Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_56.232566.69ON56756729060.0
KLTH0G15334g6.69ON58252512221e-162
SAKL0A08206g6.69ON6453822553e-22
ZYRO0E04708gsingletonON6112011198e-06
ZYRO0B01936gsingletonON8241981181e-05
ZYRO0D04158g7.68ON15871421182e-05
TBLA0E021907.101ON10891971153e-05
TPHA0L006007.101ON1117116920.016
ZYRO0A11132gsingletonON698204900.025
Kwal_55.20439singletonOFF7774780.071
KNAG0L004307.68ON1560143860.082
TDEL0H038307.68ON1582137860.085
NDAI0B055205.414ON1009126860.088
AGR274C6.69ON37575820.20
Smik_15.5067.68ON1576142830.22
NCAS0A024504.238ON1928223830.22
Ecym_31196.69ON37881800.32
Kwal_55.204217.186ON1170307810.32
KLLA0C16467g1.150ON607112790.60
Smik_12.224.23ON83786780.67
CAGL0A02596g5.414ON872241771.0
NDAI0E025908.590ON685156761.2
ZYRO0A10516g8.590ON694155751.6
TPHA0E038301.26ON822115751.7
ZYRO0G03630g4.26ON77089751.8
Kwal_47.184705.563ON435161742.0
NDAI0B061903.547ON94753732.7
YHR023W (MYO1)5.267ON1928226733.2
Suva_4.4228.590ON693161723.5
KLTH0G07128g5.267ON1862135724.0
Smik_11.251.506ON104372724.2
Kwal_56.226183.106ON74072724.3
Kpol_316.17.68ON1594139724.3
Kpol_1008.29singletonON538175714.9
SAKL0C10604gna 1ON68952715.7
AGR212W8.590ON697151706.0
ACL132C5.123ON954110698.0
CAGL0B03641g6.16ON988133698.6
NCAS0D015105.94ON90042698.8
Smik_4.6225.414ON944154699.0
KNAG0A034008.590ON690142699.8
NOTE: 6 genes in the same pillar as Kwal_56.23256 were not hit in these BLAST results
LIST: Skud_15.344 Smik_15.362 YOR177C Suva_8.233 TDEL0G04560 TPHA0K01150

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_56.23256
         (567 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_56.23256 s56 complement(468118..469821) [1704 bp, 567 aa] {...  1123   0.0  
KLTH0G15334g Chr7 (1343754..1345502) [1749 bp, 582 aa] {ON} cons...   475   e-162
SAKL0A08206g Chr1 (729465..731402) [1938 bp, 645 aa] {ON} conser...   102   3e-22
ZYRO0E04708g Chr5 complement(354494..356329) [1836 bp, 611 aa] {...    50   8e-06
ZYRO0B01936g Chr2 complement(156676..159150) [2475 bp, 824 aa] {...    50   1e-05
ZYRO0D04158g Chr4 (336740..341503) [4764 bp, 1587 aa] {ON} simil...    50   2e-05
TBLA0E02190 Chr5 complement(534078..537347) [3270 bp, 1089 aa] {...    49   3e-05
TPHA0L00600 Chr12 complement(102317..105670) [3354 bp, 1117 aa] ...    40   0.016
ZYRO0A11132g Chr1 complement(890189..892285) [2097 bp, 698 aa] {...    39   0.025
Kwal_55.20439 s55 complement(402467..402700) [234 bp, 77 aa] {OF...    35   0.071
KNAG0L00430 Chr12 complement(60407..65089) [4683 bp, 1560 aa] {O...    38   0.082
TDEL0H03830 Chr8 (646726..651474) [4749 bp, 1582 aa] {ON} Anc_7....    38   0.085
NDAI0B05520 Chr2 (1351005..1354034) [3030 bp, 1009 aa] {ON} Anc_...    38   0.088
AGR274C Chr7 complement(1252837..1253964) [1128 bp, 375 aa] {ON}...    36   0.20 
Smik_15.506 Chr15 (875291..880021) [4731 bp, 1576 aa] {ON} YOR32...    37   0.22 
NCAS0A02450 Chr1 complement(463760..469546) [5787 bp, 1928 aa] {...    37   0.22 
Ecym_3119 Chr3 (221707..222843) [1137 bp, 378 aa] {ON} similar t...    35   0.32 
Kwal_55.20421 s55 (391382..394894) [3513 bp, 1170 aa] {ON} YFR03...    36   0.32 
KLLA0C16467g Chr3 (1442002..1443825) [1824 bp, 607 aa] {ON} simi...    35   0.60 
Smik_12.22 Chr12 complement(54975..57488) [2514 bp, 837 aa] {ON}...    35   0.67 
CAGL0A02596g Chr1 (278467..281085) [2619 bp, 872 aa] {ON} simila...    34   1.0  
NDAI0E02590 Chr5 complement(537501..539558) [2058 bp, 685 aa] {O...    34   1.2  
ZYRO0A10516g Chr1 complement(849541..851625) [2085 bp, 694 aa] {...    33   1.6  
TPHA0E03830 Chr5 complement(805860..808328) [2469 bp, 822 aa] {O...    33   1.7  
ZYRO0G03630g Chr7 complement(289222..291534) [2313 bp, 770 aa] {...    33   1.8  
Kwal_47.18470 s47 complement(836322..837629) [1308 bp, 435 aa] {...    33   2.0  
NDAI0B06190 Chr2 (1503529..1506372) [2844 bp, 947 aa] {ON} Anc_3...    33   2.7  
YHR023W Chr8 (151666..157452) [5787 bp, 1928 aa] {ON}  MYO1Type ...    33   3.2  
Suva_4.422 Chr4 complement(743352..745433) [2082 bp, 693 aa] {ON...    32   3.5  
KLTH0G07128g Chr7 complement(569563..575151) [5589 bp, 1862 aa] ...    32   4.0  
Smik_11.25 Chr11 complement(55016..58147) [3132 bp, 1043 aa] {ON...    32   4.2  
Kwal_56.22618 s56 complement(207409..209631) [2223 bp, 740 aa] {...    32   4.3  
Kpol_316.1 s316 complement(395..2935,2937..5180) [4785 bp, 1594 ...    32   4.3  
Kpol_1008.29 s1008 complement(62595..64211) [1617 bp, 538 aa] {O...    32   4.9  
SAKL0C10604g Chr3 (960046..962115) [2070 bp, 689 aa] {ON} conser...    32   5.7  
AGR212W Chr7 (1153862..1155955) [2094 bp, 697 aa] {ON} Syntenic ...    32   6.0  
ACL132C Chr3 complement(120950..123814) [2865 bp, 954 aa] {ON} S...    31   8.0  
CAGL0B03641g Chr2 (363897..366863) [2967 bp, 988 aa] {ON} simila...    31   8.6  
NCAS0D01510 Chr4 complement(282977..285679) [2703 bp, 900 aa] {O...    31   8.8  
Smik_4.622 Chr4 (1112573..1115407) [2835 bp, 944 aa] {ON} YDR356...    31   9.0  
KNAG0A03400 Chr1 complement(431077..433149) [2073 bp, 690 aa] {O...    31   9.8  

>Kwal_56.23256 s56 complement(468118..469821) [1704 bp, 567 aa] {ON}
           YDL058W (USO1) - Integrin analogue gene [contig 183]
           FULL
          Length = 567

 Score = 1123 bits (2906), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 552/567 (97%), Positives = 552/567 (97%)

Query: 1   MNLTASELSSPTLKPSDYDSIDRIAKSKLKSFFHKSDSSTIPHEETDFEDTSSSADLGLQ 60
           MNLTASELSSPTLKPSDYDSIDRIAKSKLKSFFHKSDSSTIPHEETDFEDTSSSADLGLQ
Sbjct: 1   MNLTASELSSPTLKPSDYDSIDRIAKSKLKSFFHKSDSSTIPHEETDFEDTSSSADLGLQ 60

Query: 61  EDIVSDVYDVKNVNPLVEKFVAKRMKIKSRLNSMVRFGSNRTKIFDKESILQVPKKEPPR 120
           EDIVSDVYDVKNVNPLVEKFVAKRMKIKSRLNSMVRFGSNRTKIFDKESILQVPKKEPPR
Sbjct: 61  EDIVSDVYDVKNVNPLVEKFVAKRMKIKSRLNSMVRFGSNRTKIFDKESILQVPKKEPPR 120

Query: 121 LTPRDSILVVKEQNPQYLEEDSQSDWEQDIPISNPVVLEGLLRCWDACGIPESEFDDEDL 180
           LTPRDSILVVKEQNPQYLEEDSQSDWEQDIPISNPVVLEGLLRCWDACGIPESEFDDEDL
Sbjct: 121 LTPRDSILVVKEQNPQYLEEDSQSDWEQDIPISNPVVLEGLLRCWDACGIPESEFDDEDL 180

Query: 181 IMTVQKLSYGILQAFNNQGTINRLVKYQQVSKLTEDFEQCWLDLLEALQLGDTVNELKDN 240
           IMTVQKLSYGILQAFNNQGTINRLVKYQQVSKLTEDFEQCWLDLLEALQLGDTVNELKDN
Sbjct: 181 IMTVQKLSYGILQAFNNQGTINRLVKYQQVSKLTEDFEQCWLDLLEALQLGDTVNELKDN 240

Query: 241 LTTQVSINAKNEDRIHSLEDQIKTLEAQLEDQSTLKREHAENIATAEEANKKFQDLSSKY 300
           LTTQVSINAKNEDRIHSLEDQIKTLEAQLEDQSTLKREHAENIATAEEANKKFQDLSSKY
Sbjct: 241 LTTQVSINAKNEDRIHSLEDQIKTLEAQLEDQSTLKREHAENIATAEEANKKFQDLSSKY 300

Query: 301 RDASLKLDTIQMDRDEIAIRYDCLKKDHLAISEELSNCKETLNDRETQLKRLQRDVVNVQ 360
           RDASLKLDTIQMDRDEIAIRYDCLKKDHLAISEELSNCKETLNDRETQLKRLQRDVVNVQ
Sbjct: 301 RDASLKLDTIQMDRDEIAIRYDCLKKDHLAISEELSNCKETLNDRETQLKRLQRDVVNVQ 360

Query: 361 RESQEALDISNKHCSRMATELENAEATWKHNFFLILKQREEQMAISEGLKSQSMKARQEL 420
           RESQEALDISNKHCSRMATELENAEATWKHNFFLILKQREEQMAISEGLKSQSMKARQEL
Sbjct: 361 RESQEALDISNKHCSRMATELENAEATWKHNFFLILKQREEQMAISEGLKSQSMKARQEL 420

Query: 421 EDLKKRNTESLITLNATGNYIKSIELQNRELNDKVSMLSSRLETLLDFKKRAKTKILALR 480
           EDLKKRNTESLITLNATGNYIKSIELQNRELNDKVSMLSSRLETLLDFKKRAKTKILALR
Sbjct: 421 EDLKKRNTESLITLNATGNYIKSIELQNRELNDKVSMLSSRLETLLDFKKRAKTKILALR 480

Query: 481 DAKRTVKQSIKDANLTVDQLRKQAAETREMCEVQEKQKEXXXXXXXXXXXXXXXSKISTP 540
           DAKRTVKQSIKDANLTVDQLRKQAAETREMCEVQEKQKE               SKISTP
Sbjct: 481 DAKRTVKQSIKDANLTVDQLRKQAAETREMCEVQEKQKEQLFLELQAAKKLLKESKISTP 540

Query: 541 PSHSPLAHKGVRPHRPLMLANNRIDAF 567
           PSHSPLAHKGVRPHRPLMLANNRIDAF
Sbjct: 541 PSHSPLAHKGVRPHRPLMLANNRIDAF 567

>KLTH0G15334g Chr7 (1343754..1345502) [1749 bp, 582 aa] {ON}
           conserved hypothetical protein
          Length = 582

 Score =  475 bits (1222), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 247/525 (47%), Positives = 347/525 (66%), Gaps = 2/525 (0%)

Query: 45  ETDFEDTSSSADLGLQ-EDIVSDVYDVKNVNPLVEKFVAKRMKIKSRLNSMVRFGSNRTK 103
           E DF+  S   D  L+ E  VSDVY+V+N NP+VE+FV ++M++K R +S++RFG N+TK
Sbjct: 58  EMDFDLYSIDRDNDLRPETYVSDVYEVRNTNPIVEEFVTEQMRVKGRPSSLLRFGCNQTK 117

Query: 104 IFDKE-SILQVPKKEPPRLTPRDSILVVKEQNPQYLEEDSQSDWEQDIPISNPVVLEGLL 162
           +FD   SI     ++P      +SIL+VK+Q P+YLEEDS SDW+QDIPI NPVVLEG L
Sbjct: 118 LFDMHASIGNSHIRKPSGAIKPESILIVKDQEPRYLEEDSHSDWDQDIPIDNPVVLEGFL 177

Query: 163 RCWDACGIPESEFDDEDLIMTVQKLSYGILQAFNNQGTINRLVKYQQVSKLTEDFEQCWL 222
           RCW+ACGIP+ EFD ED+IMTVQKLSYGILQA  NQGT+NRLVK QQ S++TEDFE+CW+
Sbjct: 178 RCWEACGIPDFEFDAEDMIMTVQKLSYGILQALANQGTVNRLVKAQQFSEITEDFEECWI 237

Query: 223 DLLEALQLGDTVNELKDNLTTQVSINAKNEDRIHSLEDQIKTLEAQLEDQSTLKREHAEN 282
           DLLEAL+L DTV  ++ +L  Q SI A+ E RI SLE+Q++ LE QLE Q  LK+E+ + 
Sbjct: 238 DLLEALELEDTVKCMEADLAHQTSITAEKEKRIQSLENQVRGLERQLETQVELKQENKDL 297

Query: 283 IATAEEANKKFQDLSSKYRDASLKLDTIQMDRDEIAIRYDCLKKDHLAISEELSNCKETL 342
            A  E   K FQ+L+ KYRD SLKL+ +QM+ DE++I++D L  ++  +  E+  C+ T+
Sbjct: 298 RAAVEHNTKMFQELNEKYRDVSLKLNVVQMNNDEVSIKHDVLMNENAELRHEIRTCRGTV 357

Query: 343 NDRETQLKRLQRDVVNVQRESQEALDISNKHCSRMATELENAEATWKHNFFLILKQREEQ 402
            DRE+Q+K+L+R + N  RE+++ L+ S   C++MA E +NAE  WKH   ++L   EE+
Sbjct: 358 KDRESQIKQLERTMSNDSREAKKELETSKTQCNQMAFEYKNAEMNWKHRQSMLLSDLEEK 417

Query: 403 MAISEGLKSQSMKARQELEDLKKRNTESLITLNATGNYIKSIELQNRELNDKVSMLSSRL 462
            A++E    +  +A+ E+E  K +N  S  +LNA   YI+ +ELQN+ELN ++S L  ++
Sbjct: 418 SALAEAFNQELERAKNEIEGFKNQNIVSEASLNAAKEYIEELELQNKELNQRISKLCLQV 477

Query: 463 ETLLDFKKRAKTKILALRDAKRTVKQSIKDANLTVDQLRKQAAETREMCEVQEKQKEXXX 522
           E L++FK +AK K+  L+DAKR  KQ  K     +  L  +  E   + EV+E   +   
Sbjct: 478 EGLVEFKNKAKAKVALLKDAKRESKQQNKKNARLIAALESRVEELATLSEVKENDNKQLF 537

Query: 523 XXXXXXXXXXXXSKISTPPSHSPLAHKGVRPHRPLMLANNRIDAF 567
                       +K+ TP   SPL HK     R L L++ RI AF
Sbjct: 538 QELQQYKKSLHGAKVQTPSVLSPLKHKNAHNRRSLQLSDRRIGAF 582

>SAKL0A08206g Chr1 (729465..731402) [1938 bp, 645 aa] {ON} conserved
           hypothetical protein
          Length = 645

 Score =  102 bits (255), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 102/382 (26%), Positives = 185/382 (48%), Gaps = 53/382 (13%)

Query: 52  SSSADLGLQEDIVSDVYDVKNVNPLVEKFVAKRMKIKSRLNSM--VRFGSNRTKIFDKES 109
           +S  D+ L + +V+ VY +KN NP +E  +A  +      N    +RFG N  K+F  +S
Sbjct: 95  NSDEDIALNKVLVTPVYTIKNSNPFLEDAIASAICPLEVTNHTPKIRFGENSVKMFYSDS 154

Query: 110 ILQVPKKEPPRLTPRD--------SILVVKEQ-NPQYLE-EDSQS---DWEQDIPISNPV 156
           ++    +E P   P          S+LV K   N   L+ +DS +   DWE ++PI N V
Sbjct: 155 LIGNGLEENPPRKPNGNLKHDSVKSVLVEKNSDNACPLKSKDSDTADQDWEVNVPIENTV 214

Query: 157 VLEGLLRCWDACGIPESEFDDEDLIMTVQKLSYGILQAFNNQ----------------GT 200
            LE + RC++ C +P  + D++DL+M++Q+LS+GI+ AF  Q                G+
Sbjct: 215 ALEAITRCFNLCNVPLEDLDEDDLVMSLQRLSFGIVSAFKTQEMCYKYLGKKEKEEILGS 274

Query: 201 INRLVKYQQVSKLTEDFEQCWLDL----LEALQL--GDTVNELKDNLTTQV--------- 245
           +N L   ++V  L ED EQ  L +    LE  QL      + LKD L  ++         
Sbjct: 275 LNHL--GEKVICLEEDNEQLTLKVKQLSLENQQLFQNSKPDNLKDELAEKLKGKIMQLEG 332

Query: 246 SINAKNEDRIHSLEDQIKTLEAQLED----QSTLKREHAENIATAEEANKKFQDLSSKYR 301
            I+ K+++  H +  Q+ +L+    D    QS + ++ AE    AE   ++  + + +  
Sbjct: 333 KISTKDKE-YHKVLTQLNSLKNNSHDDSSQQSIVLKQLAEKTREAEILRRRLTEQNDRIV 391

Query: 302 DASLKLDTIQMDRDEIAIRYDCLKKDHLAISEELSNCKETLNDRETQLKRLQRDVVNVQR 361
           + S +L+ ++++  E+  +YD L K+      +    +E+  +   + K +Q +++ +++
Sbjct: 392 NNSNELENLKLEYREVKSQYDLLAKEKERTDFKCKEFQESWYEATERTKTIQAELLKLEK 451

Query: 362 ESQEALDISNKHCSRMATELEN 383
           E  + L  S K    +  E +N
Sbjct: 452 EKDQILTESKKTEKELIKEHQN 473

>ZYRO0E04708g Chr5 complement(354494..356329) [1836 bp, 611 aa] {ON}
           conserved hypothetical protein
          Length = 611

 Score = 50.4 bits (119), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 46/201 (22%), Positives = 98/201 (48%), Gaps = 18/201 (8%)

Query: 136 QYLEEDSQSDWEQDIPISNPVVLEGLLRCWDACGIPESEFDDEDLIMTVQKLSYGILQAF 195
           +Y+E D++   +Q+       + E   RC+  C +P S+FD+ +   +++KL  GI ++F
Sbjct: 125 KYMEPDNKMATQQE------RLFEVFRRCYTLCNLPMSQFDENNPFKSLKKLCEGIKKSF 178

Query: 196 NNQGTINRLVKYQQVSKLTEDFEQCWLDLLEALQLGDTVNELKDNLTTQVSINAKNEDRI 255
             +    + ++Y++  +L++          E  +L DT+ ELKD+    + +   N+ + 
Sbjct: 179 KAKDECYKYIRYEENRRLSQ----------EIRKLKDTIQELKDDRHNSLVLLQINKLQK 228

Query: 256 HSLE--DQIKTLEAQLEDQSTLKREHAENIATAEEANKKFQDLSSKYRDASLKLDTIQMD 313
           H+ E  ++IK L AQ+   +    E   NI+  +    +  +        S++L+  Q +
Sbjct: 229 HNNEYRNEIKDLTAQVTSTNYENSELRSNISELQTTKNQLMEKLGTALARSVELENNQEE 288

Query: 314 RDEIAIRYDCLKKDHLAISEE 334
           + E+  +   L  DH  +++E
Sbjct: 289 KIELTKQNTKLNNDHGKLNDE 309

>ZYRO0B01936g Chr2 complement(156676..159150) [2475 bp, 824 aa] {ON}
           weakly similar to uniprot|P25386 Saccharomyces
           cerevisiae YDL058W USO1 involved intracellular protein
           transport, coiled-coil protein necessary for protein
           transport from ER to Golgi; Integrin analogue gene
          Length = 824

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 53/198 (26%), Positives = 94/198 (47%), Gaps = 35/198 (17%)

Query: 39  STIPHEETDFEDTSS--SADLGLQEDIVSDVYDVKNVNPLVEK------FVAKRMKIKSR 90
           +++  E T+F   +   +A   +++ +V+  Y VKN NP++++      F+    K KS 
Sbjct: 15  TSVSLETTEFSTNAEGIAAQEAVKKLVVTPAYGVKNSNPIIDEAIDNFSFLYSEPKSKS- 73

Query: 91  LNSMVRFGSNRTKIFD-KESILQVPKK------------------EPPRLTPRDSILVVK 131
             + ++FG +RT  FD  E + ++  K                  +P  +   DS L+  
Sbjct: 74  --NKIQFGESRTITFDVDEEVDRLASKTKNTENQSKDSKPLKTILKPGPVFVHDSELLET 131

Query: 132 EQNPQYLEEDSQSDWEQDIPISNPVVLEGLLRCWDACGIPESEFDDEDLIMTVQKLSYGI 191
           E +  YL+E   SD E  +  SN  V+  L R +   GIP  E   EDL+ T+Q+L+ G+
Sbjct: 132 E-DFAYLDE---SDEETQVKTSNQDVITLLQRIFTLHGIPPCEIK-EDLLGTLQRLARGV 186

Query: 192 LQAFNNQGTINRLVKYQQ 209
           + +F  +    + V  +Q
Sbjct: 187 VASFKQREQCYKYVGRKQ 204

>ZYRO0D04158g Chr4 (336740..341503) [4764 bp, 1587 aa] {ON} similar to
            uniprot|P19524 Saccharomyces cerevisiae YOR326W MYO2 One
            of two type V myosins involved in polarized distribution
            of mitochondria required for mitochondrion and vacuole
            inheritance and nuclear spindle orientation moves
            multiple cargo
          Length = 1587

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 45/142 (31%), Positives = 76/142 (53%), Gaps = 11/142 (7%)

Query: 227  ALQLGDTVNELKDNLTTQVSINAKNEDRIHSLEDQIK---TLEAQLEDQSTLKREHA--- 280
            + QL + V EL  NL ++V  N +   RI  L+  +    TL++Q+E+Q   KREH+   
Sbjct: 949  SYQLENKVIELTQNLASKVKANKEMTARIAELQAALAASATLQSQIEEQ---KREHSKAL 1005

Query: 281  ENIATAEEANKKFQDLSSKYRDASLKLDTIQMDRDEIAIRYDCLKKDHLAISEELSNCKE 340
            EN A A +    ++DL  + ++A L++  +  +   I  +Y+ +K+D  +  EEL N K 
Sbjct: 1006 ENQAMAHD--HVYKDLEDQKKEAELQMQQVGQEVRSITEKYNKIKEDSKSALEELENTKI 1063

Query: 341  TLNDRETQLKRLQRDVVNVQRE 362
             L D +TQ   L   V +++ E
Sbjct: 1064 QLRDSKTQNSDLHDQVKSLKEE 1085

>TBLA0E02190 Chr5 complement(534078..537347) [3270 bp, 1089 aa] {ON}
           Anc_7.101 YOL034W
          Length = 1089

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 51/197 (25%), Positives = 94/197 (47%), Gaps = 10/197 (5%)

Query: 150 IPIS----NPVVLEGLLRCWDACGIPESEFDDEDLIMTVQKLSYGILQAFNNQGTINRLV 205
           IPIS    +P  LE L R      I    F   +  + V K  YG  Q + N  TI    
Sbjct: 581 IPISRRELSPSQLETLCRPNQQNSIYFRRFIHGNNFVNVNKSEYGTRQIYTNSNTIKPNK 640

Query: 206 KYQQVSKLTEDFEQCWLDLLEALQLGDTVNELKDNLTTQVSINAKNEDRIHSLEDQIKTL 265
           K+   S L+E+ ++      E + L     E ++ L    S    ++  I  ++ +IK+L
Sbjct: 641 KFYLGSGLSEEMKESVKQ--EIITLSSQFKERQEELGMLSSKKGDHKSEISDVQKEIKSL 698

Query: 266 EAQLEDQSTLKREHAENIATAEEANKKFQDLSSKYR-DASLKLDTIQMDRDEIAIRYDCL 324
            A+  + ++++  H+   +T E   ++ Q+L+++ R D S  +DT+Q   +E+      L
Sbjct: 699 SARHSELNSIRNSHSFIKSTIERLEERLQELNNEIRKDVSTTIDTVQGKINELVKNQTKL 758

Query: 325 KKDHLAISEELSNCKET 341
            K   A++E+++N K++
Sbjct: 759 LK---AMTEQMNNIKDS 772

>TPHA0L00600 Chr12 complement(102317..105670) [3354 bp, 1117 aa]
           {ON} Anc_7.101 YOL034W
          Length = 1117

 Score = 40.0 bits (92), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 58/116 (50%), Gaps = 3/116 (2%)

Query: 181 IMTVQKLSYGILQAFNNQGTINRLVKYQQVSKLTEDFEQCWLDLLEALQLGDTVNELKDN 240
           IM + K SYG  Q F   GTI R  K+ + S +  DF        E  Q+   + E K++
Sbjct: 645 IMDINKSSYGSKQVFTRDGTI-RDTKFYRESVIARDFAAKINS--EISQIKQRIKEGKEH 701

Query: 241 LTTQVSINAKNEDRIHSLEDQIKTLEAQLEDQSTLKREHAENIATAEEANKKFQDL 296
           L T +    +     + LE Q +++  +L+  + L++EH+   +T E  N+K++ L
Sbjct: 702 LETVIQEEREERKEKYELEKQRESISKELKKLNNLQKEHSYLKSTIESLNQKWKQL 757

>ZYRO0A11132g Chr1 complement(890189..892285) [2097 bp, 698 aa] {ON}
           some similarities with uniprot|Q22X91 Tetrahymena
           thermophila SB210 TTHERM_00561660 Viral A-type inclusion
           protein repeat containing protein
          Length = 698

 Score = 39.3 bits (90), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 47/204 (23%), Positives = 81/204 (39%), Gaps = 63/204 (30%)

Query: 37  DSSTIPHEE-TDFEDTSSSADLGLQEDIVSDVYDVKNVNPLV------------------ 77
           D   IP E   D+ D   S D  ++E +++ ++++KN N L+                  
Sbjct: 5   DHFKIPKERRADYWDYKPSRDELIKEPLITPIHEIKNQNKLINSAMLYFSKPSHRDHGFY 64

Query: 78  -------EKFVAKRMKIKSRLNSMVRFGSNRTKIFD-KESILQVPKKEPP---------- 119
                  E + A   + + +L    RFG N T  FD  E + ++  KE            
Sbjct: 65  PDPKIPYEAYFANETEEREKL----RFGENETITFDINEEVGKLVMKEAEYKPASQHGAL 120

Query: 120 --RLTPRDSILVVKEQNPQYLEEDSQSDWEQDIPI---SNPVV---LEGLLRCWDACGIP 171
             + T   SIL   + NP+ +           IP    +NP +    E +++C++ CGI 
Sbjct: 121 DQKNTKNKSIL---KTNPRTV-----------IPYRPHANPYIDACQEVMIKCYNMCGIS 166

Query: 172 ESEFDDEDLIMTVQKLSYGILQAF 195
               D + +  ++ KL +GI   F
Sbjct: 167 VDYLDIDKMFDSLGKLMFGISNEF 190

>Kwal_55.20439 s55 complement(402467..402700) [234 bp, 77 aa] {OFF}
           [contig 149] FULL
          Length = 77

 Score = 34.7 bits (78), Expect = 0.071,   Method: Composition-based stats.
 Identities = 20/74 (27%), Positives = 42/74 (56%), Gaps = 5/74 (6%)

Query: 111 LQVPKKEPPRLTPRDSILVVKEQNPQYLEEDSQSDWEQDIPISNPVVLEGLLRCWDACGI 170
           ++ P  + P++   D+++ V +  P  L E S S++ + +PI + + +  +L C D CG 
Sbjct: 3   MESPIWQSPKIG--DALVTVTDTPPPPLCEASYSEYSETVPICSTIPVNIVLCCADECG- 59

Query: 171 PESEFDDEDLIMTV 184
             S+F+ E + ++V
Sbjct: 60  --SDFNFEVVTLSV 71

>KNAG0L00430 Chr12 complement(60407..65089) [4683 bp, 1560 aa] {ON}
            Anc_7.68 YAL029C
          Length = 1560

 Score = 37.7 bits (86), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 40/143 (27%), Positives = 72/143 (50%), Gaps = 13/143 (9%)

Query: 227  ALQLGDTVNELKDNLTTQVSINAKNEDRIHSLE---DQIKTLEAQLEDQSTLKREHAENI 283
            + +L + V EL +NL  +V  N +   R+ +L+   D+  TL   +E Q   + EH++ I
Sbjct: 945  SYKLENKVIELTENLAAKVRENKEMHIRLVALQKQLDETATLRDSIESQ---RLEHSKMI 1001

Query: 284  ATAEEANKKF----QDLSSKYRDASLKLDTIQMDRDEIAIRYDCLKKDHLAISEELSNCK 339
               E+    F    +DL  +   A   ++  + +  E+  R+  LK++ LA  EEL   +
Sbjct: 1002 ---EDQQSDFVTKQKDLDDQLLAAHKSIEGYEREIAEMTARHGVLKQESLATLEELDTAR 1058

Query: 340  ETLNDRETQLKRLQRDVVNVQRE 362
            + LND + Q   LQ +V +++ E
Sbjct: 1059 KELNDYKLQNSDLQNEVKSLKEE 1081

>TDEL0H03830 Chr8 (646726..651474) [4749 bp, 1582 aa] {ON} Anc_7.68
            YAL029C
          Length = 1582

 Score = 37.7 bits (86), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 34/137 (24%), Positives = 74/137 (54%), Gaps = 1/137 (0%)

Query: 227  ALQLGDTVNELKDNLTTQVSINAKNEDRIHSLEDQIKTLEAQLEDQSTLKREHAENI-AT 285
            + QL + V EL  NL T+V  N +   R+  L++++++  A  ++  + +  HAE +   
Sbjct: 945  SYQLENKVIELTQNLATKVKENKEMTARLLDLQEKLQSTGALRKELESQREVHAEALKGQ 1004

Query: 286  AEEANKKFQDLSSKYRDASLKLDTIQMDRDEIAIRYDCLKKDHLAISEELSNCKETLNDR 345
            A E + +++++  + + +  ++D  + +   +A ++  + +D  A  EEL+  KE LN+ 
Sbjct: 1005 AIEHDARYKEIELQLKMSKQEVDDAKEEIRVLAAKHKQISEDARAQLEELNGTKEVLNEA 1064

Query: 346  ETQLKRLQRDVVNVQRE 362
             TQ   L  +V +++ E
Sbjct: 1065 RTQNSDLHDEVKSLKEE 1081

>NDAI0B05520 Chr2 (1351005..1354034) [3030 bp, 1009 aa] {ON}
           Anc_5.414 YDR356W
          Length = 1009

 Score = 37.7 bits (86), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 62/126 (49%), Gaps = 15/126 (11%)

Query: 254 RIHSLEDQIKTLEAQLEDQSTL---------KREHAENIATAEEA-NKKFQDLSSKYRDA 303
           +IH LE+Q+ +L      QST+         ++   E + T  E    K  DL S+ R++
Sbjct: 315 KIHKLEEQLNSLNNDTTSQSTIDSLKKQLIEEKSMLERVKTENETLENKIHDLKSQLRES 374

Query: 304 SLKLDTIQMDRDEIAIRYDCLKKDHLAISEELSN-CKETLNDRETQLKRLQRDVVNVQRE 362
            ++L  +     E   RY+   +DH + SE+ +N  K  +N+ E+++K L   + N+  E
Sbjct: 375 EIELKALS----EKCGRYETEIRDHKSTSEKSNNYYKNKINELESKIKNLHLQLENLNTE 430

Query: 363 SQEALD 368
            QE  D
Sbjct: 431 RQELQD 436

>AGR274C Chr7 complement(1252837..1253964) [1128 bp, 375 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR177C
           (MPC54)
          Length = 375

 Score = 36.2 bits (82), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 38/75 (50%), Gaps = 11/75 (14%)

Query: 122 TPRDSILVVKEQNPQYLEEDSQSDWEQDIPISNPVVLEGLL-RCWDACGIPESEFDDEDL 180
           TPR SILV ++       E   SD E+D     P  +E LL RC++ C +      +  L
Sbjct: 73  TPRKSILVSRQTT-----ETENSDNEED-----PDEVELLLHRCFNFCNLDTDGVAERPL 122

Query: 181 IMTVQKLSYGILQAF 195
           +  ++ +SYGI+  F
Sbjct: 123 VENLELISYGIISTF 137

>Smik_15.506 Chr15 (875291..880021) [4731 bp, 1576 aa] {ON} YOR326W
            (REAL)
          Length = 1576

 Score = 36.6 bits (83), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 36/142 (25%), Positives = 71/142 (50%), Gaps = 8/142 (5%)

Query: 227  ALQLGDTVNELKDNLTTQVSINAKNEDRIHSLEDQIKTLEAQLEDQSTLKREHAENIATA 286
            + +L + V EL  NL ++V  N +  +RI  L+ Q++      E    +K+EH  +I   
Sbjct: 940  SYKLENKVIELTQNLASKVKENKEMTERIKELQVQVEESAKLQETLENMKKEHLIDIDNQ 999

Query: 287  EEANKKFQ-DLSSKYRDASLKLDTIQMDRDEIAIRYDCLKKDHLAISEELSNCKETL--- 342
            +  + + Q  +    +     L   Q++ +E+A ++D LK+D +   EEL   K++L   
Sbjct: 1000 KTKDMELQKTIEDDLKSTEQSLKDAQLELEEMAKQHDQLKEDSMKKLEELEQTKKSLVEY 1059

Query: 343  ----NDRETQLKRLQRDVVNVQ 360
                 D + ++K L+ ++V +Q
Sbjct: 1060 QTLNGDLQNEVKSLKEEIVRLQ 1081

>NCAS0A02450 Chr1 complement(463760..469546) [5787 bp, 1928 aa] {ON}
           Anc_4.238 YDL058W
          Length = 1928

 Score = 36.6 bits (83), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 63/223 (28%), Positives = 112/223 (50%), Gaps = 35/223 (15%)

Query: 237 LKDNLTTQVSINAKNEDRIHSLEDQIKTLEAQLEDQST----LKREHAENIATAEEANKK 292
           LK+ L T   ++  N+  I SL++Q+KT+  + ED ST    LK EH+         + K
Sbjct: 712 LKEELET---LHHDNKASIDSLQNQLKTISGEYEDSSTELASLKTEHS-------LLSDK 761

Query: 293 FQDLSSKYRDASLKLDTIQMDRDEIAIRYDCLKKDH---LAISEE-LSNCKETLNDRETQ 348
           +  +  +  D +  L  I  +RD +    D LKK++   +  +EE L   KE L + ETQ
Sbjct: 762 YDTIKVELSDMTTSLKQITEERDTL----DALKKENENKIEKNEELLKEYKEKLQNIETQ 817

Query: 349 LKRLQRDVVNVQRESQEALDISNKHCSRMATELENAEATWKHNFFLILKQREEQMAISEG 408
           L    + ++  +++++E ++  N+    ++ E +  E   K    + LK  +++ A+ E 
Sbjct: 818 L----QTIILAKQKAEEGVNKMNRELFALSREKQELEGNQK----IALKDLQKKTAVLEK 869

Query: 409 LKSQ-SMKARQELEDLKKRNTESLITLNATGNYIKSIELQNRE 450
            K Q S K  ++ +D+ + N E L TL    N +KS+E +  E
Sbjct: 870 EKRQLSDKLNEKEKDITRLN-EELATLE---NTVKSLESEKNE 908

 Score = 31.6 bits (70), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 36/122 (29%), Positives = 65/122 (53%), Gaps = 18/122 (14%)

Query: 395  ILKQREEQMAIS----EGLKSQSMKARQEL----EDLKKRNTESLITLNATGNYIKSIEL 446
            ++ ++E++++ S    E LK+Q  + ++EL    E++ K++   LI LN T   +K    
Sbjct: 1526 LISEKEQELSASNQNLEELKNQISEIKEELKSSKEEMAKKDM-MLIDLNKTLASLKG--- 1581

Query: 447  QNRELNDKVSMLSSRLETLLDFKKRAKTKILALRDAKRTV---KQSIKDANLTVDQLRKQ 503
               ++ DKV  +    ETL   K   K K LA+   ++T+   K  IKD + T++ L+K+
Sbjct: 1582 ---DVKDKVLAIEKLNETLASLKGNIKDKDLAIEKLEKTLNSLKDDIKDKDQTIEDLKKK 1638

Query: 504  AA 505
             A
Sbjct: 1639 KA 1640

>Ecym_3119 Chr3 (221707..222843) [1137 bp, 378 aa] {ON} similar to
           Ashbya gossypii AGR274C
          Length = 378

 Score = 35.4 bits (80), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 40/81 (49%), Gaps = 10/81 (12%)

Query: 115 KKEPPRLTPRDSILVVKEQNPQYLEEDSQSDWEQDIPISNPVVLEGLLRCWDACGIPESE 174
           K E P + P+ SILV +E         + +  EQ+IP  N  VL  L RC++ C +    
Sbjct: 65  KNEVPAI-PKKSILVNRENT-------TDTPTEQEIP--NEEVLLLLRRCFNFCNLDTDG 114

Query: 175 FDDEDLIMTVQKLSYGILQAF 195
            +   +   ++ +SYGI+  F
Sbjct: 115 IEKRSIEENLESISYGIISTF 135

>Kwal_55.20421 s55 (391382..394894) [3513 bp, 1170 aa] {ON} YFR031C
           (SMC2) - SMC chromosomal ATPase family member [contig
           149] FULL
          Length = 1170

 Score = 35.8 bits (81), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 69/307 (22%), Positives = 134/307 (43%), Gaps = 44/307 (14%)

Query: 140 EDSQSDWEQDIPISNPVVLEGLL--RCWDACGIPESEFDDEDLIMTVQKLSYGILQAFNN 197
           +++QSD E    I N  V   L+  R         SE    +L  +VQ+    +     +
Sbjct: 221 QETQSDLENTSKIVNAFVFSSLVQKRKNIENAFQNSESRISELTASVQQTKVELTNLEED 280

Query: 198 QGTINRLVKYQQVSKLTEDFEQCWLDLLEALQLGDTVNELKDNLTTQV-SINAKNEDRIH 256
             TI    + Q+ +++ +D     L+ LE  QL + V+ LK +L+  + +IN +N  R  
Sbjct: 281 LDTI----RTQKRNEMRKDGALSKLEALET-QLINEVSRLKTSLSLTIENINQENGKR-E 334

Query: 257 SLEDQIKTLEAQLEDQSTLKREHAENIATAEEANKKFQDLSSKYRDASLKLDTIQMDRDE 316
           SLE  I+ ++  L+++S + + +AEN         ++ +L    ++ S +L T +     
Sbjct: 335 SLERSIRGIQTSLQEKSAISK-NAEN---------EYNELHDLVQNLSQQLQTKEELLST 384

Query: 317 IAIRYDCLKKDHLAISEELSNCKETLNDRETQLKRLQR-----------------DVVNV 359
           +          +   S +LSN K  LND   Q++R +                  D  ++
Sbjct: 385 LTTGISSTGATNSGYSAQLSNTKARLNDARIQVQRFEMKINILKKELAANEPKIVDAKSL 444

Query: 360 QRESQEALDISNKHCSRMATELENAEATWKHNFFLILKQREEQMAISEGLKSQSMKARQE 419
             E+++ ++++   CS +   LE  +  +  + F  LK+ E        LKS+      +
Sbjct: 445 SEEAKKQVEVTGIQCSDLKMHLE--KLGFNPDLFKSLKEEE------SSLKSKIYNLSND 496

Query: 420 LEDLKKR 426
           +E L+++
Sbjct: 497 MEGLRRK 503

>KLLA0C16467g Chr3 (1442002..1443825) [1824 bp, 607 aa] {ON} similar
           to uniprot|P46982 Saccharomyces cerevisiae YJL186W MNN5
           Alpha-1 2-mannosyltransferase responsible for addition
           of the second alpha-1 2-linked mannose of the branches
           on the mannan backbone of oligosaccharides localizes to
           an early Golgi compartment
          Length = 607

 Score = 35.0 bits (79), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 47/112 (41%), Gaps = 1/112 (0%)

Query: 248 NAKNEDRIHSLEDQIKTLEAQLEDQSTLKREHAENIATAEEANKKFQDLSSKYRDASLKL 307
           +A   DR  + ++  KTL AQLE  + +KRE       A+E +       S  RD  L  
Sbjct: 58  SAPKLDRTDASDEFFKTLFAQLEGAAPMKREFGWGDIKAKECDMGDVGFDSNGRDERLSY 117

Query: 308 DTIQMDRDEIAIRYDCLKKDHLAISEELSNCKETLNDRETQLKRLQRDVVNV 359
           D +          Y+ LK  H    + LS    + +  E Q+   +R +V V
Sbjct: 118 DNLAKCLQLPESNYNSLKNGHEKFVKYLSTVDTSASQLE-QIYATKRGIVTV 168

>Smik_12.22 Chr12 complement(54975..57488) [2514 bp, 837 aa] {ON}
           YLL034C (REAL)
          Length = 837

 Score = 34.7 bits (78), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 44/86 (51%), Gaps = 3/86 (3%)

Query: 191 ILQAFNNQGTINRLVKYQQVSKLTEDFEQCWLDLLEALQLGDTVNELKDNLTTQVSINAK 250
           IL+  +N   I+ ++ + +++KLT  F    L   +AL        +K    T  +I + 
Sbjct: 386 ILKKMSNNLKIDGIIDFAKLAKLTPGFVGADL---KALVTAAGTCAIKRIFQTYANIQSP 442

Query: 251 NEDRIHSLEDQIKTLEAQLEDQSTLK 276
               + SLED+++  EA  ED+S+LK
Sbjct: 443 TSTTVDSLEDKMEIDEAANEDESSLK 468

>CAGL0A02596g Chr1 (278467..281085) [2619 bp, 872 aa] {ON} similar
           to uniprot|P32380 Saccharomyces cerevisiae YDR356w NUF1
          Length = 872

 Score = 34.3 bits (77), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 50/241 (20%), Positives = 103/241 (42%), Gaps = 40/241 (16%)

Query: 277 REHAENIATAEEANKKFQDLSSKYRDASLKLDTIQMDRDEIAIRYDCLKKDHLAISEELS 336
           REH   +   E   + F++L  +Y D  +K  +IQ + DE    ++        ++EE+ 
Sbjct: 225 REHI--LEELERVTEDFKNLRDRYNDLEIKFLSIQNELDEKKQEFES---STARLNEEIH 279

Query: 337 NCKETLNDRETQLKRLQRDVVNVQRESQEALDISNKHCSRMATELENAEATWKHNFFLIL 396
             K T++D++  +   +R + N +               ++A+ +++            L
Sbjct: 280 TLKSTIDDKDATISEFKRKLGNAE--------------DQLAS-IDDQNGNQNQKLLHDL 324

Query: 397 KQREEQMAISEGLKSQSMKARQELEDLKKRNTESLITLNATGNYIKSIELQNRELNDKVS 456
           K+RE+ +   +GLK          ED+ ++        NA  +Y + I+ +  +L +  S
Sbjct: 325 KEREDAI---DGLK----------EDIIEKE-------NAIVHYKEEIQDKQNQLKESES 364

Query: 457 MLSSRLETLLDFKKRAKTKILALRDAKRTVKQSIKDANLTVDQLRKQAAETREMCEVQEK 516
             +   +   DFK+  K +     D K++  + +++ ++   QL KQ    R   E  E+
Sbjct: 365 KYAEVQKEFEDFKRELKKQTFEFEDGKKSTSRQLQELSVEKIQLEKQVCNLRGQIEKLEQ 424

Query: 517 Q 517
           Q
Sbjct: 425 Q 425

>NDAI0E02590 Chr5 complement(537501..539558) [2058 bp, 685 aa] {ON}
           Anc_8.590
          Length = 685

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 39/156 (25%), Positives = 73/156 (46%), Gaps = 23/156 (14%)

Query: 233 TVNEL--KDN-LTTQVSINAKNEDRIHSLEDQIKTLEAQLEDQSTLKREHAENIATAEEA 289
           T+NEL  K+N +  +  + A+ EDR ++LE+ I TL  +L++      E+A   + AE+ 
Sbjct: 546 TLNELIEKENAMFAKDKLVAETEDRKNTLEEYIYTLRGKLDE------EYAPFASGAEK- 598

Query: 290 NKKFQDLSSKYRDASLKLDTIQMDRDEIAIRYDCLKKDHLAISEELSNCKETLNDRETQL 349
                   +K +D   K +    D       YD +K  ++A  EEL++    +  R    
Sbjct: 599 --------TKLKDMLAKAEEWLYDEG-----YDSIKAKYIAKYEELASLGNMIRGRYLAK 645

Query: 350 KRLQRDVVNVQRESQEALDISNKHCSRMATELENAE 385
           +  ++  +   +E+ +  D+S K  ++   E E  E
Sbjct: 646 EEEKKQALRANKEASQMADLSAKLAAQRKAEAEAKE 681

>ZYRO0A10516g Chr1 complement(849541..851625) [2085 bp, 694 aa] {ON}
           highly similar to uniprot|P32589 Saccharomyces
           cerevisiae YPL106C SSE1 HSP70 family member highly
           homologous to Ssa1p and Sse2p
          Length = 694

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 39/155 (25%), Positives = 75/155 (48%), Gaps = 22/155 (14%)

Query: 236 ELKDNLTTQVSINAKNEDRIHSLEDQIKTLEAQLEDQSTLKREHAENIATAEEANKKFQD 295
           E ++ +T+Q  + A+ EDR ++LE+ I TL  +L++      E+A   +  E+       
Sbjct: 552 EKENEMTSQDKLVAETEDRKNALEEYIYTLRGKLDE------EYAPFASDQEK------- 598

Query: 296 LSSKYRDASLKL-DTIQMDRDEIAIRYDCLKKDHLAISEELSNCKETLNDRETQLKRLQR 354
             +K RD   K  D +  D       YD  K  ++A  EEL++    +  R    +  Q+
Sbjct: 599 --TKLRDQLAKAEDWLYEDG------YDSTKAKYVAKYEELASTGNIIRGRYLSKQEEQK 650

Query: 355 DVVNVQRESQEALDISNKHCSRMATELENAEATWK 389
             +  + E+++  ++S K  ++  +E EN E++ K
Sbjct: 651 QALRQKDEAKKMAELSEKLSAQRKSEAENKESSKK 685

>TPHA0E03830 Chr5 complement(805860..808328) [2469 bp, 822 aa] {ON}
           Anc_1.26 YDR520C
          Length = 822

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 33/115 (28%), Positives = 54/115 (46%), Gaps = 21/115 (18%)

Query: 174 EFDDEDLI-------MTVQKLSYGILQAFNNQGTINRLVKYQQVSKLTEDFEQCWL--DL 224
           +FD +DL        +TV KL Y I  ++ N   ++R++   + + LT  F Q     D+
Sbjct: 481 KFDAKDLYHLRILNSLTVCKLEYSI--SYGNVSPLDRML--MEFNNLTAKFPQANFGDDI 536

Query: 225 -LEALQLGDTVNELKDNLTTQVSINAKNEDRIHSLED-------QIKTLEAQLED 271
            +  L LGDTVN +  N  T   I  +  + +H+  D        I+ +  +LED
Sbjct: 537 KISELNLGDTVNSIYLNFKTYFKITKEKFEEMHTNSDDATEPIVNIQFIFPELED 591

>ZYRO0G03630g Chr7 complement(289222..291534) [2313 bp, 770 aa] {ON}
           similar to uniprot|Q07834 Saccharomyces cerevisiae
           YLL032C Hypothetical ORF
          Length = 770

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 45/89 (50%), Gaps = 9/89 (10%)

Query: 201 INRL-VKYQQVSKLTE---DFEQCWLDLLEALQLGDTVNELKDNLTTQVSINAK---NED 253
           +NRL +KYQ + K+T+   +F    L LLEAL    T+N L   L  QV+++     NED
Sbjct: 284 LNRLMIKYQSLVKVTDSCIEFRSTCLPLLEALIKAFTINILHRILEVQVTMDKNFQFNED 343

Query: 254 RIHS--LEDQIKTLEAQLEDQSTLKREHA 280
            I    +ED I       E+Q  +   H+
Sbjct: 344 SIRQVVMEDLIVVTIPSKENQLLVIGNHS 372

>Kwal_47.18470 s47 complement(836322..837629) [1308 bp, 435 aa] {ON}
           YDR448W (ADA2) - transcription factor, member of ADA and
           SAGA, two transcriptional adaptor/HAT (histone
           acetyltransferase)complexes [contig 195] FULL
          Length = 435

 Score = 33.1 bits (74), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 39/161 (24%), Positives = 72/161 (44%), Gaps = 20/161 (12%)

Query: 215 EDFEQCWLDLLEALQLGDTVNELKD---NLTTQVSINAKNE----DRIHSLEDQIKTLEA 267
           +DFE+   D+LE L+    +++L++   N  T +    K E     R+ +LE    +L +
Sbjct: 261 QDFEEFSKDILEELRCRSRIHQLQEWRSNGVTTLEAGLKYERDKQARVMTLERFGGSLHS 320

Query: 268 QLEDQSTLKREHAENIATAEEANKKFQDLSSKYRDASLKLDTIQMDRD---------EIA 318
                 + +   +    +  +  + + D SS  R  +L +  IQ   D         ++ 
Sbjct: 321 SANGNGSGRYRTSSAHRSNADYGQGYNDASS--RKKTLTISDIQHGADYGLLSAEEQQLC 378

Query: 319 IRYDCLKKDHLAISEELSNCKETLNDRETQLKRLQRDVVNV 359
           I+   L K +LAI E +   +E L    T  KR+ RD++N+
Sbjct: 379 IQLKILPKPYLAIKEVMF--RELLRAGGTLKKRVCRDLLNI 417

>NDAI0B06190 Chr2 (1503529..1506372) [2844 bp, 947 aa] {ON}
           Anc_3.547
          Length = 947

 Score = 32.7 bits (73), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 190 GILQAFNNQGTINRLVKYQQVSKLTEDFEQCWLDLLEALQLGDTVNELKDNLT 242
           GI+Q  +NQG I + ++Y    K + D + C  D L+AL +G + N   D+++
Sbjct: 354 GIIQLVSNQGLIMKCLQYLNNEKYSSDTQACVGDFLKAL-IGISANAPIDDIS 405

>YHR023W Chr8 (151666..157452) [5787 bp, 1928 aa] {ON}  MYO1Type II
            myosin heavy chain, required for wild-type cytokinesis
            and cell separation; localizes to the actomyosin ring;
            binds to myosin light chains Mlc1p and Mlc2p through its
            IQ1 and IQ2 motifs respectively
          Length = 1928

 Score = 32.7 bits (73), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 63/226 (27%), Positives = 111/226 (49%), Gaps = 42/226 (18%)

Query: 233  TVNELKD--NLTTQVSINA-KNEDRIHSLEDQIKTLEAQLED----QSTLKREHAENIAT 285
            TVNEL++  +L  Q   N  KNE  ++ ++   +TL+ Q +D    +  + RE  E    
Sbjct: 894  TVNELENTQDLLNQEKENLRKNESLLNRVKTSSETLQKQFDDLVSEKDEISREKLEVAQN 953

Query: 286  AEEANKKFQDLSSKYRDASLKLDTIQMDRDEIAIRYDCLKKDHLAISEELSN---CKETL 342
             EEA++K Q L    R+    L+ +    +E+  +   L  D   IS+E S+    KE+ 
Sbjct: 954  LEEAHQKIQGLQETIREREATLEKLHSKNNELIKQISDLNCD---ISKEQSSQSLIKESK 1010

Query: 343  NDRETQLKRLQRDVVNVQRE-----------SQEALDIS----NKHCSRMATEL-----E 382
               E ++KRL +DV+N + E           S+E LDI      K+C+   + L     E
Sbjct: 1011 LKLENEIKRL-KDVINSKEEEIKSFNDKLSSSEEDLDIKLVTLEKNCNIAMSRLQSLVTE 1069

Query: 383  NAEATWKHNFFLILKQREEQMAISEGLK---SQSMKARQELEDLKK 425
            N++   K+  F     ++E+ A++  LK   S+ +K ++++++ KK
Sbjct: 1070 NSDLRSKNENF-----KKEKAALNNQLKNKESELLKMKEKIDNHKK 1110

>Suva_4.422 Chr4 complement(743352..745433) [2082 bp, 693 aa] {ON}
           YBR169C (REAL)
          Length = 693

 Score = 32.3 bits (72), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 41/161 (25%), Positives = 77/161 (47%), Gaps = 21/161 (13%)

Query: 225 LEALQLGDTVNELKDNLTTQVSINAKNEDRIHSLEDQIKTLEAQLEDQSTLKREHAENIA 284
           L  ++L D + E ++ LT Q  + A+ EDR ++LE+ I TL A+L+D      E+++  +
Sbjct: 542 LNPVELNDLI-EKENELTNQDKLVAETEDRKNALEEYIYTLRAKLDD------EYSDFAS 594

Query: 285 TAEEANKKFQDLSSKYRDASLKLDTIQMDRDEIAIRYDCLKKDHLAISEELSNCKETLND 344
            AE+  KK ++  SK  D          D  E     D  K  ++A  EEL++    +  
Sbjct: 595 DAEK--KKLKNALSKTED-------WLYDDGE-----DSTKAKYIAKYEELASLGNVIRG 640

Query: 345 RETQLKRLQRDVVNVQRESQEALDISNKHCSRMATELENAE 385
           R    +  +R  +   +E+ +  D + K  ++   + E+ +
Sbjct: 641 RYLAKEEEKRQSLRANQETSKMNDAAEKLAAQRRAQAESGD 681

>KLTH0G07128g Chr7 complement(569563..575151) [5589 bp, 1862 aa]
           {ON} similar to uniprot|P08964 Saccharomyces cerevisiae
           YHR023W MYO1 Type II myosin heavy chain required for
           wild- type cytokinesis and cell separation localizes to
           the actomyosin ring binds to myosin light chains Mlc1p
           and Mlc2p through its IQ1 and IQ2 motifs respectively
          Length = 1862

 Score = 32.3 bits (72), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 35/135 (25%), Positives = 66/135 (48%), Gaps = 11/135 (8%)

Query: 242 TTQVSINAKNEDRIHSLEDQIKTLEAQLED--------QSTLKREHAENIATAEEANKKF 293
           T ++S   K  +++ SLE ++K +E++ E          + LK    +  A  E   K+ 
Sbjct: 795 TQEISKTRKIAEQVKSLESKLKIVESKNEKLQQEKENISAELKAVREKLAAETENLEKRQ 854

Query: 294 QDL---SSKYRDASLKLDTIQMDRDEIAIRYDCLKKDHLAISEELSNCKETLNDRETQLK 350
            DL   +SK  + +LKL+  Q  RD+ A   + L+K H ++  EL+   E  +   +  +
Sbjct: 855 NDLRLVASKEAELNLKLEESQKIRDQFAAEKEALEKAHASLQGELTRSNEEASKSHSSFQ 914

Query: 351 RLQRDVVNVQRESQE 365
            LQ + V ++++  E
Sbjct: 915 SLQNEKVQLEQKISE 929

>Smik_11.25 Chr11 complement(55016..58147) [3132 bp, 1043 aa] {ON}
           YKL197C (REAL)
          Length = 1043

 Score = 32.3 bits (72), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 36/72 (50%), Gaps = 5/72 (6%)

Query: 12  TLKPSDYDSIDRIAKSKLKSFFHKSDSSTIPHEETDFEDTSSSADLGLQEDIVSDVYDVK 71
            L+ +DY     I +  +   FH SD+  + H   D  D+ S+ +  L   I++ VYD+ 
Sbjct: 34  VLESTDY----AIQEFGIGVHFHNSDTPIV-HLGWDGHDSGSNENTVLINPILASVYDIN 88

Query: 72  NVNPLVEKFVAK 83
              PLV+ ++ +
Sbjct: 89  QKFPLVDLYIER 100

>Kwal_56.22618 s56 complement(207409..209631) [2223 bp, 740 aa] {ON}
           YGR130C - Hypothetical ORF [contig 184] FULL
          Length = 740

 Score = 32.3 bits (72), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 36/72 (50%), Gaps = 6/72 (8%)

Query: 441 IKSIELQNRELNDKVSMLSSRLETLLDFKKRAKTKILALRDAKRTVKQSIKDAN---LTV 497
           IK++E +   L DK     S LE L D +K  KT  L L DA+  + ++I D N   LT 
Sbjct: 399 IKALEAELSSLRDKYD---SSLEDLYDCRKELKTTKLELADAREAMNETITDINQLKLTF 455

Query: 498 DQLRKQAAETRE 509
           D  ++    T E
Sbjct: 456 DDQKRSWTNTEE 467

>Kpol_316.1 s316 complement(395..2935,2937..5180) [4785 bp, 1594 aa]
            {ON} complement(395..2935,2937..5180) [4785 nt, 1595 aa]
          Length = 1594

 Score = 32.3 bits (72), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 40/139 (28%), Positives = 67/139 (48%), Gaps = 5/139 (3%)

Query: 227  ALQLGDTVNELKDNLTTQVSINAKNEDRIHSLEDQIKTLEAQLEDQSTLKREHAENIATA 286
            + +L + V EL +NL +++  N     RI  L+  +   E   E     K EH++  A +
Sbjct: 962  SYKLENKVVELTENLASKIKENKDLTRRIVELQKSLTDSENLKELFELQKIEHSK--ALS 1019

Query: 287  EEANKKFQDLSSKYRDASLKLDTIQMDR---DEIAIRYDCLKKDHLAISEELSNCKETLN 343
            E+   +  +LS   +   L    +Q  R   DE+  ++D LKK+ L   EEL+N K+ L 
Sbjct: 1020 EKDTIQTTELSQIQQKLDLAQQEVQSSRAELDEMIAKHDELKKESLLQLEELNNTKQLLT 1079

Query: 344  DRETQLKRLQRDVVNVQRE 362
            +  T+   LQ  V  ++ E
Sbjct: 1080 EANTESSDLQGQVNTLKEE 1098

>Kpol_1008.29 s1008 complement(62595..64211) [1617 bp, 538 aa] {ON}
           complement(62595..64211) [1617 nt, 539 aa]
          Length = 538

 Score = 32.0 bits (71), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 37/175 (21%), Positives = 77/175 (44%), Gaps = 22/175 (12%)

Query: 53  SSADLGLQEDIVSDVYDVKNVNPLVEK----FVAKRMK----------IKSRLNSMVRFG 98
           SSA L   + IV+ +++VK  N  +E+    ++ K M+          +    N  +RF 
Sbjct: 18  SSASLTDNDIIVTPIFEVKKENSDLEEAKADYIKKSMQRNSNKNLEKMVVKEKNPKIRFD 77

Query: 99  SNRTKIFDKESILQVPKKEPPRLTPRDSILVVKEQNPQYLEEDSQSDWEQDIPISNPVVL 158
            NR  IFD++   +V K    ++  + S       + + + +  + D E  +   +  + 
Sbjct: 78  CNRILIFDQDK--EVSKSGIQKILTKSS------SSQKSILKKREDDIEDKLYPQDDEIT 129

Query: 159 EGLLRCWDACGIPESEFDDEDLIMTVQKLSYGILQAFNNQGTINRLVKYQQVSKL 213
           + + R +  CG+     +       +++LS  I  AFN +   ++ +K +  S+L
Sbjct: 130 QIVKRMFTLCGVNLKHIEGISFKEQLERLSVSITNAFNTKEMCSKYIKQKLESQL 184

>SAKL0C10604g Chr3 (960046..962115) [2070 bp, 689 aa] {ON} conserved
           hypothetical protein
          Length = 689

 Score = 32.0 bits (71), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 14/52 (26%), Positives = 29/52 (55%), Gaps = 2/52 (3%)

Query: 149 DIPISNP-VVLEGLLR-CWDACGIPESEFDDEDLIMTVQKLSYGILQAFNNQ 198
           ++P+  P   ++G++R  +  CG P+   + +DL+  ++ L Y I  A  N+
Sbjct: 240 ELPVEYPHASIKGIIRKLFVLCGFPQELAEPDDLLFNLETLGYAIATAQGNK 291

>AGR212W Chr7 (1153862..1155955) [2094 bp, 697 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL106C (SSE1) and
           YBR169C (SSE2)
          Length = 697

 Score = 31.6 bits (70), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 38/151 (25%), Positives = 71/151 (47%), Gaps = 23/151 (15%)

Query: 233 TVNEL--KDN-LTTQVSINAKNEDRIHSLEDQIKTLEAQLEDQSTLKREHAENIATAEEA 289
            +NEL  K+N L  Q  + A+ EDR ++LE+ + TL  +L++      E+A   A+ EE 
Sbjct: 546 VLNELIEKENELAAQDKLVAETEDRKNTLEEYVYTLRGKLDE------EYAA-FASDEE- 597

Query: 290 NKKFQDLSSKYRDASLKLDTIQMDRDEIAIRYDCLKKDHLAISEELSNCKETLNDRETQL 349
                   +K +D   K +    D       YD  K  ++A  EEL++    +  R    
Sbjct: 598 -------KTKLKDMLAKAEEWLYDEG-----YDSTKAKYIAKYEELASLGNVIRGRYMAK 645

Query: 350 KRLQRDVVNVQRESQEALDISNKHCSRMATE 380
           +  +R  +  ++E+ +  +++ K  ++ A E
Sbjct: 646 EEEKRQALRAKQEAAQMAEMAEKLAAQRAAE 676

>ACL132C Chr3 complement(120950..123814) [2865 bp, 954 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR045C
           (STU2)
          Length = 954

 Score = 31.2 bits (69), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 26/110 (23%), Positives = 55/110 (50%), Gaps = 7/110 (6%)

Query: 380 ELENAEATWKHNFFLILKQREEQMAISEGLKSQSMKARQELEDLKKRNTESLITLNATGN 439
           EL+ A+A W        K+R+E M      ++Q+ +   E + L+ +  +  + LN    
Sbjct: 715 ELKGAKAKWN-------KERQELMTKLTSFQTQTSQLNSENQMLQDQLNDVQLALNEKTM 767

Query: 440 YIKSIELQNRELNDKVSMLSSRLETLLDFKKRAKTKILALRDAKRTVKQS 489
            ++S +LQ  +L ++++ L S L+T L+ K    T + ++ +  + +  S
Sbjct: 768 LLRSKDLQITKLKNRLATLESELDTALNAKHSPDTPVKSVLEGIQAISPS 817

>CAGL0B03641g Chr2 (363897..366863) [2967 bp, 988 aa] {ON} similar
           to uniprot|P27895 Saccharomyces cerevisiae YEL061c CIN8
           Kinesin-like protein
          Length = 988

 Score = 31.2 bits (69), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 38/133 (28%), Positives = 66/133 (49%), Gaps = 7/133 (5%)

Query: 248 NAKNEDRIHSLEDQIKTLEAQLEDQSTLK---REHAENIATAEEANKKFQDLSSKYRDAS 304
           NA  +  I SL+D + TL++ L++Q T +   R   +++  A E  KK   L  +++   
Sbjct: 558 NACYKANIASLKDNVVTLQSSLKEQITKETNIRSLLKDVQGANEEMKKTIHL-FEFKQQE 616

Query: 305 LKLDTIQMDRDEIAIRYDCLKKDHLAISEELSNCKETLNDRETQLKRLQRDVVNVQRESQ 364
           L+        DEI+   D LKK H+   +   + K+T  +    L RL+++VV V + ++
Sbjct: 617 LQQSISTFISDEISNIRDTLKK-HIEYLQNNGDLKDT--EISGNLMRLEKEVVKVIKAAE 673

Query: 365 EALDISNKHCSRM 377
           E    S   C +M
Sbjct: 674 EEASKSYGECVKM 686

>NCAS0D01510 Chr4 complement(282977..285679) [2703 bp, 900 aa] {ON}
           Anc_5.94 YHR154W
          Length = 900

 Score = 31.2 bits (69), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 28/42 (66%), Gaps = 2/42 (4%)

Query: 223 DLLEALQLGDTVNELKDNLTTQVSINAKNEDRIHSLEDQIKT 264
           +L++AL  G TVN L  + TT +  N +N+  I SLE+Q+KT
Sbjct: 151 ELIQAL--GGTVNNLLCSRTTHLITNNENDPIITSLEEQVKT 190

>Smik_4.622 Chr4 (1112573..1115407) [2835 bp, 944 aa] {ON} YDR356W
           (REAL)
          Length = 944

 Score = 31.2 bits (69), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 43/154 (27%), Positives = 77/154 (50%), Gaps = 29/154 (18%)

Query: 192 LQAFNNQ-GTINRLVKYQQV---SKLTEDFEQCWLDLLEALQ----LGDTVNELKDNLTT 243
           LQ   N+  T N+LV  ++V   S   E+ E+    L E+ +    + D V+EL++N   
Sbjct: 200 LQELKNELNTKNKLVNSKKVEDHSGCIEERERMERKLTESEKKLKTMNDQVHELENNANV 259

Query: 244 QVSINAKNEDRIHSLEDQIKTLEAQLEDQSTLKREHAENIATAEEANKKFQDLSSKYRDA 303
           Q S       R+ S ED +K L  QL           E+ ++AEE +K+ +  +S+ +  
Sbjct: 260 QNS-------RVKSKEDDLKRLLNQL----------NESKSSAEEKDKQLESKNSELKKR 302

Query: 304 SLKLDTIQMDRDEIAIRYDCLKKDHLAISEELSN 337
           + +L+ +++  DE+    D L ++  + SE L+N
Sbjct: 303 TNELNELKIKSDEV----DTLLQEKKSESERLTN 332

>KNAG0A03400 Chr1 complement(431077..433149) [2073 bp, 690 aa] {ON}
           Anc_8.590 YBR169C
          Length = 690

 Score = 31.2 bits (69), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 34/142 (23%), Positives = 65/142 (45%), Gaps = 30/142 (21%)

Query: 236 ELKDNLTTQVSINAKNEDRIHSLEDQIKTLEAQLEDQSTLKREHAENIATAEEANKKFQD 295
           E ++ +T Q  + A+ EDR ++LE+ I TL  +L++      E+A+  + AE+   K +D
Sbjct: 552 EKENEMTAQDKLVAETEDRKNALEEYIYTLRGKLDE------EYADFASDAEKT--KLKD 603

Query: 296 LSSK-----YRDASLKLDTIQMDRDEIAIRYDCLKKDHLAISEELSNCKETLNDRETQLK 350
           + +K     Y D                  +D +K  ++A  EEL+     +  R    +
Sbjct: 604 MLAKTEEWLYDDG-----------------FDSIKAKYIAKYEELAALGNLVKGRYQAKE 646

Query: 351 RLQRDVVNVQRESQEALDISNK 372
             +R  +  + E+ +  D+S K
Sbjct: 647 EEKRQALRSKNEASQMADLSAK 668

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.128    0.347 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 56,183,746
Number of extensions: 2466305
Number of successful extensions: 14559
Number of sequences better than 10.0: 1023
Number of HSP's gapped: 14312
Number of HSP's successfully gapped: 1716
Length of query: 567
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 452
Effective length of database: 40,294,809
Effective search space: 18213253668
Effective search space used: 18213253668
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 68 (30.8 bits)