Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_56.235778.254ON68366830930.0
KLTH0G13882g8.254ON68767325870.0
SAKL0H17248g8.254ON66066721690.0
NDAI0B023708.254ON72266721400.0
Suva_10.1678.254ON68467121300.0
YLR083C (EMP70)8.254ON66766921200.0
KLLA0F18931g8.254ON66566721100.0
NCAS0B049708.254ON66666621050.0
Smik_12.1428.254ON66366721000.0
Skud_12.1518.254ON66466720690.0
YDR107C (TMN2)8.254ON67266720420.0
KAFR0B026808.254ON66466720050.0
Suva_2.2678.254ON67267119950.0
CAGL0B01683g8.254ON69167719840.0
ZYRO0C01848g8.254ON64766819640.0
TBLA0E043708.254ON67667219610.0
Smik_4.3538.254ON69066719600.0
Kpol_543.358.254ON65866819400.0
Skud_4.3688.254ON67267219250.0
KNAG0G019908.254ON66766919040.0
TBLA0H014508.254ON67367018580.0
TPHA0A018408.254ON68567318510.0
NCAS0B038908.254ON66367118240.0
AGR097W8.254ON65366818020.0
TDEL0F038108.254ON65666417220.0
NDAI0J014208.254ON61963815930.0
Ecym_43178.254ON60566614220.0
NDAI0A015107.411ON6797102894e-26
NCAS0A145207.411ON6702502305e-19
KNAG0C034307.411ON6802582235e-18
ZYRO0B03784g7.411ON6582572154e-17
TDEL0C027107.411ON6782502002e-15
YER113C (TMN3)7.411ON7062391968e-15
Skud_5.2667.411ON7072141951e-14
KLLA0E20835g7.411ON6762841922e-14
Smik_5.2587.411ON7062451904e-14
Suva_5.2347.411ON7062141887e-14
KLTH0C06226g7.411ON6941531833e-13
SAKL0F12914g7.411ON7071631807e-13
CAGL0G03487g7.411ON7042131772e-12
KAFR0K019507.411ON6642441743e-12
Kwal_27.107467.411ON6901601743e-12
Ecym_71437.411ON6763011573e-10
TBLA0I003307.411ON7133111467e-09
AGL295C7.411ON6571591451e-08
TPHA0K007307.411ON7331521361e-07
Kpol_1045.287.411ON6811601299e-07
NCAS0B075601.303ON49558724.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_56.23577
         (683 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_56.23577 s56 complement(605281..607332) [2052 bp, 683 aa] {...  1196   0.0  
KLTH0G13882g Chr7 (1204180..1206243) [2064 bp, 687 aa] {ON} simi...  1001   0.0  
SAKL0H17248g Chr8 (1530599..1532581) [1983 bp, 660 aa] {ON} simi...   840   0.0  
NDAI0B02370 Chr2 complement(593012..595180) [2169 bp, 722 aa] {O...   828   0.0  
Suva_10.167 Chr10 complement(299075..301129) [2055 bp, 684 aa] {...   825   0.0  
YLR083C Chr12 complement(294091..296094) [2004 bp, 667 aa] {ON} ...   821   0.0  
KLLA0F18931g Chr6 complement(1734636..1736633) [1998 bp, 665 aa]...   817   0.0  
NCAS0B04970 Chr2 complement(909770..911770) [2001 bp, 666 aa] {O...   815   0.0  
Smik_12.142 Chr12 complement(273932..275923) [1992 bp, 663 aa] {...   813   0.0  
Skud_12.151 Chr12 complement(277467..279461) [1995 bp, 664 aa] {...   801   0.0  
YDR107C Chr4 complement(669016..671034) [2019 bp, 672 aa] {ON}  ...   791   0.0  
KAFR0B02680 Chr2 complement(537048..539042) [1995 bp, 664 aa] {O...   776   0.0  
Suva_2.267 Chr2 complement(463458..465476) [2019 bp, 672 aa] {ON...   773   0.0  
CAGL0B01683g Chr2 complement(154275..156350) [2076 bp, 691 aa] {...   768   0.0  
ZYRO0C01848g Chr3 (146621..148564) [1944 bp, 647 aa] {ON} simila...   761   0.0  
TBLA0E04370 Chr5 complement(1108954..1110984) [2031 bp, 676 aa] ...   759   0.0  
Smik_4.353 Chr4 complement(630320..632392) [2073 bp, 690 aa] {ON...   759   0.0  
Kpol_543.35 s543 complement(78246..80222) [1977 bp, 658 aa] {ON}...   751   0.0  
Skud_4.368 Chr4 complement(640627..642645) [2019 bp, 672 aa] {ON...   746   0.0  
KNAG0G01990 Chr7 complement(441326..443329) [2004 bp, 667 aa] {O...   738   0.0  
TBLA0H01450 Chr8 complement(321416..323437) [2022 bp, 673 aa] {O...   720   0.0  
TPHA0A01840 Chr1 (371758..373815) [2058 bp, 685 aa] {ON} Anc_8.2...   717   0.0  
NCAS0B03890 Chr2 (693950..695941) [1992 bp, 663 aa] {ON} Anc_8.254    707   0.0  
AGR097W Chr7 (920133..922094) [1962 bp, 653 aa] {ON} Syntenic ho...   698   0.0  
TDEL0F03810 Chr6 complement(696251..698221) [1971 bp, 656 aa] {O...   667   0.0  
NDAI0J01420 Chr10 (326749..328608) [1860 bp, 619 aa] {ON} Anc_8....   618   0.0  
Ecym_4317 Chr4 (685854..687671) [1818 bp, 605 aa] {ON} similar t...   552   0.0  
NDAI0A01510 Chr1 (335693..337732) [2040 bp, 679 aa] {ON} Anc_7.4...   115   4e-26
NCAS0A14520 Chr1 complement(2860704..2862716) [2013 bp, 670 aa] ...    93   5e-19
KNAG0C03430 Chr3 (674411..676453) [2043 bp, 680 aa] {ON} Anc_7.4...    91   5e-18
ZYRO0B03784g Chr2 complement(314902..316878) [1977 bp, 658 aa] {...    87   4e-17
TDEL0C02710 Chr3 complement(474759..476795) [2037 bp, 678 aa] {O...    82   2e-15
YER113C Chr5 complement(387932..390052) [2121 bp, 706 aa] {ON}  ...    80   8e-15
Skud_5.266 Chr5 (431486..433609) [2124 bp, 707 aa] {ON} YER113C ...    80   1e-14
KLLA0E20835g Chr5 complement(1857426..1859456) [2031 bp, 676 aa]...    79   2e-14
Smik_5.258 Chr5 complement(396781..398901) [2121 bp, 706 aa] {ON...    78   4e-14
Suva_5.234 Chr5 complement(363605..365725) [2121 bp, 706 aa] {ON...    77   7e-14
KLTH0C06226g Chr3 (541022..543106) [2085 bp, 694 aa] {ON} simila...    75   3e-13
SAKL0F12914g Chr6 complement(1013914..1016037) [2124 bp, 707 aa]...    74   7e-13
CAGL0G03487g Chr7 complement(337133..339247) [2115 bp, 704 aa] {...    73   2e-12
KAFR0K01950 Chr11 complement(401168..403162) [1995 bp, 664 aa] {...    72   3e-12
Kwal_27.10746 s27 (479237..481309) [2073 bp, 690 aa] {ON} YER113...    72   3e-12
Ecym_7143 Chr7 (290555..292585) [2031 bp, 676 aa] {ON} similar t...    65   3e-10
TBLA0I00330 Chr9 (52200..54341) [2142 bp, 713 aa] {ON} Anc_7.411...    61   7e-09
AGL295C Chr7 complement(152197..154170) [1974 bp, 657 aa] {ON} S...    60   1e-08
TPHA0K00730 Chr11 (150877..153078) [2202 bp, 733 aa] {ON} Anc_7....    57   1e-07
Kpol_1045.28 s1045 (64235..66280) [2046 bp, 681 aa] {ON} (64237....    54   9e-07
NCAS0B07560 Chr2 complement(1426000..1427477,1427593..1427602) [...    32   4.7  

>Kwal_56.23577 s56 complement(605281..607332) [2052 bp, 683 aa] {ON}
           YLR083C (EMP70) - endosomal membrane protein [contig
           176] FULL
          Length = 683

 Score = 1196 bits (3093), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 589/668 (88%), Positives = 589/668 (88%)

Query: 16  RVEGFYLPGVAPTTYHEGDSIPLLVNHLTPSMYFKHVDDDGKDTGDRESFLYSYDYYYDK 75
           RVEGFYLPGVAPTTYHEGDSIPLLVNHLTPSMYFKHVDDDGKDTGDRESFLYSYDYYYDK
Sbjct: 16  RVEGFYLPGVAPTTYHEGDSIPLLVNHLTPSMYFKHVDDDGKDTGDRESFLYSYDYYYDK 75

Query: 76  FHFCKPEKLEKQRESLGSIIFGDRIYNSPFKLEMLKDKECEALCSSKIPANDAKFINKLI 135
           FHFCKPEKLEKQRESLGSIIFGDRIYNSPFKLEMLKDKECEALCSSKIPANDAKFINKLI
Sbjct: 76  FHFCKPEKLEKQRESLGSIIFGDRIYNSPFKLEMLKDKECEALCSSKIPANDAKFINKLI 135

Query: 136 ANGFFQNWLVDGLPAARKTTDERTKSEFYTPGFELGFIDVGGAKLRMDGQGEEDAHPKGA 195
           ANGFFQNWLVDGLPAARKTTDERTKSEFYTPGFELGFIDVGGAKLRMDGQGEEDAHPKGA
Sbjct: 136 ANGFFQNWLVDGLPAARKTTDERTKSEFYTPGFELGFIDVGGAKLRMDGQGEEDAHPKGA 195

Query: 196 TKPVAQDDYLDRPSKSKNEKRKKIVDPKELVKQLETAYFANHFNIEVQYHDRGNGDYRVV 255
           TKPVAQDDYLDRPSKSKNEKRKKIVDPKELVKQLETAYFANHFNIEVQYHDRGNGDYRVV
Sbjct: 196 TKPVAQDDYLDRPSKSKNEKRKKIVDPKELVKQLETAYFANHFNIEVQYHDRGNGDYRVV 255

Query: 256 GVIVNPQSIKRDSSNSCAATGXXXXXXXXXXTTVHFSYSVKFTPSDTVWATRWDKYLHVY 315
           GVIVNPQSIKRDSSNSCAATG          TTVHFSYSVKFTPSDTVWATRWDKYLHVY
Sbjct: 256 GVIVNPQSIKRDSSNSCAATGELLKLSEEEETTVHFSYSVKFTPSDTVWATRWDKYLHVY 315

Query: 316 DPKIQWYXXXXXXXXXXXXXXXXXXXXYRTLRDDLSRYNQLNLDDDFQEETGWKLVHGDV 375
           DPKIQWY                    YRTLRDDLSRYNQLNLDDDFQEETGWKLVHGDV
Sbjct: 316 DPKIQWYSLINFSIVVIVLSSVVIHSLYRTLRDDLSRYNQLNLDDDFQEETGWKLVHGDV 375

Query: 376 FRTPTKXXXXXXXXXXXTQLFVMAACTIAFAXXXXXXXXXXXXXTTVMFILYALFGSLGS 435
           FRTPTK           TQLFVMAACTIAFA             TTVMFILYALFGSLGS
Sbjct: 376 FRTPTKSLLLSVLVGSGTQLFVMAACTIAFALLGLLSPSSRGSLTTVMFILYALFGSLGS 435

Query: 436 YTSMATYKFFGGEYWKVNMILTPILVPGLLFCVVLGLNFFLIMVESAGAIPFGTMCAIVL 495
           YTSMATYKFFGGEYWKVNMILTPILVPGLLFCVVLGLNFFLIMVESAGAIPFGTMCAIVL
Sbjct: 436 YTSMATYKFFGGEYWKVNMILTPILVPGLLFCVVLGLNFFLIMVESAGAIPFGTMCAIVL 495

Query: 496 LWFVFSIPLSLAGSLIAKKKCRWNEHPTKTRQIPRQIPFQPWYLKTAPAALIAGIFPFGS 555
           LWFVFSIPLSLAGSLIAKKKCRWNEHPTKTRQIPRQIPFQPWYLKTAPAALIAGIFPFGS
Sbjct: 496 LWFVFSIPLSLAGSLIAKKKCRWNEHPTKTRQIPRQIPFQPWYLKTAPAALIAGIFPFGS 555

Query: 556 IAVELYFVYSSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXXXXXXXCLENWKWQWRGFW 615
           IAVELYFVYSSLWFNKIFYMFG                         CLENWKWQWRGFW
Sbjct: 556 IAVELYFVYSSLWFNKIFYMFGFLFVSFLLLTLTTALVTVLLTYYSLCLENWKWQWRGFW 615

Query: 616 IGGAGCALYVFLHAILFTKFKLGGFVTIVLYVGYSLVISLLTCLITGAVGFMSSLWFVRR 675
           IGGAGCALYVFLHAILFTKFKLGGFVTIVLYVGYSLVISLLTCLITGAVGFMSSLWFVRR
Sbjct: 616 IGGAGCALYVFLHAILFTKFKLGGFVTIVLYVGYSLVISLLTCLITGAVGFMSSLWFVRR 675

Query: 676 IYSSIKVD 683
           IYSSIKVD
Sbjct: 676 IYSSIKVD 683

>KLTH0G13882g Chr7 (1204180..1206243) [2064 bp, 687 aa] {ON} similar
           to uniprot|P32802 Saccharomyces cerevisiae YLR083C EMP70
           Protein whose 24kDa cleavage product is found in
           endosome-enriched membrane fractions predicted to be a
           transmembrane protein
          Length = 687

 Score = 1001 bits (2587), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 488/673 (72%), Positives = 545/673 (80%), Gaps = 5/673 (0%)

Query: 16  RVEGFYLPGVAPTTYHEGDSIPLLVNHLTPSMYFKHVDDDGKDTGDRESFLYSYDYYYDK 75
           +V GFYLPGVAPTTYHEGD+IPLLVNHLTP+MY++H D+DG D GD+ES LYSYDYYY K
Sbjct: 15  QVSGFYLPGVAPTTYHEGDAIPLLVNHLTPTMYYQHADEDGNDLGDKESLLYSYDYYYPK 74

Query: 76  FHFCKPEKLEKQRESLGSIIFGDRIYNSPFKLEMLKDKECEALCSSKIPANDAKFINKLI 135
           FHFC+PEKLEKQRESLGSIIFGDRIYNSPF++EMLK+KEC +LCS  IPA+DAKFINKLI
Sbjct: 75  FHFCRPEKLEKQRESLGSIIFGDRIYNSPFQIEMLKNKECASLCSESIPADDAKFINKLI 134

Query: 136 ANGFFQNWLVDGLPAARKTTDERTKSEFYTPGFELGFIDVGGAKLRMDGQGE----EDAH 191
            NGFFQNWLVDGLPAARKTTD RTKSEFYTPGFELG++ +GG++LRM+GQG     +D+ 
Sbjct: 135 TNGFFQNWLVDGLPAARKTTDVRTKSEFYTPGFELGYVGIGGSELRMNGQGGSQDGDDSG 194

Query: 192 PKGATKPVAQDDYLDRP-SKSKNEKRKKIVDPKELVKQLETAYFANHFNIEVQYHDRGNG 250
             G+TK V++ DYLD P +K    KRK++ + KELVKQLET YFANHF IEVQYHDRGNG
Sbjct: 195 SHGSTKEVSESDYLDAPPAKRSLAKRKQVSNTKELVKQLETPYFANHFEIEVQYHDRGNG 254

Query: 251 DYRVVGVIVNPQSIKRDSSNSCAATGXXXXXXXXXXTTVHFSYSVKFTPSDTVWATRWDK 310
           +YRVVGVIVNP SIKR+S ++C  TG          T VHFSYSVKFTPS+TVWATRWDK
Sbjct: 255 NYRVVGVIVNPYSIKRESPDTCDKTGELLKLSETEATEVHFSYSVKFTPSETVWATRWDK 314

Query: 311 YLHVYDPKIQWYXXXXXXXXXXXXXXXXXXXXYRTLRDDLSRYNQLNLDDDFQEETGWKL 370
           YLHVYDPKIQW+                    Y TL DDLSRYNQ+NLDDDFQEETGWKL
Sbjct: 315 YLHVYDPKIQWFSLINFSLVVVFLSTVMIHRLYVTLTDDLSRYNQINLDDDFQEETGWKL 374

Query: 371 VHGDVFRTPTKXXXXXXXXXXXTQLFVMAACTIAFAXXXXXXXXXXXXXTTVMFILYALF 430
           +HGDVFRTP +            QLF+MAACTI FA             TTVMFILYALF
Sbjct: 375 IHGDVFRTPERSLILSVLVGSGAQLFLMAACTIGFALLGLLSPSSRGSLTTVMFILYALF 434

Query: 431 GSLGSYTSMATYKFFGGEYWKVNMILTPILVPGLLFCVVLGLNFFLIMVESAGAIPFGTM 490
           GS GSYTSMATYKFFGG YWKVNM+LTPILVPGLLFCV+L LNFFL++VESAGAIPFGTM
Sbjct: 435 GSFGSYTSMATYKFFGGPYWKVNMLLTPILVPGLLFCVMLALNFFLVVVESAGAIPFGTM 494

Query: 491 CAIVLLWFVFSIPLSLAGSLIAKKKCRWNEHPTKTRQIPRQIPFQPWYLKTAPAALIAGI 550
           C IVLLWF+FSIPLS+AGSLIA+KKC+W+EHPTKT+QIPRQIPFQPWYLKT PA+LIAGI
Sbjct: 495 CVIVLLWFLFSIPLSVAGSLIARKKCKWDEHPTKTKQIPRQIPFQPWYLKTVPASLIAGI 554

Query: 551 FPFGSIAVELYFVYSSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXXXXXXXCLENWKWQ 610
           FPFGSIAVELYF+YSSLWFNKIFYMFG                         CLENWKWQ
Sbjct: 555 FPFGSIAVELYFIYSSLWFNKIFYMFGFLFVSFLLLTLTTSLITVLLTYYSLCLENWKWQ 614

Query: 611 WRGFWIGGAGCALYVFLHAILFTKFKLGGFVTIVLYVGYSLVISLLTCLITGAVGFMSSL 670
           WRGFWIGGAGCALY+F+HAILFTKF+LGGF TIVLYVGYSLV+SLL+CLITG VGF+SSL
Sbjct: 615 WRGFWIGGAGCALYMFIHAILFTKFRLGGFTTIVLYVGYSLVMSLLSCLITGTVGFLSSL 674

Query: 671 WFVRRIYSSIKVD 683
           WFVRRIYSS+KVD
Sbjct: 675 WFVRRIYSSVKVD 687

>SAKL0H17248g Chr8 (1530599..1532581) [1983 bp, 660 aa] {ON} similar
           to uniprot|P32802 Saccharomyces cerevisiae YLR083C EMP70
           Protein whose 24kDa cleavage product is found in
           endosome-enriched membrane fractions predicted to be a
           transmembrane protein
          Length = 660

 Score =  840 bits (2169), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 415/667 (62%), Positives = 477/667 (71%), Gaps = 21/667 (3%)

Query: 18  EGFYLPGVAPTTYHEGDSIPLLVNHLTPSMYFKHVDDDGKD-TGDRESFLYSYDYYYDKF 76
             FYLPGVAPTTYH+GD IPLLVNHLTPS YF+H D +G   +GD+E FLYSYDYYYDKF
Sbjct: 14  SAFYLPGVAPTTYHKGDEIPLLVNHLTPSTYFQHADQEGHTMSGDKERFLYSYDYYYDKF 73

Query: 77  HFCKPEKLEKQRESLGSIIFGDRIYNSPFKLEMLKDKECEALCSSKIPANDAKFINKLIA 136
           HFC+PE L KQ ESLGSIIFGDRIYNSPF+L ML++K C  LC S+IP +DAKFINKLI 
Sbjct: 74  HFCRPENLIKQPESLGSIIFGDRIYNSPFELNMLENKTCVPLCKSEIPKDDAKFINKLIR 133

Query: 137 NGFFQNWLVDGLPAARKTTDERTKSEFYTPGFELGFIDVGGAKLRMDGQGEEDAHPKGAT 196
           NGFF NWLVDGLPAAR+  D RT S FY  GFELGF+DV      +D   + D      T
Sbjct: 134 NGFFHNWLVDGLPAAREMHDGRTNSYFYGNGFELGFVDV------VDTIEDPD------T 181

Query: 197 KPVAQDDYLDRPSKSKNEKRKKIVDPKELVKQLETAYFANHFNIEVQYHDRGNGDYRVVG 256
           K V++ DY++     K  K +         K  E +YF NHF+I+++YHDRG  +YRVVG
Sbjct: 182 KKVSESDYIEIADADKELKERS-------AKLTELSYFINHFDIKIEYHDRGEDNYRVVG 234

Query: 257 VIVNPQSIKRDSSNSCAATGXXXXXXXXXXTTVHFSYSVKFTPSDTVWATRWDKYLHVYD 316
           V V P SIKRDSS+SC   G           TVHF+YSV F PS T+WATRWDKYLHVYD
Sbjct: 235 VSVIPASIKRDSSDSCDTEGEPLVLSEDADNTVHFTYSVSFVPSQTLWATRWDKYLHVYD 294

Query: 317 PKIQWYXXXXXXXXXXXXXXXXXXXXYRTLRDDLSRYNQLNLDDDFQEETGWKLVHGDVF 376
           P+IQW+                    +R L++DLSRYN+LNLDD+FQEETGWKLVHGDVF
Sbjct: 295 PQIQWFSLISFSLIVILLSSVMVHSLFRALKNDLSRYNELNLDDEFQEETGWKLVHGDVF 354

Query: 377 RTPTKXXXXXXXXXXXTQLFVMAACTIAFAXXXXXXXXXXXXXTTVMFILYALFGSLGSY 436
           RTP +            QLF+MA  TI FA             TTVMFILYALFGS GSY
Sbjct: 355 RTPERTMLLSVLVGSGAQLFLMAGFTILFALLGLLSPSSRGSLTTVMFILYALFGSFGSY 414

Query: 437 TSMATYKFFGGEYWKVNMILTPILVPGLLFCVVLGLNFFLIMVESAGAIPFGTMCAIVLL 496
           TSMA YKFF G+ WK+NMILTPIL+P ++F  +LGLN FL+ V S+GAIPFGTM AIV+L
Sbjct: 415 TSMAVYKFFNGQNWKLNMILTPILIPSMIFISMLGLNTFLVFVHSSGAIPFGTMLAIVVL 474

Query: 497 WFVFSIPLSLAGSLIAKKKCRWNEHPTKTRQIPRQIPFQPWYLKTAPAALIAGIFPFGSI 556
           WFVFSIPLS+AGS+I++KK +W + PT T QI RQIPFQPWYLKT PA+LIAG FPFGSI
Sbjct: 475 WFVFSIPLSVAGSIISRKKSQW-DRPTNTNQIARQIPFQPWYLKTVPASLIAGTFPFGSI 533

Query: 557 AVELYFVYSSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXXXXXXXCLENWKWQWRGFWI 616
            VELYF+YSSLWFNKIFYMFG                         C+ENWKWQWRGFWI
Sbjct: 534 VVELYFIYSSLWFNKIFYMFGFLFFSFLLLTLTTTLVTVLLTYYSLCMENWKWQWRGFWI 593

Query: 617 GGAGCALYVFLHAILFTKFKLGGFVTIVLYVGYSLVISLLTCLITGAVGFMSSLWFVRRI 676
           GGAGCA YVF+HAILFTKFKLGG  T+VLY+GYS+VIS L CLITGAVGF+SSLWFVR+I
Sbjct: 594 GGAGCAFYVFVHAILFTKFKLGGLTTVVLYLGYSVVISGLCCLITGAVGFLSSLWFVRKI 653

Query: 677 YSSIKVD 683
           Y SIKVD
Sbjct: 654 YGSIKVD 660

>NDAI0B02370 Chr2 complement(593012..595180) [2169 bp, 722 aa] {ON}
           Anc_8.254
          Length = 722

 Score =  828 bits (2140), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/667 (60%), Positives = 469/667 (70%), Gaps = 16/667 (2%)

Query: 18  EGFYLPGVAPTTYHEGDSIPLLVNHLTPSMYFKHVDDDGKDT-GDRESFLYSYDYYYDKF 76
             FYLPGVAPTTYH  D IPLLVNHLTPSMYF+H ++DGK    D+E FLYSYDYYYD+F
Sbjct: 71  RAFYLPGVAPTTYHPDDEIPLLVNHLTPSMYFQHKNEDGKTMKSDKERFLYSYDYYYDRF 130

Query: 77  HFCKPEKLEKQRESLGSIIFGDRIYNSPFKLEMLKDKECEALCSSKIPANDAKFINKLIA 136
           HFC+PE +EKQ ESLGSIIFGDRIYNSPF++ ML+DK C +LC + IP  DAKFINKLI 
Sbjct: 131 HFCQPEHIEKQPESLGSIIFGDRIYNSPFQINMLQDKTCVSLCKTTIPGKDAKFINKLIK 190

Query: 137 NGFFQNWLVDGLPAARKTTDERTKSEFYTPGFELGFIDVGGAKLRMDGQGEEDAHPKGAT 196
           NGFFQNWL+DGLPAAR+  D RTK+EFY  GFELGF+DV      + G    D     A 
Sbjct: 191 NGFFQNWLIDGLPAARQVYDSRTKTEFYGTGFELGFVDV------VQGTTTGDNANTVAK 244

Query: 197 KPVAQDDYLDRPSKSKNEKRKKIVDPKELVKQLETAYFANHFNIEVQYHDRGNGDYRVVG 256
           KP   +        +KN          +++K  E  YFANHF+I+V+YHDRG  +YRVVG
Sbjct: 245 KPTTNEGLELDTRDAKN---------VQMLKNFELPYFANHFDIQVEYHDRGENNYRVVG 295

Query: 257 VIVNPQSIKRDSSNSCAATGXXXXXXXXXXTTVHFSYSVKFTPSDTVWATRWDKYLHVYD 316
           VIVNP SIKR +  +C  +G            V+F+YSVKF PS+T+WATRWDKYLH+YD
Sbjct: 296 VIVNPVSIKRSTPGTCETSGAPLMLSEDQDNDVYFTYSVKFIPSETIWATRWDKYLHIYD 355

Query: 317 PKIQWYXXXXXXXXXXXXXXXXXXXXYRTLRDDLSRYNQLNLDDDFQEETGWKLVHGDVF 376
           P IQW+                     + L+ D +RYN+LNLDDDFQEE GWKL HGDVF
Sbjct: 356 PAIQWFSLINFSVVVLLLSSVVIHSLLKALKSDFARYNELNLDDDFQEEAGWKLGHGDVF 415

Query: 377 RTPTKXXXXXXXXXXXTQLFVMAACTIAFAXXXXXXXXXXXXXTTVMFILYALFGSLGSY 436
           R P +            QLF+M  C+I FA              TVMFILYALFG +GSY
Sbjct: 416 RIPHRSLLLSVLVGSGVQLFLMIICSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSY 475

Query: 437 TSMATYKFFGGEYWKVNMILTPILVPGLLFCVVLGLNFFLIMVESAGAIPFGTMCAIVLL 496
           TSM  YKFFGG YWKVNM+LTPILVPGL+FC ++ LN FL+ V S+G IP  T+  ++LL
Sbjct: 476 TSMGVYKFFGGPYWKVNMLLTPILVPGLIFCGIVALNIFLLFVHSSGVIPAVTLFFMILL 535

Query: 497 WFVFSIPLSLAGSLIAKKKCRWNEHPTKTRQIPRQIPFQPWYLKTAPAALIAGIFPFGSI 556
           WFVFSIPL+LAGSLIA KKC W+EHPTKT QI RQIPFQPWYLKT PA LIAGIFPFGSI
Sbjct: 536 WFVFSIPLALAGSLIAHKKCNWDEHPTKTNQIARQIPFQPWYLKTWPATLIAGIFPFGSI 595

Query: 557 AVELYFVYSSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXXXXXXXCLENWKWQWRGFWI 616
           AVELYF+YSSLWFNKIFYMFG                         CLENW WQWRGF I
Sbjct: 596 AVELYFIYSSLWFNKIFYMFGFLLFSFFLLTLTTSLVTILITYHSLCLENWMWQWRGFII 655

Query: 617 GGAGCALYVFLHAILFTKFKLGGFVTIVLYVGYSLVISLLTCLITGAVGFMSSLWFVRRI 676
           GG GCA+YVF+H+ILFTKFKLGGF TIVLYVGYS +ISLL C++TGA+GF+SS++F+R+I
Sbjct: 656 GGVGCAIYVFIHSILFTKFKLGGFTTIVLYVGYSTIISLLFCIVTGAIGFLSSMFFIRKI 715

Query: 677 YSSIKVD 683
           YSSIKV+
Sbjct: 716 YSSIKVE 722

>Suva_10.167 Chr10 complement(299075..301129) [2055 bp, 684 aa] {ON}
           YLR083C (REAL)
          Length = 684

 Score =  825 bits (2130), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/671 (59%), Positives = 473/671 (70%), Gaps = 8/671 (1%)

Query: 18  EGFYLPGVAPTTYHEGDSIPLLVNHLTPSMYFKHVDDDGKD-TGDRESFLYSYDYYYDKF 76
             FYLPGVAPTTY E D IPLLVNHLTPSMY++H D+DG + +GD+E FLYSYDYYYDKF
Sbjct: 17  RAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHQDEDGNNVSGDKEHFLYSYDYYYDKF 76

Query: 77  HFCKPEKLEKQRESLGSIIFGDRIYNSPFKLEMLKDKECEALCSSKIPANDAKFINKLIA 136
           HFCKPE +EKQ ESLGSIIFGDRIYNSPF+L ML++KEC +LC + IP +DAKFINKLI 
Sbjct: 77  HFCKPEHVEKQPESLGSIIFGDRIYNSPFELNMLQEKECVSLCKTVIPGDDAKFINKLIK 136

Query: 137 NGFFQNWLVDGLPAARKTTDERTKSEFYTPGFELGFIDVGGAKLRMDGQGEEDAHPKGAT 196
           NGFFQNWL+DGLPAAR+  D RTK++FY  GF LGF++V      +D + E+     G T
Sbjct: 137 NGFFQNWLIDGLPAAREVHDGRTKTDFYGAGFGLGFVEVAQV---VDSETEQVQVASGET 193

Query: 197 KPVAQDDYLDRPSKSKNEKRKKIVDP----KELVKQLETAYFANHFNIEVQYHDRGNGDY 252
           +     D    P K K+      +D     K +VK  E  YFANHF+I+++YHDRG G+Y
Sbjct: 194 EQTQAADGKTEPEKGKSSNEGMELDARDQGKNMVKTREFPYFANHFDIKIEYHDRGEGNY 253

Query: 253 RVVGVIVNPQSIKRDSSNSCAATGXXXXXXXXXXTTVHFSYSVKFTPSDTVWATRWDKYL 312
           RVVGVIVNP SIKR S  +C   G            V+F+YSVKF  S T WATRWDKYL
Sbjct: 254 RVVGVIVNPLSIKRSSPGTCETNGSPLVLDEANDNEVYFTYSVKFEESPTSWATRWDKYL 313

Query: 313 HVYDPKIQWYXXXXXXXXXXXXXXXXXXXXYRTLRDDLSRYNQLNLDDDFQEETGWKLVH 372
           HVYDP IQW+                     R L+ D +RYN+LNLDDDFQE++GWKL H
Sbjct: 314 HVYDPSIQWFSLINFSLVVVLLSSVVIHSLLRALKSDFARYNELNLDDDFQEDSGWKLNH 373

Query: 373 GDVFRTPTKXXXXXXXXXXXTQLFVMAACTIAFAXXXXXXXXXXXXXTTVMFILYALFGS 432
           GDVFR P++            Q+F+M  C+I FA              TVMFILYALFG 
Sbjct: 374 GDVFRPPSQSLMLSILVGSGVQIFLMVTCSIFFAALGFLSPSSRGSLATVMFILYALFGF 433

Query: 433 LGSYTSMATYKFFGGEYWKVNMILTPILVPGLLFCVVLGLNFFLIMVESAGAIPFGTMCA 492
           +GSYTSM  YKFF G YWK N+I+TP+L+PG +  V++ LNFFL+ V S+G IP  T+  
Sbjct: 434 VGSYTSMGIYKFFDGPYWKANVIMTPLLIPGAILLVIIALNFFLMFVHSSGVIPASTLFF 493

Query: 493 IVLLWFVFSIPLSLAGSLIAKKKCRWNEHPTKTRQIPRQIPFQPWYLKTAPAALIAGIFP 552
           +V LWF+FSIPLS AGSL+A+KKC W+EHPTKT QI RQIPFQPWYLKT PA LIAGIFP
Sbjct: 494 MVFLWFLFSIPLSFAGSLVARKKCHWDEHPTKTNQIARQIPFQPWYLKTLPATLIAGIFP 553

Query: 553 FGSIAVELYFVYSSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXXXXXXXCLENWKWQWR 612
           FGSIAVELYF+Y+SLWFNKIFYMFG                         CLENWKWQWR
Sbjct: 554 FGSIAVELYFIYTSLWFNKIFYMFGFLFFSFLLLTLTTSLVTVMITYHSLCLENWKWQWR 613

Query: 613 GFWIGGAGCALYVFLHAILFTKFKLGGFVTIVLYVGYSLVISLLTCLITGAVGFMSSLWF 672
           GF +GG GCALYVF+H+ILFTKFKLGGF TIVLY+GYS VISLL CL+TG++GF+SS++F
Sbjct: 614 GFTVGGVGCALYVFIHSILFTKFKLGGFTTIVLYLGYSSVISLLCCLVTGSIGFISSMFF 673

Query: 673 VRRIYSSIKVD 683
           +R+IYSSIKVD
Sbjct: 674 IRKIYSSIKVD 684

>YLR083C Chr12 complement(294091..296094) [2004 bp, 667 aa] {ON}
           EMP70Protein with a role in cellular adhesion,
           filamentous growth, and endosome-to-vacuole sorting;
           similar to Tmn2p and Tmn3p; member of Transmembrane Nine
           family of proteins with 9 transmembrane segments
          Length = 667

 Score =  821 bits (2120), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/669 (59%), Positives = 477/669 (71%), Gaps = 23/669 (3%)

Query: 17  VEGFYLPGVAPTTYHEGDSIPLLVNHLTPSMYFKHVDDDGKD-TGDRESFLYSYDYYYDK 75
           V+ FYLPGVAPTTY E D+IPLLVNHLTPSM ++H D+DG + +GD+E+FLYSYDYYY++
Sbjct: 20  VKAFYLPGVAPTTYRENDNIPLLVNHLTPSMNYQHKDEDGNNVSGDKENFLYSYDYYYNR 79

Query: 76  FHFCKPEKLEKQRESLGSIIFGDRIYNSPFKLEMLKDKECEALCSSKIPANDAKFINKLI 135
           FHFC+PEK+EKQ ESLGS+IFGDRIYNSPF+L ML++KECE+LC + IP +DAKFINKLI
Sbjct: 80  FHFCQPEKVEKQPESLGSVIFGDRIYNSPFQLNMLQEKECESLCKTVIPGDDAKFINKLI 139

Query: 136 ANGFFQNWLVDGLPAARKTTDERTKSEFYTPGFELGFIDVGGAKLRMDGQGEE-DAHPKG 194
            NGFFQNWL+DGLPAAR+  D RTK+ FY  GF LGF+ V         QG + +A PKG
Sbjct: 140 KNGFFQNWLIDGLPAAREVYDGRTKTSFYGAGFNLGFVQVT--------QGTDIEATPKG 191

Query: 195 ATKPVAQDDYLDRPSKSKNEKRKKIVDPKELVKQLETAYFANHFNIEVQYHDRGNGDYRV 254
           A     +    D   +++N++         +VK  E  YFANHF+I ++YHDRG G+YRV
Sbjct: 192 A-----ETTDKDVELETRNDRN--------MVKTYELPYFANHFDIMIEYHDRGEGNYRV 238

Query: 255 VGVIVNPQSIKRDSSNSCAATGXXXXXXXXXXTTVHFSYSVKFTPSDTVWATRWDKYLHV 314
           VGVIV P SIKR S  +C  TG            V+F+YSVKF  S T WATRWDKYLHV
Sbjct: 239 VGVIVEPVSIKRSSPGTCETTGSPLMLDEGNDNEVYFTYSVKFNESATSWATRWDKYLHV 298

Query: 315 YDPKIQWYXXXXXXXXXXXXXXXXXXXXYRTLRDDLSRYNQLNLDDDFQEETGWKLVHGD 374
           YDP IQW+                     R L+ D +RYN+LNLDDDFQE++GWKL HGD
Sbjct: 299 YDPSIQWFSLINFSLVVVLLSSVVIHSLLRALKSDFARYNELNLDDDFQEDSGWKLNHGD 358

Query: 375 VFRTPTKXXXXXXXXXXXTQLFVMAACTIAFAXXXXXXXXXXXXXTTVMFILYALFGSLG 434
           VFR+P++            QLF+M  C+I FA              TVMFILYALFG +G
Sbjct: 359 VFRSPSQSLTLSILVGSGVQLFLMVTCSIFFAALGFLSPSSRGSLATVMFILYALFGFVG 418

Query: 435 SYTSMATYKFFGGEYWKVNMILTPILVPGLLFCVVLGLNFFLIMVESAGAIPFGTMCAIV 494
           SYTSM  YKFF G YWK N+ILTP+LVPG +  +++ LNFFL+ V S+G IP  T+  +V
Sbjct: 419 SYTSMGIYKFFNGPYWKANLILTPLLVPGAILLIIIALNFFLMFVHSSGVIPASTLFFMV 478

Query: 495 LLWFVFSIPLSLAGSLIAKKKCRWNEHPTKTRQIPRQIPFQPWYLKTAPAALIAGIFPFG 554
            LWF+FSIPLS AGSLIA+K+C W+EHPTKT QI RQIPFQPWYLKT PA LIAGIFPFG
Sbjct: 479 FLWFLFSIPLSFAGSLIARKRCHWDEHPTKTNQIARQIPFQPWYLKTIPATLIAGIFPFG 538

Query: 555 SIAVELYFVYSSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXXXXXXXCLENWKWQWRGF 614
           SIAVELYF+Y+SLWFNKIFYMFG                         CLENWKWQWRGF
Sbjct: 539 SIAVELYFIYTSLWFNKIFYMFGFLFFSFLLLTLTSSLVTILITYHSLCLENWKWQWRGF 598

Query: 615 WIGGAGCALYVFLHAILFTKFKLGGFVTIVLYVGYSLVISLLTCLITGAVGFMSSLWFVR 674
            IGGAGCALYVF+H+ILFTKFKLGGF TIVLYVGYS VISLL CL+TG++GF+SS+ FVR
Sbjct: 599 IIGGAGCALYVFIHSILFTKFKLGGFTTIVLYVGYSSVISLLCCLVTGSIGFISSMLFVR 658

Query: 675 RIYSSIKVD 683
           +IYSSIKVD
Sbjct: 659 KIYSSIKVD 667

>KLLA0F18931g Chr6 complement(1734636..1736633) [1998 bp, 665 aa]
           {ON} similar to uniprot|P32802 Saccharomyces cerevisiae
           YLR083C EMP70 Protein whose 24kDa cleavage product is
           found in endosome-enriched membrane fractions predicted
           to be a transmembrane protein
          Length = 665

 Score =  817 bits (2110), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/667 (59%), Positives = 468/667 (70%), Gaps = 21/667 (3%)

Query: 17  VEGFYLPGVAPTTYHEGDSIPLLVNHLTPSMYFKHVDDDGKDTGDRESFLYSYDYYYDKF 76
           VE FYLPGVAPTTYHEGD +PLLVNHLTPS ++KH D D  DTGD+E FLYSYDYYY KF
Sbjct: 20  VEAFYLPGVAPTTYHEGDDLPLLVNHLTPSQFYKHYDTDQHDTGDKEGFLYSYDYYYKKF 79

Query: 77  HFCKPEKLEKQRESLGSIIFGDRIYNSPFKLEMLKDKECEALCSSKIPANDAKFINKLIA 136
           HFC+P +L+KQ ESLGSIIFGDRIYNSPFKL++LK+ EC++LC S IP  DAKFINKLI 
Sbjct: 80  HFCQPAELKKQPESLGSIIFGDRIYNSPFKLQLLKNVECQSLCKSVIPGKDAKFINKLIL 139

Query: 137 NGFFQNWLVDGLPAARKTTDERTKSEFYTPGFELGFIDVGGAKLRMDGQGEEDAHPKGAT 196
           NGFFQNW++DGLPAARK  D +T   FY  GFELG +DV             D  P   T
Sbjct: 140 NGFFQNWIIDGLPAARKMEDTKTNKIFYGNGFELGLVDV-----------LSDYEPD--T 186

Query: 197 KPVAQDDYLDRPSKSKNEKRKKIVDPKELVKQLETAYFANHFNIEVQYHDRGNGDYRVVG 256
           + +  +  L   +K      K ++ P +  K  E  YF NH++I+++YHDRG  +YR+VG
Sbjct: 187 RSLHDELELQLNAK------KNVLSPGD--KVTEIPYFVNHYDIQIEYHDRGENNYRIVG 238

Query: 257 VIVNPQSIKRDSSNSCAATGXXXXXXXXXXTTVHFSYSVKFTPSDTVWATRWDKYLHVYD 316
           V VNP SIKRDS +SC +TG            V+F+YSVKF  SDTVWATRWDKYLHVYD
Sbjct: 239 VTVNPASIKRDSPDSCESTGKSLVLSETEDNEVYFTYSVKFIKSDTVWATRWDKYLHVYD 298

Query: 317 PKIQWYXXXXXXXXXXXXXXXXXXXXYRTLRDDLSRYNQLNLDDDFQEETGWKLVHGDVF 376
           PKIQW+                    Y  L++DL+RYN+LNLD DF+EETGWKL+HGDVF
Sbjct: 299 PKIQWFSLINFSTIVVLLSSVMLHSLYSALKNDLARYNELNLDTDFEEETGWKLIHGDVF 358

Query: 377 RTPTKXXXXXXXXXXXTQLFVMAACTIAFAXXXXXXXXXXXXXTTVMFILYALFGSLGSY 436
           R+P K            QL +M   TI FA             +TVMF+LYA+FGS GS+
Sbjct: 359 RSPNKALLLSVLVGSGGQLALMLTTTILFACLGFLSPSSRGSLSTVMFLLYAIFGSFGSF 418

Query: 437 TSMATYKFFGGEYWKVNMILTPILVPGLLFCVVLGLNFFLIMVESAGAIPFGTMCAIVLL 496
           TSMATYKFF G+ W++N++LTP+LVPG +  VVLGLNFFLI V S+GAIPF TM  +VLL
Sbjct: 419 TSMATYKFFNGKAWRLNLVLTPLLVPGSILTVVLGLNFFLIFVHSSGAIPFQTMLVLVLL 478

Query: 497 WFVFSIPLSLAGSLIAKKKCRWNEHPTKTRQIPRQIPFQPWYLKTAPAALIAGIFPFGSI 556
           WFV SIPLS  GS+IA KKC WNEHPTKT QI RQIPFQPWYLKT P AL+AGIFPFGSI
Sbjct: 479 WFVISIPLSAIGSVIAWKKCNWNEHPTKTNQIARQIPFQPWYLKTIPVALLAGIFPFGSI 538

Query: 557 AVELYFVYSSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXXXXXXXCLENWKWQWRGFWI 616
           AVELYF+YSSLWFNKI+YMFG                         C+ENWKWQWR F I
Sbjct: 539 AVELYFIYSSLWFNKIYYMFGFLFFSFILLALTTSLITVLLTYHSLCMENWKWQWRSFVI 598

Query: 617 GGAGCALYVFLHAILFTKFKLGGFVTIVLYVGYSLVISLLTCLITGAVGFMSSLWFVRRI 676
           GG GCA YVF H+ILFTKF+LGG  TIVLY+GYS++IS L CL+TGA+GF+SSL  VR+I
Sbjct: 599 GGCGCAFYVFCHSILFTKFRLGGLTTIVLYLGYSILISGLCCLVTGAIGFLSSLILVRKI 658

Query: 677 YSSIKVD 683
           YS +KVD
Sbjct: 659 YSCVKVD 665

>NCAS0B04970 Chr2 complement(909770..911770) [2001 bp, 666 aa] {ON} 
          Length = 666

 Score =  815 bits (2105), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/666 (58%), Positives = 470/666 (70%), Gaps = 17/666 (2%)

Query: 18  EGFYLPGVAPTTYHEGDSIPLLVNHLTPSMYFKHVDDDGKDTGDRESFLYSYDYYYDKFH 77
             FYLPGVAPTTYHEGD IPLLVNHLTPS+YF+  D +GK + ++E FLYS+DYY+D+ H
Sbjct: 18  RAFYLPGVAPTTYHEGDEIPLLVNHLTPSVYFQRTDANGK-SKNKEHFLYSFDYYFDRLH 76

Query: 78  FCKPEKLEKQRESLGSIIFGDRIYNSPFKLEMLKDKECEALCSSKIPANDAKFINKLIAN 137
           FCKPE +EKQ ESLGSIIFGDRIYNSPF+L+ML++K C +LC S IP  DAKFINKLI N
Sbjct: 77  FCKPEHIEKQPESLGSIIFGDRIYNSPFELKMLEEKTCVSLCKSTIPGKDAKFINKLIKN 136

Query: 138 GFFQNWLVDGLPAARKTTDERTKSEFYTPGFELGFIDVGGAKLRMDGQGEEDAHPKGATK 197
           GFFQNWL+DGLPAA +  D +TKSEFY  GFELGF++   A   +DGQ      PK  T 
Sbjct: 137 GFFQNWLIDGLPAATQVYDRKTKSEFYGTGFELGFVESFQA---IDGQAPATTKPKQTT- 192

Query: 198 PVAQDDYLDRPSKSKNEKRKKIVDPKELVKQLETAYFANHFNIEVQYHDRGNGDYRVVGV 257
                   +   + +  + K +    ++VK +E AYF NH++I+V+YHDRG G YRVVGV
Sbjct: 193 --------NEGLELETREAKNV----QMVKNIEIAYFVNHYDIQVEYHDRGEGTYRVVGV 240

Query: 258 IVNPQSIKRDSSNSCAATGXXXXXXXXXXTTVHFSYSVKFTPSDTVWATRWDKYLHVYDP 317
           IVNP SIKR +  +C  TG            V+F+YSVKF PS+TVWATRWDKYLH YDP
Sbjct: 241 IVNPVSIKRSTPGTCETTGDPLVLSEDADNDVYFTYSVKFVPSETVWATRWDKYLHTYDP 300

Query: 318 KIQWYXXXXXXXXXXXXXXXXXXXXYRTLRDDLSRYNQLNLDDDFQEETGWKLVHGDVFR 377
            IQW+                     + L+ D +RYN+ NL+DDFQE+ GWKL HGDVFR
Sbjct: 301 TIQWFSLVNFSIIVLLLSSVVIHSLMKALKSDFARYNEFNLEDDFQEDAGWKLGHGDVFR 360

Query: 378 TPTKXXXXXXXXXXXTQLFVMAACTIAFAXXXXXXXXXXXXXTTVMFILYALFGSLGSYT 437
            P K            QLF+M +C+I FA              TVMFILYALFG +GSYT
Sbjct: 361 IPHKSMLLSVLVGSGVQLFLMISCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYT 420

Query: 438 SMATYKFFGGEYWKVNMILTPILVPGLLFCVVLGLNFFLIMVESAGAIPFGTMCAIVLLW 497
           SMA YKFF G YWKVNM+LTP ++PG +F  ++GLNFFL+   S+G +P GT+  ++LLW
Sbjct: 421 SMAVYKFFKGPYWKVNMLLTPFMIPGFIFLTIVGLNFFLMFAHSSGVVPAGTLFFMILLW 480

Query: 498 FVFSIPLSLAGSLIAKKKCRWNEHPTKTRQIPRQIPFQPWYLKTAPAALIAGIFPFGSIA 557
           F+FSIPL+ AGSLIA KKC W+EHPTKT QI RQIPFQPWYLKT PA +IAGIFPFGSIA
Sbjct: 481 FIFSIPLAFAGSLIAHKKCTWDEHPTKTNQIARQIPFQPWYLKTWPATMIAGIFPFGSIA 540

Query: 558 VELYFVYSSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXXXXXXXCLENWKWQWRGFWIG 617
           VELYF+Y+SLWFNKIFYMFG                         CLENW+WQWRGF +G
Sbjct: 541 VELYFIYTSLWFNKIFYMFGFLLFSFLLLTLTTSLVTILITYHSLCLENWQWQWRGFIVG 600

Query: 618 GAGCALYVFLHAILFTKFKLGGFVTIVLYVGYSLVISLLTCLITGAVGFMSSLWFVRRIY 677
           G GCA+YVF+H+ILFTKFKLGGF TIVLYVGYS +ISLL C++TGA+GF+SSL FVR+IY
Sbjct: 601 GVGCAIYVFVHSILFTKFKLGGFATIVLYVGYSTMISLLFCVVTGAIGFLSSLIFVRKIY 660

Query: 678 SSIKVD 683
           S+IKVD
Sbjct: 661 SAIKVD 666

>Smik_12.142 Chr12 complement(273932..275923) [1992 bp, 663 aa] {ON}
           YLR083C (REAL)
          Length = 663

 Score =  813 bits (2100), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/667 (58%), Positives = 464/667 (69%), Gaps = 21/667 (3%)

Query: 18  EGFYLPGVAPTTYHEGDSIPLLVNHLTPSMYFKHVDDDGKD-TGDRESFLYSYDYYYDKF 76
           + FYLPGVAPTTY E D IPLLVNHLTPSMY++H D++G + +GD+E+FLYSYDYY  +F
Sbjct: 17  KAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHKDEEGNNVSGDKENFLYSYDYYNSRF 76

Query: 77  HFCKPEKLEKQRESLGSIIFGDRIYNSPFKLEMLKDKECEALCSSKIPANDAKFINKLIA 136
           HFCKPEK+EKQ ESLGSIIFGDRIYNSPF+L+ML++KEC +LC   IP NDAKFINKLI 
Sbjct: 77  HFCKPEKVEKQPESLGSIIFGDRIYNSPFQLKMLEEKECVSLCKKTIPGNDAKFINKLIK 136

Query: 137 NGFFQNWLVDGLPAARKTTDERTKSEFYTPGFELGFIDVGGAKLRMDGQGEEDAHPKGAT 196
           NGFFQNWL+DGLPAAR  +D+RTK+ FY  GFELGF++V         QG          
Sbjct: 137 NGFFQNWLIDGLPAARNVSDKRTKTSFYGAGFELGFVEVT--------QGTASEATPNTA 188

Query: 197 KPVAQDDYLDRPSKSKNEKRKKIVDPKELVKQLETAYFANHFNIEVQYHDRGNGDYRVVG 256
           +   Q   LD              D   +V+  E  YF NH++I ++YHDRG G+YRVVG
Sbjct: 189 ETTNQGVELDTR------------DGHNMVQTYEHPYFTNHYDIRIEYHDRGEGNYRVVG 236

Query: 257 VIVNPQSIKRDSSNSCAATGXXXXXXXXXXTTVHFSYSVKFTPSDTVWATRWDKYLHVYD 316
           VIVNP SIKR    +C   G            V+F+YSVKF  S+T WATRWDKYLHVYD
Sbjct: 237 VIVNPVSIKRSDPETCETDGSPLMLDEENDNEVYFTYSVKFVESETSWATRWDKYLHVYD 296

Query: 317 PKIQWYXXXXXXXXXXXXXXXXXXXXYRTLRDDLSRYNQLNLDDDFQEETGWKLVHGDVF 376
           P IQW+                     R L+ D +RYN+LNLDDDFQE++GWKL HGDVF
Sbjct: 297 PSIQWFSLINFSLVVVLLSSVVIHSLLRALKSDFARYNELNLDDDFQEDSGWKLSHGDVF 356

Query: 377 RTPTKXXXXXXXXXXXTQLFVMAACTIAFAXXXXXXXXXXXXXTTVMFILYALFGSLGSY 436
           R P++            QLF M  C+I FA              TVMF+LYALFG +GSY
Sbjct: 357 RAPSRSLTLSILVGSGVQLFFMVTCSIFFAALGFLSPSSRGSLATVMFMLYALFGFVGSY 416

Query: 437 TSMATYKFFGGEYWKVNMILTPILVPGLLFCVVLGLNFFLIMVESAGAIPFGTMCAIVLL 496
           TSM  YKFF G YWK N+ILTP+LVPG +  +++ LNFFL+ V S+G IP  T+  +V L
Sbjct: 417 TSMGIYKFFDGPYWKANLILTPLLVPGTILIIIIALNFFLMFVHSSGVIPASTLFFMVFL 476

Query: 497 WFVFSIPLSLAGSLIAKKKCRWNEHPTKTRQIPRQIPFQPWYLKTAPAALIAGIFPFGSI 556
           WF+FSIPLS AGSL+A+KKC W+EHPTKT QI RQIPFQPWYLKT PA LIAG+FPFGSI
Sbjct: 477 WFLFSIPLSFAGSLVARKKCHWDEHPTKTNQIARQIPFQPWYLKTVPATLIAGVFPFGSI 536

Query: 557 AVELYFVYSSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXXXXXXXCLENWKWQWRGFWI 616
           AVELYF+Y+SLWFNKIFYMFG                         CLENWKWQWRGF +
Sbjct: 537 AVELYFIYTSLWFNKIFYMFGFLFFSFLLLTLTTSLVTILITYHSLCLENWKWQWRGFIV 596

Query: 617 GGAGCALYVFLHAILFTKFKLGGFVTIVLYVGYSLVISLLTCLITGAVGFMSSLWFVRRI 676
           GGAGCALYVF+H+ILFTKFKLGGF TIVLYVGYS VISLL CL+TG++GF+SS++F+R+I
Sbjct: 597 GGAGCALYVFIHSILFTKFKLGGFTTIVLYVGYSSVISLLCCLVTGSIGFISSMFFIRKI 656

Query: 677 YSSIKVD 683
           YSSIKVD
Sbjct: 657 YSSIKVD 663

>Skud_12.151 Chr12 complement(277467..279461) [1995 bp, 664 aa] {ON}
           YLR083C (REAL)
          Length = 664

 Score =  801 bits (2069), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/667 (58%), Positives = 460/667 (68%), Gaps = 20/667 (2%)

Query: 18  EGFYLPGVAPTTYHEGDSIPLLVNHLTPSMYFKHVDDDGKD-TGDRESFLYSYDYYYDKF 76
           + FYLPGVAPTTY E D IPLLVNHLTPSMY++H D+ G   +GD+E+FLYSYDYYYD+F
Sbjct: 17  KAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHEDEQGNSVSGDKENFLYSYDYYYDRF 76

Query: 77  HFCKPEKLEKQRESLGSIIFGDRIYNSPFKLEMLKDKECEALCSSKIPANDAKFINKLIA 136
           HFC+P+ +EKQ ESLGS+IFGDRIYNSPF+L ML++KEC  LC++ IP NDAKFINKLI 
Sbjct: 77  HFCRPKHVEKQPESLGSVIFGDRIYNSPFELNMLQEKECVPLCNTTIPGNDAKFINKLIK 136

Query: 137 NGFFQNWLVDGLPAARKTTDERTKSEFYTPGFELGFIDVGGAKLRMDGQGEEDAHPKGAT 196
           NGFFQNWL+DGLPAAR+  D RTK+ FY  GFELG ++V           + +   +G  
Sbjct: 137 NGFFQNWLIDGLPAAREVYDGRTKTNFYGAGFELGDVEVSQGTRSKTAPKQAETTNEGLE 196

Query: 197 KPVAQDDYLDRPSKSKNEKRKKIVDPKELVKQLETAYFANHFNIEVQYHDRGNGDYRVVG 256
                +DY                    +V+  E  YFANHF+I ++YHDRG GDYRVVG
Sbjct: 197 LGTRAEDY-------------------SIVETFEHPYFANHFDIMIEYHDRGGGDYRVVG 237

Query: 257 VIVNPQSIKRDSSNSCAATGXXXXXXXXXXTTVHFSYSVKFTPSDTVWATRWDKYLHVYD 316
           VIVNP SIKR  + +C                V F+YSVKF  S T WATRWDKYLHVYD
Sbjct: 238 VIVNPLSIKRSITGTCETDASPLILDEERDNEVSFTYSVKFKESATSWATRWDKYLHVYD 297

Query: 317 PKIQWYXXXXXXXXXXXXXXXXXXXXYRTLRDDLSRYNQLNLDDDFQEETGWKLVHGDVF 376
           P IQW+                     R L+ D +RYN+LNL+DDFQE++GWKL HGDVF
Sbjct: 298 PSIQWFSLINFSLVVVLLSSVVIHSLLRALKSDFARYNELNLEDDFQEDSGWKLNHGDVF 357

Query: 377 RTPTKXXXXXXXXXXXTQLFVMAACTIAFAXXXXXXXXXXXXXTTVMFILYALFGSLGSY 436
           R P+             QLF+M  C+I FA              TVMFILYALFG +GSY
Sbjct: 358 RPPSHSLLLSILVGSGVQLFLMVTCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSY 417

Query: 437 TSMATYKFFGGEYWKVNMILTPILVPGLLFCVVLGLNFFLIMVESAGAIPFGTMCAIVLL 496
           TSM  YKFF G YWK N++LTP+LVPG +  +++ LNFFL++V S+G IP  T+  +V L
Sbjct: 418 TSMGIYKFFNGPYWKANLLLTPLLVPGAILLIIVALNFFLMVVHSSGVIPARTLFFMVFL 477

Query: 497 WFVFSIPLSLAGSLIAKKKCRWNEHPTKTRQIPRQIPFQPWYLKTAPAALIAGIFPFGSI 556
           WF+FSIPLS  GSLIA+KKC W+EHPTKT QI RQIPFQPWYLKT PA LIAGIFPFGSI
Sbjct: 478 WFLFSIPLSFGGSLIARKKCGWDEHPTKTNQIARQIPFQPWYLKTIPATLIAGIFPFGSI 537

Query: 557 AVELYFVYSSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXXXXXXXCLENWKWQWRGFWI 616
           AVELYF+Y+SLWFNKIFYMFG                         CLENWKWQWRGF +
Sbjct: 538 AVELYFIYTSLWFNKIFYMFGFLFFSFLLLTLTTSLVTILITYHSLCLENWKWQWRGFIV 597

Query: 617 GGAGCALYVFLHAILFTKFKLGGFVTIVLYVGYSLVISLLTCLITGAVGFMSSLWFVRRI 676
           GG GCALYVF+H+ILFTKFKLGGFVTIVLYVGYS VISLL CL+TG++GF+SS++F+RRI
Sbjct: 598 GGVGCALYVFIHSILFTKFKLGGFVTIVLYVGYSYVISLLCCLVTGSIGFISSMFFLRRI 657

Query: 677 YSSIKVD 683
           YSSIKVD
Sbjct: 658 YSSIKVD 664

>YDR107C Chr4 complement(669016..671034) [2019 bp, 672 aa] {ON}
           TMN2Protein with a role in cellular adhesion and
           filamentous growth; similar to Emp70p and Tmn3p; member
           of the evolutionarily conserved Transmembrane Nine
           family of proteins with nine membrane-spanning segments
          Length = 672

 Score =  791 bits (2042), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/667 (56%), Positives = 468/667 (70%), Gaps = 12/667 (1%)

Query: 18  EGFYLPGVAPTTYHEGDSIPLLVNHLTPSMYFKHVDDDGKD-TGDRESFLYSYDYYYDKF 76
           +GF LPG++PTTYH GD IPLLVN LTPS+YF+H D++G D +GD+E FLYSYDYY  +F
Sbjct: 17  KGFSLPGLSPTTYHSGDEIPLLVNRLTPSIYFQHQDEEGNDVSGDKEHFLYSYDYYNKRF 76

Query: 77  HFCKPEKLEKQRESLGSIIFGDRIYNSPFKLEMLKDKECEALCSSKIPANDAKFINKLIA 136
           HFC+PE +EKQ ESLGS+IFGDRIYNSPF+L ML++KEC ALC S IP  DAKFIN LI 
Sbjct: 77  HFCRPEHVEKQPESLGSVIFGDRIYNSPFQLNMLEEKECVALCKSTIPGKDAKFINTLIK 136

Query: 137 NGFFQNWLVDGLPAARKTTDERTKSEFYTPGFELGFIDVGGAKLRMDGQGEEDAHPKGAT 196
           +GFFQNWLVDGLPAARK  D RTK+ +Y  GFELGF DV   K  +DG+       +  +
Sbjct: 137 SGFFQNWLVDGLPAARKAYDSRTKTNYYGTGFELGFTDV---KQTVDGKAVPSTMEELTS 193

Query: 197 KPVAQDDYLDRPSKSKNEKRKKIVDPKELVKQLETAYFANHFNIEVQYHDRGNGDYRVVG 256
           +   +D  LD        +  K V P  LVK +E  YF NHF+IEV++HDRGN +YRVVG
Sbjct: 194 EASNEDVILD-------ARLPKNVKPN-LVKTVELPYFVNHFDIEVEFHDRGNDNYRVVG 245

Query: 257 VIVNPQSIKRDSSNSCAATGXXXXXXXXXXTTVHFSYSVKFTPSDTVWATRWDKYLHVYD 316
           VIVNP SI+R S  +C+ TG            V+F+YSVKF  SDTVWATRWDKYLH+YD
Sbjct: 246 VIVNPVSIERSSPGACSTTGKPLILDEDKDNEVYFTYSVKFVASDTVWATRWDKYLHIYD 305

Query: 317 PKIQWYXXXXXXXXXXXXXXXXXXXXYRTLRDDLSRYNQLNLDDDFQEETGWKLVHGDVF 376
           P+IQW+                     R L+ DL+RYN+LNLD++F E++GWKL HGDVF
Sbjct: 306 PQIQWFSLINFSVIVILLSSVVMHSLLRALKSDLARYNELNLDNEFHEDSGWKLGHGDVF 365

Query: 377 RTPTKXXXXXXXXXXXTQLFVMAACTIAFAXXXXXXXXXXXXXTTVMFILYALFGSLGSY 436
           RTP+K            QLF+M  C+I FA              TVMF+LYALFG +GSY
Sbjct: 366 RTPSKSMLLSILVGSGMQLFLMVMCSIFFAAVGLVSPVSRGSLPTVMFVLYALFGFVGSY 425

Query: 437 TSMATYKFFGGEYWKVNMILTPILVPGLLFCVVLGLNFFLIMVESAGAIPFGTMCAIVLL 496
            SM  YKFF G YWK NMILTPIL+PG +F +++ +NFFL+   S+G IP  ++  I+LL
Sbjct: 426 ASMGVYKFFRGPYWKANMILTPILLPGAIFLLIVIMNFFLLFAHSSGVIPARSLFFIILL 485

Query: 497 WFVFSIPLSLAGSLIAKKKCRWNEHPTKTRQIPRQIPFQPWYLKTAPAALIAGIFPFGSI 556
           WF+ S+PLS AGS++A K+C W+EHPTKT QI RQIP+QPWYL+TA A LIAGIF FGSI
Sbjct: 486 WFLVSVPLSFAGSIVAHKQCNWDEHPTKTNQIARQIPYQPWYLRTAQATLIAGIFSFGSI 545

Query: 557 AVELYFVYSSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXXXXXXXCLENWKWQWRGFWI 616
           AVELYF+YSSLWFNKIFYMFG                         CLENW WQWR F I
Sbjct: 546 AVELYFIYSSLWFNKIFYMFGFLLFSFLLLTLTTSLVTILITYYSLCLENWLWQWRSFII 605

Query: 617 GGAGCALYVFLHAILFTKFKLGGFVTIVLYVGYSLVISLLTCLITGAVGFMSSLWFVRRI 676
           GG GC++Y F+H+ILFTKFKLGG +T+VLY+GYSL+IS L C++TGA+GF SS++F+R+I
Sbjct: 606 GGLGCSIYTFIHSILFTKFKLGGVITVVLYLGYSLIISALCCVVTGAIGFFSSMFFIRKI 665

Query: 677 YSSIKVD 683
           YS+IKV+
Sbjct: 666 YSAIKVE 672

>KAFR0B02680 Chr2 complement(537048..539042) [1995 bp, 664 aa] {ON}
           Anc_8.254 YLR083C
          Length = 664

 Score =  776 bits (2005), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/667 (57%), Positives = 467/667 (70%), Gaps = 19/667 (2%)

Query: 18  EGFYLPGVAPTTYHEGDSIPLLVNHLTPSMYFKHVDDDGKD-TGDRESFLYSYDYYYDKF 76
             FYLPGVAPTTYHEGD IPLLVNHL+PSMY++H +D+GKD + D+  +LYSYDYYYD+F
Sbjct: 16  RAFYLPGVAPTTYHEGDEIPLLVNHLSPSMYWQHKNDEGKDVSSDKNKYLYSYDYYYDRF 75

Query: 77  HFCKPEKLEKQRESLGSIIFGDRIYNSPFKLEMLKDKECEALCSSKIPANDAKFINKLIA 136
           HFC+PEK+EKQ ESLGSI+FGDRIYNSPF+L ML++K+C +LC S IP NDAKFINKLI 
Sbjct: 76  HFCQPEKIEKQPESLGSIMFGDRIYNSPFQLNMLEEKQCASLCKSTIPGNDAKFINKLIK 135

Query: 137 NGFFQNWLVDGLPAARKTTDERTKSEFYTPGFELGFIDVGGAKLRMDGQGEEDAHPKGAT 196
           NGFFQNWL+DGLPAA +  D RT ++FY  GFELG +DV  A    + + +  A  +GA 
Sbjct: 136 NGFFQNWLIDGLPAAHEAHDTRTGTDFYGSGFELGLVDVVQAVDETEARTKVAAANQGAE 195

Query: 197 KPVAQDDYLDRPSKSKNEKRKKIVDPKELVKQLETAYFANHFNIEVQYHDRGNGDYRVVG 256
                   LD    +KN K          +K +E  YF NH++I ++YHDRGNGDYRVVG
Sbjct: 196 --------LD-ARDAKNVKT---------IKNVELVYFVNHYDIRIEYHDRGNGDYRVVG 237

Query: 257 VIVNPQSIKRDSSNSCAATGXXXXXXXXXXTTVHFSYSVKFTPSDTVWATRWDKYLHVYD 316
           VIVNP SI+R S  SC +TG            V+F+YSV F PS+T WATRWDKYLHVYD
Sbjct: 238 VIVNPVSIQRSSPGSCESTGQPLTLQEDEDNDVYFTYSVTFVPSETSWATRWDKYLHVYD 297

Query: 317 PKIQWYXXXXXXXXXXXXXXXXXXXXYRTLRDDLSRYNQLNLDDDFQEETGWKLVHGDVF 376
           P IQW+                     + L++D +RYN+ NLDD+FQE+ GWKL HGDVF
Sbjct: 298 PTIQWFSLVNFSLIVLLLSTVVLHSLLKALKNDFARYNEFNLDDEFQEDAGWKLCHGDVF 357

Query: 377 RTPTKXXXXXXXXXXXTQLFVMAACTIAFAXXXXXXXXXXXXXTTVMFILYALFGSLGSY 436
           R P K            QLF+M + TI FA              TVMF+LYALFG +GSY
Sbjct: 358 RIPHKSMLLSVLVGSGVQLFIMISTTIFFAALGFLSPSSRGLLGTVMFMLYALFGFVGSY 417

Query: 437 TSMATYKFFGGEYWKVNMILTPILVPGLLFCVVLGLNFFLIMVESAGAIPFGTMCAIVLL 496
           TSM  YKFF G YWK NM+LTPILVPG +F  ++ +NFFL+ V S+G IP  T+  +VLL
Sbjct: 418 TSMGVYKFFRGPYWKANMVLTPILVPGSIFITIIAMNFFLMYVHSSGVIPAKTLFFMVLL 477

Query: 497 WFVFSIPLSLAGSLIAKKKCRWNEHPTKTRQIPRQIPFQPWYLKTAPAALIAGIFPFGSI 556
           WFVFSIP + AGSL+A KKC WNEHPTKT QI RQIPFQPWYLKT PA  IAGIFPFGSI
Sbjct: 478 WFVFSIPSAFAGSLVANKKCNWNEHPTKTEQIARQIPFQPWYLKTIPATFIAGIFPFGSI 537

Query: 557 AVELYFVYSSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXXXXXXXCLENWKWQWRGFWI 616
           AVE+YF+Y+SLW+NKIFYMFG                         CLENW WQWR F +
Sbjct: 538 AVEIYFIYTSLWYNKIFYMFGFLFVSLLLLALTTSLVTVLITYHSLCLENWNWQWRSFIV 597

Query: 617 GGAGCALYVFLHAILFTKFKLGGFVTIVLYVGYSLVISLLTCLITGAVGFMSSLWFVRRI 676
           GG GCA+YVF+H+ILFTKFKLGGF T+VLY+GYS +ISLL C++TG++GF+SS++FVR+I
Sbjct: 598 GGVGCAIYVFIHSILFTKFKLGGFTTVVLYLGYSSIISLLCCIVTGSIGFLSSMFFVRKI 657

Query: 677 YSSIKVD 683
           +SSIKVD
Sbjct: 658 FSSIKVD 664

>Suva_2.267 Chr2 complement(463458..465476) [2019 bp, 672 aa] {ON}
           YDR107C (REAL)
          Length = 672

 Score =  773 bits (1995), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/671 (56%), Positives = 453/671 (67%), Gaps = 20/671 (2%)

Query: 18  EGFYLPGVAPTTYHEGDSIPLLVNHLTPSMYFKHVDDDGKD-TGDRESFLYSYDYYYDKF 76
           + F LPGV+PTTY   D IPLLVN LTPS+YF+H D++GKD + D+E FLYSYDYY DKF
Sbjct: 17  KAFSLPGVSPTTYRANDEIPLLVNRLTPSIYFQHKDENGKDVSSDKEHFLYSYDYYNDKF 76

Query: 77  HFCKPEKLEKQRESLGSIIFGDRIYNSPFKLEMLKDKECEALCSSKIPANDAKFINKLIA 136
           HFCKPE +EKQ ESLGS+IFGDRIYNSPF+L+ML+DKEC ALC S IP  DAKFIN LI 
Sbjct: 77  HFCKPEHVEKQPESLGSVIFGDRIYNSPFQLKMLEDKECVALCKSTIPGKDAKFINTLIK 136

Query: 137 NGFFQNWLVDGLPAARKTTDERTKSEFYTPGFELGFIDVGGAKLRMDGQGEEDAHPKGAT 196
           NGFFQNWLVDGLPAAR   D RTK+ +Y  GFELGF DV                  G T
Sbjct: 137 NGFFQNWLVDGLPAARNVYDSRTKTNYYGTGFELGFTDVKQTV-------------GGKT 183

Query: 197 KPVAQDDYLDRPSKSKNEKRKKIVDPKE----LVKQLETAYFANHFNIEVQYHDRGNGDY 252
            P   ++     SK+      +  DPK     LV+ +E  +F NHFNI+V+YHDRGNG+Y
Sbjct: 184 IPSTMEELDSEDSKTGATLDAR--DPKNIKPNLVQTIELTHFVNHFNIQVEYHDRGNGNY 241

Query: 253 RVVGVIVNPQSIKRDSSNSCAATGXXXXXXXXXXTTVHFSYSVKFTPSDTVWATRWDKYL 312
           RVVGV VNP SI+R S  +C+ TG            V+F+YSVKF  SDTVWATRWDKYL
Sbjct: 242 RVVGVTVNPLSIERSSPGACSTTGEPLTLVEDKDNDVYFTYSVKFIASDTVWATRWDKYL 301

Query: 313 HVYDPKIQWYXXXXXXXXXXXXXXXXXXXXYRTLRDDLSRYNQLNLDDDFQEETGWKLVH 372
           HVYDP+IQW+                     R +R D +RYN+LNLD++F E+ GWKL H
Sbjct: 302 HVYDPQIQWFSLINFSIIVILLSSVVIHSILRAVRSDFARYNELNLDNEFHEDAGWKLGH 361

Query: 373 GDVFRTPTKXXXXXXXXXXXTQLFVMAACTIAFAXXXXXXXXXXXXXTTVMFILYALFGS 432
           GDVFR P K            QLF+M  C+I FA              TVMF+LYALFG 
Sbjct: 362 GDVFRIPPKSMVLSVLVGSGIQLFLMIICSIFFAALGLVSPASRGSLPTVMFVLYALFGF 421

Query: 433 LGSYTSMATYKFFGGEYWKVNMILTPILVPGLLFCVVLGLNFFLIMVESAGAIPFGTMCA 492
           +GSYTSM  YKFF G YWK N+I+TPIL+PG +F +++ +NFFL+   S+G IP  T+  
Sbjct: 422 VGSYTSMGVYKFFHGPYWKANLIITPILLPGAIFLLIVAMNFFLLFAHSSGVIPARTLFF 481

Query: 493 IVLLWFVFSIPLSLAGSLIAKKKCRWNEHPTKTRQIPRQIPFQPWYLKTAPAALIAGIFP 552
           I+ LWF  SIPLS AGS IA K+C+W+EHPTKT QI RQ P QPWYL+T  A LIAGIF 
Sbjct: 482 IIFLWFSVSIPLSFAGSYIAHKRCKWDEHPTKTNQIARQSPRQPWYLRTIQATLIAGIFS 541

Query: 553 FGSIAVELYFVYSSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXXXXXXXCLENWKWQWR 612
           FGSIAVELYF+YSSLWFNKIFYMFG                         CLENW WQWR
Sbjct: 542 FGSIAVELYFIYSSLWFNKIFYMFGFLLFSFLLLTLATSLVTVFITYHSLCLENWSWQWR 601

Query: 613 GFWIGGAGCALYVFLHAILFTKFKLGGFVTIVLYVGYSLVISLLTCLITGAVGFMSSLWF 672
            F IGG GC++Y+F+HAILFTKFKLGGFVT+VLYVGYS +IS L C++TGA+GF SS+ F
Sbjct: 602 SFIIGGLGCSVYMFIHAILFTKFKLGGFVTVVLYVGYSFIISALCCVVTGAIGFFSSMIF 661

Query: 673 VRRIYSSIKVD 683
           +R+IYS IKV+
Sbjct: 662 IRKIYSRIKVE 672

>CAGL0B01683g Chr2 complement(154275..156350) [2076 bp, 691 aa] {ON}
           highly similar to uniprot|Q04562 Saccharomyces
           cerevisiae YDR107c or uniprot|P32802 Saccharomyces
           cerevisiae YLR083c EMP70
          Length = 691

 Score =  768 bits (1984), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/677 (55%), Positives = 456/677 (67%), Gaps = 14/677 (2%)

Query: 19  GFYLPGVAPTTYHEGDSIPLLVNHLTPSMYFKHVDDDGKDT-GDRESFLYSYDYYYDKFH 77
           GFYLPG AP TY +GD+IPLLVNHLTPS+ F+HVDDDG +  GD+   LY YDYY +K H
Sbjct: 17  GFYLPGAAPRTYKQGDAIPLLVNHLTPSLNFQHVDDDGNEIKGDKARMLYPYDYYNEKLH 76

Query: 78  FCKPEKLEKQRESLGSIIFGDRIYNSPFKLEMLKDKECEALCSSKIPANDAKFINKLIAN 137
           FC+PEK+EKQ ESLGS+IFG++IYNSPF ++ML+D EC  LCS+ IP  DAKFINKLI N
Sbjct: 77  FCQPEKIEKQPESLGSVIFGEKIYNSPFNVKMLEDNECVQLCSTTIPGKDAKFINKLIKN 136

Query: 138 GFFQNWLVDGLPAARKTTDERTKSEFYTPGFELGFIDVG---GAKLRMDGQGEEDAHPKG 194
           GF QNWL+DGLPAARK  D RT +EFY  GFELGF++V    G K+  + + E     + 
Sbjct: 137 GFMQNWLIDGLPAARKLHDSRTNTEFYGQGFELGFVEVRQAVGGKIVSESEKELQLSERD 196

Query: 195 ATKPVAQDDYLDRPSK-----SKNEKR--KKIVDPKELVKQLETAYFANHFNIEVQYHDR 247
           A   +   D   R  K     S  E R  K +VD   +V  +E   FANHF+IEV+YHDR
Sbjct: 197 AKNIIDFTDIEIRSPKNLVDLSNLEVREAKNVVD--NIVTNVEVPVFANHFDIEVEYHDR 254

Query: 248 GNGDYRVVGVIVNPQSIKRDSSNSCA-ATGXXXXXXXXXXTTVHFSYSVKFTPSDTVWAT 306
           GNGD+RVVGVIVNP S+    S SCA A              V F+YSVKFTPSDT WAT
Sbjct: 255 GNGDFRVVGVIVNPVSLDNYKSRSCALANQHKLHLDENKDNEVMFTYSVKFTPSDTPWAT 314

Query: 307 RWDKYLHVYDPKIQWYXXXXXXXXXXXXXXXXXXXXYRTLRDDLSRYNQLNLDDDFQEET 366
           RWDKYLH+YDPKIQW+                     R L+ D+SRYN+ NL D+F+E++
Sbjct: 315 RWDKYLHIYDPKIQWFSLINFSVIVLLLSSVAIHSLLRALKSDISRYNEFNLGDEFEEDS 374

Query: 367 GWKLVHGDVFRTPTKXXXXXXXXXXXTQLFVMAACTIAFAXXXXXXXXXXXXXTTVMFIL 426
           GWKLVHGDVFRTP              QLF+M   +I  +              T MF+ 
Sbjct: 375 GWKLVHGDVFRTPKNSMLLSVLVGSGIQLFLMIFLSIILSALGILSPSSRGSLPTAMFMF 434

Query: 427 YALFGSLGSYTSMATYKFFGGEYWKVNMILTPILVPGLLFCVVLGLNFFLIMVESAGAIP 486
           YA+FG +GSYTSM  YKFF G YWK NMILTP+L+PG++F  V+ +N  L  V S+  IP
Sbjct: 435 YAIFGFVGSYTSMGIYKFFKGPYWKANMILTPVLLPGIIFLTVIFMNVLLYFVGSSNVIP 494

Query: 487 FGTMCAIVLLWFVFSIPLSLAGSLIAKKKCRWNEHPTKTRQIPRQIPFQPWYLKTAPAAL 546
             T+  +V LW +FSIPL+ AGSLI+ KKC W+EHPTKT +IPRQIPFQPW+LKT PA L
Sbjct: 495 LATLVFMVFLWILFSIPLAFAGSLISYKKCNWDEHPTKTNEIPRQIPFQPWFLKTVPATL 554

Query: 547 IAGIFPFGSIAVELYFVYSSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXXXXXXXCLEN 606
           I G+  FGSIAVELYF+YSSLWFNKIFYMFG                         C EN
Sbjct: 555 IGGLVSFGSIAVELYFIYSSLWFNKIFYMFGFLLFSIVLFSFTTGLINVIITYRALCSEN 614

Query: 607 WKWQWRGFWIGGAGCALYVFLHAILFTKFKLGGFVTIVLYVGYSLVISLLTCLITGAVGF 666
           W WQWR F+IGG GC++Y+F+H+ILFT+FKLGGF TIVLYVGYS +IS LTC++TGA+GF
Sbjct: 615 WTWQWRSFFIGGLGCSIYIFIHSILFTQFKLGGFATIVLYVGYSFLISFLTCIVTGAIGF 674

Query: 667 MSSLWFVRRIYSSIKVD 683
           + S++FVRRI++SIKVD
Sbjct: 675 ICSMFFVRRIFASIKVD 691

>ZYRO0C01848g Chr3 (146621..148564) [1944 bp, 647 aa] {ON} similar
           to uniprot|P32802 Saccharomyces cerevisiae YLR083C EMP70
           Protein whose 24kDa cleavage product is found in
           endosome-enriched membrane fractions predicted to be a
           transmembrane protein
          Length = 647

 Score =  761 bits (1964), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/668 (57%), Positives = 458/668 (68%), Gaps = 37/668 (5%)

Query: 17  VEGFYLPGVAPTTYHEGDSIPLLVNHLTPSMYFKHVDDDGKDT-GDRESFLYSYDYYYDK 75
           V+ FYLPGVAPTTYH  D I LLVNHLTPSM F+H D+DG    GD+E +LYSYDYYY K
Sbjct: 16  VKAFYLPGVAPTTYHSNDEIQLLVNHLTPSMNFQHEDEDGNMVKGDKEHYLYSYDYYYSK 75

Query: 76  FHFCKPEKLEKQRESLGSIIFGDRIYNSPFKLEMLKDKECEALCSSKIPANDAKFINKLI 135
           FHFCKPE + +Q  SLGS+IFGDRI+NSPFKL ML++KEC  LCSS+IP  DAKF+NKLI
Sbjct: 76  FHFCKPENVVRQPASLGSVIFGDRIFNSPFKLNMLEEKECVPLCSSRIPGEDAKFVNKLI 135

Query: 136 ANGFFQNWLVDGLPAARKTTDERTKSEFYTPGFELGFIDVGGAKLRMDGQGEEDAHPKGA 195
            NGF QNWL+DGLPA R+  D RT S FY  GF+LGF+DV         +G  D+     
Sbjct: 136 KNGFMQNWLIDGLPAGREIHDSRTNSNFYGTGFQLGFVDVT--------EGFSDS----- 182

Query: 196 TKPVAQDDYLDRPSKSKNEKRKKIVDPKELVKQLETAYFANHFNIEVQYHDRGNGDYRVV 255
                            N++ KKI+      K LE  Y ANH++I ++YHDRGN +YRVV
Sbjct: 183 -----------------NDEEKKIM------KTLEVPYLANHYDINIEYHDRGNDNYRVV 219

Query: 256 GVIVNPQSIKRDSSNSCAATGXXXXXXXXXXTTVHFSYSVKFTPSDTVWATRWDKYLHVY 315
           GV V+P SIKR SS+SC                VHF+YSVKF  SDTVWATRWDKYLHVY
Sbjct: 220 GVTVDPVSIKRSSSDSCQYNSGSLTLSETEENEVHFTYSVKFIKSDTVWATRWDKYLHVY 279

Query: 316 DPKIQWYXXXXXXXXXXXXXXXXXXXXYRTLRDDLSRYNQLNLDDDFQEETGWKLVHGDV 375
           DP IQW+                     R L++DLSRYN+ NLD++F E++GWKL HGDV
Sbjct: 280 DPTIQWFSLINCSVIVVALSSVVLHMLLRALKNDLSRYNEFNLDNEFHEDSGWKLSHGDV 339

Query: 376 FRTPTKXXXXXXXXXXXTQLFVMAACTIAFAXXXXXXXXXXXXXTTVMFILYALFGSLGS 435
           FR P +            QLF+M AC+I FA              TVMF+LYALFG +GS
Sbjct: 340 FRIPPRSLLLSILVGSGVQLFLMIACSIIFAALGFLSPSSRGSLPTVMFLLYALFGFVGS 399

Query: 436 YTSMATYKFFGGEYWKVNMILTPILVPGLLFCVVLGLNFFLIMVESAGAIPFGTMCAIVL 495
           YTSMA YKFF G  WKVN++LTP+LVPG +F  ++ LNFFL+ V S+GAIP GT+  I+L
Sbjct: 400 YTSMAIYKFFKGPLWKVNLLLTPVLVPGGIFVTIILLNFFLVFVRSSGAIPAGTLFTIIL 459

Query: 496 LWFVFSIPLSLAGSLIAKKKCRWNEHPTKTRQIPRQIPFQPWYLKTAPAALIAGIFPFGS 555
           LWFVFSIPLS AGSLIA K+CR + HPTKT QI RQIP QPWYLKT P +LIAG+FPF S
Sbjct: 460 LWFVFSIPLSFAGSLIAHKRCRLDNHPTKTNQIARQIPIQPWYLKTIPVSLIAGVFPFAS 519

Query: 556 IAVELYFVYSSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXXXXXXXCLENWKWQWRGFW 615
           IAVELYF+Y+SLWFNKIFYMFG                         CLENWKWQWR F 
Sbjct: 520 IAVELYFIYTSLWFNKIFYMFGFLLFSFLLLTFTTALVTILTTYHSLCLENWKWQWRSFI 579

Query: 616 IGGAGCALYVFLHAILFTKFKLGGFVTIVLYVGYSLVISLLTCLITGAVGFMSSLWFVRR 675
           IGG GCA+YVF+H+ILFTKFKLGGF T+VLY+GYS +IS+L C++TG++GF+SS++F+R+
Sbjct: 580 IGGCGCAIYVFIHSILFTKFKLGGFTTVVLYLGYSGLISVLCCIVTGSIGFISSMFFIRK 639

Query: 676 IYSSIKVD 683
           IYSS+KVD
Sbjct: 640 IYSSVKVD 647

>TBLA0E04370 Chr5 complement(1108954..1110984) [2031 bp, 676 aa]
           {ON} Anc_8.254 YLR083C
          Length = 676

 Score =  759 bits (1961), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/672 (54%), Positives = 460/672 (68%), Gaps = 20/672 (2%)

Query: 18  EGFYLPGVAPTTYHEGDSIPLLVNHLTPSMYFKHVDDDGKD-TGDRESFLYSYDYYYDKF 76
            GFYLPGVAPTTYHE DSIPLLVNHLTPSM+FKH D DG + + D+E+FLYSYDYYY K 
Sbjct: 19  NGFYLPGVAPTTYHELDSIPLLVNHLTPSMFFKHKDSDGNELSSDKENFLYSYDYYYSKL 78

Query: 77  HFCKP--EKLEKQRESLGSIIFGDRIYNSPFKLEMLKDKECEALCSSKIPANDAKFINKL 134
           HFCKP   +++KQ ESLGSI+FGDRIYNSPF+L+ML D+ C+ LCS+ IP +DAKFIN L
Sbjct: 79  HFCKPLDREIKKQPESLGSILFGDRIYNSPFELKMLVDENCKELCSTNIPGDDAKFINDL 138

Query: 135 IANGFFQNWLVDGLPAARKTTDERTKSEFYTPGFELGFIDVGGAKLRMDGQGEEDAHPKG 194
           I +GF QNWL+DGLPAAR+  D+ TKS FY  GFELG +++    +++  +      PK 
Sbjct: 139 IKSGFLQNWLIDGLPAARQLYDQTTKSSFYGSGFELGSVEM----IQVVDEAPSHTTPK- 193

Query: 195 ATKPVAQD---DYLDRPSKSKNEKRKKIVDPKELVKQLETAYFANHFNIEVQYHDRGNGD 251
             +P+ +D     LD   +   EKR      + LV  +E  YFANHF+I ++YHDRGN +
Sbjct: 194 --QPIVEDVLSQELDE--EQATEKRAN----QMLVSSVERTYFANHFDIHIEYHDRGNNE 245

Query: 252 YRVVGVIVNPQSIKRDSSNSCAATGXXXXXXXXXXTTVHFSYSVKFTPSDTVWATRWDKY 311
           YR+VGV VNP S+KRDS+  C              T V F+YSV F  SDTVWATRWDKY
Sbjct: 246 YRIVGVTVNPISMKRDSA-ICDTNLGKLALSEVSDTDVIFTYSVTFEKSDTVWATRWDKY 304

Query: 312 LHVYDPKIQWYXXXXXXXXXXXXXXXXXXXXYRTLRDDLSRYNQLNLDDDFQEETGWKLV 371
           LH+YDP IQW+                     + L++D  RYN+ NL+D F E++GWKL 
Sbjct: 305 LHIYDPTIQWFSLINFTVIVVVLSIIVVHFLTKALKNDFVRYNEFNLNDSFDEDSGWKLA 364

Query: 372 HGDVFRTPTKXXXXXXXXXXXTQLFVMAACTIAFAXXXXXXXXXXXXXTTVMFILYALFG 431
           HGDVFR PTK           TQLF M +  +  A              T+MFILYA+FG
Sbjct: 365 HGDVFRIPTKSMLLSIFVGSGTQLFFMISSVLVLAALGFLSPSARGSLPTIMFILYAVFG 424

Query: 432 SLGSYTSMATYKFFGGEYWKVNMILTPILVPGLLFCVVLGLNFFLIMVESAGAIPFGTMC 491
            +GSYTSM  Y+FF G YWK NMILTP++VPG +F  ++ +N FL+ V S+  +P GT+ 
Sbjct: 425 FVGSYTSMGVYRFFNGPYWKANMILTPLIVPGGIFMFIISMNLFLVFVHSSDVVPIGTLS 484

Query: 492 AIVLLWFVFSIPLSLAGSLIAKKKCRWNEHPTKTRQIPRQIPFQPWYLKTAPAALIAGIF 551
            +VLLW V S+PLS AGSLI+ K+C W +HPTKT ++ RQIPFQPWYLKT PA LI GIF
Sbjct: 485 LMVLLWIVLSLPLSFAGSLISFKRCTWYDHPTKTNEVLRQIPFQPWYLKTVPATLIGGIF 544

Query: 552 PFGSIAVELYFVYSSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXXXXXXXCLENWKWQW 611
           PFGSIAVELYF+YSSLWFNKIFYMFG                         CLENW+WQW
Sbjct: 545 PFGSIAVELYFIYSSLWFNKIFYMFGFLLVSFLLLTMTTSLVTIIVTYHSLCLENWRWQW 604

Query: 612 RGFWIGGAGCALYVFLHAILFTKFKLGGFVTIVLYVGYSLVISLLTCLITGAVGFMSSLW 671
           R F IGG GC++Y+F+H+ILFT+FKLGGF+TIVLYVGYS +I++L  ++TGA+GF+S+++
Sbjct: 605 RSFIIGGIGCSIYIFIHSILFTEFKLGGFITIVLYVGYSALIAILCAMVTGAIGFISNMF 664

Query: 672 FVRRIYSSIKVD 683
           FV++IYSSIKV+
Sbjct: 665 FVKKIYSSIKVE 676

>Smik_4.353 Chr4 complement(630320..632392) [2073 bp, 690 aa] {ON}
           YDR107C (REAL)
          Length = 690

 Score =  759 bits (1960), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/667 (54%), Positives = 454/667 (68%), Gaps = 12/667 (1%)

Query: 18  EGFYLPGVAPTTYHEGDSIPLLVNHLTPSMYFKHVDDDGKD-TGDRESFLYSYDYYYDKF 76
           + F LPG++PTTYH+ D IPLLVN LTPS+YF+H D++GKD + D+E +LYSYDYY ++F
Sbjct: 35  KAFSLPGLSPTTYHKNDEIPLLVNRLTPSIYFQHQDENGKDISSDKEHYLYSYDYYNERF 94

Query: 77  HFCKPEKLEKQRESLGSIIFGDRIYNSPFKLEMLKDKECEALCSSKIPANDAKFINKLIA 136
           HFC+PE +E+Q ESLGSIIFGDRIYNSPF+L ML+ KEC ALC + IP  DAKFINKLI 
Sbjct: 95  HFCRPEHVERQPESLGSIIFGDRIYNSPFQLRMLETKECVALCENTIPGKDAKFINKLIK 154

Query: 137 NGFFQNWLVDGLPAARKTTDERTKSEFYTPGFELGFIDVGGAKLRMDGQGEEDAHPKGAT 196
           +GFFQNWLVDGLPAARK  D RTK+ +Y  GFELG   +   K  +DG+       +   
Sbjct: 155 SGFFQNWLVDGLPAARKVWDSRTKTNYYGTGFELG---ITAVKNTIDGKVIPSTMEE--- 208

Query: 197 KPVAQDDYLDRPSKSKNEKRKKIVDPKELVKQLETAYFANHFNIEVQYHDRGNGDYRVVG 256
                D        + + +  K + P  LVK +E  YF NHF+IEV++HDRG+ +YRVVG
Sbjct: 209 ----LDSETSNTGAALDAREPKNIKPN-LVKTVELPYFVNHFDIEVEFHDRGDDNYRVVG 263

Query: 257 VIVNPQSIKRDSSNSCAATGXXXXXXXXXXTTVHFSYSVKFTPSDTVWATRWDKYLHVYD 316
           V VNP SI+R S +SC+               ++F+YSVKF  SDTVWATRWDKYLH+YD
Sbjct: 264 VTVNPMSIERSSPDSCSKATKPLILDEEGDNEIYFTYSVKFVASDTVWATRWDKYLHIYD 323

Query: 317 PKIQWYXXXXXXXXXXXXXXXXXXXXYRTLRDDLSRYNQLNLDDDFQEETGWKLVHGDVF 376
           P+IQW+                     R L  DLSRYN+LNLD++F E++GWKL HGDVF
Sbjct: 324 PQIQWFSLINFSVIIVLLSSVVMHSLLRALNSDLSRYNELNLDNEFHEDSGWKLGHGDVF 383

Query: 377 RTPTKXXXXXXXXXXXTQLFVMAACTIAFAXXXXXXXXXXXXXTTVMFILYALFGSLGSY 436
           RTPTK            QLF+M  C+I  A              TVMF+ YALFG +GSY
Sbjct: 384 RTPTKSMLLSVLVGSGVQLFLMIICSIFLAALGLVSPVSRGSLPTVMFVFYALFGFVGSY 443

Query: 437 TSMATYKFFGGEYWKVNMILTPILVPGLLFCVVLGLNFFLIMVESAGAIPFGTMCAIVLL 496
           TSM  YKFF G YWK N+ILTPIL+PG +F +++ +NFFL+   S+G IP  T+  I+ L
Sbjct: 444 TSMGVYKFFHGPYWKANLILTPILLPGGIFVLIVAMNFFLLFAHSSGVIPASTLFFIIFL 503

Query: 497 WFVFSIPLSLAGSLIAKKKCRWNEHPTKTRQIPRQIPFQPWYLKTAPAALIAGIFPFGSI 556
           WF  SIPLS AGS+IA K C W+EHPTKT QI RQ+P+QPWYL+T  A LIAGIF FGSI
Sbjct: 504 WFAVSIPLSFAGSMIAHKWCNWDEHPTKTNQIARQVPYQPWYLRTIQATLIAGIFCFGSI 563

Query: 557 AVELYFVYSSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXXXXXXXCLENWKWQWRGFWI 616
           AVELYF+YSSLWFNKIFYMFG                         CLENW+WQWR F I
Sbjct: 564 AVELYFIYSSLWFNKIFYMFGFLLFSFLLLTLTTSLVTVLITYHSLCLENWQWQWRSFII 623

Query: 617 GGAGCALYVFLHAILFTKFKLGGFVTIVLYVGYSLVISLLTCLITGAVGFMSSLWFVRRI 676
           GG GC++Y+F+H+ILFTKFKLGGF+TIVLY GYS +IS L C++TGA+GF S + F+R+I
Sbjct: 624 GGLGCSVYMFIHSILFTKFKLGGFITIVLYFGYSFIISALCCVVTGAIGFFSCMLFIRKI 683

Query: 677 YSSIKVD 683
           YS++K++
Sbjct: 684 YSAVKIE 690

>Kpol_543.35 s543 complement(78246..80222) [1977 bp, 658 aa] {ON}
           complement(78246..80222) [1977 nt, 659 aa]
          Length = 658

 Score =  751 bits (1940), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/668 (55%), Positives = 444/668 (66%), Gaps = 29/668 (4%)

Query: 18  EGFYLPGVAPTTYHEGDSIPLLVNHLTPSMYFKHVDDDGKDT-GDRESFLYSYDYYYDKF 76
             FYLPGVAPTTY +GD IPLLVNHLTPS+ F+H DD G D  G++E FLYS+DYY+ K 
Sbjct: 18  SAFYLPGVAPTTYGKGDEIPLLVNHLTPSLNFQHKDDQGNDIKGNKEHFLYSFDYYFPKL 77

Query: 77  HFCKPEKLEKQRESLGSIIFGDRIYNSPFKLEMLKDKECEALCSSKIPANDAKFINKLIA 136
           HFCKPE +EKQ ESLGSI+FGDRIYNSPF ++ML+++EC +LC   IPA+DAKFINKLI 
Sbjct: 78  HFCKPEHVEKQPESLGSILFGDRIYNSPFSIKMLENQECTSLCKVTIPADDAKFINKLIK 137

Query: 137 NGFFQNWLVDGLPAARKTTDERTKSEFYTPGFELGFIDVGGAKLRMDGQGEEDAHPKGAT 196
           NGFFQNWL+DGLPAARK  D +TKS+FY  GF LG                 + H + A 
Sbjct: 138 NGFFQNWLIDGLPAARKLHDVKTKSDFYGTGFPLG-----------------NVHVRQAV 180

Query: 197 KPVAQDDY-LDRPSKSKNEKRKKIVDPKELVKQLETAYFANHFNIEVQYHDRGNGDYRVV 255
             +A     L+ P++          +   +V  +E  +  NH++I V+YHDRG G+YRVV
Sbjct: 181 GGLASSKLNLENPAREAK-------NVNNMVHNVEIPFLFNHYDINVEYHDRGEGNYRVV 233

Query: 256 GVIVNPQSIKRDSSNSCAATGXXXXXXXXXXTTVHFSYSVKFTPSDTVWATRWDKYLHVY 315
           GV V+P+S    + + C                V FSYSV+F PS+TVWATRWDKYLHVY
Sbjct: 234 GVTVDPKS---STGDICTKKSGGLILLETEDNEVQFSYSVRFIPSETVWATRWDKYLHVY 290

Query: 316 DPKIQWYXXXXXXXXXXXXXXXXXXXXYRTLRDDLSRYNQLNLDDDFQEETGWKLVHGDV 375
           DP IQW+                     R L+ D +RY + NLDD FQ+++GWKL HGDV
Sbjct: 291 DPTIQWFSLINFSVVVILLSMVVIHSLMRALKSDFARYEEFNLDDTFQQDSGWKLGHGDV 350

Query: 376 FRTPTKXXXXXXXXXXXTQLFVMAACTIAFAXXXXXXXXXXXXXTTVMFILYALFGSLGS 435
           FR P K           TQLF+M A +I FA              + MFILYALFG  GS
Sbjct: 351 FRIPDKSMLLSILVGSGTQLFLMVAVSIFFAAIGILSPSSRGSLPSAMFILYALFGFCGS 410

Query: 436 YTSMATYKFFGGEYWKVNMILTPILVPGLLFCVVLGLNFFLIMVESAGAIPFGTMCAIVL 495
           Y SM  YKFF G YWK NMILTPILVPGLLF  ++GLNFFL+   S+G IP   +  +++
Sbjct: 411 YVSMGVYKFFNGPYWKANMILTPILVPGLLFISIVGLNFFLLFSRSSGTIPPTALIFVIV 470

Query: 496 LWFVFSIPLSLAGSLIAKKKCRWNEHPTKTRQIPRQIPFQPWYLKTAPAALIAGIFPFGS 555
           LWF+ SIPLSLAGSLIA KKC W EHPTKT +I RQIPFQPWYLKT PA LIAG+FPFGS
Sbjct: 471 LWFIISIPLSLAGSLIANKKCNWGEHPTKTNEIARQIPFQPWYLKTVPATLIAGLFPFGS 530

Query: 556 IAVELYFVYSSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXXXXXXXCLENWKWQWRGFW 615
           IAVELYF+YSSLWFNKIFYMFG                          LENW+WQWR F 
Sbjct: 531 IAVELYFIYSSLWFNKIFYMFGFLFVSFLLLTLTTTLVTILITYYSLNLENWRWQWRSFI 590

Query: 616 IGGAGCALYVFLHAILFTKFKLGGFVTIVLYVGYSLVISLLTCLITGAVGFMSSLWFVRR 675
           +GG GCA Y+F+H+I+FTKFKLGGF TIVLYVGYSL+IS L  ++TGA+GF+SS+ FV++
Sbjct: 591 VGGVGCAFYIFVHSIIFTKFKLGGFTTIVLYVGYSLIISALCAVVTGAIGFISSMLFVKK 650

Query: 676 IYSSIKVD 683
           IYSS+KVD
Sbjct: 651 IYSSVKVD 658

>Skud_4.368 Chr4 complement(640627..642645) [2019 bp, 672 aa] {ON}
           YDR107C (REAL)
          Length = 672

 Score =  746 bits (1925), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/672 (53%), Positives = 449/672 (66%), Gaps = 22/672 (3%)

Query: 18  EGFYLPGVAPTTYHEGDSIPLLVNHLTPSMYFKHVDDDGKD-TGDRESFLYSYDYYYDKF 76
           + F LPG++PTTYH  D IPLLVN LTPS+YF+H D++G D + D+E FLYSYDYY ++F
Sbjct: 17  KAFSLPGLSPTTYHSNDEIPLLVNRLTPSIYFQHQDENGNDISSDKEHFLYSYDYYNERF 76

Query: 77  HFCKPEKLEKQRESLGSIIFGDRIYNSPFKLEMLKDKECEALCSSKIPANDAKFINKLIA 136
           HFC+PE +EKQ ESLGS+IFGDRIYNSPF+L ML++KEC ALC   IP  DA+FIN+LI 
Sbjct: 77  HFCRPEHVEKQPESLGSVIFGDRIYNSPFQLRMLEEKECVALCKGTIPGRDAEFINRLII 136

Query: 137 NGFFQNWLVDGLPAARKTTDERTKSEFYTPGFELGFIDV----GGAKL-RMDGQGEEDAH 191
           +GFFQNWLVDGLPAAR   D RTK+ +Y  GFELGF DV    G   +     + + DA 
Sbjct: 137 SGFFQNWLVDGLPAARSVYDSRTKTNYYGTGFELGFTDVIQTVGDETVPNTMEEADMDAS 196

Query: 192 PKGATKPVAQDDYLDRPSKSKNEKRKKIVDPKELVKQLETAYFANHFNIEVQYHDRGNGD 251
             GAT  +               +  K + P   VK +E  YF NHF I V++H+RGN  
Sbjct: 197 NAGATLHI---------------RSPKNIRPNP-VKTVELPYFVNHFEIVVEFHERGNDS 240

Query: 252 YRVVGVIVNPQSIKRDSSNSCAATGXXXXXXXXXXTTVHFSYSVKFTPSDTVWATRWDKY 311
           YR+VGV VNP SI+R S  SC+ T             V+F+YSVKF  S TVWATRWDKY
Sbjct: 241 YRIVGVTVNPVSIERSSPGSCSRTRKPLTLHEDRDNEVYFTYSVKFVASATVWATRWDKY 300

Query: 312 LHVYDPKIQWYXXXXXXXXXXXXXXXXXXXXYRTLRDDLSRYNQLNLDDDFQEETGWKLV 371
           LH+YDP+IQW+                     R L+ DL+RYN+LNL+++F E+ GWKL 
Sbjct: 301 LHIYDPQIQWFSLIGFSVIVILLSSAVIHSLLRALKSDLTRYNELNLNNEFHEDAGWKLS 360

Query: 372 HGDVFRTPTKXXXXXXXXXXXTQLFVMAACTIAFAXXXXXXXXXXXXXTTVMFILYALFG 431
           HGDVFRTP K            QLF+M  C+I FA              TVMF+LYALFG
Sbjct: 361 HGDVFRTPPKSMLLSVLVGSGIQLFLMIICSIFFAAFGLVSPISRGSLQTVMFLLYALFG 420

Query: 432 SLGSYTSMATYKFFGGEYWKVNMILTPILVPGLLFCVVLGLNFFLIMVESAGAIPFGTMC 491
            +GSYTSM  YKFF G YWK N+I+TPIL+PG +  +++ +N FL+   S+G IP  ++ 
Sbjct: 421 FVGSYTSMGVYKFFHGPYWKANLIITPILLPGAILLLIVAMNIFLLFAHSSGVIPAKSLF 480

Query: 492 AIVLLWFVFSIPLSLAGSLIAKKKCRWNEHPTKTRQIPRQIPFQPWYLKTAPAALIAGIF 551
            I+ LWFV SIPLS  GS++A K+C WNEHPTKT QI RQIP QPWYL+T  A ++AGIF
Sbjct: 481 FIIFLWFVVSIPLSFVGSVLAHKRCSWNEHPTKTNQIARQIPHQPWYLRTTQATMVAGIF 540

Query: 552 PFGSIAVELYFVYSSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXXXXXXXCLENWKWQW 611
            FGSIAVELYF+YSSLWFNKIFYMFG                         CLENW WQW
Sbjct: 541 SFGSIAVELYFIYSSLWFNKIFYMFGFLLFSFLLLTLTTSLITVLITYHSLCLENWLWQW 600

Query: 612 RGFWIGGAGCALYVFLHAILFTKFKLGGFVTIVLYVGYSLVISLLTCLITGAVGFMSSLW 671
           R F IGG GC++Y+F+H+ILFTKFKLGGF+T+VLY+GYS ++S+L C++TGA+GF SS+ 
Sbjct: 601 RSFIIGGLGCSIYMFIHSILFTKFKLGGFITVVLYLGYSFIMSVLCCVVTGAIGFFSSMI 660

Query: 672 FVRRIYSSIKVD 683
           F+R+IY ++KV+
Sbjct: 661 FIRKIYYAVKVE 672

>KNAG0G01990 Chr7 complement(441326..443329) [2004 bp, 667 aa] {ON}
           Anc_8.254 YLR083C
          Length = 667

 Score =  738 bits (1904), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/669 (55%), Positives = 458/669 (68%), Gaps = 20/669 (2%)

Query: 16  RVEGFYLPGVAPTTYHEGDSIPLLVNHLTPSMYFKHVDDDGKDT-GDRESFLYSYDYYYD 74
           +V  FYLPGVAPTTY   D IPLLVNHL+PSMY++H  +DG++  GD+  +LYSYDYYYD
Sbjct: 18  QVNAFYLPGVAPTTYKANDEIPLLVNHLSPSMYWQHETEDGENMKGDKSRYLYSYDYYYD 77

Query: 75  KFHFCKPEKLEKQRESLGSIIFGDRIYNSPFKLEMLKDKECEALCSSKIPANDAKFINKL 134
           +FHFC+PEK+ K+ ESLGSIIFGDRIYNSP++++ML++K C  LC++ IP  DA+FINKL
Sbjct: 78  RFHFCQPEKIVKEPESLGSIIFGDRIYNSPYQIKMLEEKTCVPLCNTIIPGKDAEFINKL 137

Query: 135 IANGFFQNWLVDGLPAARKTTDERTKSEFYTPGFELGFIDVGGAKLRMDGQGEEDAHPKG 194
           I NGFFQNWL+DGLPAAR   D+ T S+FY  GFELG ++V      +    +   HPK 
Sbjct: 138 IKNGFFQNWLIDGLPAARVVHDKSTNSDFYGNGFELGSVEV------VQAVAQAKTHPK- 190

Query: 195 ATKPVAQDDYLDRPSKSKNEKRKKIVDPKELVKQLETAYFANHFNIEVQYHDRGNGDYRV 254
                 +DD       +++ K        +++K +E  YFANH +I V+YHDRG G+ RV
Sbjct: 191 ------EDDSGSAKLSTRDAKNV------QMLKNVELPYFANHHDITVEYHDRGEGNLRV 238

Query: 255 VGVIVNPQSIKRDSSNSCAATGXXXXXXXXXXTTVHFSYSVKFTPSDTVWATRWDKYLHV 314
           VGV V+P SIKR S  +C  +G            V+F+YSV+F  SDTVWATRWDKYLH 
Sbjct: 239 VGVTVDPISIKRSSPGTCQTSGDPLMLDEKNDNEVYFTYSVRFVASDTVWATRWDKYLHT 298

Query: 315 YDPKIQWYXXXXXXXXXXXXXXXXXXXXYRTLRDDLSRYNQLNLDDDFQEETGWKLVHGD 374
           YDP IQW+                     + LR D +RYN+LNLD++FQE++GWKL HGD
Sbjct: 299 YDPTIQWFSLVNFSIVVVLLSSVVIHMLLKALRSDFARYNELNLDNEFQEDSGWKLTHGD 358

Query: 375 VFRTPTKXXXXXXXXXXXTQLFVMAACTIAFAXXXXXXXXXXXXXTTVMFILYALFGSLG 434
           VFR P+K            QLF+M + +I FA              TVMF+LYALFG +G
Sbjct: 359 VFRIPSKSMLLSILVGSGIQLFLMISVSIFFAALGFLSPSSRGSLGTVMFMLYALFGFVG 418

Query: 435 SYTSMATYKFFGGEYWKVNMILTPILVPGLLFCVVLGLNFFLIMVESAGAIPFGTMCAIV 494
           SYTSM  YKFF G YWK NMILTP+LVPG L   ++GLN FL+   S+G IP  T+  IV
Sbjct: 419 SYTSMGVYKFFRGPYWKANMILTPLLVPGCLLLSIVGLNMFLLGAHSSGTIPAKTLFFIV 478

Query: 495 LLWFVFSIPLSLAGSLIAKKKCRWNEHPTKTRQIPRQIPFQPWYLKTAPAALIAGIFPFG 554
           LLWFV S+P +LAGSLIA KKC W+EHPTKT Q+ RQ+PFQPWYLKT  A  IAGIFPFG
Sbjct: 479 LLWFVISVPSALAGSLIAHKKCSWDEHPTKTNQVARQVPFQPWYLKTVAATFIAGIFPFG 538

Query: 555 SIAVELYFVYSSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXXXXXXXCLENWKWQWRGF 614
           SIAVELYF+Y+SLW+NKIFYMFG                          LENW+WQWR F
Sbjct: 539 SIAVELYFIYTSLWYNKIFYMFGFLFVSFLLLTLTTVLVTILITYHSLSLENWQWQWRSF 598

Query: 615 WIGGAGCALYVFLHAILFTKFKLGGFVTIVLYVGYSLVISLLTCLITGAVGFMSSLWFVR 674
            +GG GCA+Y+F+H+ILFTK KLGGFVTIVLYVGYS VISLL CL+TG++GF+SS++FVR
Sbjct: 599 IVGGVGCAIYMFVHSILFTKLKLGGFVTIVLYVGYSAVISLLCCLVTGSIGFLSSMFFVR 658

Query: 675 RIYSSIKVD 683
           RIYSSIKV+
Sbjct: 659 RIYSSIKVE 667

>TBLA0H01450 Chr8 complement(321416..323437) [2022 bp, 673 aa] {ON}
           Anc_8.254 YLR083C
          Length = 673

 Score =  720 bits (1858), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/670 (51%), Positives = 437/670 (65%), Gaps = 22/670 (3%)

Query: 18  EGFYLPGVAPTTYHEGDSIPLLVNHLTPSMYFKHVDDDGKDTG-DRESFLYSYDYYYDKF 76
             FY+PG++  TYH GD I L VN LTPSMYF+H D++G+    D+E FLYSYDYYYDKF
Sbjct: 20  NAFYIPGISANTYHPGDPIELEVNRLTPSMYFEHTDENGQSVANDKEHFLYSYDYYYDKF 79

Query: 77  HFCKPEKLEKQRESLGSIIFGDRIYNSPFKLEMLKDKECEALCSSKIPANDAKFINKLIA 136
           HFC+PEK+E++ ESLGS++FGDRIYNSPF+L ML+ KEC  LC + IPA+DAKFINKLI 
Sbjct: 80  HFCRPEKVERKSESLGSVLFGDRIYNSPFELYMLEPKECVPLCKTTIPADDAKFINKLIK 139

Query: 137 NGFFQNWLVDGLPAARKTTDERTKSEFYTPGFELGFIDV----GGAKLRMDGQGEEDAHP 192
           NGFF NWL+DGLP+ARK  D +T+S FY+ GF LG + V    GG+K+ + G  +     
Sbjct: 140 NGFFYNWLIDGLPSARKIYDSKTESIFYSSGFPLGSVSVEHMSGGSKVTIPGVSK----- 194

Query: 193 KGATKPVAQDDYLDRPSKSKNEKRKKIVDPKELVKQLETAYFANHFNIEVQYHDRGNGDY 252
                       ++   K+  ++  K V P  L+   E  YFANHFNI ++YHDRGN +Y
Sbjct: 195 -----------LVNEAVKAYKKREAKNV-PAGLITAEEVEYFANHFNIHIEYHDRGNNNY 242

Query: 253 RVVGVIVNPQSIKRDSSNSCAATGXXXXXXXXXXTTVHFSYSVKFTPSDTVWATRWDKYL 312
           RVVGV V+P SIKRD   SC  TG            V F+YSV F  S+T WATRWDKYL
Sbjct: 243 RVVGVTVDPISIKRDDFESCTPTGNQLHLNENAENQVLFTYSVDFIKSETAWATRWDKYL 302

Query: 313 HVYDPKIQWYXXXXXXXXXXXXXXXXXXXXYRTLRDDLSRYNQLNLDDDFQEETGWKLVH 372
           H YDP IQW+                     R L+ D+SRY  LNLD+ F E++GWKL H
Sbjct: 303 HTYDPSIQWFSLINFTIVVVLLSTIVIHALLRALKKDISRYTDLNLDNSFTEDSGWKLTH 362

Query: 373 GDVFRTPTKXXXXXXXXXXXTQLFVMAACTIAFAXXXXXXXXXXXXXTTVMFILYALFGS 432
           GDVFR P K            QLF+M  C +  A              T MF+LYA+FG 
Sbjct: 363 GDVFRMPRKAMVLSIYVGSGVQLFLMILCCLTVAALGFMSPSYRGALPTCMFVLYAIFGF 422

Query: 433 LGSYTSMATYKFFGGEYWKVNMILTPILVPGLLFCVVLGLNFFLIMVESAGAIPFGTMCA 492
           +GSYTSM  YKFF G YWK NMILTP+LVPG +  +++ LNFFL+ V S+G IP  T+  
Sbjct: 423 VGSYTSMGVYKFFHGPYWKANMILTPLLVPGSMLLLIIFLNFFLLGVHSSGTIPASTIIL 482

Query: 493 IVLLWFVFSIPLSLAGSLIAKKKCRWNEHPTKTRQIPRQIPFQPWYLKTAPAALIAGIFP 552
           ++ LW + S+PLS  GS +A KKC WN++PT   +IPR+IP QPWY+++ P  L++GI P
Sbjct: 483 MICLWLLVSVPLSFLGSFVAFKKCNWNDNPTTVNEIPREIPIQPWYMRSIPVVLLSGIVP 542

Query: 553 FGSIAVELYFVYSSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXXXXXXXCLENWKWQWR 612
           FG+IAVELYF+YSSLW+NKIFYMFG                         CLENW+WQWR
Sbjct: 543 FGAIAVELYFIYSSLWYNKIFYMFGFLLVSFILMIFTSVLVSIIVVYHSLCLENWRWQWR 602

Query: 613 GFWIGGAGCALYVFLHAILFTKFKLGGFVTIVLYVGYSLVISLLTCLITGAVGFMSSLWF 672
            F  GG GCA Y+FL++I FT+FK  GFV+I+LY+GYS +I +++CLITGAV FM +++F
Sbjct: 603 SFVAGGLGCAFYIFLYSIAFTRFKFTGFVSILLYMGYSSLICVVSCLITGAVSFMCNMFF 662

Query: 673 VRRIYSSIKV 682
           V+RI++SIKV
Sbjct: 663 VKRIFTSIKV 672

>TPHA0A01840 Chr1 (371758..373815) [2058 bp, 685 aa] {ON} Anc_8.254
           YLR083C
          Length = 685

 Score =  717 bits (1851), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/673 (52%), Positives = 439/673 (65%), Gaps = 10/673 (1%)

Query: 18  EGFYLPGVAPTTYHEGDSIPLLVNHLTPSMYFKHVDDDGKDTGDRESFLYSYDYYYDKFH 77
             FYLPGVAP+TY+EGD +PLLVNHLTPS+ ++  DD GK    RE  LYS+DYY+ K H
Sbjct: 16  NAFYLPGVAPSTYNEGDELPLLVNHLTPSLNYQKKDDLGKKVESREKMLYSFDYYFPKLH 75

Query: 78  FCKPEKLEKQRESLGSIIFGDRIYNSPFKLEMLKDKECEALCSSKIPANDAKFINKLIAN 137
           FCKPEK+ KQ +SLGSI+FGDRIYNSPF ++MLK +    LCS  IP +DAKFINKLI N
Sbjct: 76  FCKPEKIVKQPDSLGSILFGDRIYNSPFSIKMLKPENNVKLCSITIPGSDAKFINKLIKN 135

Query: 138 GFFQNWLVDGLPAARKTTDERTKSEFYTPGFELGFID----VGGAKLRMDGQGEEDAHPK 193
           GFFQNWL+DGLPAARK  D  T +EFY  GF LGF++    VGG  + MD + ++     
Sbjct: 136 GFFQNWLIDGLPAARKIYDSNTHTEFYDVGFPLGFVEIKKNVGGLGIPMDAKTKDSGKKN 195

Query: 194 GATKPVAQDDYLDRPSKSKNEKRKKIVDPK---ELVKQLETAYFANHFNIEVQYHDRGNG 250
             +         D   K ++  +K+  +PK   +LV  +E  Y ANH+ I V+ HDRG G
Sbjct: 196 SNSDKKKDSKKKDDSQKKEDSNKKEKREPKRISKLVHNVEFPYLANHYVINVEVHDRGEG 255

Query: 251 DYRVVGVIVNPQSIKRDSSNSCAATGXXXXXXXXXXTTVHFSYSVKFTPSDTVWATRWDK 310
           +YRVVGV V+P S   DS+N     G            V FSYSV F  S+TVWATRWDK
Sbjct: 256 NYRVVGVTVDPYS-TTDSAN--PEKGNKLFLDEKKDNEVTFSYSVNFIESETVWATRWDK 312

Query: 311 YLHVYDPKIQWYXXXXXXXXXXXXXXXXXXXXYRTLRDDLSRYNQLNLDDDFQEETGWKL 370
           YLH Y+P IQW+                     + L+ D +RY + NLD+ F E++GWKL
Sbjct: 313 YLHTYNPTIQWFSLVNFSIIVLLLSALVTYSLLKALKSDFARYEEFNLDNSFNEDSGWKL 372

Query: 371 VHGDVFRTPTKXXXXXXXXXXXTQLFVMAACTIAFAXXXXXXXXXXXXXTTVMFILYALF 430
            HGDVFR P++            QLF+M   +I  A              + MF  YALF
Sbjct: 373 GHGDVFRIPSQSMLLSILVGSGAQLFLMIISSIFLAAIGIISPSSRGSLPSAMFTFYALF 432

Query: 431 GSLGSYTSMATYKFFGGEYWKVNMILTPILVPGLLFCVVLGLNFFLIMVESAGAIPFGTM 490
           G  GSY SM+ YKFF G YWK NMILTP+LVPG +   +LGLNFFL+ V S+G IP   +
Sbjct: 433 GFWGSYISMSVYKFFKGPYWKANMILTPLLVPGFILVSILGLNFFLLFVHSSGTIPMTAL 492

Query: 491 CAIVLLWFVFSIPLSLAGSLIAKKKCRWNEHPTKTRQIPRQIPFQPWYLKTAPAALIAGI 550
             IV++WFV S+PLS  GSL+A K+  W EHPTKT QI RQIPFQ WYLKT PA LIAGI
Sbjct: 493 LLIVVIWFVISLPLSFLGSLLANKRSNWGEHPTKTNQIARQIPFQSWYLKTIPAILIAGI 552

Query: 551 FPFGSIAVELYFVYSSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXXXXXXXCLENWKWQ 610
           FPFG+IAVELYF+Y+SLWFNKIFYMFG                         C+ENW WQ
Sbjct: 553 FPFGAIAVELYFIYTSLWFNKIFYMFGFLFVSFLLLTLTTSLVTVLITYQSLCMENWNWQ 612

Query: 611 WRGFWIGGAGCALYVFLHAILFTKFKLGGFVTIVLYVGYSLVISLLTCLITGAVGFMSSL 670
           WR F IGG GC+LY+F+H+ILFTKFKLGGF T++LY+GY+L++S+L+C++TGAVGF+SS+
Sbjct: 613 WRSFTIGGVGCSLYIFIHSILFTKFKLGGFTTMILYIGYTLLLSILSCIVTGAVGFISSM 672

Query: 671 WFVRRIYSSIKVD 683
            FVR+IYS+++VD
Sbjct: 673 IFVRKIYSNVRVD 685

>NCAS0B03890 Chr2 (693950..695941) [1992 bp, 663 aa] {ON} Anc_8.254
          Length = 663

 Score =  707 bits (1824), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/671 (50%), Positives = 429/671 (63%), Gaps = 26/671 (3%)

Query: 17  VEGFYLPGVAPTTYHEGDSIPLLVNHLTPSMYFKHVDDDGKDTGDRESFL-YSYDYYYDK 75
           VE F LPG+ P TY +GD IPLLVNHLTPSM+F H +++GKD    + ++ +SYDYYY+K
Sbjct: 15  VEAFNLPGLGPVTYQKGDDIPLLVNHLTPSMHFHHKNEEGKDISTAKKYVVHSYDYYYEK 74

Query: 76  FHFCKPEKLEKQRESLGSIIFGDRIYNSPFKLEMLKDKECEALCSSKIPANDAKFINKLI 135
           FHFC+P  +EK   S+GSI+FGDRIYNSPF+L ML++K C  LC S IP  DA+FINKLI
Sbjct: 75  FHFCQPVHIEKAGSSIGSILFGDRIYNSPFQLNMLENKTCVPLCESIIPGKDAEFINKLI 134

Query: 136 ANGFFQNWLVDGLPAARKTTDERTKSEFYTPGFELGFIDV---GGAKLRMDGQGEEDAHP 192
            NG++QNW +DGLPAAR+  D+RTKS FY  GFELG +++    G KL  D   +     
Sbjct: 135 KNGYYQNWFIDGLPAAREVYDKRTKSSFYGNGFELGLVEIRQTTGDKLLPDSVHDISDLA 194

Query: 193 KGATKPVAQDDYLDRPSKSKNEKRKKIVDPKELVKQLETAYFANHFNIEVQYHDRGNGDY 252
           K   K + Q+                      L+K++E  YF NHF+I ++YH+RGNG+Y
Sbjct: 195 KRDAKNLVQN----------------------LIKEVEVPYFVNHFDIVIEYHERGNGNY 232

Query: 253 RVVGVIVNPQSIKRDSSNSCAATGXXXXXXXXXXTTVHFSYSVKFTPSDTVWATRWDKYL 312
           RVVG  VNP SI R S+  C  TG            VH +YSV F PS T W TRWDKYL
Sbjct: 233 RVVGATVNPVSIARKSAGDCTPTGKSLTLNEEEDNNVHSTYSVTFVPSKTSWVTRWDKYL 292

Query: 313 HVYDPKIQWYXXXXXXXXXXXXXXXXXXXXYRTLRDDLSRYNQLNLDDDFQEETGWKLVH 372
           HVYDPKIQW+                     + L+ D +RYN +NLDDD +EE+GWKLVH
Sbjct: 293 HVYDPKIQWFSLINFSLIVILLSVILINSLLKALKSDFARYNNINLDDDVKEESGWKLVH 352

Query: 373 GDVFRTPTKXXXXXXXXXXXTQLFVMAACTIAFAXXXXXXXXXXXXXTTVMFILYALFGS 432
           G VFR P              QLF++  CT+  A              T M ILY LFG 
Sbjct: 353 GYVFRIPKNPMILSILVGSGFQLFLVIVCTVFLAAIDILSPIYRGALPTAMIILYILFGF 412

Query: 433 LGSYTSMATYKFFGGEYWKVNMILTPILVPGLLFCVVLGLNFFLIMVESAGAIPFGTMCA 492
           + SY SM  YKFF G YWKVNM+LTPILVPGL+    L LN FL+  ES+  +P  T+  
Sbjct: 413 ISSYVSMGVYKFFKGPYWKVNMLLTPILVPGLIIITFLALNLFLMFSESSSVVPAKTIMT 472

Query: 493 IVLLWFVFSIPLSLAGSLIAKKKCRWNEHPTKTRQIPRQIPFQPWYLKTAPAALIAGIFP 552
           ++LLWF  SIPLS+AGSL+A+KKC W+EHPT T QI + IP Q WYLKT PA+LI G+F 
Sbjct: 473 LILLWFAVSIPLSVAGSLMAQKKCHWDEHPTVTNQIAKVIPPQKWYLKTIPASLIGGLFS 532

Query: 553 FGSIAVELYFVYSSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXXXXXXXCLENWKWQWR 612
           FGSI+V+LYF+Y+SLWFN IFYM+G                         C ENWKWQWR
Sbjct: 533 FGSISVQLYFIYTSLWFNNIFYMYGFLLFSICLFTMTITLVTILFTYHSLCQENWKWQWR 592

Query: 613 GFWIGGAGCALYVFLHAILFTKFKLGGFVTIVLYVGYSLVISLLTCLITGAVGFMSSLWF 672
           GF+IGG GC++YV LH++ F + KLGGF  I+LY+GYS V++ L  L+TG+VGF+SS++F
Sbjct: 593 GFFIGGLGCSIYVLLHSLFFIELKLGGFTNILLYMGYSSVVTALIFLVTGSVGFLSSMFF 652

Query: 673 VRRIYSSIKVD 683
           ++RI+SS+KVD
Sbjct: 653 IKRIFSSVKVD 663

>AGR097W Chr7 (920133..922094) [1962 bp, 653 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR083C (EMP70) and
           YDR107C
          Length = 653

 Score =  698 bits (1802), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/668 (52%), Positives = 446/668 (66%), Gaps = 31/668 (4%)

Query: 18  EGFYLPGVAPTTYHEGDSIPLLVNHLTPSMYFKHVDDDGKDTG--DRESFLYSYDYYYDK 75
           +GFYLPG APTTY  GD+IPLLVNH+TP+++    DD     G  D+E +LY+YDYYY +
Sbjct: 15  QGFYLPGSAPTTYRRGDAIPLLVNHITPTVF---SDDRAGTDGQRDKERYLYAYDYYYPR 71

Query: 76  FHFCKPEKLEKQRESLGSIIFGDRIYNSPFKLEMLKDKECEALCSSKIPANDAKFINKLI 135
            H C+P+K+EK  ESLGSIIFGDR++NSPF+L+ML++K C ALC   +PA DAKFIN+LI
Sbjct: 72  LHMCRPDKIEKVSESLGSIIFGDRLHNSPFELKMLEEKSCVALCEKTVPAEDAKFINQLI 131

Query: 136 ANGFFQNWLVDGLPAARKTTDERTKSEFYTPGFELGFIDVGGAKLRMDGQGEEDAHPKGA 195
            +GFF NWLVDGLPA R+  D RT + FY  GFELG +  G                   
Sbjct: 132 RSGFFHNWLVDGLPAGREMHDARTNTVFYGTGFELGRVIRG------------------- 172

Query: 196 TKPVAQDDYLDRPSKSKNEKRKKIVDPKELVKQLETAYFANHFNIEVQYHDRGNGDYRVV 255
                +D   + P + + + R+ ++ P E V  +   YF NHF I V YH R   + RVV
Sbjct: 173 ----TEDRNQEEPGEIELQTRR-VLQPGESV--VAVPYFINHFEITVDYHKRAEDELRVV 225

Query: 256 GVIVNPQSIKRDSSNSCAATGXXXXXXXXXXTTVHFSYSVKFTPSDTVWATRWDKYLHVY 315
           GV V P+S++    + CA +G          T V F+YSV+F  SD  WATRW KYLHVY
Sbjct: 226 GVSVLPRSLQNPVGDKCANSGNGLVLSETADTKVTFTYSVRFHESDVSWATRWGKYLHVY 285

Query: 316 DPKIQWYXXXXXXXXXXXXXXXXXXXXYRTLRDDLSRYNQLNLDDDFQEETGWKLVHGDV 375
           DPK+QWY                    +R L+ DL RYN  NLD++FQE+ GWKL+H DV
Sbjct: 286 DPKVQWYSLINFSLVVLLLSSIMVHSLFRALKTDLDRYNDFNLDNEFQEDYGWKLLHSDV 345

Query: 376 FRTPTKXXXXXXXXXXXTQLFVMAACTIAFAXXXXXXXXXXXXXTTVMFILYALFGSLGS 435
           FR+P+K            QLF+M+ACT+  A              T+MF+LYA+FG  GS
Sbjct: 346 FRSPSKTLLLSVFVGSGGQLFLMSACTLFIAMLGFLSPSSRGSLGTIMFVLYAIFGGFGS 405

Query: 436 YTSMATYKFFGGEYWKVNMILTPILVPGLLFCVVLGLNFFLIMVESAGAIPFGTMCAIVL 495
           Y SM+TYK FGGE WKVNM+LTP+LVPG++F  +L +NFFL+MV+S+GA+PFGTM AIV+
Sbjct: 406 YLSMSTYKMFGGEKWKVNMVLTPLLVPGIIFATMLLMNFFLVMVQSSGAMPFGTMLAIVV 465

Query: 496 LWFVFSIPLSLAGSLIAKKKCRWNEHPTKTRQIPRQIPFQPWYLKTAPAALIAGIFPFGS 555
           LWFV SIP+S+ GSL A+KK  W++HPTKT QI +QIP QPWYL+T PAA IAG+FPFG+
Sbjct: 466 LWFVLSIPISIMGSLFARKKNTWDQHPTKTSQIAKQIPPQPWYLRTWPAAYIAGLFPFGA 525

Query: 556 IAVELYFVYSSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXXXXXXXCLENWKWQWRGFW 615
           IAVELYF+Y+S+WFN +FYMFG                         C+ENW WQWR F 
Sbjct: 526 IAVELYFIYTSIWFNTMFYMFGFLFFTFLLLTLTTALVTILLTYYSLCMENWSWQWRSFI 585

Query: 616 IGGAGCALYVFLHAILFTKFKLGGFVTIVLYVGYSLVISLLTCLITGAVGFMSSLWFVRR 675
           IGG GC+ YVF+++ILFTKF+LGGFVTIVLYVGYSL+IS L CL+TG +GF+SSLWFVR+
Sbjct: 586 IGGIGCSTYVFINSILFTKFRLGGFVTIVLYVGYSLLISFLFCLVTGTIGFVSSLWFVRK 645

Query: 676 IYSSIKVD 683
           IYSSIKVD
Sbjct: 646 IYSSIKVD 653

>TDEL0F03810 Chr6 complement(696251..698221) [1971 bp, 656 aa] {ON}
           Anc_8.254 YLR083C
          Length = 656

 Score =  667 bits (1722), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/664 (49%), Positives = 408/664 (61%), Gaps = 27/664 (4%)

Query: 21  YLPGVAPTTYHEGDSIPLLVNHLTPSMYFKHVDDDGKDT-GDRESFLYSYDYYYDKFHFC 79
           +LPG++PT Y     I L VNHLTPS +F+H D DG +   D+E +LYSYDYY  K HFC
Sbjct: 19  FLPGISPTNYDAKSEIALYVNHLTPSRHFQHKDKDGNNIKSDKEHYLYSYDYYNSKLHFC 78

Query: 80  KPEKLEKQRESLGSIIFGDRIYNSPFKLEMLKDKECEALCSSKIPANDAKFINKLIANGF 139
           KPE + +Q ESLGS++FGDR+YNSPFKL ML+DK C +LC S IP  DA FINKLI NGF
Sbjct: 79  KPENVIEQAESLGSVLFGDRLYNSPFKLNMLEDKSCVSLCKSVIPGEDAAFINKLIKNGF 138

Query: 140 FQNWLVDGLPAARKTTDERTKSEFYTPGFELGFIDVGGAKLRMDGQGEEDAHPKGATKPV 199
             NWLVDGLPA     +ER  S   T GF LG +++      M G      H      P 
Sbjct: 139 LHNWLVDGLPAGTLINNERESSAHITNGFPLGSVEI------MQG-----VHNGAMATP- 186

Query: 200 AQDDYLDRPSKSKNEKRKKIVDPKELVKQLETAYFANHFNIEVQYHDRGNGDYRVVGVIV 259
                         E+         +V  LE  +  NH++I +QYH+   G YR+VGV V
Sbjct: 187 -------------REETGISAHGSNVVVNLELPHLNNHYDITIQYHEPEAGKYRIVGVEV 233

Query: 260 NPQSIKRDSSNSCAATGXXXXXXXXXXTTVHFSYSVKFTPSDTVWATRWDKYLHVYDPKI 319
            P+SIK+ +SNSC  TG            V ++YSV++      WATRWD Y   YD  +
Sbjct: 234 EPKSIKQ-TSNSCEFTGEQISLSEDQDNEVLYTYSVRYVRFSHTWATRWDNYRFSYDTTV 292

Query: 320 QWYXXXXXXXXXXXXXXXXXXXXYRTLRDDLSRYNQLNLDDDFQEETGWKLVHGDVFRTP 379
           QW+                     R L+ D +RYN+LNLDD+F EE+GWKL HGDVFR P
Sbjct: 293 QWFSLISCVIVVIGLSSVVLHMLLRALKSDFARYNELNLDDEFHEESGWKLSHGDVFRMP 352

Query: 380 TKXXXXXXXXXXXTQLFVMAACTIAFAXXXXXXXXXXXXXTTVMFILYALFGSLGSYTSM 439
            K            QL ++A   I  A              T+ F+LYALFG +GSY SM
Sbjct: 353 NKSLLLSVLVGSGVQLLLLAVGGIVIAAIAFNNAGSREVLPTIFFVLYALFGFVGSYASM 412

Query: 440 ATYKFFGGEYWKVNMILTPILVPGLLFCVVLGLNFFLIMVESAGAIPFGTMCAIVLLWFV 499
             Y+FF G Y KVNMILTP L+PGL+   ++ LNFFL++  S+ AIPF  + A+VLLW +
Sbjct: 413 GVYRFFKGPYPKVNMILTPFLIPGLILLTIISLNFFLLIAHSSDAIPFSALFAVVLLWLI 472

Query: 500 FSIPLSLAGSLIAKKKCRWNEHPTKTRQIPRQIPFQPWYLKTAPAALIAGIFPFGSIAVE 559
            S+PLSLAGSL A K C W++HPTKT QI RQIPFQPWYLKT PAAL+AGIFPF SIAVE
Sbjct: 473 ISVPLSLAGSLTAIKTCSWDQHPTKTNQIARQIPFQPWYLKTLPAALVAGIFPFASIAVE 532

Query: 560 LYFVYSSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXXXXXXXCLENWKWQWRGFWIGGA 619
           LYF+Y+SLWF++ FYMFG                         CLENW+WQWR F +GG 
Sbjct: 533 LYFIYNSLWFHQFFYMFGFSMVSLFLLVLTTALVTVMITYHSLCLENWQWQWRSFIVGGL 592

Query: 620 GCALYVFLHAILFTKFKLGGFVTIVLYVGYSLVISLLTCLITGAVGFMSSLWFVRRIYSS 679
           G A+Y+F+H+I FT+FKL GF TIVLYVGYS++IS+L CL TGAVGF SS++ VR+I+SS
Sbjct: 593 GSAVYIFIHSIFFTEFKLRGFTTIVLYVGYSMLISILCCLTTGAVGFFSSMFLVRKIFSS 652

Query: 680 IKVD 683
           +KVD
Sbjct: 653 VKVD 656

>NDAI0J01420 Chr10 (326749..328608) [1860 bp, 619 aa] {ON} Anc_8.254
          Length = 619

 Score =  618 bits (1593), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/638 (48%), Positives = 396/638 (62%), Gaps = 20/638 (3%)

Query: 47  MYFKHVDDDGKD-TGDRESFLYSYDYYYDKFHFCKPEKLEKQRESLGSIIFGDRIYNSPF 105
           M++ H + +G+D + D +  +YSYDYYY+K HFCKPE +EK   S+GS++FGDR+YNSPF
Sbjct: 1   MHYHHKNQEGQDISTDDKRTIYSYDYYYEKLHFCKPEHVEKAGVSIGSVLFGDRLYNSPF 60

Query: 106 KLEMLKDKECEALCSSKIPANDAKFINKLIANGFFQNWLVDGLPAARKTTDERTKSEFYT 165
           +L MLK+K CE LC+S I   DAKFINKLI NG++QNWL+DGLPAAR+  D RTKS FY 
Sbjct: 61  QLNMLKNKTCERLCNSTIIGRDAKFINKLIKNGYYQNWLIDGLPAAREVYDTRTKSNFYG 120

Query: 166 PGFELGFIDVGGAKLRMDGQGEEDAHPKGATKPVAQDDYLDRPSKSKNEKRKKIVDPKEL 225
            GFELG +++          GE+         P + D + D   +      K IV  + L
Sbjct: 121 NGFELGLVEI------RQTTGEK-------LLPNSADTFRDLHKRDA----KNIV--QNL 161

Query: 226 VKQLETAYFANHFNIEVQYHDRGNGDYRVVGVIVNPQSIKRDSSNSCAATGXXXXXXXXX 285
           ++ +E  YF NHF+I ++YHDRGN +YRVVGV VNP SI R     C  TG         
Sbjct: 162 MQDIEVPYFVNHFDIRIEYHDRGNDNYRVVGVTVNPVSIDRSPDGGCKPTGKALSLSESE 221

Query: 286 XTTVHFSYSVKFTPSDTVWATRWDKYLHVYDPKIQWYXXXXXXXXXXXXXXXXXXXXYRT 345
              +HF+YSV+F PS+T W TRWDKYLHVYDP IQW                      + 
Sbjct: 222 VNYIHFTYSVEFIPSETAWVTRWDKYLHVYDPTIQWVSIVNFSIVVIILSCAVARSLLQA 281

Query: 346 LRDDLSRYNQLNLDDDFQEETGWKLVHGDVFRTPTKXXXXXXXXXXXTQLFVMAACTIAF 405
           L+ D SRY +LNLD+  +E+  WKL HGDVFR P              QLF+M  CTI  
Sbjct: 282 LKSDFSRYGELNLDETIKEDASWKLGHGDVFRAPDHPMLLSILVGSGVQLFLMIICTIFL 341

Query: 406 AXXXXXXXXXXXXXTTVMFILYALFGSLGSYTSMATYKFFGGEYWKVNMILTPILVPGLL 465
                          TVMF+LY  F  + S+ SM  YKFF G+ W +N ILTP LVPGLL
Sbjct: 342 PAVGLITPGSRGTLPTVMFLLYLGFSFISSFVSMGVYKFFNGQKWHINCILTPFLVPGLL 401

Query: 466 FCVVLGLNFFLIMVESAGAIPFGTMCAIVLLWFVFSIPLSLAGSLIAKKKCRWNEHPTKT 525
             V++GLN FLI V S+G IP  T  +++LLWF   +PLS+ GSL+A+K C W+ HPTKT
Sbjct: 402 LLVIIGLNIFLIFVHSSGVIPLATFTSLILLWFFIGVPLSITGSLMARKTCHWDIHPTKT 461

Query: 526 RQIPRQIPFQPWYLKTAPAALIAGIFPFGSIAVELYFVYSSLWFNKIFYMFGXXXXXXXX 585
             + + IP Q WYL+T PA+LI G+F FGS++VELYFVY+SLWFNKIFYM+G        
Sbjct: 462 NTVSKVIPPQKWYLQTIPASLIGGLFSFGSLSVELYFVYTSLWFNKIFYMYGFLFGSAIL 521

Query: 586 XXXXXXXXXXXXXXXXXCLENWKWQWRGFWIGGAGCALYVFLHAILFTKFKLGGFVTIVL 645
                              ENW+WQWR F I G GC+ YVFLH++LFT+ KLGGF   +L
Sbjct: 522 FTLTVSLVTVLFTYYSLSAENWQWQWRSFLIAGLGCSFYVFLHSLLFTEVKLGGFTNALL 581

Query: 646 YVGYSLVISLLTCLITGAVGFMSSLWFVRRIYSSIKVD 683
           Y+GYS VI+ L  ++TGA+GF+SS+ FVR IYS++KVD
Sbjct: 582 YMGYSFVITSLAFVVTGALGFLSSMLFVRTIYSAVKVD 619

>Ecym_4317 Chr4 (685854..687671) [1818 bp, 605 aa] {ON} similar to
           Ashbya gossypii AGR097W
          Length = 605

 Score =  552 bits (1422), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/666 (42%), Positives = 380/666 (57%), Gaps = 77/666 (11%)

Query: 19  GFYLPGVAPTTYHEGDSIPLLVNHLTPSMYFKHVDDDGKDTGDRESFLYSYDYYYDKFHF 78
           GFY PGV+P TYH GD IPLLVN+L+                    FL++ DYY D    
Sbjct: 16  GFYFPGVSPVTYHIGDEIPLLVNYLS------------------SDFLWNIDYYSDSIGL 57

Query: 79  CKPEKLEKQRESLGSIIFGDRIYNSPFKLEMLKDKECEALCSSKIPANDAKFINKLIANG 138
           CKP  +++Q ESLGS+IFGDR+YNSPFK+ MLK+ EC  LC + I   D    N      
Sbjct: 58  CKPNTIKEQSESLGSVIFGDRLYNSPFKVSMLKNSECVKLCDTTI---DTALWNTFFGYR 114

Query: 139 FFQNWLVDGLPAARKTTDERTKSEFYTPGFELGFIDVGGAKLRMDGQGEEDAHPKGATKP 198
           +  NWLVDGLP                              L +DG  + + +   +   
Sbjct: 115 YSYNWLVDGLPV-----------------------------LGIDGTSDANGYHNNSELF 145

Query: 199 VA-QDDYLDRPSKSKNEKRKKIVDPKELVKQLETAYFANHFNIEVQYHDRGNGDYRVVGV 257
           +  Q D                          E  Y  NHF+I + Y+DRG G+YRVV  
Sbjct: 146 MGYQAD--------------------------EQKYIYNHFDIYIHYNDRGKGEYRVVFA 179

Query: 258 IVNPQSIKRDSSNSCAATGXXXXXXXXXXTTVHFSYSVKFTPSDTVWATRWDKYLHVYDP 317
              P S+ R  S  C+               + F+YSV F  SD  W+TRWD+YLHVYD 
Sbjct: 180 EAKPISLPRTGSELCSKDAKPVPIGSGNHENITFTYSVIFKKSDISWSTRWDQYLHVYDF 239

Query: 318 KIQWYXXXXXXXXXXXXXXXXXXXXYRTLRDDLSRYNQLNLDDDFQEETGWKLVHGDVFR 377
            IQ                      +R L+ D++ Y++ NLDD+FQ++  WK++HG+VFR
Sbjct: 240 DIQLAELISFSLVVLLLSSVLVHSLFRVLKRDIAAYSEFNLDDEFQQDYCWKIIHGEVFR 299

Query: 378 TPTKXXXXXXXXXXXTQLFVMAACTIAFAXXXXXXXXXXXXXTTVMFILYALFGSLGSYT 437
           +P+K           +QLF MA CT+                 TVMF+LYALFG +GSYT
Sbjct: 300 SPSKALLLSVFVGSGSQLFFMALCTVLLGSCGFLSPSARGSLGTVMFVLYALFGGVGSYT 359

Query: 438 SMATYKFFGGEYWKVNMILTPILVPGLLFCVVLGLNFFLIMVESAGAIPFGTMCAIVLLW 497
           SM+ YKFFGG+ WK+N+ILTP+L+P  LF   + LNFFLI  +S+GA+PFGTM  I++LW
Sbjct: 360 SMSIYKFFGGQNWKLNLILTPLLIPVFLFVTTVLLNFFLIYAKSSGAMPFGTMVTIIILW 419

Query: 498 FVFSIPLSLAGSLIAKKKCRWNEHPTKTRQIPRQIPFQPWYLKTAPAALIAGIFPFGSIA 557
           F+ S+P+S+ GSL++ K  RW+EHP KT QI RQ+P QPWY+KT  A  +AG+FPFG++A
Sbjct: 420 FILSVPVSIIGSLLSWKLNRWDEHPAKTNQIARQVPSQPWYIKTWVATFLAGMFPFGAMA 479

Query: 558 VELYFVYSSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXXXXXXXCLENWKWQWRGFWIG 617
           VELY++Y+S+W   IF+M+G                         C+ENWKWQWR F IG
Sbjct: 480 VELYYIYASIWGEIIFFMYGFLFVAFILLTLTTSLVTILLTYYSLCMENWKWQWRSFIIG 539

Query: 618 GAGCALYVFLHAILFTKFKLGGFVTIVLYVGYSLVISLLTCLITGAVGFMSSLWFVRRIY 677
           G GC++YVFLH++ F KFK  GFV++VLY+GYS ++S++ CL+TG++GF+++LWFVR+IY
Sbjct: 540 GVGCSVYVFLHSLFFIKFKFPGFVSMVLYLGYSAMVSIVCCLVTGSIGFLANLWFVRKIY 599

Query: 678 SSIKVD 683
           S+IKVD
Sbjct: 600 SNIKVD 605

>NDAI0A01510 Chr1 (335693..337732) [2040 bp, 679 aa] {ON} Anc_7.411
           YER113C
          Length = 679

 Score =  115 bits (289), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 159/710 (22%), Positives = 259/710 (36%), Gaps = 137/710 (19%)

Query: 25  VAPTTYHEGDSIPLLVNHLTPSMYFKHVDDDGKDTGDRESFLYSYDYYYDKFHFCKPEKL 84
           + P  Y +GD + L+VN +                   ES L    Y Y    F  P  +
Sbjct: 41  LQPNFYFQGDEVELIVNKV-------------------ESDLTQLPYAYYDLPFTCPPTM 81

Query: 85  EKQ--RESLGSIIFGDRIYNSPFKLEMLKDKECEALCSSKIPANDAKFINKLIANGFFQN 142
            K+    SL  II GDR + S + L+  +D  C  LC+ K      K   KL+ +G+   
Sbjct: 82  HKKPLHLSLNEIIRGDRKWQSDYILKFGQDDTCHILCTRKTTKEGLKNAKKLVEDGYVVQ 141

Query: 143 WLVDG-LPAARKTTDERTKSEFYTPGFELGFIDVGGAKLRMDGQGEEDAHPKGATKPVAQ 201
           WL+D  LPAA        + ++Y  GF LGF+D                           
Sbjct: 142 WLIDEELPAATTFISTIDQKKYYASGFPLGFVD--------------------------- 174

Query: 202 DDYLDRPSKSKNEKRKKIVDPKELVKQLETAYFANHFNIEVQYHDRGNGDYRVVGVIVNP 261
                 P   K                    Y   H  + ++Y+      + +VG  V P
Sbjct: 175 ------PDTGK-------------------VYLNTHVMLVIRYNTVDVNKHTIVGFEVYP 209

Query: 262 QSIKR----DSSNSCAATGXXXXXXXXXXTTVHFSYSVKFTPSDTV-WATRWDKYLHVYD 316
           +S+       +S +               T + F+YSV +     V W  RWD YL+  +
Sbjct: 210 KSVSDFHCPGASKNYEPYEIVIPENDDDLTFIPFTYSVYWREEYLVDWDHRWDLYLNSGE 269

Query: 317 ------PKIQWYXXXXXXXXXXXXXXXXXXXXYRTLRDDLSRYNQLNLDDDFQEETGWKL 370
                  +  W                      R+ +        +N  ++ +    +++
Sbjct: 270 LSENKTTQFHWISLANSAGIVFLMSFVVSVILLRSFKSSRDISTDINKSEEHRNGLVYEV 329

Query: 371 VHGDVF--RTPTKXXXXXXXXXXXTQLF-VMAACTIAFAXXXXXXXXXXXXXTTVM-FIL 426
               +   RTP               LF V+ + TI+ +               V+ F+L
Sbjct: 330 ARNWIINERTPLANLLILFVSMGVQFLFTVLGSLTISCSLNKLHDIGDSVLTMAVLCFVL 389

Query: 427 YALFGS-LGS----YTSMATYK----------FFGGEYWKVNMILTPILVPGLLFCVVLG 471
            A   S +GS      + AT K          FF         IL    +PG++  V L 
Sbjct: 390 GAFMSSYIGSVLLRLKNKATMKKQPIKKGFHLFFA--------ILCGSFLPGIVMIVTLL 441

Query: 472 LNFFLIMVESAGAIPFGTMCAIVLLWFVFSIPLSLAGSLIA---KKKCRWNEHPTKTRQI 528
           LN  +   +S  A+PF T+   + ++F+  IPLS+ G  +A   K K    +    T + 
Sbjct: 442 LNSIVWAHDSTHALPFKTVVMFITVYFIVCIPLSILGGYMANSSKTKGSLTDPKFHTSRP 501

Query: 529 PRQI------PFQPWYL--------KTAPAALIAGIFPFGSIAVELYFVYSSLWFNK--I 572
             ++      P +  +L        K A   L++GIFPF  I VEL +VY S+W  K   
Sbjct: 502 ELELFANKLKPKKHIFLFGARLKSIKIALPILLSGIFPFVIIYVELQYVYKSVWLEKTAF 561

Query: 573 FYMFGXXXXXXXXXXXXXXXXXXXXXXXXXCL---ENWKWQWRGFWIGGAGCALYVFLHA 629
           +Y +G                          +    N  W+W  F++G + CA Y+ L++
Sbjct: 562 YYFYGFLFANILLLCIVVGEIAIIGTYTMLHMADRNNTDWRWISFFMGSS-CAWYMELYS 620

Query: 630 ILFTKFKLG--GFVTIVLYVGYSLVISLLTCLITGAVGFMSSLWFVRRIY 677
           + +  F L   GF +I + V Y  + + L     G++  ++S +FV ++Y
Sbjct: 621 LYYVFFILNIRGFSSIFISVCYGALFNTLCGCAMGSIASLTSHFFVEKLY 670

>NCAS0A14520 Chr1 complement(2860704..2862716) [2013 bp, 670 aa]
           {ON} Anc_7.411 YER113C
          Length = 670

 Score = 93.2 bits (230), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 77/250 (30%), Positives = 114/250 (45%), Gaps = 23/250 (9%)

Query: 448 EYWKVNMILTPILVPGLLFCVVLGLNFFLIMVESAGAIPFGTMCAIVLLWFVFSIPLSLA 507
            Y+ V  +L   L+P  +  V L LN  +   +S  A+PFGT+  ++ ++FV  IPLSL 
Sbjct: 418 RYYPVFALLCGSLLPSFVMLVALLLNSIVWAHDSTHALPFGTVLFLISVYFVVCIPLSLL 477

Query: 508 GSLIAKKKCRWNEHPTKTRQIP---------RQIPFQPWYLKTAP----AALIAGIFPFG 554
           G  IA K    N  P+ +  I          + I   P  L   P    A L  G+FPF 
Sbjct: 478 GGYIAVKST--NSKPSFSFSIGNYSDRIFVYKTITMSPSVLINRPLSSLAILAGGLFPFI 535

Query: 555 SIAVELYFVYSSLWFNKI----FYMFGXXXXXXXXXXXXXXXXXXXXXXXXXCLENW-KW 609
            I VEL +VY SLW  K     FY F                            +N   W
Sbjct: 536 IIYVELQYVYKSLWLEKTTFYYFYGFLLANILLLCIVICEISIIGTFILLNSADKNSNNW 595

Query: 610 QWRGFWIGGAGCALYVFLHAILFTKFKLG--GFVTIVLYVGYSLVISLLTCLITGAVGFM 667
           +W  F I GA CA Y+ ++++ +  F L   GF +I + V Y  + +++    TG++  +
Sbjct: 596 RWTSFQI-GASCAFYMEVYSLYYVFFILNIRGFSSIFISVCYGTLFNIMCGCATGSIACL 654

Query: 668 SSLWFVRRIY 677
           +S WFV++IY
Sbjct: 655 TSHWFVQKIY 664

 Score = 68.9 bits (167), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 48/159 (30%), Positives = 67/159 (42%), Gaps = 20/159 (12%)

Query: 27  PTTYHEGDSIPLLVNHLTPSMYFKHVDDDGKDTGDRESFLYSYDYYYDKFHFCKPEKLEK 86
           P  Y +GD + L+VN               K   D     Y+Y   YD    C P   +K
Sbjct: 44  PNYYSKGDPVELIVN---------------KVESDLTQLPYAY---YDLPFTCPPTMHKK 85

Query: 87  QRE-SLGSIIFGDRIYNSPFKLEMLKDKECEALCSSKIPANDAKFINKLIANGFFQNWLV 145
               SL  II GDR + S + L   +D +C  LC+ K      K   +L+ NG+   WL+
Sbjct: 86  PLHLSLNEIIRGDRKWQSDYILNFGEDDQCHILCTRKTTKEGMKEAQELVKNGYVVQWLI 145

Query: 146 DG-LPAARKTTDERTKSEFYTPGFELGFIDVGGAKLRMD 183
           D  LPA           ++Y  GF LGF+D    K  ++
Sbjct: 146 DDELPAVTTFISTTDHKKYYASGFPLGFVDPETGKTYLN 184

>KNAG0C03430 Chr3 (674411..676453) [2043 bp, 680 aa] {ON} Anc_7.411
           YER113C
          Length = 680

 Score = 90.5 bits (223), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 70/258 (27%), Positives = 118/258 (45%), Gaps = 39/258 (15%)

Query: 460 LVPGLLFCVVLGLNFFLIMVESAGAIPFGTMCAIVLLWFVFSIPLSLAGSLIAKKK---- 515
           L+PG++    + LN  + +  S   +PF T+  ++ ++F+  IPLS+ G  IA  K    
Sbjct: 420 LLPGMVILTAIILNCIIWLHTSTNVLPFATIMKLLFIYFIVCIPLSVLGGSIAANKDSEE 479

Query: 516 --------------CRWN----EHPTKTRQIPRQIPFQ-PWYLK-------TAPAALIAG 549
                          R N    E      +  R++ ++  W LK       T  + L +G
Sbjct: 480 YSRLRSDSIKRISRTRANKIMDEDQGTDVRTTRKLKYKVRWQLKKMMLDTVTVVSLLASG 539

Query: 550 IFPFGSIAVELYFVYSSLWFNK--IFYMFGXXXXXXXXXXXXXXXXXXXXXXXXXCLENW 607
           IFPF  I VEL FVY S+W+ K   +Y +G                          + + 
Sbjct: 540 IFPFIMIYVELQFVYKSVWYEKTTFYYYYGFLLANIILLCLVICDIAIICSYLMMTVSSK 599

Query: 608 ----KWQWRGFWIGGAGCALYVFLHAI--LFTKFKLGGFVTIVLYVGYSLVISLLTCLIT 661
                W+W+ F +  + CA Y+  ++I  +F    +  F +I++ V YSL+ + L  L  
Sbjct: 600 DNSDSWKWKTFQLSSS-CAWYMEAYSIYYVFKVLNMRDFSSILISVCYSLLFNALCGLAM 658

Query: 662 GAVGFMSSLWFVRRIYSS 679
           G++G+++SLWFV+R+Y S
Sbjct: 659 GSIGYLASLWFVKRVYRS 676

 Score = 72.8 bits (177), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 53/182 (29%), Positives = 77/182 (42%), Gaps = 26/182 (14%)

Query: 25  VAPTTYHEGDSIPLLVNHLTPSMYFKHVDDDGKDTGDRESFLYSYDYYYDKFHFCKPEKL 84
           + PT Y  GD + ++VN               K   D     Y Y   YD    C P   
Sbjct: 33  LTPTIYRHGDPVEIIVN---------------KIESDATQLPYGY---YDLPFTCPPTVD 74

Query: 85  EKQRE-SLGSIIFGDRIYNSPFKLEMLKDKECEALCSSKIPANDAKFINKLIANGFFQNW 143
           +K    SL  +I GDR + S ++LE  KD EC  LC+ K   +  + ++K I   +   W
Sbjct: 75  KKPLHLSLNEVIRGDRKWQSNYELEFGKDTECTVLCARKTNPDGMRSLDKFIKQEYVVQW 134

Query: 144 LVDG-LPAARKTTDERTKSEFYTPGFELGFIDVGGAKLRMDGQGEEDAHPKGATKPVAQD 202
            +D  LPAA        + ++Y  GF LGF+D    K+ ++       H     +  A D
Sbjct: 135 FIDKELPAATTFISTVDQKKYYGSGFPLGFVDEETGKVYVNN------HVMMVIRYHAID 188

Query: 203 DY 204
           DY
Sbjct: 189 DY 190

>ZYRO0B03784g Chr2 complement(314902..316878) [1977 bp, 658 aa] {ON}
           similar to uniprot|P40071 Saccharomyces cerevisiae
           YER113C Hypothetical ORF
          Length = 658

 Score = 87.4 bits (215), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 70/257 (27%), Positives = 121/257 (47%), Gaps = 20/257 (7%)

Query: 438 SMATYKFFGGEYWKVNMILTPILVPGLLFCVVLGLNFFLIMVESAGAIPFGTMCAIVLLW 497
           +++ Y F+      V  +L    +PG +  + L LN  + + +S  A+PFGTM   V  +
Sbjct: 402 NISAYTFYN----PVFAVLCGSALPGSIMVLTLSLNCIIWIWDSTKALPFGTMVVFVSWY 457

Query: 498 FVFSIPLSLAGSLIAKKKCRWNEH---PTKT---RQIPRQIPFQPWYLKTAPAALIAGIF 551
           FV  I +SL G  +A +  R   H   P  T   R++ R+       L    A LI+G  
Sbjct: 458 FVVCIVVSLLGGAVAAQMHRSVRHDAPPATTASDRKVLRRSRAISGKLVVFLAGLISGFL 517

Query: 552 PFGSIAVELYFVYSSLWFNK--IFYMFGXXXXXXXXXXXXXXXXXXXXXXXXXCLE---- 605
           PF  I VEL ++Y S+W  K  ++Y++                           L     
Sbjct: 518 PFVIIYVELEYLYKSVWLEKTTLYYLYSFLFANVLLLCIVVCEISLLGCLVLMKLNHKFI 577

Query: 606 -NWKWQWRGFWIGGAGCALYVFLHAILFTKF--KLGGFVTIVLYVGYSLVISLLTCLITG 662
            +  W+WR F I   GC+ Y+ ++++ +  F   + G   + + V YS + ++L  L TG
Sbjct: 578 NDQNWRWRCFVIS-TGCSWYMEIYSLYYIFFIIHMTGDSAVFISVCYSFIFNVLCGLATG 636

Query: 663 AVGFMSSLWFVRRIYSS 679
           ++G+++S WFV++I+ +
Sbjct: 637 SLGYLTSSWFVKKIHRT 653

 Score = 68.6 bits (166), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 65/237 (27%), Positives = 97/237 (40%), Gaps = 36/237 (15%)

Query: 27  PTTYHEGDSIPLLVNHLTPSMYFKHVDDDGKDTGDRESFLYSYDY-YYDKFHFCKPEKLE 85
           P  Y  GD + L+VN +                   ES +    + YYD    C P   +
Sbjct: 43  PNVYSIGDPLELVVNTV-------------------ESEITDIPFGYYDLPFTCPPTPEK 83

Query: 86  KQRE-SLGSIIFGDRIYNSPFKLEMLKDKECEALCSSKIPANDAKFINKLIANGFFQNWL 144
           K    SL  II GDR + S +KL + +D  CE LC+ K      +    LI +G+   W+
Sbjct: 84  KPLHLSLNEIIKGDRKWESDYKLVVGQDNPCEILCARKTTREGLQTAKDLIKSGYMVQWM 143

Query: 145 V-DGLPAARKTTDERTKSEFYTPGFELGFIDVGGAK----------LRMDGQGEEDAHPK 193
           + D LPAA          ++Y PGF LG +D   ++          +R +    +     
Sbjct: 144 IDDDLPAATTYISTTDNLKYYAPGFPLGSVDPRSSRVFFNNHVMLVIRYNLVDSDKVTIV 203

Query: 194 G-ATKPVAQDDYLDRPSKSKNEKRKKIVDP--KELVKQLETAYFANHFNIEVQYHDR 247
           G    P +  DY   P  SK+ K  +I DP  +E+V    T       + E+ + DR
Sbjct: 204 GFEAYPKSVSDY-HCPGASKDFKPFEITDPPLEEIVYIPVTYSVYWREDAEIDWSDR 259

>TDEL0C02710 Chr3 complement(474759..476795) [2037 bp, 678 aa] {ON}
           Anc_7.411 YER113C
          Length = 678

 Score = 81.6 bits (200), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 64/250 (25%), Positives = 110/250 (44%), Gaps = 28/250 (11%)

Query: 455 ILTPILVPGLLFCVVLGLNFFLIMVESAGAIPFGTMCAIVLLWFVFSIPLSLAGSLIAKK 514
           IL    +PGL+      LN+ +   ES+ A+PF T+   V ++FV  IPLSL G  ++ +
Sbjct: 427 ILCGSALPGLVMISTQMLNWIVWANESSHALPFRTIVLFVSIYFVICIPLSLLGEEVSHR 486

Query: 515 KCRWNEH--PTKTRQIPRQIPFQPWYLKTAPAAL------------IAGIFPFGSIAVEL 560
             R      P  +    R I         AP  +            I G  PF  I VEL
Sbjct: 487 VHRKQAQNFPILSSLGARSIKPCRAPTTLAPRKISERLTFDFATFAICGFLPFAVIYVEL 546

Query: 561 YFVYSSLWFNK--IFYMFGXXXXXXXXXXXXXXXX-------XXXXXXXXXCLENWKWQW 611
            ++Y S+W  K   +Y++G                                  ++W+W+ 
Sbjct: 547 QYIYKSVWLEKTDFYYLYGFLLANIILLCIVVCEVSFLGCYVMMRKHKRVATFDSWRWK- 605

Query: 612 RGFWIGGAGCALYVFLHAI--LFTKFKLGGFVTIVLYVGYSLVISLLTCLITGAVGFMSS 669
              ++ G  CA Y+ L+++  +F   K+ GF +I + V YSL+ +++     G++G+++S
Sbjct: 606 --CFMMGTSCAWYMELYSLYYIFHTLKMTGFPSIFISVSYSLIFNIMCGCGMGSLGYLTS 663

Query: 670 LWFVRRIYSS 679
            W V R++ +
Sbjct: 664 CWLVNRVFCT 673

 Score = 75.5 bits (184), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 52/161 (32%), Positives = 71/161 (44%), Gaps = 20/161 (12%)

Query: 25  VAPTTYHEGDSIPLLVNHLTPSMYFKHVDDDGKDTGDRESFLYSYDYYYDKFHFCKPEKL 84
           + P  Y  GD + LLVN               K   D   F Y Y   YD    C P + 
Sbjct: 41  LQPNVYRWGDHVELLVN---------------KVESDLTQFPYGY---YDLPFTCPPTED 82

Query: 85  EKQRE-SLGSIIFGDRIYNSPFKLEMLKDKECEALCSSKIPANDAKFINKLIANGFFQNW 143
           +K    SL  II GDR + S +KL+  +D  CEALC+ K      +   +L+  G+   W
Sbjct: 83  KKPLHLSLNEIIRGDRKWESDYKLKFGQDASCEALCARKTKPAGMRRAQELVRQGYVVQW 142

Query: 144 LVDG-LPAARKTTDERTKSEFYTPGFELGFIDVGGAKLRMD 183
           L+D  LPAA          ++Y  GF LGF+D    K  ++
Sbjct: 143 LIDQELPAATTFISTIDHKKYYVSGFPLGFVDPDTEKTYLN 183

>YER113C Chr5 complement(387932..390052) [2121 bp, 706 aa] {ON}
           TMN3Protein with a role in cellular adhesion and
           filamentous growth; similar to Emp70p and Tmn2p; member
           of Transmembrane Nine family with 9 transmembrane
           segments; localizes to Golgi; induced by
           8-methoxypsoralen plus UVA irradiation
          Length = 706

 Score = 80.1 bits (196), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 62/239 (25%), Positives = 108/239 (45%), Gaps = 26/239 (10%)

Query: 461 VPGLLFCVVLGLNFFLIMVESAGAIPFGTMCAIVLLWFVFSIPLSLAGSLIAKK---KCR 517
           +PG++      LN  +   +S  A+PF T+   + ++F+  IPLSL G ++A        
Sbjct: 466 LPGIVMVSTFLLNSIVWAHDSTSALPFKTIVFFMSIYFIVCIPLSLFGGIVANNIPLPQY 525

Query: 518 WNEHPTKTRQ--------IPR-QIPFQPWYLKTAPAALIAGIFPFGSIAVELYFVYSSLW 568
           W    TK           +P+ +  F P          + GIFP   I VE+ +VY SLW
Sbjct: 526 WLSGITKDESNSDGNGLFVPKSRAKFNPL---VYCGIYLCGIFPLLVIYVEMQYVYKSLW 582

Query: 569 FNKI----FYMFGXXXXXXXXXXXXXXXXXXXXXXXXXCLENW----KWQWRGFWIGGAG 620
             K     FY F                          C E+      W+W+ F +G +G
Sbjct: 583 LEKTTFYYFYGFLFLSIILLCVLTMEISIIGSYLLMRFCFEDKVVRNNWRWKCFEMGFSG 642

Query: 621 CALYVFLHAI--LFTKFKLGGFVTIVLYVGYSLVISLLTCLITGAVGFMSSLWFVRRIY 677
             +Y+ L+++  +F    + GF +I++ + YSL+ +++  L  GA+ ++++ WF+ +IY
Sbjct: 643 -GVYMELYSLYYIFAVLNIHGFSSILISICYSLIFNVMCSLGLGALSYLTASWFINKIY 700

 Score = 79.3 bits (194), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 62/214 (28%), Positives = 90/214 (42%), Gaps = 34/214 (15%)

Query: 25  VAPTTYHEGDSIPLLVNHLTPSMYFKHVDDDGKDTGDRESFLYSYDYYYDKFHFCKPEKL 84
           + P  Y +GD + L+VN +                   ES L    Y Y    F  P  +
Sbjct: 52  ITPNFYRKGDPLELIVNKV-------------------ESDLTQLPYAYYDLPFTCPPTM 92

Query: 85  EKQ--RESLGSIIFGDRIYNSPFKLEMLKDKECEALCSSKIPANDAKFINKLIANGFFQN 142
            K+    SL  II GDR + S +KL+  +D  CE LC+ K      + ++KL+  G+   
Sbjct: 93  HKKPLHLSLNEIIRGDRKWESDYKLKFGEDNPCETLCARKTTKEGMQTLDKLVREGYVVQ 152

Query: 143 WLVDG-LPAARKTTDERTKSEFYTPGFELGFIDVGGAK----------LRMDGQGEEDAH 191
           WL+D  LPAA          ++Y  GF LGFID    K          +R      +   
Sbjct: 153 WLIDDELPAATTFISTTDHKKYYASGFPLGFIDPDTDKTYLHNHVMLVIRFHASDNDKNT 212

Query: 192 PKG-ATKPVAQDDYLDRPSKSKNEKRKKIVDPKE 224
             G    P +  DY   P  SKN ++ +IV P++
Sbjct: 213 IVGFEVYPRSVSDY-HCPGASKNYEQYEIVIPED 245

>Skud_5.266 Chr5 (431486..433609) [2124 bp, 707 aa] {ON} YER113C
           (REAL)
          Length = 707

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 62/214 (28%), Positives = 91/214 (42%), Gaps = 34/214 (15%)

Query: 25  VAPTTYHEGDSIPLLVNHLTPSMYFKHVDDDGKDTGDRESFLYSYDYYYDKFHFCKPEKL 84
           + P  Y + D + L+VN +                   ES L    Y Y    F  P  +
Sbjct: 53  ITPNFYKKNDFLELIVNKV-------------------ESDLTQLPYAYYDLPFTCPPTM 93

Query: 85  EKQ--RESLGSIIFGDRIYNSPFKLEMLKDKECEALCSSKIPANDAKFINKLIANGFFQN 142
            K+    SL  II GDR + S +KL   +D  CE LC+ K      + ++KL+  G+   
Sbjct: 94  HKKPLHLSLNEIIRGDRKWESDYKLRFGEDNACETLCARKTDKKGMQTLDKLVREGYVVQ 153

Query: 143 WLVDG-LPAARKTTDERTKSEFYTPGFELGFIDVGGAK----------LRMDGQGEEDAH 191
           WL+D  LPAA          ++Y  GF LGF+D    K          +R  G G++   
Sbjct: 154 WLIDDELPAATTFISTTDHKKYYASGFPLGFVDPDTDKTYLHNHVILVIRFHGGGDDKNT 213

Query: 192 PKG-ATKPVAQDDYLDRPSKSKNEKRKKIVDPKE 224
             G    P +  DY   P  SKN ++ +IV P++
Sbjct: 214 VVGFEVYPKSVSDY-HCPGASKNYEQYEIVVPED 246

 Score = 74.3 bits (181), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 63/239 (26%), Positives = 108/239 (45%), Gaps = 26/239 (10%)

Query: 461 VPGLLFCVVLGLNFFLIMVESAGAIPFGTMCAIVLLWFVFSIPLSLAGSLIAKK------ 514
           +PG++      LN  +   +S  A+PF T+   + ++FV  IPLSL G ++A        
Sbjct: 467 LPGMVMIGTFLLNSVVGAHDSTNALPFRTIVFFISIYFVVCIPLSLFGGIVANNIPLPKY 526

Query: 515 ------KCRWNEHPTKTRQIPRQIPFQPWYLKTAPAALIAGIFPFGSIAVELYFVYSSLW 568
                 K   + + +K  +   +  F P          + GIFP   I VE+ +VY SLW
Sbjct: 527 WLSGITKDETDGNGSKLFKPKSRTRFNPL---VHCGVYLCGIFPLLVIYVEMQYVYKSLW 583

Query: 569 FNKI----FYMFGXXXXXXXXXXXXXXXXXXXXXXXXXCLENWK----WQWRGFWIGGAG 620
             K     FY F                          C ++ +    W+WR F +G +G
Sbjct: 584 LEKTTFYFFYGFLFLSIILLCVLTMEISIIGSYLLMRFCFDDKEVRNNWRWRCFEMGFSG 643

Query: 621 CALYVFLHAI--LFTKFKLGGFVTIVLYVGYSLVISLLTCLITGAVGFMSSLWFVRRIY 677
             +Y+ L+++  +F    + GF +I++ + YSL+ ++L  L  GA+  +++ WF+ RIY
Sbjct: 644 -GVYMELYSLYYIFVVLNIHGFSSILISICYSLLFNILCGLGLGALSCLTASWFINRIY 701

>KLLA0E20835g Chr5 complement(1857426..1859456) [2031 bp, 676 aa]
           {ON} similar to uniprot|P40071 Saccharomyces cerevisiae
           YER113C Hypothetical ORF
          Length = 676

 Score = 78.6 bits (192), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 72/284 (25%), Positives = 122/284 (42%), Gaps = 43/284 (15%)

Query: 434 GSYTSMATYKFFGGEYWK---VNMILTPILVPGLLFCVVLGLNFFLIMVESAGAIPFGTM 490
           GS+TS        G+  +   VN I+    +PG+   +VL LN+ L    +A  +P GT+
Sbjct: 388 GSFTSSFIGALLEGQMSQHKLVNSIIFGSTLPGITLVIVLLLNYILKANNAANTLPHGTV 447

Query: 491 CAIVLLWFVFSIPLSLAGSLIAKKKCR---------------WNEHPTKTRQIPRQIPFQ 535
             +   +F+  +P+S+ G   A +  +                N+H T+   +  +    
Sbjct: 448 ALLFGAYFIVCVPISIIGGKCADRFLKVNSTNTLLNSFALAEVNKHDTRPLYVESKNSI- 506

Query: 536 PWYLKTAPA-ALIAGIFPFGSIAVELYFVYSSLWFNK--IFYMFGXXXXXXXXXXXXXXX 592
           P+ LK   A  L  G+ PF  I VEL F Y SLW  K  ++Y++G               
Sbjct: 507 PFVLKNPIAITLTFGLIPFALIYVELLFAYKSLWLQKTTLYYLYGFLLSNIVIVCICICL 566

Query: 593 XXXXXXXXXXCLEN------W------------KWQWRGFWIGGAGCALYVFLHAILFTK 634
                        N      W             W+W+ F +GGA  A Y+  ++IL+  
Sbjct: 567 LSIIGCYIHLNYGNDSLNFKWDNVIGRVLEACHSWRWKAFHMGGA-VAWYMEAYSILYLI 625

Query: 635 F--KLGGFVTIVLYVGYSLVISLLTCLITGAVGFMSSLWFVRRI 676
           F  +   F++  L+V YS + ++L     G++ ++SSLWF+ ++
Sbjct: 626 FVARYRDFISSFLFVCYSTLFNILCWTAFGSLSYLSSLWFIGKL 669

 Score = 62.0 bits (149), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 65/298 (21%), Positives = 108/298 (36%), Gaps = 83/298 (27%)

Query: 25  VAPTTYHEGDSIPLLVNHLTPSMYFKHVDDDGKDTGDRESFLYSYDYYYDKFHF-CKPEK 83
           ++P  Y  GD + + VN +                   ES L  + Y Y   HF C P +
Sbjct: 57  LSPNFYEYGDKVDITVNKV-------------------ESDLTHFSYGYYDLHFTCPPSQ 97

Query: 84  -LEKQRESLGSIIFGDRIYNSPFKLEMLKDKECEALCSSKIPANDAKFINKLIANGFFQN 142
            ++    +   I++G++ + S ++L   KD++C  LC  K      K   +LI   +   
Sbjct: 98  DMKPLPLTFSDILYGNKKWQSDYQLTFGKDEDCVRLCDRKTNGEGKKQAYELIKQNYVVQ 157

Query: 143 WLV-DGLPAARKTTDERTKSEFYTPGFELGFIDVGGAKLRMDGQGEEDAHPKGATKPVAQ 201
           WL  D LP A    + + K ++Y+ GF LG         + D + +E             
Sbjct: 158 WLADDDLPGATTYLNTKDKKKYYSSGFPLG---------QYDPETDE------------- 195

Query: 202 DDYLDRPSKSKNEKRKKIVDPKELVKQLETAYFANHFNIEVQYHDRGNGDYRVVGVIVNP 261
                                         AY  NH  I ++YH    G   +VG  V P
Sbjct: 196 ------------------------------AYINNHVMIVIRYHTIDQGKNTIVGFEVYP 225

Query: 262 QSIKRDSSNSCAATGXXXXXXXXXXTT-----VHFSYSVKFTPSDTV-WATRWDKYLH 313
           +S+   S + C              T      + F+Y+V +     V W  RW+ +++
Sbjct: 226 KSV---SDHHCPGASKDYTPYKIDPTNEDIEFISFTYAVYWREDFKVDWKNRWNFFIN 280

>Smik_5.258 Chr5 complement(396781..398901) [2121 bp, 706 aa] {ON}
           YER113C (REAL)
          Length = 706

 Score = 77.8 bits (190), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 62/245 (25%), Positives = 113/245 (46%), Gaps = 27/245 (11%)

Query: 461 VPGLLFCVVLGLNFFLIMVESAGAIPFGTMCAIVLLWFVFSIPLSLAGSLIAKK------ 514
           +PG++      LN  +   +S  A+PF T+   + ++F+  IPLSL G ++A        
Sbjct: 466 LPGMIMISTFLLNSIVWAHDSTNALPFKTIVFFISVYFIVCIPLSLFGGIVANNIPLPQY 525

Query: 515 ---KCRWNEHPTKTRQ--IPRQ-IPFQPWYLKTAPAALIAGIFPFGSIAVELYFVYSSLW 568
                  +E  +K  +  +P+    F P          + G+FP   I VE+ +VY SLW
Sbjct: 526 WLSGITIDESDSKNNKLFLPKSPNKFNPL---VNCGIYLCGVFPLLVIYVEMQYVYKSLW 582

Query: 569 FNKI----FYMFGXXXXXXXXXXXXXXXXXXXXXXXXXCLENW----KWQWRGFWIGGAG 620
             K     FY F                          C E+      W+W+ F +G +G
Sbjct: 583 LEKTTFYYFYGFLFLSIILLCVLTMEISVIGSYLLMRFCFEDKVVRNNWRWKCFEMGFSG 642

Query: 621 CALYVFLHAI--LFTKFKLGGFVTIVLYVGYSLVISLLTCLITGAVGFMSSLWFVRRIYS 678
             +Y+ L+++  +F    + GF +I++ + YSL+ +++  L  GA+ ++++ WF+ +IY 
Sbjct: 643 -GVYMELYSLYYIFAVLNIHGFSSILISICYSLLFNIMCGLGLGALSYLTASWFINKIY- 700

Query: 679 SIKVD 683
            +KV+
Sbjct: 701 HVKVN 705

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 73/297 (24%), Positives = 104/297 (35%), Gaps = 79/297 (26%)

Query: 25  VAPTTYHEGDSIPLLVNHLTPSMYFKHVDDDGKDTGDRESFLYSYDYYYDKFHFCKPEKL 84
           + P  Y  GD + L+VN +                   ES L    Y Y    F  P  +
Sbjct: 52  ITPNFYKNGDPLELIVNKV-------------------ESDLTQLPYAYYDLPFTCPPTM 92

Query: 85  EKQ--RESLGSIIFGDRIYNSPFKLEMLKDKECEALCSSKIPANDAKFINKLIANGFFQN 142
            K     SL  II GDR + S +KL   +D  CE LC+ K      + ++KLI  G+   
Sbjct: 93  HKTPLHLSLNEIIRGDRKWESDYKLTFGEDNPCEVLCARKTTKEGMQTLDKLIREGYVVQ 152

Query: 143 WLVDG-LPAARKTTDERTKSEFYTPGFELGFIDVGGAKLRMDGQGEEDAHPKGATKPVAQ 201
           WL+D  LPAA          ++Y  GF LGF+D    K                      
Sbjct: 153 WLIDDELPAATTFISTTDHKKYYASGFPLGFMDPDTGK---------------------- 190

Query: 202 DDYLDRPSKSKNEKRKKIVDPKELVKQLETAYFANHFNIEVQYHDRGNGDYRVVGVIVNP 261
                                          Y  NH  + +++H   NG   +VG  V P
Sbjct: 191 ------------------------------TYLHNHVMLVIRFHSGDNGKNTIVGFEVYP 220

Query: 262 QSIKR----DSSNSCAATGXXXXXXXXXXTTVHFSYSVKFTPSDTV-WATRWDKYLH 313
           +S+       +S +               T + F+YSV +     V W  RWD +L+
Sbjct: 221 RSVSDYHCPGASKTYEQYEITIPEDENELTYLPFTYSVYWREEFEVDWNHRWDYFLN 277

>Suva_5.234 Chr5 complement(363605..365725) [2121 bp, 706 aa] {ON}
           YER113C (REAL)
          Length = 706

 Score = 77.0 bits (188), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 58/214 (27%), Positives = 89/214 (41%), Gaps = 34/214 (15%)

Query: 25  VAPTTYHEGDSIPLLVNHLTPSMYFKHVDDDGKDTGDRESFLYSYDYYYDKFHFCKPEKL 84
           + P  Y +GD + L+VN +                   ES L    Y Y    F  P  +
Sbjct: 52  ITPNFYKKGDPLELIVNKV-------------------ESDLTQLPYAYYDLPFTCPPTM 92

Query: 85  EKQ--RESLGSIIFGDRIYNSPFKLEMLKDKECEALCSSKIPANDAKFINKLIANGFFQN 142
            K+    SL  II GDR + S + L   +D  C+ LC+ K      + ++KL+  G+   
Sbjct: 93  HKKPLHLSLNEIIRGDRKWESDYILAFGEDNACQTLCARKTTKEGMQSLDKLVREGYVVQ 152

Query: 143 WLVDG-LPAARKTTDERTKSEFYTPGFELGFIDVGGAKLRM-----------DGQGEEDA 190
           WL+D  LPAA          ++Y  GF LGF+D    K  +            G  +++ 
Sbjct: 153 WLIDDKLPAATTFISTTDHKKYYASGFPLGFVDPDTGKTYLHNHVMLVIRFHSGDNDQNT 212

Query: 191 HPKGATKPVAQDDYLDRPSKSKNEKRKKIVDPKE 224
                  P +  DY   P  SKN ++ +IV P++
Sbjct: 213 IVGFEVYPRSVSDY-HCPGASKNYEQYEIVVPED 245

 Score = 75.5 bits (184), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 63/241 (26%), Positives = 107/241 (44%), Gaps = 26/241 (10%)

Query: 461 VPGLLFCVVLGLNFFLIMVESAGAIPFGTMCAIVLLWFVFSIPLSLAGSLIAKK---KCR 517
           +PGL+      LN  +   +S  A+PF T+   + ++F+  IPLSL G  +A        
Sbjct: 466 LPGLVMVSTFLLNSIVWAHDSTNALPFRTIVFFISVYFIVCIPLSLFGGTVANNIPLPRH 525

Query: 518 WNEHPTKTRQ--------IPR-QIPFQPWYLKTAPAALIAGIFPFGSIAVELYFVYSSLW 568
           W    TK           +PR +  F P          + G+FPF  I VEL +VY S+W
Sbjct: 526 WLSGITKDETCGNSSRLFVPRSRTKFNPL---VYCGIYLCGLFPFLVIYVELQYVYKSVW 582

Query: 569 FNKI----FYMFGXXXXXXXXXXXXXXXXXXXXXXXXXCLENW----KWQWRGFWIGGAG 620
             K     FY F                          C E+      W+W+ F +G +G
Sbjct: 583 LEKTTFYYFYGFLLLNIILLCVLTMEISIIGSYSLMRFCFEDKDVRNNWRWKCFEMGFSG 642

Query: 621 CALYVFLHAI--LFTKFKLGGFVTIVLYVGYSLVISLLTCLITGAVGFMSSLWFVRRIYS 678
             +Y+ L+++  +F    + GF + ++ + YSL+ +++  L  G + ++++ WF+ +IY 
Sbjct: 643 -GVYMELYSLYYIFAVLNIHGFSSTLISICYSLLFNIMCGLGLGGLSYLTASWFINKIYH 701

Query: 679 S 679
           S
Sbjct: 702 S 702

>KLTH0C06226g Chr3 (541022..543106) [2085 bp, 694 aa] {ON} similar
           to uniprot|P40071 Saccharomyces cerevisiae YER113C
           Hypothetical ORF
          Length = 694

 Score = 75.1 bits (183), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 49/153 (32%), Positives = 71/153 (46%), Gaps = 22/153 (14%)

Query: 25  VAPTTYHEGDSIPLLVNHLTPSMYFKHVDDDGKDTGDRESFLYSYDY-YYDKFHFCKPEK 83
           + P  Y  GD + L VN +                   ES + +  Y YYD    C P +
Sbjct: 44  IKPNVYKRGDKVDLTVNKV-------------------ESEITNLPYGYYDLRFVCPPSE 84

Query: 84  LEKQRE-SLGSIIFGDRIYNSPFKLEMLKDKECEALCSSKIPANDAKFINKLIANGFFQN 142
            +K    SL  +I GDR + S + LE    ++CE LC  K   +  +  ++LI   +  +
Sbjct: 85  TKKPLHLSLDEVIRGDRKWESDYNLEFGVGQDCERLCDRKTMPDGLRQADRLIRENYMVH 144

Query: 143 WLVDG-LPAARKTTDERTKSEFYTPGFELGFID 174
           WL+DG LPAA      R+  +FYT GF LG +D
Sbjct: 145 WLIDGDLPAATTFASTRSGKKFYTAGFPLGRVD 177

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 50/112 (44%), Gaps = 20/112 (17%)

Query: 480 ESAGAIPFGTMCAIVLLWFVFSIPLSLAGSLIAKK--KCRWNEHPTKTRQIP----RQIP 533
           +S+ A+PFGT+ A++  +FV  +PLS  G   A+K      N    +  ++P      I 
Sbjct: 423 DSSAALPFGTLLALLTSYFVICLPLSFLGGFSARKLRSAPANGLNYEQSKVPFSFLLSIE 482

Query: 534 FQPWYL------KTAPAAL--------IAGIFPFGSIAVELYFVYSSLWFNK 571
           +  + L      K  PA L        + G  PF     EL FVY SLW  K
Sbjct: 483 YHEYNLLPAGQEKEIPAILSNPFLLTIVTGFPPFVVTCTELLFVYRSLWLQK 534

 Score = 42.0 bits (97), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 41/68 (60%), Gaps = 3/68 (4%)

Query: 608 KWQWRGFWIGGAGCALYVFLHAILFTKF--KLGGFVTIVLYVGYSLVISLLTCLITGAVG 665
            W+W+ F + GA  A Y  L+++ +  F   L  F +I+L+V Y+ + +L+     GA+G
Sbjct: 618 SWRWKAF-MAGASVAWYFELYSLYYLIFVLHLRDFSSILLFVCYTSLFNLMCWCAFGALG 676

Query: 666 FMSSLWFV 673
           +++ LWF+
Sbjct: 677 YLTCLWFL 684

>SAKL0F12914g Chr6 complement(1013914..1016037) [2124 bp, 707 aa]
           {ON} similar to uniprot|P40071 Saccharomyces cerevisiae
           YER113C Hypothetical ORF
          Length = 707

 Score = 73.9 bits (180), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 48/163 (29%), Positives = 71/163 (43%), Gaps = 20/163 (12%)

Query: 25  VAPTTYHEGDSIPLLVNHLTPSMYFKHVDDDGKDTGDRESFLYSYDYYYDKFHFCKPEKL 84
           + P  Y E D + ++VN               K   D   F Y+Y   Y+    C P  +
Sbjct: 56  IRPNVYEENDPVEIIVN---------------KIESDLTQFPYAY---YELPFTCPPTNV 97

Query: 85  EKQRE-SLGSIIFGDRIYNSPFKLEMLKDKECEALCSSKIPANDAKFINKLIANGFFQNW 143
           +K    SL  II GDR + S + L   KD+ C  LC  K   +  +  ++LI  G+   W
Sbjct: 98  KKPLHLSLNEIIRGDRKWQSDYLLHFKKDEHCLRLCDRKTSPDALRKAHELIKQGYVVQW 157

Query: 144 LVDG-LPAARKTTDERTKSEFYTPGFELGFIDVGGAKLRMDGQ 185
           L+D  LPAA      +   ++Y  GF LGF+D    K  ++  
Sbjct: 158 LIDDELPAATTFISTKDHKKYYASGFPLGFMDKDTGKTYLNNH 200

 Score = 66.6 bits (161), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 48/149 (32%), Positives = 74/149 (49%), Gaps = 37/149 (24%)

Query: 461 VPGLLFCVVLGLNFFLIMVESAGAIPFGTMCAIVLLWFVFSIPLSLAGSLIA---KKKC- 516
           +PG   CVVL LN  +   +S  A+PFGT+  ++ ++F+  IPLS+ G + A   ++KC 
Sbjct: 420 LPGFTLCVVLILNCIIWAKDSTHALPFGTIVLLITVYFIVCIPLSILGGVSATYTRRKCL 479

Query: 517 ----------------RWNEHPTKTRQI--PR-----QIPF---QPWYLKTAPAALIAGI 550
                            +++ P    ++  PR     ++P    QP  L      +I+GI
Sbjct: 480 SLDPRSIINRFFLLNIHYDDQPVVENKVHLPRISGNSKLPLMLRQPVLL-----TVISGI 534

Query: 551 FPFGSIAVELYFVYSSLWFNK--IFYMFG 577
            PF  I VEL FVY SLW  K   +Y++G
Sbjct: 535 VPFIVIYVELLFVYKSLWLEKTTFYYLYG 563

 Score = 48.5 bits (114), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 45/80 (56%), Gaps = 11/80 (13%)

Query: 608 KWQWRGFWIGGA------GCALYVFLHAILFTKFKLGGFVTIVLYVGYSLVISLLTCLIT 661
           +W+W+ F IGG+        +LY FL     T  K+  F +I+L+  YS + + L     
Sbjct: 631 QWRWKSFQIGGSVAWYLEAYSLYYFL-----TVLKIRDFSSILLFFCYSALFNFLCWCSF 685

Query: 662 GAVGFMSSLWFVRRIYSSIK 681
           GA+G++S  WFV RI+++ K
Sbjct: 686 GALGYLSCCWFVNRIHTNSK 705

>CAGL0G03487g Chr7 complement(337133..339247) [2115 bp, 704 aa] {ON}
           similar to uniprot|P40071 Saccharomyces cerevisiae
           YER113c
          Length = 704

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 60/213 (28%), Positives = 86/213 (40%), Gaps = 32/213 (15%)

Query: 25  VAPTTYHEGDSIPLLVNHLTPSMYFKHVDDDGKDTGDRESFLYSYDYYYDKFHFCKPEKL 84
           V P  Y  GD + L+VN               K   D     Y+Y   YD    C P K 
Sbjct: 51  VNPNLYKIGDHVELIVN---------------KVESDLTQLPYAY---YDLPFICPPTKE 92

Query: 85  EKQRE-SLGSIIFGDRIYNSPFKLEMLKDKECEALCSSKIPANDAKFINKLIANGFFQNW 143
           +K    SL  I  GDR + S +KL    D  CE LC+ K          +L+  G+   W
Sbjct: 93  KKPLHLSLDEIFRGDRKWQSDYKLSFGIDSPCEILCARKTKKEGMIKAKELVQQGYVTQW 152

Query: 144 LVD-GLPAARKTTDERTKSEFYTPGFELGFIDVGGAK----------LRMDGQGEEDAHP 192
           L+D  LPAA         +++Y  GF +G++D    K          +R     EE+   
Sbjct: 153 LIDESLPAATTFISSTNHNKYYAAGFPVGYVDDRTGKTFLNNHVMLVIRYHPVSEEEFTI 212

Query: 193 KG-ATKPVAQDDYLDRPSKSKNEKRKKIVDPKE 224
            G    P +  DY   P  +KN  + +I+ P++
Sbjct: 213 VGFEVYPKSVSDY-HCPGANKNHDKYEIIVPEK 244

 Score = 71.6 bits (174), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 68/254 (26%), Positives = 112/254 (44%), Gaps = 36/254 (14%)

Query: 461 VPGLLFCVVLGLNFFLIMVESAGAIPFGTMCAIVLLWFVFSIPLSLAGSLIAKKKCRWNE 520
           +PGLL  +   LN  ++  +S  A+PF T   +V ++FV  IPLSL G ++A   C+ + 
Sbjct: 453 LPGLLMVISFSLNCIILAHDSTNALPFKTEVFLVSIYFVTCIPLSLLGGVLA-LNCKVDS 511

Query: 521 HPTKTR---------------------QIPRQIPFQPWYLK-TAPAALIAGIFPFGSIAV 558
           + T  R                      + +++ F   +   T   AL  G F F  I V
Sbjct: 512 YNTLKRITSLRRNTISRKSRSDFTKKVSLYQRLVFDIKHDSFTTFGALAGGFFSFIIIWV 571

Query: 559 ELYFVYSSLWFNK--IFYMFGXXXXXXXXXXXXXXXXXXXXXXXXXCLENWK-----WQW 611
           EL +VY S+W  K   +Y +G                           +N +     W W
Sbjct: 572 ELQYVYKSVWLEKTSFYYYYGFLLANILILSIVTIEIAIIGCYVMLKAKNDRYLRHTWGW 631

Query: 612 RGFWIGGAGCALYVFLHAILFTKFKLG--GFVTIVLYVGYSLVISLLTCLITGAVGFMSS 669
           + F + G+ CA Y+ L+++ +  F L   GF +I + V YSL+ + +     G++ +++S
Sbjct: 632 KSF-LMGSSCAWYMELYSLYYIFFVLNMQGFSSIFISVCYSLLFNGMCGWALGSLSYLTS 690

Query: 670 LWFVRRIYSSIKVD 683
              V +IY   KVD
Sbjct: 691 YMLVTQIY---KVD 701

>KAFR0K01950 Chr11 complement(401168..403162) [1995 bp, 664 aa] {ON}
           Anc_7.411 YER113C
          Length = 664

 Score = 71.6 bits (174), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 65/244 (26%), Positives = 104/244 (42%), Gaps = 34/244 (13%)

Query: 460 LVPGLLFCVVLGLNFFLIMVESAGAIPFGTMCAIVLLWFVFSIPLSLAGSLIAKKKC--- 516
           L+P ++  + + LN  +    S+ A+P  T+  ++ ++F+  IPLSL G   A   C   
Sbjct: 421 LLPAVIMIITIFLNNIVWAHGSSRALPLKTILFLISIYFIVCIPLSLLGGSYASDICQKR 480

Query: 517 --RWNEHPTKTR------QIPRQI------PFQPWYLKTAPAALIAGIFPFGSIAVELYF 562
             R    P + +       + R I      PF      +   A I G+FPF  I VEL  
Sbjct: 481 TLRAFSSPAQQKLAVTNSNLARTIKSIFDDPF------SGLLASIGGLFPFFIIYVELQH 534

Query: 563 VYSSLWFNKI-------FYMFGXXXXXXXXXXXXXXXXXXXXXXXXXCLENWKWQWRGFW 615
           VY  +W  K        F                              LEN  W+WR F 
Sbjct: 535 VYKFVWLEKASFYYLRWFLFANIIILCIVVVEIAIISAYIMMHSSRSSLEN-SWRWRSFQ 593

Query: 616 IGGAGCALYVFLHAILFTKFKLG--GFVTIVLYVGYSLVISLLTCLITGAVGFMSSLWFV 673
           I  + CA Y+ L+++ +  + L   GF +I+L V  S + + L     G++G++++ WFV
Sbjct: 594 ISSS-CAWYMELYSLYYIFYVLNTTGFSSILLSVCSSALFNGLCGCALGSIGYLATCWFV 652

Query: 674 RRIY 677
            R+Y
Sbjct: 653 GRVY 656

 Score = 71.6 bits (174), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 72/254 (28%), Positives = 98/254 (38%), Gaps = 63/254 (24%)

Query: 20  FYLPGVAPTTYHEGDSIPLL----VNHLTPSMYFKHVDDDGKDTGDRESFLYSYDY-YYD 74
           F+L  V  +T   G  IP++     N LTP++Y K  DD        ES L    Y YYD
Sbjct: 11  FFLLIVTISTIIYGH-IPIIQRHDANRLTPNIYRKG-DDVELIVNKIESDLTKLPYGYYD 68

Query: 75  KFHFCKPEKLEKQ-RESLGSIIFGDRIYNSPFKLEMLKDKECEALCSSKI-PANDAKFIN 132
               C P    K    SL  I+ GDR + S + L   KD +C  LC+ K  P    K IN
Sbjct: 69  LPFICPPTNQRKPLHMSLTEILRGDRKWQSDYSLTFGKDNDCAVLCARKTTPEGIQKAIN 128

Query: 133 KLIANGFFQNWLVDG-LPAARKTTDERTKSEFYTPGFELGFIDVGGAKLRMDGQGEEDAH 191
            L+   +   W +D  LPA+          ++Y PGF LGF                   
Sbjct: 129 -LVKKDYIVQWSIDNDLPASTTFISTSENRKYYIPGFSLGF------------------- 168

Query: 192 PKGATKPVAQDDYLDRPSKSKNEKRKKIVDPKELVKQLETAYFANHFNIEVQYHDRGNGD 251
                                       VDP       ETAY  NH  + ++YH   +  
Sbjct: 169 ----------------------------VDPDT-----ETAYLNNHVMLVIRYHAIDDEH 195

Query: 252 YRVVGVIVNPQSIK 265
           + +VG+ V P+S+ 
Sbjct: 196 FTIVGLEVYPKSVS 209

>Kwal_27.10746 s27 (479237..481309) [2073 bp, 690 aa] {ON} YER113C -
           Hypothetical ORF [contig 33] FULL
          Length = 690

 Score = 71.6 bits (174), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 48/160 (30%), Positives = 69/160 (43%), Gaps = 20/160 (12%)

Query: 25  VAPTTYHEGDSIPLLVNHLTPSMYFKHVDDDGKDTGDRESFLYSYDYYYDKFHFCKPEKL 84
           + P  Y +GD + +++N               K   +   F Y Y   YD    C P   
Sbjct: 40  IKPNVYKKGDKVDVIIN---------------KVVSETARFPYGY---YDLQFVCPPSDK 81

Query: 85  EKQRE-SLGSIIFGDRIYNSPFKLEMLKDKECEALCSSKIPANDAKFINKLIANGFFQNW 143
           +K    SL  II GDR + S + L   +  +C  LC  K      K  + LI  G+  +W
Sbjct: 82  KKPLHLSLNEIIRGDRKWESDYNLAFGERHDCLRLCDRKTKPEGLKQADALIRQGYVAHW 141

Query: 144 LV-DGLPAARKTTDERTKSEFYTPGFELGFIDVGGAKLRM 182
           L+ D LPAA      ++  +FYT GF LG +D    K R+
Sbjct: 142 LIDDDLPAATTFAKTKSGKKFYTAGFPLGEVDAVTGKTRL 181

 Score = 60.1 bits (144), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 46/139 (33%), Positives = 67/139 (48%), Gaps = 22/139 (15%)

Query: 461 VPGLLFCVVLGLNFFLIMVESAGAIPFGTMCAIVLLWFVFSIPLSLAGSLIAKK-KCRWN 519
           +PGL+   VL LN  + + +S+ AIPFGT+   V  +F+ S PLSL G   A+K K    
Sbjct: 400 LPGLVLFTVLVLNGIVWLKDSSSAIPFGTVVVFVAGYFMISFPLSLLGGFSARKMKNAAK 459

Query: 520 EHPTK----------------TRQIPRQIPFQPWYLKTAPAALI---AGIFPFGSIAVEL 560
             P                  TR  P     +P+ +  +   L+   AGI PF  I VEL
Sbjct: 460 LAPANAISKSPFSFLLTLSYDTRSWPATALGKPFPIALSNPILLTILAGIAPFVVICVEL 519

Query: 561 YFVYSSLWFN--KIFYMFG 577
           ++VY S+W      +Y++G
Sbjct: 520 FYVYKSMWLQTTNFYYLYG 538

 Score = 35.8 bits (81), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 40/75 (53%), Gaps = 3/75 (4%)

Query: 609 WQWRGFWIGG--AGCALYVFLHAILFTKFKLGGFVTIVLYVGYSLVISLLTCLITGAVGF 666
           W+W+ F  GG  A       L+ ++F    L    +I+L+V Y+ + + +     GA+G+
Sbjct: 615 WRWKSFVAGGSVAWYLELYSLYYLIFV-LHLRDLSSILLFVCYTALFNFMCWCAFGALGY 673

Query: 667 MSSLWFVRRIYSSIK 681
           +S LWF+  I SS K
Sbjct: 674 LSCLWFLSHISSSSK 688

>Ecym_7143 Chr7 (290555..292585) [2031 bp, 676 aa] {ON} similar to
           Ashbya gossypii AGL295C
          Length = 676

 Score = 65.1 bits (157), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 66/301 (21%), Positives = 105/301 (34%), Gaps = 75/301 (24%)

Query: 25  VAPTTYHEGDSIPLLVNHLTPSMYFKHVDDDGKDTGDRESFLYSYDYYYDKFHFCKPEKL 84
           V P  Y +G+ + +L+N +        V   G+          SY YY  +F  C P K 
Sbjct: 40  VRPRIYQDGEEVEMLLNQV--------VGKPGE---------LSYGYYDLQFT-CTPTKS 81

Query: 85  EKQ-RESLGSIIFGDRIYNSPFKLEMLKDKECEALCSSKIPANDAKFINKLIANGFFQNW 143
            +    SL  +  GDR + S +KL   ++ +C  LC  K   +     + LI   +    
Sbjct: 82  RRMVHHSLYEVFSGDRKWQSDYKLYFNRENKCSTLCFRKTQPSGLIEADSLIRQNYTVQL 141

Query: 144 LVDG-LPAARKTTDERTKSEFYTPGFELGFIDVGGAKLRMDGQGEEDAHPKGATKPVAQD 202
           L+D  +PA++     R    +Y PGF LGF+D                            
Sbjct: 142 LIDEIMPASKTYVSMRDNKRYYVPGFPLGFVD---------------------------- 173

Query: 203 DYLDRPSKSKNEKRKKIVDPKELVKQLETAYFANHFNIEVQYHDRGNGDYRVVGVIVNPQ 262
                                    + +  Y  NHF + ++Y+      Y +VG  V P+
Sbjct: 174 ------------------------PETDVTYLHNHFMLVIRYNAVDINKYTIVGFEVYPK 209

Query: 263 SIKRDSS--NSCAATGXXXXXXXXXXTTVHFSYSVKFTPSDTV-WATRWDKYLHVYDPKI 319
           S+  D    +S                 +  +YSV +     V W  RW+ YL   D  +
Sbjct: 210 SVSDDHCPGSSKDYENYAVNPSEKDVVFIPITYSVYWREEFMVDWENRWNFYLSAGDLDV 269

Query: 320 Q 320
            
Sbjct: 270 N 270

 Score = 53.9 bits (128), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 59/269 (21%), Positives = 108/269 (40%), Gaps = 57/269 (21%)

Query: 461 VPGLLFCVVLGLNFFLIMVESAGAIPFGTMCAIVLLWFVFSIPLSLAGSLIAKKKCRWNE 520
           +P L   V++  N    ++E    +PF  +  ++ L+F+ S+PLSL G   A  K + ++
Sbjct: 404 LPALTVAVLVLANSIAWIIERGKEMPFRDITLLLALYFMVSLPLSLLGGTSASYKLK-DQ 462

Query: 521 H----------------PTK----------TRQIP----RQIPFQPWYLKTAPAALIAGI 550
           H                P+K          TR  P     QIP   W  K      I GI
Sbjct: 463 HFQLYSLSTKYTGTPVSPSKPTFWFNFEYDTRGTPACAHEQIPM--WLSKPFLITSIIGI 520

Query: 551 FPFGSIAVELYFVYSSLWFNK----------IFYMFGXXXXXXXXXXXXXXXXXXXXXXX 600
            PF +I +++ F++  LW +           I  M                         
Sbjct: 521 IPFLAIYLQMEFIWKPLWTHSKSLFQIYVSLIIGMILQSILVMEICILIMYVHMHHGDDS 580

Query: 601 XXCLENW-----------KWQWRGFWIGGAGCALYVFLHAILFTKF--KLGGFVTIVLYV 647
             C ++             W+W+ F++GGA  A Y   +++ +  F  +L  F +I+LY+
Sbjct: 581 ECCFDDTCVTGRISNAVSSWRWKAFYMGGAA-AWYWEAYSLYYMIFILRLRNFGSILLYL 639

Query: 648 GYSLVISLLTCLITGAVGFMSSLWFVRRI 676
            Y  ++++      G++G+++  WF+ ++
Sbjct: 640 SYGTLLNVFYFYSFGSIGYLACCWFLNKL 668

>TBLA0I00330 Chr9 (52200..54341) [2142 bp, 713 aa] {ON} Anc_7.411
           YER113C
          Length = 713

 Score = 60.8 bits (146), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 71/311 (22%), Positives = 96/311 (30%), Gaps = 80/311 (25%)

Query: 25  VAPTTYHEGDSIPLLVNHLTPSMYFKHVDDDGKDTGDRESFLYSYDYYYDKFHFCKPEKL 84
           + P  Y  GD + +  N   P        DD   +            YYD    C P   
Sbjct: 60  IKPNLYKVGDKVQITTNKALP--------DDPAVSQPALC-------YYDLPFVCPPSDT 104

Query: 85  EKQ-RESLGSIIFGDRIYNSPFKLEMLKDKECEALCSSKIPANDAKFINKLIANGFFQNW 143
           ++    SL  +  GD +  S + LE  KD+ C  LCS K      +    LI N +   W
Sbjct: 105 KRPIHNSLTELFNGDYLSESDYILEFAKDEPCHILCSRKTSKKGMQRAYDLIKNDYIVQW 164

Query: 144 LVDG-LPAARKTTDERTKSEFYTPGFELGFIDVGGAKLRMDGQGEEDAHPKGATKPVAQD 202
            VD  LP        +   + Y PGF LG+ D                            
Sbjct: 165 YVDNDLPVGTTYISNKVNKKQYLPGFSLGYFD---------------------------- 196

Query: 203 DYLDRPSKSKNEKRKKIVDPKELVKQLETAYFANHFNIEVQYHDRGNGDYRVVGVIVNPQ 262
                                    Q   AY   H    V+YH   +  + +VG+ V P+
Sbjct: 197 ------------------------NQTGQAYLNTHLMFVVRYHAVTSDTFTIVGLEVYPR 232

Query: 263 SIKR----DSSNSCAATGXXXXXXXXXXTTVHFSYSVKFTPS-DTVWATRWDKY------ 311
           SI       +S                 T + FSYSV +    D  W  RWD +      
Sbjct: 233 SIVDYNCPGASKDFIPLEVKVPENNDDPTYLPFSYSVYWREEFDLPWNQRWDLFKTADEL 292

Query: 312 LHVYDPKIQWY 322
           L   D    WY
Sbjct: 293 LREKDLSFHWY 303

 Score = 34.7 bits (78), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 23/101 (22%), Positives = 47/101 (46%), Gaps = 2/101 (1%)

Query: 425 ILYALFGSLGSYTSMATYKFFGGEYWKVNMILTPILVPGLLFCVVLGLNFFLIMVESAGA 484
           I+    G+L   T + T   F  +Y+  N IL    +P  +   +  +N  + + E   A
Sbjct: 401 IVSVFIGTLIQRTFILTN--FPDKYYLTNPILFGSTLPAFILLSMFIINSIIYLSEKNHA 458

Query: 485 IPFGTMCAIVLLWFVFSIPLSLAGSLIAKKKCRWNEHPTKT 525
            PF         +F+ SIPLS+   +++ +   + ++P+++
Sbjct: 459 FPFKLSMYFFTSYFILSIPLSIISGVLSTRFISFPKYPSRS 499

>AGL295C Chr7 complement(152197..154170) [1974 bp, 657 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER113C
          Length = 657

 Score = 60.5 bits (145), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 40/159 (25%), Positives = 70/159 (44%), Gaps = 20/159 (12%)

Query: 27  PTTYHEGDSIPLLVNHLTPSMYFKHVDDDGKDTGDRESFLYSYDYYYDKFHFCKPEKLEK 86
           P+ Y  G+ + LLV+++                 DRE     + YY   F    P +   
Sbjct: 39  PSAYTRGERVQLLVDNIWT---------------DREV----WGYYETLFTCPPPAEARA 79

Query: 87  QRESLGSIIFGDRIYNSPFKLEMLKDKECEALCSSKIPANDAKFINKLIANGFFQNWLVD 146
              SLG +   +  + S + L +  + +C+ LC  ++  +  + + ++I +G    W +D
Sbjct: 80  IYGSLGQVFRREMPWESNYVLHVRAETQCQPLCMRELRPDSHRRLIQMIRDGAQVRWTLD 139

Query: 147 GLPAARKTTDERTKSEFYTPGFELGFIDVGGAKLRMDGQ 185
           GLPAA  T  +R  S  Y  GF+LG +D     +R+   
Sbjct: 140 GLPAA-TTYPDRQSSYRYEAGFKLGEVDAETGHVRLHNH 177

 Score = 33.5 bits (75), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 64/305 (20%), Positives = 112/305 (36%), Gaps = 72/305 (23%)

Query: 420 TTVMFILYALFGSLGSYTSMATYKFFGGEYWKVNM-----------ILTPILVPGLLFCV 468
           T V  +L A   +LG+Y +     F+G   W               ++    +P LLF  
Sbjct: 349 THVTIVLAATICALGAYLA----AFYGVWTWATTQSVVVHRYIKRSVICGSAIPILLFVT 404

Query: 469 VLGLNFFLIMVESAGAIPFGTMCAIVLLWFVFSIPLSLAGSLIA--------------KK 514
              ++  +++ +    IPF T  A++ L+   S  LS+ G   A                
Sbjct: 405 AAIVHLIVMLSDRTRGIPFATELAVLALYIPASAILSVFGGFTAFSILRTREDRVALLDS 464

Query: 515 KCRW----------NEHPTKTRQIPRQIPFQPWYLKTAPAALIAGIFPF----------- 553
           K +W          NE+ T   ++ R        + +   +L+AG+ PF           
Sbjct: 465 KGKWASATSEQKTTNENSTGRSRLTR--------IASVLYSLLAGVPPFILAKSLVQATY 516

Query: 554 -----GSIAVEL-YFVYSSLWFNKIFYM---FGXXXXXXXXXXXXXXXXXXXXXXXXXCL 604
                   A+EL  F++S+L    +  +    G                          L
Sbjct: 517 STVAVAKSALELDAFIFSALALQCLVVVEVCIGTMLAQIFWSQIFQITGCEYPKPRKGVL 576

Query: 605 ENWKWQWRGFWIGGAGCALYVFLHAILFTKFKLG--GFVTIVLYVGYSLVISLLTCLITG 662
             + W+W+ F +GGA  A Y+  HAI   +      G   I+L + Y+ V+++   L+ G
Sbjct: 577 --YSWRWKLFGVGGAA-AWYLEAHAIHSIRHAYAHLGSPNIILAIFYATVLNIAYWLVFG 633

Query: 663 AVGFM 667
           A G++
Sbjct: 634 AFGYL 638

>TPHA0K00730 Chr11 (150877..153078) [2202 bp, 733 aa] {ON} Anc_7.411
           YER113C
          Length = 733

 Score = 57.0 bits (136), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 43/152 (28%), Positives = 66/152 (43%), Gaps = 13/152 (8%)

Query: 25  VAPTTYHEGDSIPLLVNHLTPSMYFKHVDDDGKDTGDRESFLYSYDYYYDKFHFCKPEKL 84
           V P TY  GD + ++VN +          D   D+ +  S+      Y+D  + C P   
Sbjct: 46  VHPNTYTFGDPVEVIVNKMVQE------KDMLGDSNEGVSY-----KYHDLPYICPPTNT 94

Query: 85  EKQ-RESLGSIIFGDRIYNSPFKLEMLKDKECEALCSSKIPANDAKFINKLIANGFFQNW 143
           +K    SL  +  GD    S + L+   D +C+ALC  K      +   ++I   +  NW
Sbjct: 95  KKSIHNSLKELFNGDYNEQSDYILKFGVDNDCQALCLRKTYNAGIRKAKEMIDEDYIVNW 154

Query: 144 LVDG-LPAARKTTDERTKSEFYTPGFELGFID 174
            +D  LPAA       T+ + Y  GF LG+ D
Sbjct: 155 FIDDYLPAATTYISSVTRKKKYFEGFSLGWKD 186

 Score = 37.4 bits (85), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 30/55 (54%)

Query: 460 LVPGLLFCVVLGLNFFLIMVESAGAIPFGTMCAIVLLWFVFSIPLSLAGSLIAKK 514
           ++PGL    V   N     +E   + PF  +  ++ ++F+FSIP+SL G  +A K
Sbjct: 439 ILPGLTLAGVTVFNTVTWFLEGNSSYPFRKLSWLIFVYFIFSIPMSLIGGSLAVK 493

 Score = 33.9 bits (76), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 25/37 (67%)

Query: 643 IVLYVGYSLVISLLTCLITGAVGFMSSLWFVRRIYSS 679
           ++L +GYSL+ +LL  L  G + +M+S+WF+   + S
Sbjct: 689 LLLSIGYSLLFNLLIGLAAGFISYMASVWFIVNRFKS 725

>Kpol_1045.28 s1045 (64235..66280) [2046 bp, 681 aa] {ON}
           (64237..66282) [2046 nt, 682 aa]
          Length = 681

 Score = 54.3 bits (129), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 42/160 (26%), Positives = 65/160 (40%), Gaps = 18/160 (11%)

Query: 25  VAPTTYHEGDSIPLLVNHLTPSMYFKHVDDDGKDTGDRESFLYSYDYYYDKFHFCKPEKL 84
           + P  Y  GD++ LLVN    ++             D + ++Y     +D    C P  +
Sbjct: 47  LQPNVYKVGDNVDLLVNKAISTL-----------NADLKPYIY-----HDLPFVCPPTSV 90

Query: 85  EKQRE-SLGSIIFGDRIYNSPFKLEMLKDKECEALCSSKIPANDAKFINKLIANGFFQNW 143
            K       S+  GD +  S +KL+   D ECE LC+ K   N       +I   +   W
Sbjct: 91  RKPVHLEFDSLFRGDTLSESDYKLKFGDDYECEILCARKTNKNGVSKAIDMIKQDYQILW 150

Query: 144 LVDG-LPAARKTTDERTKSEFYTPGFELGFIDVGGAKLRM 182
            +D  LP +       T+ + Y PGF LG  D    K+ +
Sbjct: 151 SIDDELPISMPYISTITQRKKYIPGFPLGRFDKDKNKVYL 190

 Score = 51.2 bits (121), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 52/259 (20%), Positives = 102/259 (39%), Gaps = 39/259 (15%)

Query: 455 ILTPILVPGLLFCVVLGLNFFLIMVESAGAIPFGTMCAIVLLWFVFSIPLSLAGSLIAKK 514
           IL   L+P LL   V  ++  + ++ES+   PF T+  ++  +++  +P S+ G  +AKK
Sbjct: 426 ILCGSLLPFLLMIFVYPIHSIVWLIESSSRYPFKTLTMMISFFYIICVPFSIIGGGLAKK 485

Query: 515 KCRW--------------NEHPTKTRQIPRQIP--FQPWYLKTAPAALIAGIFPFGSIAV 558
             +               N++  K R   +  P       L T   +LI  I PF  I  
Sbjct: 486 YRKHYKEMFGNITLDNENNDNDEKKRFKAQHRPSSINKNKLGTLVYSLITAIVPFFIIKS 545

Query: 559 ELYFVYSSLWFNKIFYM-------FGXXXXXXXXXXXXXXXXXXXXXXXXXCLENWK--- 608
           ELY+++++ W N   ++                                   +  W+   
Sbjct: 546 ELYWIFTNKWLNYTTFIKSFIFLIIKLFIIIITVSSTSLVGLFVNIMMTKKGISQWRDDP 605

Query: 609 --WQWRGFWIGGAGC------ALYVFLHAILFTKFKLGGFVTIVLYVGYSLVISLLTCLI 660
              +W  F      C      +LY  +  I     ++ GF   VL + Y++ ++++  + 
Sbjct: 606 ISLRWSCFLNSFNICYLTGLYSLYYIIEVI-----RIHGFSMTVLTIFYTIALNVILGIS 660

Query: 661 TGAVGFMSSLWFVRRIYSS 679
            GA+ +M+  W + ++Y +
Sbjct: 661 CGAIAYMTCYWLIIKLYKN 679

>NCAS0B07560 Chr2 complement(1426000..1427477,1427593..1427602)
           [1488 bp, 495 aa] {ON} Anc_1.303 YBR283C
          Length = 495

 Score = 32.3 bits (72), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 27/58 (46%), Gaps = 3/58 (5%)

Query: 516 CRWNEHPTKTRQIPRQIPFQPWYLKTAPAALIAGIF--PFGSIAVELYFVYSSLWFNK 571
           C+   H      I   +P  P  L T P +LI G+F  P   I   L+ V +S+WF K
Sbjct: 328 CKILGHYENVNNI-LAVPTFPLSLLTPPRSLIGGLFSQPLTFIVFTLFIVSTSVWFAK 384

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.141    0.451 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 66,651,365
Number of extensions: 2804587
Number of successful extensions: 9145
Number of sequences better than 10.0: 52
Number of HSP's gapped: 9139
Number of HSP's successfully gapped: 97
Length of query: 683
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 567
Effective length of database: 40,180,143
Effective search space: 22782141081
Effective search space used: 22782141081
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 69 (31.2 bits)