YNGSF       +
Sbjct: 657  ESSNDLNFSTSDNSGVEGQFKNMQPFSEGIFLYGNFNLSGVTEGAVTYNGSFNPFTQYGN 716

Query: 709  SNVTTFTNFTLDGAELVSLGNYYAINTTTDTLFRNSSKMTLTARSAGLNNLGETVFYGSL 768
            S++ TF N T   +E++   N Y  N ++ TL  NSS ++L+  SAG N  G+ +F G+ 
Sbjct: 717  SSIDTFKNVTFGNSEILVFNNAYLYNVSSSTLMSNSSSLSLSLWSAGANANGDLLFNGAS 776

Query: 769  TRNEYTDLXXXXXXXXXXXXXXXXXXXXXXXWYDATYIDNSTTGYAFYDPSSTNGSYGVS 828
            ++  Y+                          Y   Y++ S   Y + D  +T       
Sbjct: 777  SQMSYS-FNNESINIGANNIVQGLNFNESIDPYLGLYMNTSHGAYFYQDDDNTR------ 829

Query: 829  IYKDMAKERDLSYRWTNMVGSMLYSKNSSLLALGMKNETRSPQLLLTNLTTGEDTATFEW 888
            +Y     +   S++W N V + +YS N SLL  G  +   S   L    TT  D    E 
Sbjct: 830  VYFTNGSQP--SWQWPNDVVAAIYSDNQSLLIAGTSSSLESSSFLTVLNTTTYDVIANES 887

Query: 889  KTNVSINS--LIFFDQNTSVLVGGDFNESESNCSGLCLFDYERKHWSPFFDNMINGSIHS 946
             ++       ++ F  N + ++GG+F+    NC GLCLF+Y    WS F D  ING++  
Sbjct: 888  LSSQQSQISGIVNFASNATAIIGGNFSMPNVNCFGLCLFNYGNSTWSSFADASINGTVDH 947

Query: 947  MKIFNKSSLVLGGFFDINDTKQVNLASMSLTDGSYNILHQG-TETILDFIFVDGKVDNLV 1005
            M++FN+S L++ G F   +   + +AS++L +     L  G + T   F   D K+   V
Sbjct: 948  MQLFNESELIVSGLFSTKNISSITMASLNLKNNKITALKSGESNTFKSFTVADQKI---V 1004

Query: 1006 AVSANDLFRLTNNNW--ESISAQFDDSSVFGGLSEFPIQQGGQNKKREEEKNSLLITGDL 1063
            A +   L    +N W  E IS   + SSV   L+   +     +K+     +++L++G L
Sbjct: 1005 AWNNTALSIYEDNVWTVERIS-NINSSSVVDNLNYVTLAS-ALSKRDTSSSDAILVSGQL 1062

Query: 1064 LHKTYGKISAALYDFNDWIPYFSTTPATSTDGLGQSRIYSNKDISSAFNYQGVLQXXXXX 1123
               +YG I A +YDF+ W+PY       +++       + ++D+SS  N Q  L      
Sbjct: 1063 YDNSYGHIQAMVYDFSSWVPYL----LINSESDSSINAFIDRDMSSFTNTQVALLTNSGT 1118

Query: 1124 XXXXXXXXXXXXXXXXXXQLGAK--KNKIARGFVVLIGLALAMGTLAVMGVIGIALTFFF 1181
                               +  K  K KI RGFVVL+GLALA+GT+AV+G+ G+ + + F
Sbjct: 1119 VSNSSSSTTSPGASASATSIPNKTHKRKIDRGFVVLLGLALALGTVAVLGIAGVIMAYVF 1178

Query: 1182 GKSSDKYQSLEPRADESEMIDTVPPEKLMRFI 1213
               +  Y+ + PR DE+EMI+TVPPEKLM++I
Sbjct: 1179 RDDNGAYEPINPRIDENEMIETVPPEKLMKYI 1210

>AGR095W Chr7 (914098..917703) [3606 bp, 1201 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YLR084C (RAX2)
          Length = 1201

 Score =  570 bits (1469), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/1235 (30%), Positives = 625/1235 (50%), Gaps = 68/1235 (5%)

Query: 7    LATSFLVVAKLCSGTHLNTIESALGVKNFEVPSLDLSGSNNEEIQLLGNFQNLNYYRYTG 66
            L  +   +  +  G+HL ++     +K+++ P LDLS + NE + +  +FQ   YY Y G
Sbjct: 7    LVAALAPLGDVVRGSHLESVAQHFDIKHWQTPRLDLSAARNERLLVFDDFQAFEYYNYKG 66

Query: 67   QDNFTGISDEKARESLIYHSNGTLLELSSPQYSNESFSVDHVIPLRDDSFILSGTGAISG 126
            Q  FTG  ++    SLIY+S GT ++L+     ++   V  ++P   DSFILSGTG +  
Sbjct: 67   QQLFTG-QEQHQGSSLIYYSEGTYVQLAK---LDDDTVVRRIVPFGSDSFILSGTGKLQD 122

Query: 127  AVLDHQVVFNLSDLSYTAIFNQSLSPVNAITVNGNKAYFGGSFKFKGPDQDTHGLIVWDF 186
              L+HQ+++NLS L  T I  QSL  VN I V+G+  YFGG F +   ++  H  + W+ 
Sbjct: 123  QRLEHQLMYNLSTLEVTEILPQSLESVNDILVDGDMVYFGGQFTYSDGNKSGHSAVQWNA 182

Query: 187  VKNEVETLPFGGLGKDSNVNSILVLDDNNILFAGNFSTIDEKSALNSTLGINSTSD---- 242
                   LPFGG G+ S+VN+IL L  + +LF G FS ++  S   +   + ST      
Sbjct: 183  TSRTTSLLPFGGFGRGSSVNNILKLSGSGVLFVGRFSNLEAASYAETASVLASTEKPQLN 242

Query: 243  -SAPELSHKIPLKTAKWTSDGSLQKDDLVCPSNSATSAWL---GTGTT-GQFELSIAHTI 297
             +  E +    L+ +  TSDG L K   +CP+++  S ++   G G   G+  + + H I
Sbjct: 243  VTTIETNALTSLRYSTITSDGHLDKGKFICPTSNDDSWFVPHSGDGPARGELNIKVLHRI 302

Query: 298  RPSKLRLHNARTLDEEVSLFRVITTPSNGIMNLTYLDPSSGELRTCDAWCPLLSTQNLTA 357
             PSK+R++N++    E+ LFR++T+PS  IMN+TY+DP++GEL TCDAWCPL+   NLT+
Sbjct: 303  IPSKIRIYNSKKNGNEIKLFRIVTSPSQSIMNMTYIDPNTGELATCDAWCPLMPRSNLTS 362

Query: 358  AKSKAASTDQVEFLNNQTT-VQWSESYQDFAFVNSVPVTSITFMALDSYGSSVGVNGFEL 416
              +++   D    +N++   ++W+  YQ+FAF+N + +  I F+ALDSYG++VG+ G EL
Sbjct: 363  KAAESGPADVARLVNDEKVLIKWTPDYQEFAFINQIHMEEIKFIALDSYGNNVGLVGVEL 422

Query: 417  YEDDFSVYANDSFNVPDCSSTSNYSKASLSASQWDQGSSDEDYVYTLVENSQEAPSVTFY 476
            ++ ++  Y N + N P+C      S  S +A+ W QG++D  Y+   V  S   P V   
Sbjct: 423  FQTEYDAYVNSTLNQPNCGE-QQLSPFSTTANIWHQGATDASYLSANVVESN--PMVNVK 479

Query: 477  PQIVYSGLYTINVLTPGCLADGSCQSRSVVNASLWDSNNGTLLSSITIYQNNDYEKYDNL 536
            P I +SG YT+N+ TPGC  DG+C  R +VN +L  S NGT L +  IYQNN   KYD L
Sbjct: 480  PVIPHSGTYTLNLYTPGCEDDGTCDYRGIVNVTLLAS-NGTTLMTRWIYQNNYRLKYDPL 538

Query: 537  YSGYLENEVKVVLEYEGAIGNTEGSPMMVAGQISVNTDEFDS--SVFTDKYKTGKXXXXX 594
            Y+G+L+    V +E+   I +     +MVA ++S   D  D    +   + K+       
Sbjct: 539  YTGHLDPNPTVRMEWVSPINSAVNRKIMVADRVSAIIDSLDGLDDIRHPREKSLNGLFQY 598

Query: 595  XXXXXXXXXXXQNF-KSNNSTDLAQYSVSNFAKNSNFFVDKFKNYIMLFASSGKVSKLEI 653
                       Q +   +  TD+ +  VS   +    +  K    I+   S+G ++ +  
Sbjct: 599  TPAGSSLDNGIQKYINKDPQTDMPE-GVSLVGQ---VYDGKL---ILGVKSTGHIAVVTP 651

Query: 654  D-QQFDVRTVTTEEVGDEVSGVFAFSEGLGVIGTFDGST--KGAKFYN---GSFFDIPLS 707
                ++   VT ++V   ++G+  +S+GL   G F+ S+    A  Y+   GSFFD+   
Sbjct: 652  KGTDWNDVDVTRQDVPGSLNGISPYSKGLVFTGKFNLSSGPSSALHYDGNFGSFFDL--- 708

Query: 708  HSNVTTFTNFTLDGAELVSLGNYYAINTTTDTLFRNSSKMTLTARSAGLNNLGETVFYGS 767
            +S  ++  N T+DG+EL+   N +  NT+T  +   SS   L+A SA  N+  + +F GS
Sbjct: 709  NSETSSIINMTIDGSELLLFNNKFIYNTSTSQML-TSSMFQLSALSAAANSNNDLLFTGS 767

Query: 768  LTRNEYTDLXXXXXXXXXXXX-XXXXXXXXXXXWYDATYIDNSTTGYAFY--DPSSTNGS 824
            +   ++                            +   Y++++ T YA+Y   P+S+  +
Sbjct: 768  IADIKHGSAHGAVALDAEGNIFTSGTPSISGARVHRGVYLNDTATAYAYYSVSPNSSVAT 827

Query: 825  YGVSIYKDMAKERDLSYRWTNMVGSMLYSKNSSLLALGMKNETRSP-QLLLTNLTTGEDT 883
             GV I +      +LS      V  M+Y K ++ L +       +P  L+L +L T ++ 
Sbjct: 828  GGVVI-ETPGNNFNLSNNIAT-VREMIYVKKTNFLVISTNEVEGTPGALILYDLRTLQEV 885

Query: 884  ATFEWKTNVSINSLIFFDQNTSVLVGGDFNESESNCSGLCLFDYERKHWSPFFDNMINGS 943
            A  +      INS++ F ++ ++LVGG F   +  C  LCL+++ ++ WS F   +I+G 
Sbjct: 886  AREKLNPGERINSIVLFGEDNTLLVGGSF--EKDGCHDLCLYNFVKRSWSAFASGLISGE 943

Query: 944  IHSMKIFNKSSLVLGGFFDINDTKQVNLASMSLTDGSYNILH-QGTETILDFIFVDGKV- 1001
            I  ++  N  +L+  G   +     +   +  L        H Q      + +   G   
Sbjct: 944  IKQLQFVNNRNLIAVGSMTVQSRPNILFLNFDLVRSRVVEQHEQPNGRAFNSVLTIGDSG 1003

Query: 1002 DNLVAVSANDLFRLTNNNWESISAQFDDSSVFGGLSEFPIQQGGQNKKREEEKNSL-LIT 1060
            D  VA     ++  + + W++++          G+S   +       KR    N L +I 
Sbjct: 1004 DEYVAEDGKQVWHYSGSEWKTVTPLSGGQIRIDGISLLMLNNPRSQNKRNRVGNELVVIH 1063

Query: 1061 GDLLHKTYGKISAALYDFNDWIPYFSTTPATSTD--GLGQSRIYSNKDISSAFNYQGVLQ 1118
            G +    YG+I+A  Y+F +W PY+ T  +++ +   + + +I+ N+DIS        L+
Sbjct: 1064 GQMNSSEYGEINAMHYNFENWEPYYFTIGSSAREEFNVPRGQIFLNQDISRQTTTSLPLE 1123

Query: 1119 XXXXXXXXXXXXXXXXXXXXXXXQLGAKKNKIARGFVVLIGLALAMGTLAVMGVIGIALT 1178
                                        K K+A+G+VVLI L LA+ T+A++G+IG+ L 
Sbjct: 1124 VVVSDSPPT----------------AEPKRKLAKGYVVLIALGLALATIALLGIIGVILA 1167

Query: 1179 FFFGKSSDKYQSLEPRADESEMIDTVPPEKLMRFI 1213
            + FG   + YQ L+PR +E EM+ TVPPEKLM+FI
Sbjct: 1168 YAFG-DHNAYQPLKPRINEDEMLKTVPPEKLMKFI 1201

>Ecym_4315 Chr4 (679627..683265) [3639 bp, 1212 aa] {ON} similar to
            Ashbya gossypii AGR095W
          Length = 1212

 Score =  569 bits (1467), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/1233 (31%), Positives = 634/1233 (51%), Gaps = 67/1233 (5%)

Query: 14   VAKLCSGTHLNTIESALGVKNFEVPSLDLSGSNNEEIQLLGNFQNLNYYRYTGQDNFTGI 73
            VA L  G+ +N + +   +  +  P LDLS   N ++ +  +FQ  +YY Y GQ  FTG+
Sbjct: 14   VAGLAQGSQINGVVNHFNITQYTAPHLDLSTVRNSQLLIFDDFQTFDYYTYKGQQIFTGL 73

Query: 74   SDEKARESLIYHSNGTLLELSSPQYSNESFSVDHVIPLRDDSFILSGTGAISGAVLDHQV 133
            +DE+ + SLIY+SN T ++L+      E   +  ++P  DDSFILSG G   G  L+HQ+
Sbjct: 74   ADER-KNSLIYYSNNTYVQLAELPDGAE---IKKIVPWGDDSFILSGRGVFEGHRLEHQL 129

Query: 134  VFNLSDLSYTAIFNQSLSPVNAITVNGNKAYFGGSFKFKGPDQDTHGLIVWDFVKNEVET 193
            ++NLS    T I  + L  VN I  +G   YFGG F +   +   H ++ WD        
Sbjct: 130  IYNLSSFEITEILKEPLEHVNDILTDGEVVYFGGGFTYNDGNLSGHSVVKWDATDKSSSL 189

Query: 194  LPFGGLGKDSNVNSILVLDDNNILFAGNFSTIDEKSAL-----NSTLGINSTSDSAPELS 248
            LPF G G+ S VN+I+ LDD+NILF G FSTID  + L     +S+   NST+     L+
Sbjct: 190  LPFYGFGQGSVVNNIIKLDDSNILFVGKFSTIDNTALLPHRNVSSSFLSNSTNIETNALA 249

Query: 249  HKIPLKTAKWTSDGSLQKDDLVCPSNSATSAWLGTGTTGQFELSIAHTIRPSKLRLHNAR 308
                L+ +    DG+L     VCP  SA S  +   T G+  + + + + PSK+R++N++
Sbjct: 250  S---LRFSSLVHDGTLNSSAFVCPEGSADSWTIPHSTMGELTIRVINQMTPSKIRIYNSK 306

Query: 309  TLDEEVSLFRVITTPSNGIMNLTYLDPSSGELRTCDAWCPLLSTQNLTAAKSKAASTDQV 368
              + +V+LFR++T+PS  IMN+TY+DP +G L  CDAWCPL     L+     + S+   
Sbjct: 307  DSNNQVNLFRIVTSPSRSIMNMTYVDPITGALAVCDAWCPLQPLSVLSNLAENSTSSVMA 366

Query: 369  EFLNNQTT-VQWSESYQDFAFVNSVPVTSITFMALDSYGSSVGVNGFELYEDDFSVYAND 427
             F NN    V+W+ +YQ+FAFVN VP+  +TF+A+DS+G +VG+ G EL++ ++  Y N+
Sbjct: 367  AFPNNNNVLVKWTAAYQEFAFVNRVPIQELTFIAIDSFGHNVGLLGIELFQAEYDTYVNN 426

Query: 428  SFNVPDCSSTSNYSKASLSA-SQWDQGSSDEDYVYTLVENSQEAPSVTFYPQIVYSGLYT 486
            + N P+C S  N+  + +S  + W QG  D+ Y+ T     +  PSVT  P I Y G+YT
Sbjct: 427  TLNQPNCDSQQNFPASVVSKDTVWYQGLPDQSYMATSFTAGK--PSVTLTPSIPYPGIYT 484

Query: 487  INVLTPGCLADGSCQSRSVVNASLWDSNNGTLLSSITIYQNNDYEKYDNLYSGYLENEVK 546
            +N++TPGCL D +C  R +VN ++  + NGT L +  IYQNN+  KYD L+ GYL++   
Sbjct: 485  LNLVTPGCLTDNTCAFRGIVNVTI-RAQNGTHLMNRWIYQNNENLKYDPLFRGYLDDSPN 543

Query: 547  VVLEYEGAIGNTEGSPMMVAGQISVNTDEFDSSVFTDKYKTGKXXXXXXXXXXXXXXXXQ 606
            VVLE+ G I     + +MVA +++   D  +      + K G                  
Sbjct: 544  VVLEWIGPIDPAAANNVMVADRVTSIIDSIEDL----EMKNG--TSNSNLLNGLFQYAAS 597

Query: 607  NFKSNN------STDLAQYSVSNFAKNSNFFVDKFKNYIMLFASS----GKVSKLEIDQQ 656
            NF + N      ST++ QY V N   +S+ F   + + + + + S     K+S+ + D  
Sbjct: 598  NFTNTNLSTLVGSTNIDQYPVRNIPHSSSLFGQIYNDTLFIGSPSIDGLAKISRRKDDWN 657

Query: 657  ---FDVRTVTTEEVGDEVSGVFAFSEGLGVIGTFDGSTKGAKF-YNGSFFDIPLSHSNVT 712
                D + + TE     V+G+F +S GL +    + +   +   +NGS   I  S++   
Sbjct: 658  DIIVDPQLIDTE---GPVTGIFPYSNGLALTVHSNQTNMASSLSFNGSISTIFRSNAPSL 714

Query: 713  TFTNFTLDGAELVSLGNYYAINTTTDTLFRNSSKMTLTARSAGLNNLGETVFYGSL--TR 770
            +  N T+DG+E++   N Y  N ++ +   NS  + L+  SAG N   + +  G++  T+
Sbjct: 715  SILNLTIDGSEILVFDNGYVYNVSSQSDISNSETLKLSLLSAGANLEDDLILAGNVQSTK 774

Query: 771  NEYTDLXXXXXXXXXXXXXXXXXXXXXXXWYDATYIDNSTTGYAFYDPSSTNGSYGVSIY 830
            +   +                         Y   +I++S++ YA+Y  S  +   G+ +Y
Sbjct: 775  HFVPNGAIAIDADSNEVVTSGLPSVDDGIIYRGLFINDSSSAYAYYSKSLGSSKGGIVVY 834

Query: 831  KDMAKERDLSYRWTN--MVGSMLYSKNSSLLALGMKNETRS-PQLLLTNLTTGEDTATFE 887
             +   E    Y  T+   V  MLY K+S+LLA+     ++    L + +L+         
Sbjct: 835  GEHEPE----YLSTDDSTVNDMLYIKDSNLLAVVTSGTSQGLASLYIHDLSADFAPIKET 890

Query: 888  WKTNVSINSLIFFDQNTSVLVGGDFNESESNCSGLCLFDYERKHWSPFFDNMINGSIHSM 947
            ++    IN+++ F +N ++LVGG F  + + C  LCL++Y   +W+ F D  I G I  +
Sbjct: 891  FEIGEVINTMVLFGRNYTLLVGGTF--TRNGCRDLCLYNYATNNWTRFMDGNITGDIRQL 948

Query: 948  KIFNKSSLVLGGFFDINDTKQVNLASMSLTDGSYNILHQGTE--TILDFIFVDGKVDNLV 1005
            +  + ++L++ G    +D+K + L  + L++       QGT   T    + V      L+
Sbjct: 949  QFLDGNTLMVAGLLASSDSKDLQLVEIDLSNMEIISKLQGTNTGTFQHVLTVGNSSSELI 1008

Query: 1006 AVSANDLFRLTNNNWESISAQFDDSSVFGGLSEFPIQQGGQNK--KREEEKNSL-LITGD 1062
            A   N +F   +  W++IS      +   GL+        +N   KR+   N L +I G+
Sbjct: 1009 AHDGNQVFHFVDGQWKNISPDTSGQTQINGLTLLSTDFSQRNSIMKRDRVGNELVVINGN 1068

Query: 1063 LLHKTYGKISAALYDFNDWIPYFSTTP--ATSTDGLGQSRIYSNKDISSAFNYQGVLQXX 1120
                 YG I+A  YDFN W PY+ + P  + S + + Q +++ NKD+S   + Q  L   
Sbjct: 1069 FSSPDYGDINAMYYDFNGWNPYYFSVPRESNSDEVIPQGQLFLNKDVSFTSSSQIYLSND 1128

Query: 1121 XXXXXXXXXXXXXXXXXXXXXQLGAKKNKIARGFVVLIGLALAMGTLAVMGVIGIALTFF 1180
                                        K+A+ FVVLI LALA+ T+AV+GV+G+   + 
Sbjct: 1129 NDNDDTPAASEPATHE--------KHTKKLAKIFVVLIALALALATVAVLGVVGVLFAYL 1180

Query: 1181 FGKSSDKYQSLEPRADESEMIDTVPPEKLMRFI 1213
            FG   + Y+ L+PR +E+EM+ TVPPEKLM+FI
Sbjct: 1181 FGD-HNAYEPLKPRINEAEMLKTVPPEKLMKFI 1212

>KNAG0G02000 Chr7 complement(443631..447239) [3609 bp, 1202 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1202

 Score =  565 bits (1455), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 393/1234 (31%), Positives = 615/1234 (49%), Gaps = 67/1234 (5%)

Query: 6    WLATSFLV--VAKLCSGTHLNTIESALGVKNFEVPSLDLSGSNNEEIQLLGNFQNLNYYR 63
            W +  + +     +   ++L  +   L      VP+ D+ G+ N + Q+L +   +++Y 
Sbjct: 2    WCSVVYCLWFAVAITRASNLENVRRILNATEVTVPTFDV-GNKNNQFQILDDINGISFYE 60

Query: 64   YTGQDNFTGISDEKARESLIYHSNGTLLELSSPQYSNESFSVDHVIPLRDDSFILSGTGA 123
            Y GQ NFT  ++    + LIY+SN T + LS    +     +  +IPL DDSFILSG G 
Sbjct: 61   YLGQQNFTTDANVTDVQRLIYYSNETFMSLSDSIAAEAQ--IQGIIPLGDDSFILSGQGM 118

Query: 124  ISGAVLDHQVVFNLSDLSYTAIFNQSLSPVNAITVNGNKAYFGGSFKFKGPDQDTHGLIV 183
            I+   L  Q+VFN++DLS T IF+  L  +  +TV+G   YF G+F F     +  G I+
Sbjct: 119  INNVSLASQLVFNMTDLSITKIFDTPLRSIEGVTVDGPLVYFMGNFTFN----NNTGAIM 174

Query: 184  WDFVKNEVETLPFGGLGKDSNVNSILVLDDNNILFAGNFSTIDEKSALNSTLGINSTSDS 243
            WD     +  LPF G G  +N+NSIL L+D+NILFAG+FST+   S L   L  N + +S
Sbjct: 175  WDSRDRSINLLPFHGFGPYANINSILKLNDDNILFAGHFSTVWNSSLL---LQSNVSEES 231

Query: 244  APE-----LSHKIPLKTAKWTSDGSLQKDDLVCPSNSATSAWLGTGTTGQFELSIAHTIR 298
                    L+  +PL+ ++W ++G L    L+CP  S  S W  + TTG F   +   I 
Sbjct: 232  VRNTTSLLLNPSVPLQYSQWKTNGELDSSQLICPDPSKDS-WSVSATTGDFTCELPFQIT 290

Query: 299  PSKLRLHNARTLDEEVSLFRVITTPSNGIMNLTYLDPSSGELRTCDAWCPLLSTQNLTAA 358
            PSK+R++N+   D +VSLFR +T P+  IMNLTYLDP SG + +CDA+CPL S   L + 
Sbjct: 291  PSKIRIYNSPDKDSQVSLFRFLTYPAGSIMNLTYLDPLSGNMTSCDAFCPLYSKTVLQSQ 350

Query: 359  KSKAASTDQVEFLNNQTT-VQWSESYQDFAFVNSVPVTSITFMALDSYGSSVGVNGFELY 417
                A  + V  +NN +T +QW+ +YQ+FA V+ V  TS+ F AL SYG+++G+ GF++Y
Sbjct: 351  WDNTAEANTVAIINNNSTNIQWTPNYQEFALVSPVAATSLEFNALASYGNNLGLAGFQIY 410

Query: 418  EDDFSVYANDSFNVPDCS-----STSNYSKASLSASQWDQGSSDEDYVYTLVENSQEAPS 472
            +  FS + N+SFN P+C+     S + ++ +SLS + W   S  E        N    P 
Sbjct: 411  QASFSAFGNNSFNTPNCNNNDKDSNNTFTSSSLSPNNWT--SVGEYLTVGYTPNENPVPK 468

Query: 473  VTFYPQIVYSGLYTINVLTPGCLADGSCQSRSVVNASLWDSNNGTLLSSITIYQNNDYEK 532
            VT+   I +SG Y+INV TPGC AD +C +R +VN +L+D+    +L++  IYQNND  K
Sbjct: 469  VTYKIDIQHSGEYSINVFTPGCSADNTCSTRGIVNYTLFDTVTNKMLATSLIYQNNDEIK 528

Query: 533  YDNLYSGYLENEVKVVLEYEGAIGNTEGSPMMVAGQISVNTDEFDSSVFTDKYKTGKXXX 592
            YD LYSG L +  ++ + Y   +  +     +VA ++ +N    D S  T+  K      
Sbjct: 529  YDTLYSGQLNSSCEITMTYYSGLYASNTVTTIVADRVDLNIISMDLSHRTEVSKLALNGL 588

Query: 593  XXXXXXXXXXXXXQNFKSNNSTDLAQYSVSNFAKNSNFFVDKFKN-YIMLFASSGKVSKL 651
                             +N  T L Q++++NF  + +       N  I+L  + G +  +
Sbjct: 589  FQYQISNFTNDSIPMKIAN--TSLNQFALNNFEPSVSLRAFPLSNSSILLSGTEGNMFSI 646

Query: 652  EIDQQFDVRTVTTEEVGDEVSGVFAFSEGLGVIGTFDGSTKGAKFY-NGSFFDIPLSHSN 710
             ++    V+  T     +  +    +S GL ++   DG    + F  N    +  +  S 
Sbjct: 647  NLNTDLSVQNSTRLISTENFTTFQPYSNGLVML---DGQGNVSLFKDNFKNLNTTMDGSL 703

Query: 711  VTTFTNFTLDGAELVSLGNYYAINTTTDTLFR-NSSKMTLTARSAGLNNLGETVFYGSLT 769
             T   N TL+G EL+   N Y  N T+    R NSS   LT  SAG N++ +T+F G + 
Sbjct: 704  ATDVANITLNGDELLVFNNGYIYNVTSQQQTRSNSSIFNLTVSSAGANSINDTIFLGKVV 763

Query: 770  RNEYTDLXXXXXXXXX-XXXXXXXXXXXXXXWYDATYIDNSTTGYAFYDPSSTNGSYGVS 828
            + +Y                                ++++ +TGY FY  S+ +  Y  +
Sbjct: 764  QWQYAIANQSAQVNADFNDGIEQMSLPSNTVPSRGIFLNDDSTGY-FYKESNKSKLYITN 822

Query: 829  IYKDMAKERDLSYRWTNMVGSMLYSKNSSLLALGMKNE-TRSPQLLLTNLTTGEDTATFE 887
                   E      W     +++Y KN +LL +G  N+ T S  L LTNLT+ +      
Sbjct: 823  SNSTSGLE------WYGEPETVVYDKNDTLLMVGYYNDNTFSSTLSLTNLTSFDVIKEEN 876

Query: 888  WKTNVSINSLIFFDQNTSVLVGGDFNESESNCSGLCLFDYERKHWSPFFDNMINGSIHSM 947
                 SI+SL++F +N ++LV GDF  S  NCS LCL++Y+   W    +N ++GS+ ++
Sbjct: 877  LNVGSSISSLLYFAKNDTLLVAGDFEPSNGNCSDLCLYNYKSGQWDSLANNSVSGSVAAL 936

Query: 948  KIFNKSSLVLGGFFDINDTKQVNLASMSLTDGSYNILHQGTETILDFIFVDGKVDNLVAV 1007
            +++   ++++ G   +     VN+A ++L++     L    +  ++   +      +VA 
Sbjct: 937  QLYQNDTILVLGNLTLPQANDVNMAFVNLSNNHVGSLIMKKDAPVNLHSMIVSNSRIVAW 996

Query: 1008 SANDLFRLTNNNWESISAQFDDSSVFGGLSEFPIQQGGQNKKREEEKNSLLITGDLLHKT 1067
            +   LF    N+W  +S    DSS     S        Q    E   ++LL+ G+  H  
Sbjct: 997  NDTVLFSFDGNSWTRVSVPGTDSSATSISSV-------QFISMEGTDDALLLLGEFRHSE 1049

Query: 1068 YGKISAALYDFNDWIPYFSTTPATSTDG--LGQSRIYSNKDIS-------SAFNYQGVLQ 1118
            +G I + +Y+F DWIPY         DG   G   ++ N+DIS          N   VL 
Sbjct: 1050 FGDIKSIVYNFRDWIPYL-----LYVDGPRQGTGHLFMNRDISLHNIAQIPLLNSTRVLT 1104

Query: 1119 XXXXXXXXXXXXXXXXXXXXXXXQLGAKKNK--IARGFVVLIGLALAMGTLAVMGVIGIA 1176
                                      +K  +  + RGFVVLIGLALA+ T++VMGV G+ 
Sbjct: 1105 NQSFASSTSSSVSSTSTTLPKVSTTHSKPGRRIVDRGFVVLIGLALALATVSVMGVAGVL 1164

Query: 1177 LTFFFGKS-SDKYQSLEPRADESEMIDTVPPEKL 1209
            L + F  +  D YQ+L PR DE+ M++T+PPEKL
Sbjct: 1165 LAYIFRDNVGDSYQTLNPRMDENAMVNTLPPEKL 1198

>CAGL0L12144g Chr12 complement(1304574..1308044) [3471 bp, 1156 aa]
            {ON} similar to uniprot|Q12465 Saccharomyces cerevisiae
            YLR084c
          Length = 1156

 Score =  554 bits (1427), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 389/1198 (32%), Positives = 610/1198 (50%), Gaps = 67/1198 (5%)

Query: 40   LDLSGSNNEEIQLLGNFQNLNYYRYTGQDNFTGISDEKARESLIYHSNGTLLELSSPQYS 99
            L+ S S N EIQLLG+ +  NYY Y GQ NFT  S  +    LIY+SN TLL L +    
Sbjct: 2    LNFSSSRNNEIQLLGSIETFNYYNYQGQQNFTTASSSQNELELIYYSNNTLLRLDAVPTD 61

Query: 100  NESFSVDHVIPLRDDSFILSGTGAISGAVLDHQVVFNLSDLSYTAIFNQSLSPVNAITVN 159
             E   + H+IP  DD FILSG G ISG  L  Q++ NL+ LSY  IF + L  V +I V+
Sbjct: 62   VE---MRHIIPFMDDCFILSGIGTISGIELSRQILLNLTQLSYQPIFEKELGMVKSIFVD 118

Query: 160  GNKAYFGGSFKFKGPDQDTHGLIVWDFVKNEVETLPFGGLGKDSNVNSILVLDDNNILFA 219
                YFGG   +         ++ W+   N    LPFGG G +S VNSI+ L++NN+LF 
Sbjct: 119  NEVVYFGGDITYNNNGVSGRSVVQWNSTTNSSSLLPFGGFGSNSTVNSIIRLENNNLLFT 178

Query: 220  GNFSTIDEKSALNSTLGINSTSDSAP--ELSHKIPLKTAKWTSDGSLQKDDLVCPSNSAT 277
            G F+ ++  S ++ T    + S S    E+  +I L+ A W ++ +L  D  +CP NS  
Sbjct: 179  GQFAKLENNSFVSKTNRTRNFSISMEDSEVGQQISLRQATWNANSNLDVDAFICP-NSDQ 237

Query: 278  SAWLGTGTTGQFELSIAHTIRPSKLRLHNARTLDEEVSLFRVITTPSNGIMNLTYLDPSS 337
             AW   G+ G    +  +T+  SK+R++N    D ++SLFR+I  P NGI+NLTYLDP S
Sbjct: 238  QAWYSEGSYGVITCNFPNTLTLSKIRIYNTPITDNQISLFRLIAIPGNGILNLTYLDPIS 297

Query: 338  GELRTCDAWCPLLSTQNLTAAKSKAAS-TDQVEFLNNQTT-VQWSESYQDFAFVNSVPVT 395
             +++ C   CPL + + L  A       +D + F+NN +T ++W+E YQ+FAFVN +P+T
Sbjct: 298  HDIKHCTENCPLFTRETLLNAMGNVTQESDVIRFINNNSTNIKWNEYYQEFAFVNQLPIT 357

Query: 396  SITFMALDSYGSSVGVNGFELYEDDFSVYANDSFNVPDCSSTSNY-SKASLSASQWDQGS 454
            S+ F+A +SY  +VG++GF++Y+D F ++ N+SFN P+C S+++  S   LS + W   +
Sbjct: 358  SLQFVASNSYYQNVGLSGFQIYQDSFPIFPNNSFNEPNCPSSNDIASYVKLSGNGWFTVA 417

Query: 455  SDEDYVY-TLVENSQEAPSVTFYPQIVYSGLYTINVLTPGCLADGSCQSRSVVNASLWDS 513
            +D  Y+  + + N    PS+T++  I   G Y +N++TPGC  D +C +R +VN + +D+
Sbjct: 418  NDNSYLANSYIPNQGTKPSITYFVGINVPGEYVLNLVTPGCDKDNTCSTRGIVNVTTFDN 477

Query: 514  NNGTLLSSITIYQNNDYEKYDNLYSGYLENEVKVVLEYEGAIGNTEGSPMMVAGQISVNT 573
            +NG +L S  IYQNN+  KYD +++G L N + V +EY   I    G+  +V G + V  
Sbjct: 478  SNGNILGSALIYQNNNNLKYDQIFAGVLNNSISVQVEYYSGINTNTGTATVVVGVVDVVR 537

Query: 574  DEFDSSVFTDKYKTGKXXXXXXXXXXXXXXXXQNFKSNNS--------TDLAQYSVSNFA 625
                S   +D+    +                 NF  +N         T L  + VSNF 
Sbjct: 538  VSISSEFISDQIDGDR----SLHLNGIFEYSPSNFTFDNGYLTGKIDYTILDDFGVSNFN 593

Query: 626  KNSNFF-VDKFKNYIMLFASSGKVSKLEIDQQFDVRTVTTEEVGDEVSGVFAFSEGLGVI 684
            K ++ F VD+ +N + L +++G V +L       V + T   +   ++G+++  EGL + 
Sbjct: 594  KGASIFAVDQNQN-LYLGSTNGSVYELNSLNGSSVPS-TENNLSGLINGMYSVEEGLVIF 651

Query: 685  GTF--DGSTKGAKFYNGSF--FDIPLSHSNVTTFTNFTLDGAELVSLGNYYAINTTTDTL 740
            G+    G   GA   N S    DI  + S   +F N TL G+ L+   N    N T+  +
Sbjct: 652  GSIAHRGREYGAVILNKSITPLDIVANDSIQASF-NSTLFGSNLLVFDNSTIFNMTSFMV 710

Query: 741  FRNSSKMTLTARSAGLNNLGETVFYGSLTRNEYTDLXXXXXXXXXXXXXXXXXXXXXXXW 800
            F N+S   L  R+AG N+  + +  G++  N+ + +                        
Sbjct: 711  FENTSYRNLDLRNAGKNSNDDMLLVGNIV-NKGSAIGNESLLISSNGTYSPFSLSDNDTI 769

Query: 801  YDATYIDNSTTGYAFYDPSSTNGSYGVSIYKDMAKERDLSYRWTNMVGSMLYSKNSSLLA 860
              A Y++++    A Y  SS N +     Y  ++ ++ L + W + V  + YS    LL 
Sbjct: 770  EGAIYLNDTK---ALYSLSSGNVN-----YFQLSDKQRLPWTWQSTVVPVFYSNGQQLLG 821

Query: 861  LGMKNETRSPQLLLTNLTTGE---DTATFEWKTNVSINSLIFFDQNTSVLVGGDFNESES 917
               +N  +S Q++L +L + +   DT          IN+++ F  N + LVGGDF+ S  
Sbjct: 822  AIQENSNKS-QIVLIDLFSSQVINDTGNLTMH---KINAIVNFASNATALVGGDFSLSNP 877

Query: 918  NCSGLCLFDYERKHWSPFFDNMINGSIHSMKIFNKSSLVLGGFFDINDTKQVNLASMSLT 977
             C GLCL++Y   +WS F +N I G+I  +K FN + ++L G  ++N T  +NL S++LT
Sbjct: 878  ACVGLCLYNYNNSNWSSFLNNSITGNISQIK-FNDTQMLLSGKLEVNKTADINLLSINLT 936

Query: 978  DGSYNILHQGTETIL-DFIFVDGKVDNLVAVSANDLFRLTNNNWESISAQFDDSSVFGGL 1036
                +IL      +L DFI V   V   V  ++ D+F      W +++  FDD +     
Sbjct: 937  SNKQDILLYNNSVVLDDFILVRNLV---VGWNSTDIFIRNVTQWSNLNI-FDDGT---NA 989

Query: 1037 SEFPIQQGGQNKKREEEKNSLLITGDLLHKTYGKISAALYDFNDWIPYFSTTPATSTDGL 1096
            +   I+  G      +   +L+I G      YG I+A +YDFN W PYF     + T   
Sbjct: 990  TINRIENFG-----ADSNPALIIYGQFDSMKYGTINAVIYDFNSWYPYFEVDVVSQT--- 1041

Query: 1097 GQSRIYSNKDISSAFNYQGVLQXXXXXXXXXXXXXXXXXXXXXXXQLGAKKNKIARGFVV 1156
                 ++++D SS  N + V+                        +   K  KI RGFVV
Sbjct: 1042 ATPLFFADRDQSSYGNTRHVVPDHIIVSSSHSSSAPSSSSSHKTNE---KPYKIRRGFVV 1098

Query: 1157 LIGLALAMGTLAVMGVIGIALTFFFGKSSD-KYQSLEPRADESEMIDTVPPEKLMRFI 1213
            LIGLALA+ TL V+G+ G+ +   F  S +  Y  ++    ++     + PEKL+R +
Sbjct: 1099 LIGLALALATLIVLGITGVVIALLFNPSVNGDYDIIKTNDSDNFAGSNITPEKLIRVL 1156

>Kpol_1054.40 s1054 complement(93513..95747) [2235 bp, 744 aa] {ON}
           complement(93513..95747) [2235 nt, 745 aa]
          Length = 744

 Score = 34.3 bits (77), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 44/86 (51%), Gaps = 1/86 (1%)

Query: 52  LLGNFQNLNYYRYTGQDNFTGISDEKARESLIYHSNGTLLELSSPQYSNESFSVDHVIPL 111
           + G FQNL +Y  T QD +  ++D +    LI  + GT+LE + PQ ++  FS   VI  
Sbjct: 66  IAGIFQNLKFYINTEQDAYDTVNDIETLTRLIQSNGGTVLE-NIPQQNSIDFSKFFVISP 124

Query: 112 RDDSFILSGTGAISGAVLDHQVVFNL 137
            +D+ + + T     A   +  + N+
Sbjct: 125 YNDTKLRTVTSTFIKACCQNNTLLNI 150

>YJL045W Chr10 (356024..357928) [1905 bp, 634 aa] {ON} Minor
           succinate dehydrogenase isozyme; homologous to Sdh1p,
           the major isozyme reponsible for the oxidation of
           succinate and transfer of electrons to ubiquinone;
           induced during the diauxic shift in a Cat8p-dependent
           manner
          Length = 634

 Score = 33.5 bits (75), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 39/75 (52%), Gaps = 7/75 (9%)

Query: 296 TIRPSKLRLHNARTLDEEVSLFRVITTPSNGIMNLTYLDPSSGELRTCDA---W----CP 348
           +++ S++RL+  RT+ ++VS+FR   T   G+ N+T +D +  ++   D    W      
Sbjct: 492 SLKTSQIRLNMQRTMQKDVSVFRTQDTLDEGVRNITEVDKTFEDVHVSDKSMIWNSDLVE 551

Query: 349 LLSTQNLTAAKSKAA 363
            L  QNL    ++ A
Sbjct: 552 TLELQNLLTCATQTA 566

>YGR196C Chr7 complement(889733..892186) [2454 bp, 817 aa] {ON}
           FYV8Protein of unknown function, required for survival
           upon exposure to K1 killer toxin
          Length = 817

 Score = 33.5 bits (75), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 35/74 (47%), Gaps = 3/74 (4%)

Query: 696 FYNGSFFDIPLSHSNVTTFTNFTLDGAELVSLGNYYAINTTTDTLFRNSSKMTLTARSAG 755
           + N + +++P    N +      +D  E ++ GN    N+TTD    N++   L ARSA 
Sbjct: 610 YDNNTIYNVPGLIGNQSNLPPLPMDAQEQLNAGN---DNSTTDNDNSNNTANDLAARSAS 666

Query: 756 LNNLGETVFYGSLT 769
             +   TV  G +T
Sbjct: 667 FKSENRTVSQGEMT 680

>NDAI0J00920 Chr10 complement(203498..205330) [1833 bp, 610 aa] {ON} 
          Length = 610

 Score = 33.1 bits (74), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 36/160 (22%), Positives = 67/160 (41%), Gaps = 34/160 (21%)

Query: 930  KHWSPFFDN------MINGSIHSMKIFNKSSLVLGGFFDINDTKQVNLASMSLTDGSYNI 983
            K+W+PFF+N        NGSIH +  F                K + +   SLTDG  ++
Sbjct: 402  KNWTPFFNNDEGESEFSNGSIHFIYSF----------------KPLEILRCSLTDGLCDV 445

Query: 984  LHQGTETILDFIFVDGKVDNLVAVSANDLFRLTNNNWESISAQFDDSSVFGGLSEFPIQQ 1043
            +++     LD      K D+  +V     F    N    +  +  D +++ G ++  +Q 
Sbjct: 446  VYEKKFLDLD------KEDDFSSVHGGSQFVPLPN----VLPKVKDQNIWVGFAKMHLQN 495

Query: 1044 GGQNKKREEEKNSLLITGDLLHKTYGKISAALYDFNDWIP 1083
             G N         L+I    ++  + +++  ++DFN  +P
Sbjct: 496  SGCNPHYYRPMLMLMIENKGIY--HLEMTVPIFDFNFDVP 533

>Skud_4.53 Chr4 (91849..93033) [1185 bp, 394 aa] {ON} YDL204W (REAL)
          Length = 394

 Score = 32.3 bits (72), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 38/73 (52%), Gaps = 4/73 (5%)

Query: 403 DSYGSSV-GVNGFELYEDDFSVYANDSFNVPDCSSTSNYSKASLSASQWDQG---SSDED 458
           DSY +SV G +    ++ +   ++    N+ D SSTS  SK + S SQ+ QG   +S  +
Sbjct: 222 DSYSTSVSGKDDSVTHKRNKGDFSTSGHNIKDNSSTSQRSKDAYSTSQYSQGNYPTSKSE 281

Query: 459 YVYTLVENSQEAP 471
            + TL     E+P
Sbjct: 282 DISTLKSGKHESP 294

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.131    0.376 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 131,600,389
Number of extensions: 6125482
Number of successful extensions: 14543
Number of sequences better than 10.0: 73
Number of HSP's gapped: 14733
Number of HSP's successfully gapped: 83
Length of query: 1213
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1092
Effective length of database: 39,606,813
Effective search space: 43250639796
Effective search space used: 43250639796
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 72 (32.3 bits)