Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_56.232426.65ON25625612201e-171
KLTH0G15444g6.65ON2632648691e-118
SAKL0A08426g6.65ON2991716183e-79
NCAS0F003306.65ON2812155893e-75
Smik_15.3526.65ON2882435712e-72
Suva_8.2276.65ON2872395661e-71
AGR270W6.65ON2942265652e-71
ZYRO0D14190g6.65ON2951775626e-71
YOR174W (MED4)6.65ON2842345616e-71
CAGL0L04620g6.65ON2641825511e-69
Kpol_1042.116.65ON2921775512e-69
Skud_15.3366.65ON2861925271e-65
TBLA0G005506.65ON3181855255e-65
KNAG0M010206.65ON2792115121e-63
Ecym_31246.65ON2742205111e-63
NDAI0J013206.65ON3341665162e-63
KAFR0G025006.65ON2891855113e-63
TPHA0F025906.65ON3061774899e-60
KLLA0F20185g6.65ON2851664843e-59
TDEL0G040606.65ON2201634427e-54
KLTH0F06006g1.229ON400111780.22
Kwal_33.140991.229ON394111760.36
Skud_10.911.229ON38775740.54
Suva_6.2041.229ON387116701.9
YJL125C (GCD14)1.229ON383136701.9
Kwal_55.209437.154ON123067675.9
TDEL0H011101.229ON37977666.0
Kpol_1031.311.229ON37638657.0
Smik_10.1101.229ON387116658.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_56.23242
         (256 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_56.23242 s56 (459387..460157) [771 bp, 256 aa] {ON} YOR174W...   474   e-171
KLTH0G15444g Chr7 complement(1353833..1354624) [792 bp, 263 aa] ...   339   e-118
SAKL0A08426g Chr1 complement(746101..747000) [900 bp, 299 aa] {O...   242   3e-79
NCAS0F00330 Chr6 (53650..54495) [846 bp, 281 aa] {ON} Anc_6.65 Y...   231   3e-75
Smik_15.352 Chr15 (614812..615678) [867 bp, 288 aa] {ON} YOR174W...   224   2e-72
Suva_8.227 Chr8 (408722..409585) [864 bp, 287 aa] {ON} YOR174W (...   222   1e-71
AGR270W Chr7 (1244264..1245148) [885 bp, 294 aa] {ON} Syntenic h...   222   2e-71
ZYRO0D14190g Chr4 (1200325..1201212) [888 bp, 295 aa] {ON} simil...   221   6e-71
YOR174W Chr15 (658747..659601) [855 bp, 284 aa] {ON}  MED4Subuni...   220   6e-71
CAGL0L04620g Chr12 (533791..534585) [795 bp, 264 aa] {ON} simila...   216   1e-69
Kpol_1042.11 s1042 (21260..22138) [879 bp, 292 aa] {ON} (21260.....   216   2e-69
Skud_15.336 Chr15 (607340..608200) [861 bp, 286 aa] {ON} YOR174W...   207   1e-65
TBLA0G00550 Chr7 (115655..116611) [957 bp, 318 aa] {ON} Anc_6.65...   206   5e-65
KNAG0M01020 Chr13 complement(180570..181409) [840 bp, 279 aa] {O...   201   1e-63
Ecym_3124 Chr3 complement(232769..233593) [825 bp, 274 aa] {ON} ...   201   1e-63
NDAI0J01320 Chr10 complement(308327..309331) [1005 bp, 334 aa] {...   203   2e-63
KAFR0G02500 Chr7 complement(519629..520498) [870 bp, 289 aa] {ON...   201   3e-63
TPHA0F02590 Chr6 (565725..566645) [921 bp, 306 aa] {ON} Anc_6.65...   192   9e-60
KLLA0F20185g Chr6 complement(1882094..1882951) [858 bp, 285 aa] ...   191   3e-59
TDEL0G04060 Chr7 complement(741796..742458) [663 bp, 220 aa] {ON...   174   7e-54
KLTH0F06006g Chr6 complement(534961..536163) [1203 bp, 400 aa] {...    35   0.22 
Kwal_33.14099 s33 complement(528108..529292) [1185 bp, 394 aa] {...    34   0.36 
Skud_10.91 Chr10 complement(160617..161780) [1164 bp, 387 aa] {O...    33   0.54 
Suva_6.204 Chr6 (363194..364357) [1164 bp, 387 aa] {ON} YJL125C ...    32   1.9  
YJL125C Chr10 complement(185528..186679) [1152 bp, 383 aa] {ON} ...    32   1.9  
Kwal_55.20943 s55 complement(620378..624070) [3693 bp, 1230 aa] ...    30   5.9  
TDEL0H01110 Chr8 complement(197953..199092) [1140 bp, 379 aa] {O...    30   6.0  
Kpol_1031.31 s1031 (72969..74099) [1131 bp, 376 aa] {ON} (72969....    30   7.0  
Smik_10.110 Chr10 complement(183201..184364) [1164 bp, 387 aa] {...    30   8.6  

>Kwal_56.23242 s56 (459387..460157) [771 bp, 256 aa] {ON} YOR174W
           (MED4) - Stoichiometric member of mediator complex
           [contig 183] FULL
          Length = 256

 Score =  474 bits (1220), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 234/256 (91%), Positives = 234/256 (91%)

Query: 1   MSTSSVHKNPEVERPTNAESRLSKAQIYSDICEFEETLGKLVASVDKFNPDLKIAESLIE 60
           MSTSSVHKNPEVERPTNAESRLSKAQIYSDICEFEETLGKLVASVDKFNPDLKIAESLIE
Sbjct: 1   MSTSSVHKNPEVERPTNAESRLSKAQIYSDICEFEETLGKLVASVDKFNPDLKIAESLIE 60

Query: 61  VDKRLSKTLESLPRYDEIDLRAKELDQKHLETDERMVRILETLTECSTDLNALPMLEQVE 120
           VDKRLSKTLESLPRYDEIDLRAKELDQKHLETDERMVRILETLTECSTDLNALPMLEQVE
Sbjct: 61  VDKRLSKTLESLPRYDEIDLRAKELDQKHLETDERMVRILETLTECSTDLNALPMLEQVE 120

Query: 121 FERQTMLKQREKVFTNVLLDYAMKLAKFTHVPPTFDKGAVGPNNFVWPAEDAMRRGMLAI 180
           FERQTMLKQREKVFTNVLLDYAMKLAKFTHVPPTFDKGAVGPNNFVWPAEDAMRRGMLAI
Sbjct: 121 FERQTMLKQREKVFTNVLLDYAMKLAKFTHVPPTFDKGAVGPNNFVWPAEDAMRRGMLAI 180

Query: 181 ASLQASEDAKKPXXXXXXXXXXXXKQPQSSPQLKVEEPMQRRDSFEFNGTGTKSPESEKA 240
           ASLQASEDAKKP            KQPQSSPQLKVEEPMQRRDSFEFNGTGTKSPESEKA
Sbjct: 181 ASLQASEDAKKPETGAAQTAEETTKQPQSSPQLKVEEPMQRRDSFEFNGTGTKSPESEKA 240

Query: 241 XXXXXXXXXXFNSDEL 256
                     FNSDEL
Sbjct: 241 DDDIDLDLDLFNSDEL 256

>KLTH0G15444g Chr7 complement(1353833..1354624) [792 bp, 263 aa]
           {ON} some similarities with uniprot|Q12343 Saccharomyces
           cerevisiae YOR174W MED4 Member of RNA Polymerase II
           transcriptional regulation mediator Stoichiometric
           member of mediator complex
          Length = 263

 Score =  339 bits (869), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 170/264 (64%), Positives = 200/264 (75%), Gaps = 9/264 (3%)

Query: 1   MSTSSVHKNPEVERPTNAESRLSKAQIYSDICEFEETLGKLVASVDKFNPDLKIAESLIE 60
           MSTS+ H+NP  +R  + E+ LSK Q+Y+DICEFE+TLGKLVASVD+FNPDL++A +LIE
Sbjct: 1   MSTSTGHRNPGPDRSDSVENPLSKLQVYNDICEFEDTLGKLVASVDRFNPDLELARALIE 60

Query: 61  VDKRLSKTLESLPRYDEIDLRAKELDQKHLETDERMVRILETLTECSTDLNALPMLEQVE 120
            DK+L K+LE LP+YDEID RAK LD++H +TDE+ +RILETLTEC +DLNALPMLEQVE
Sbjct: 61  ADKQLYKSLECLPKYDEIDTRAKTLDEEHRDTDEKTIRILETLTECGSDLNALPMLEQVE 120

Query: 121 FERQTMLKQREKVFTNVLLDYAMKLAKFTHVPPTFDKGAVGPNNFVWPAEDAMRRGMLAI 180
           FER+TMLKQREKVFT+VLLDYAMKLAKFTHVPPTFDKG VGPNNFVWPAEDAMRRGMLAI
Sbjct: 121 FERETMLKQREKVFTDVLLDYAMKLAKFTHVPPTFDKGTVGPNNFVWPAEDAMRRGMLAI 180

Query: 181 ASLQASEDAKKPXXXXXXXXXXXXKQPQS--------SPQLKVEEPMQRRDSFEFNGTGT 232
           ASL+ASE A               K  ++        SP  K EEP+ RR SF F+G+G 
Sbjct: 181 ASLRASEGANAQEQQASSEQKTSEKSSENEEAQTDIRSPDTK-EEPVARRPSFGFDGSGA 239

Query: 233 KSPESEKAXXXXXXXXXXFNSDEL 256
           K  ESEKA          FNS+E 
Sbjct: 240 KDHESEKADDDIDLDLDLFNSEEF 263

>SAKL0A08426g Chr1 complement(746101..747000) [900 bp, 299 aa] {ON}
           similar to gnl|GLV|KLLA0F20185g Kluyveromyces lactis
           KLLA0F20185g and weakly similar to YOR174W
           uniprot|Q12343 Saccharomyces cerevisiae YOR174W MED4
           Member of RNA Polymerase II transcriptional regulation
           mediator Stoichiometric member of mediator complex
          Length = 299

 Score =  242 bits (618), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 111/171 (64%), Positives = 138/171 (80%)

Query: 22  LSKAQIYSDICEFEETLGKLVASVDKFNPDLKIAESLIEVDKRLSKTLESLPRYDEIDLR 81
           LS+ ++Y+DICE+EETLGKLV+SVDKF PDLK+A+ LIE DK+L K LE  P+YD+ID R
Sbjct: 44  LSRVEVYADICEYEETLGKLVSSVDKFKPDLKVAQELIETDKKLFKALEEFPKYDKIDGR 103

Query: 82  AKELDQKHLETDERMVRILETLTECSTDLNALPMLEQVEFERQTMLKQREKVFTNVLLDY 141
             +L+++  E D++  +ILE L  C   LN+LP LEQV  ER TMLKQREK+++ VLLDY
Sbjct: 104 LNDLEKQSQEVDKKTSKILEVLNGCHAQLNSLPALEQVLLERDTMLKQREKIYSGVLLDY 163

Query: 142 AMKLAKFTHVPPTFDKGAVGPNNFVWPAEDAMRRGMLAIASLQASEDAKKP 192
           AMKLAKFT VPPTFDKG VGPNNF+WPAEDAMRRGMLA+ASL++ E  + P
Sbjct: 164 AMKLAKFTRVPPTFDKGMVGPNNFIWPAEDAMRRGMLAMASLKSKELTRIP 214

>NCAS0F00330 Chr6 (53650..54495) [846 bp, 281 aa] {ON} Anc_6.65
           YOR174W
          Length = 281

 Score =  231 bits (589), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 115/215 (53%), Positives = 149/215 (69%), Gaps = 5/215 (2%)

Query: 16  TNAESRLSKAQIYSDICEFEETLGKLVASVDKFNPDLKIAESLIEVDKRLSKTLESLPRY 75
           +N E  +SK QIYSD+C +E+ L  LV SVDKF PD+  A  LIEVD+ L +TL+S   Y
Sbjct: 35  SNDEDDISKVQIYSDLCSYEQKLANLVNSVDKFKPDMNAARELIEVDRHLFQTLDSFEEY 94

Query: 76  DEIDLRAKELDQKHLETDERMVRILETLTECSTDLNALPMLEQVEFERQTMLKQREKVFT 135
           D+ID   K+L+ + +E D R   IL  L EC  +LNALPML+QVEFE +T+L+QR K+ +
Sbjct: 95  DKIDNSLKKLNAESIELDARTKEILGILNECHDELNALPMLKQVEFEMETILQQRSKINS 154

Query: 136 NVLLDYAMKLAKFTHVPPTFDKGAVGPNNFVWPAEDAMRRGMLAIASLQASEDAKKPXXX 195
           +VLLDYA KL+KFT +PPTFDKG++GPNNF+WPAEDA+RRGMLA+ASL A E  K P   
Sbjct: 155 SVLLDYATKLSKFTKIPPTFDKGSIGPNNFIWPAEDALRRGMLALASLHADELTKAPGAH 214

Query: 196 XXXXXXXXXKQPQSSPQLKVEEPM-QRRDSFEFNG 229
                      P+ S  +  EEP+  RR+SF F+G
Sbjct: 215 EGEEELI----PKGSEPIAQEEPVTTRRESFTFSG 245

>Smik_15.352 Chr15 (614812..615678) [867 bp, 288 aa] {ON} YOR174W
           (REAL)
          Length = 288

 Score =  224 bits (571), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 113/243 (46%), Positives = 153/243 (62%), Gaps = 7/243 (2%)

Query: 1   MSTSSVHKNPEVERPTNAESRLSKAQIYSDICEFEETLGKLVASVDKFNPDLKIAESLIE 60
           M +SSV    E     N+E +LSK Q+Y D+C +E+TL KLV SVD+F PD+ +A  LI+
Sbjct: 16  MKSSSVSLVVEATSNMNSEDKLSKVQLYEDLCRYEDTLKKLVESVDRFKPDIDVARDLIK 75

Query: 61  VDKRLSKTLESLPRYDEIDLRAKELDQKHLETDERMVRILETLTECSTDLNALPMLEQVE 120
           +D+ L   ++ L  YD ID   +++D+   E D +  RILE + EC  +L ALPMLEQVE
Sbjct: 76  IDESLFNNVDLLSEYDNIDRNLRKIDKDSEELDSKTKRILEIMNECHDELGALPMLEQVE 135

Query: 121 FERQTMLKQREKVFTNVLLDYAMKLAKFTHVPPTFDKGAVGPNNFVWPAEDAMRRGMLAI 180
           FE+ T+L+QR K+ +  LLDYA KL+KFT +PPTFDKG++GPNNF+WPAEDA+RRGMLA+
Sbjct: 136 FEKNTILQQRSKINSTALLDYATKLSKFTRIPPTFDKGSIGPNNFIWPAEDALRRGMLAM 195

Query: 181 ASLQASEDAKKPXXXXXXXXXXXXKQPQSSPQLKVE-------EPMQRRDSFEFNGTGTK 233
           ASL + E  + P                S  Q  ++       E +   DSF FNGT  K
Sbjct: 196 ASLHSKELTRVPGEEAEEAAETEEVLVSSPSQNGLDNEHKTAKEEVPSTDSFIFNGTANK 255

Query: 234 SPE 236
           + E
Sbjct: 256 NSE 258

>Suva_8.227 Chr8 (408722..409585) [864 bp, 287 aa] {ON} YOR174W
           (REAL)
          Length = 287

 Score =  222 bits (566), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 114/239 (47%), Positives = 154/239 (64%), Gaps = 6/239 (2%)

Query: 1   MSTSSVHKNPEVERPTNAESRLSKAQIYSDICEFEETLGKLVASVDKFNPDLKIAESLIE 60
           + +SSV    E     N+E + SK Q+Y D+C +E+ LGKLV SVD+F P+L+IA+ LI+
Sbjct: 16  IRSSSVSLVAEATSSMNSEHKSSKVQLYEDLCRYEDILGKLVESVDRFKPNLEIAKDLIK 75

Query: 61  VDKRLSKTLESLPRYDEIDLRAKELDQKHLETDERMVRILETLTECSTDLNALPMLEQVE 120
            D+ L   ++ L  YD+IDL  +++D+   E D +  +ILE L EC  +L+ALPMLEQVE
Sbjct: 76  TDESLFNNVKLLADYDKIDLNLRKIDKDSEELDSKTRKILEILNECHDELSALPMLEQVE 135

Query: 121 FERQTMLKQREKVFTNVLLDYAMKLAKFTHVPPTFDKGAVGPNNFVWPAEDAMRRGMLAI 180
           FE++T+L+QR K+ +  LLDYA KL+KFT +PPTFDKG VGPNNF+WPAEDA+RRGMLA+
Sbjct: 136 FEKKTILQQRSKINSTALLDYATKLSKFTRIPPTFDKGTVGPNNFIWPAEDALRRGMLAM 195

Query: 181 ASLQASEDAKKPXXXXXXXX---XXXXKQPQSSPQLKVEEPMQR---RDSFEFNGTGTK 233
           ASL + E  + P                QPQ   +   E   Q    +DSF FNG   K
Sbjct: 196 ASLHSKELTRIPGEEEQETEEVPTDTLSQPQKEKKESSENSPQNSPTKDSFIFNGIANK 254

>AGR270W Chr7 (1244264..1245148) [885 bp, 294 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR174W (MED4)
          Length = 294

 Score =  222 bits (565), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 111/226 (49%), Positives = 150/226 (66%), Gaps = 6/226 (2%)

Query: 19  ESRLSKAQIYSDICEFEETLGKLVASVDKFNPDLKIAESLIEVDKRLSKTLESLPRYDEI 78
           +++L    IY D+C++EE+L +LV SVDKF PDL+ A+ LIE+D +L   L  LP+YD I
Sbjct: 44  QNKLHSVAIYEDLCQYEESLQRLVTSVDKFQPDLEAAQELIEIDSKLYSNLAQLPKYDLI 103

Query: 79  DLRAKELDQKHLETDERMVRILETLTECSTDLNALPMLEQVEFERQTMLKQREKVFTNVL 138
           D + K+L+++  + DER  +IL  L EC  DLN+LPM+EQVEFE  TM KQ++KV ++VL
Sbjct: 104 DSQLKKLEEESKDIDERTAKILGILGECYNDLNSLPMVEQVEFEMATMKKQKDKVNSSVL 163

Query: 139 LDYAMKLAKFTHVPPTFDKGAVGPNNFVWPAEDAMRRGMLAIASLQASEDAKKPXXXXXX 198
           L+YAMKL+KFT VPPTF+K A+GPNNF+WPAEDA+RRGMLA+ASL++ E    P      
Sbjct: 164 LEYAMKLSKFTRVPPTFNKDAIGPNNFIWPAEDAIRRGMLAMASLKSKELTSLPGQSDQE 223

Query: 199 XXXXXXKQ--PQSSPQLKVEEPM----QRRDSFEFNGTGTKSPESE 238
                  +    + P +   EP      RR SFEF G     P S+
Sbjct: 224 AEQASAGKEADTAGPGVSTLEPANGGHNRRGSFEFTGIRKPPPASD 269

>ZYRO0D14190g Chr4 (1200325..1201212) [888 bp, 295 aa] {ON} similar
           to uniprot|Q12343 Saccharomyces cerevisiae YOR174W MED4
           Member of RNA Polymerase II transcriptional regulation
           mediator Stoichiometric member of mediator complex
          Length = 295

 Score =  221 bits (562), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 105/177 (59%), Positives = 130/177 (73%)

Query: 16  TNAESRLSKAQIYSDICEFEETLGKLVASVDKFNPDLKIAESLIEVDKRLSKTLESLPRY 75
            N +  LSK QIY+D+ ++EE L  LV SVD F PD+KI   LIEVDK L K+L+S   Y
Sbjct: 37  NNNDDELSKVQIYADLTQYEEKLAALVESVDNFKPDVKIVHELIEVDKSLYKSLDSFAEY 96

Query: 76  DEIDLRAKELDQKHLETDERMVRILETLTECSTDLNALPMLEQVEFERQTMLKQREKVFT 135
           D ID     LD++  E D +   +LETL+EC   LN LPMLEQVEFE+Q++LKQR KV +
Sbjct: 97  DRIDSELNRLDKESNELDRKTKEVLETLSECYEMLNGLPMLEQVEFEKQSILKQRSKVNS 156

Query: 136 NVLLDYAMKLAKFTHVPPTFDKGAVGPNNFVWPAEDAMRRGMLAIASLQASEDAKKP 192
           +VLL+YA KL+KFT +PPTFDKG +GPNNFVWPAEDA+RRGMLAIASL + E  + P
Sbjct: 157 SVLLNYATKLSKFTKIPPTFDKGTIGPNNFVWPAEDALRRGMLAIASLHSKEMTRIP 213

>YOR174W Chr15 (658747..659601) [855 bp, 284 aa] {ON}  MED4Subunit
           of the RNA polymerase II mediator complex; associates
           with core polymerase subunits to form the RNA polymerase
           II holoenzyme; essential for transcriptional regulation
          Length = 284

 Score =  220 bits (561), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 113/234 (48%), Positives = 151/234 (64%), Gaps = 3/234 (1%)

Query: 1   MSTSSVHKNPEVERPTNAESRLSKAQIYSDICEFEETLGKLVASVDKFNPDLKIAESLIE 60
           + +SSV    E    TN+E +LSK Q+Y D+C +E+TL KLV SVD+F P+L IA+ LI 
Sbjct: 16  IRSSSVSLVAEATSNTNSEDKLSKVQLYEDLCRYEDTLSKLVESVDRFKPNLDIAKDLIR 75

Query: 61  VDKRLSKTLESLPRYDEIDLRAKELDQKHLETDERMVRILETLTECSTDLNALPMLEQVE 120
            D+ L + ++ L  YD I    +++D+   E D +  +ILE L EC  +L ALPMLEQVE
Sbjct: 76  TDEALFENVKLLAEYDNIYRNLQKIDKDSEELDSKTRKILEILNECHDELKALPMLEQVE 135

Query: 121 FERQTMLKQREKVFTNVLLDYAMKLAKFTHVPPTFDKGAVGPNNFVWPAEDAMRRGMLAI 180
           FE+ T+L+QR K+ +  LLDYA KL+KFT +PPTFDKGAVGPNNF+WPAEDA+RRGMLA+
Sbjct: 136 FEKNTILQQRSKINSTELLDYATKLSKFTKIPPTFDKGAVGPNNFIWPAEDALRRGMLAM 195

Query: 181 ASLQASEDAKKPXXXXXXXXXXXXKQPQS---SPQLKVEEPMQRRDSFEFNGTG 231
           ASL + E  + P               QS     Q+  +E   + DSF F+GT 
Sbjct: 196 ASLHSKELTRIPGEEVEETEVPTVPPSQSEEQKGQMAKKEGTPKTDSFIFDGTA 249

>CAGL0L04620g Chr12 (533791..534585) [795 bp, 264 aa] {ON} similar
           to uniprot|Q12343 Saccharomyces cerevisiae YOR174w MED4
          Length = 264

 Score =  216 bits (551), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 103/182 (56%), Positives = 132/182 (72%)

Query: 11  EVERPTNAESRLSKAQIYSDICEFEETLGKLVASVDKFNPDLKIAESLIEVDKRLSKTLE 70
           E    T +E  L K Q+YSD+C +EE L KLV SVD F P L+I + LIE DK+L  TL+
Sbjct: 6   ESNSGTISEQELDKVQLYSDLCLYEEALTKLVDSVDNFKPQLEIGKQLIEADKKLYSTLD 65

Query: 71  SLPRYDEIDLRAKELDQKHLETDERMVRILETLTECSTDLNALPMLEQVEFERQTMLKQR 130
            LP+YD +  R + LD +  + D++   IL  L EC  DLNALP+LE+VEFE++ +LKQR
Sbjct: 66  LLPQYDSVFTRLRTLDDEISKVDQQTKNILSILNECHDDLNALPLLEEVEFEKKMILKQR 125

Query: 131 EKVFTNVLLDYAMKLAKFTHVPPTFDKGAVGPNNFVWPAEDAMRRGMLAIASLQASEDAK 190
           EK+ +NVLL+YA KLAKFT +PPTFDKG +GPNNF+WPAEDA+R+GMLA+ASL   E  K
Sbjct: 126 EKIKSNVLLEYATKLAKFTKIPPTFDKGTIGPNNFIWPAEDALRKGMLAMASLHGKELTK 185

Query: 191 KP 192
            P
Sbjct: 186 LP 187

>Kpol_1042.11 s1042 (21260..22138) [879 bp, 292 aa] {ON}
           (21260..22138) [879 nt, 293 aa]
          Length = 292

 Score =  216 bits (551), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 103/177 (58%), Positives = 133/177 (75%)

Query: 16  TNAESRLSKAQIYSDICEFEETLGKLVASVDKFNPDLKIAESLIEVDKRLSKTLESLPRY 75
            N  + LSK QIY+DI E+E TL KLV SVDKF PD+K+A  LI+VD+RL K+L+S   Y
Sbjct: 36  NNESNDLSKVQIYNDISEYENTLFKLVESVDKFKPDVKLAHQLIDVDERLFKSLDSFVEY 95

Query: 76  DEIDLRAKELDQKHLETDERMVRILETLTECSTDLNALPMLEQVEFERQTMLKQREKVFT 135
           D+I  + +E D++  E D +   IL TL EC   LN+LPMLEQVEFE+  +LKQR K+ +
Sbjct: 96  DKISTKLEECDKEAAELDTKTKEILGTLNECHGLLNSLPMLEQVEFEKDIILKQRSKINS 155

Query: 136 NVLLDYAMKLAKFTHVPPTFDKGAVGPNNFVWPAEDAMRRGMLAIASLQASEDAKKP 192
            +LLDYA KL+KFT +PPTF+KG++GPNNF+WPAEDA+RRGMLA+ASL + E  K P
Sbjct: 156 KLLLDYATKLSKFTKIPPTFNKGSIGPNNFIWPAEDALRRGMLAMASLHSKELTKLP 212

>Skud_15.336 Chr15 (607340..608200) [861 bp, 286 aa] {ON} YOR174W
           (REAL)
          Length = 286

 Score =  207 bits (527), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 99/192 (51%), Positives = 131/192 (68%)

Query: 1   MSTSSVHKNPEVERPTNAESRLSKAQIYSDICEFEETLGKLVASVDKFNPDLKIAESLIE 60
           + +SSV    E     N+E +LSK Q+Y D+C +E  L KLV SVD+F PDL +A  LI 
Sbjct: 16  IKSSSVSLVAEAASNMNSEDKLSKVQLYEDLCRYEGVLSKLVESVDRFKPDLDVARDLIS 75

Query: 61  VDKRLSKTLESLPRYDEIDLRAKELDQKHLETDERMVRILETLTECSTDLNALPMLEQVE 120
            D+ L   ++ L  YD ID   +++D+   E D +  +ILE L EC  +L+ LP LEQVE
Sbjct: 76  ADESLFNNVKLLADYDNIDRNLQKIDKDSEELDSKSRKILEILNECHDELSGLPTLEQVE 135

Query: 121 FERQTMLKQREKVFTNVLLDYAMKLAKFTHVPPTFDKGAVGPNNFVWPAEDAMRRGMLAI 180
           FE+ T+L+QR K+ +  LLDYA KL+KFT +PPTFDKG VGPNNF+WPAEDA+RRGMLA+
Sbjct: 136 FEKNTILQQRSKINSTALLDYATKLSKFTKIPPTFDKGTVGPNNFIWPAEDALRRGMLAM 195

Query: 181 ASLQASEDAKKP 192
           ASL + E  + P
Sbjct: 196 ASLHSKELTRVP 207

>TBLA0G00550 Chr7 (115655..116611) [957 bp, 318 aa] {ON} Anc_6.65
           YOR174W
          Length = 318

 Score =  206 bits (525), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 96/185 (51%), Positives = 133/185 (71%)

Query: 3   TSSVHKNPEVERPTNAESRLSKAQIYSDICEFEETLGKLVASVDKFNPDLKIAESLIEVD 62
           ++S+ +   ++   +    LSK Q Y+D+ ++EETL KL +SVDK+ PDL+ A  LI++D
Sbjct: 18  STSISEGDVLQDNNDKNDELSKIQTYNDLIQYEETLSKLSSSVDKYKPDLQYAYDLIDID 77

Query: 63  KRLSKTLESLPRYDEIDLRAKELDQKHLETDERMVRILETLTECSTDLNALPMLEQVEFE 122
           ++L  TL+S  +YDEI  + K+L+      DE+   +L++L +C   LN LPMLEQVEFE
Sbjct: 78  RKLYSTLDSFVKYDEISTKLKKLEIDTKALDEKTKSVLDSLNDCHELLNTLPMLEQVEFE 137

Query: 123 RQTMLKQREKVFTNVLLDYAMKLAKFTHVPPTFDKGAVGPNNFVWPAEDAMRRGMLAIAS 182
           + TMLKQREK+ + VLLDYA KLAKFT +PPTF+K  +GPNNF+WPAEDA+RRGMLA+AS
Sbjct: 138 KNTMLKQREKINSKVLLDYATKLAKFTKIPPTFNKNTLGPNNFIWPAEDALRRGMLAVAS 197

Query: 183 LQASE 187
               E
Sbjct: 198 AHTEE 202

>KNAG0M01020 Chr13 complement(180570..181409) [840 bp, 279 aa] {ON}
           Anc_6.65 YOR174W
          Length = 279

 Score =  201 bits (512), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 102/211 (48%), Positives = 134/211 (63%), Gaps = 2/211 (0%)

Query: 22  LSKAQIYSDICEFEETLGKLVASVDKFNPDLKIAESLIEVDKRLSKTLESLPRYDEIDLR 81
           L K +IYS I E+E+TL  LV SVD + PD+ +A+ L++ DK L  +L+    YDEI  R
Sbjct: 40  LKKVRIYSGIVEYEDTLAALVESVDSYKPDMAVAQRLVDADKELFASLDKFKEYDEISTR 99

Query: 82  AKELDQKHLETDERMVRILETLTECSTDLNALPMLEQVEFERQTMLKQREKVFTNVLLDY 141
             EL  K    D +   ILE L EC  +LN LP LEQV+FE  T+L+QREK+ ++ LLDY
Sbjct: 100 LGELKGKSTALDTKTRDILEKLNECHDELNKLPYLEQVQFEMDTILEQREKINSSELLDY 159

Query: 142 AMKLAKFTHVPPTFDKGAVGPNNFVWPAEDAMRRGMLAIASLQASEDAKKPXXXXXXXXX 201
           A KL+KFT +PPTFDKG++GPNNF+WPAEDA+R+GMLAIA+L + E  + P         
Sbjct: 160 ATKLSKFTRIPPTFDKGSIGPNNFIWPAEDALRKGMLAIAALHSRELTRIPGQDDAEDKK 219

Query: 202 XXXKQPQSSPQLKVEEPMQRRDSFEFNGTGT 232
              ++P       V E  +RR SF F  T T
Sbjct: 220 KQTEKPDVPEPAPVTE--ERRSSFVFGDTST 248

>Ecym_3124 Chr3 complement(232769..233593) [825 bp, 274 aa] {ON}
           similar to Ashbya gossypii AGR270W
          Length = 274

 Score =  201 bits (511), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 109/220 (49%), Positives = 147/220 (66%), Gaps = 10/220 (4%)

Query: 20  SRLSKAQIYSDICEFEETLGKLVASVDKFNPDLKIAESLIEVDKRLSKTLESLPRYDEID 79
           + + +  +Y D+C+FEE L KLV SVDKF+PDL+ A+ LI  D +L  TLE LP YD ID
Sbjct: 20  NHVQQVTLYKDLCQFEEDLQKLVVSVDKFSPDLQAAQDLINSDLKLYSTLEQLPLYDSID 79

Query: 80  LRAKELDQKHLETDERMVRILETLTECSTDLNALPMLEQVEFERQTMLKQREKVFTNVLL 139
           ++ K+LD +  E DER  +IL  L +C  +LN LPM+EQVEFE + M KQ+EK+ + VLL
Sbjct: 80  IQLKQLDNESQEIDERTGKILSILDKCYNNLNKLPMVEQVEFEMKMMKKQKEKIKSGVLL 139

Query: 140 DYAMKLAKFTHVPPTFDKGAVGPNNFVWPAEDAMRRGMLAIASLQASEDAKKPXXXXXXX 199
           +YAMKLAKFT VPPTF+K A+GPNNF+WPAEDA+RRGMLA+ASL++ E  + P       
Sbjct: 140 EYAMKLAKFTRVPPTFNKDAIGPNNFIWPAEDAIRRGMLAMASLKSEELTRIPVELNSEE 199

Query: 200 XXXXXKQPQSSPQLKV----------EEPMQRRDSFEFNG 229
                ++ QS  + +V           +P  + +SFEF G
Sbjct: 200 PQEPPQKGQSQEEDEVTPTHSSDTPSSKPDSKSESFEFTG 239

>NDAI0J01320 Chr10 complement(308327..309331) [1005 bp, 334 aa] {ON}
           Anc_6.65 YOR174W
          Length = 334

 Score =  203 bits (516), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 94/166 (56%), Positives = 122/166 (73%)

Query: 22  LSKAQIYSDICEFEETLGKLVASVDKFNPDLKIAESLIEVDKRLSKTLESLPRYDEIDLR 81
           LS+ +IY DI  +E+ L +L+ SVDKF P+L IA+ LI+ DK L  TL S  +YDEIDL 
Sbjct: 76  LSEVRIYDDIITYEKALSRLIDSVDKFKPNLNIAQELIQADKSLFDTLNSFIQYDEIDLH 135

Query: 82  AKELDQKHLETDERMVRILETLTECSTDLNALPMLEQVEFERQTMLKQREKVFTNVLLDY 141
            K L+ K  + DE     L+TL EC  DLN LP L Q+EFE  T+L QR K+ + +LLDY
Sbjct: 136 LKALETKASKIDELTQSTLQTLNECHDDLNKLPTLPQIEFELNTILNQRTKINSTILLDY 195

Query: 142 AMKLAKFTHVPPTFDKGAVGPNNFVWPAEDAMRRGMLAIASLQASE 187
           A KL+KFT +PPTFDKG++GPNNF+WPAED++RRGMLA+ASL+A +
Sbjct: 196 ATKLSKFTKIPPTFDKGSIGPNNFIWPAEDSLRRGMLAMASLKADQ 241

>KAFR0G02500 Chr7 complement(519629..520498) [870 bp, 289 aa] {ON}
           Anc_6.65 YOR174W
          Length = 289

 Score =  201 bits (511), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 90/185 (48%), Positives = 133/185 (71%)

Query: 3   TSSVHKNPEVERPTNAESRLSKAQIYSDICEFEETLGKLVASVDKFNPDLKIAESLIEVD 62
           ++S+  +  ++  + A   ++K  IYSD+ ++EETL +L+ S+D + PD KIA+ LI++D
Sbjct: 22  STSITNSNNIDSASGASPAITKVGIYSDLSQYEETLSRLIQSIDTYKPDKKIAQELIDID 81

Query: 63  KRLSKTLESLPRYDEIDLRAKELDQKHLETDERMVRILETLTECSTDLNALPMLEQVEFE 122
            +L  +L+S  +YD I  R K+ +++  E+  +   ILETL EC   LN LP ++QV FE
Sbjct: 82  SKLFNSLDSFVQYDRISSRLKDFEKQEKESTLKTKEILETLNECHNALNLLPTVDQVHFE 141

Query: 123 RQTMLKQREKVFTNVLLDYAMKLAKFTHVPPTFDKGAVGPNNFVWPAEDAMRRGMLAIAS 182
             TML+QR+K+ ++VLLDYA KL+KFT +PPTFDKG++GPNNFVWPAEDA+RRGMLA+A+
Sbjct: 142 MNTMLEQRKKINSSVLLDYATKLSKFTKIPPTFDKGSIGPNNFVWPAEDALRRGMLALAA 201

Query: 183 LQASE 187
               E
Sbjct: 202 SHTDE 206

>TPHA0F02590 Chr6 (565725..566645) [921 bp, 306 aa] {ON} Anc_6.65
           YOR174W
          Length = 306

 Score =  192 bits (489), Expect = 9e-60,   Method: Compositional matrix adjust.
 Identities = 89/177 (50%), Positives = 127/177 (71%)

Query: 16  TNAESRLSKAQIYSDICEFEETLGKLVASVDKFNPDLKIAESLIEVDKRLSKTLESLPRY 75
           T A   L+   IY+DI  +E+TL KLV+S+D F PD+++A++LIEVDKRL K L S   Y
Sbjct: 51  TAAVDSLANVAIYNDIKNYEDTLIKLVSSIDNFRPDVEVAKTLIEVDKRLYKNLGSFKEY 110

Query: 76  DEIDLRAKELDQKHLETDERMVRILETLTECSTDLNALPMLEQVEFERQTMLKQREKVFT 135
           DEID +  ++     + D +   IL+ L +    LN+LPMLE++ FER  M ++++K+ +
Sbjct: 111 DEIDTKISKIKDDSEKLDLQTKHILDILNDSRNMLNSLPMLEEIYFERDVMHEKQKKINS 170

Query: 136 NVLLDYAMKLAKFTHVPPTFDKGAVGPNNFVWPAEDAMRRGMLAIASLQASEDAKKP 192
            +LLDYA K++KFT +PPTF+KG++GPNNF+WPAEDA+RRGMLA+AS+  SE  K P
Sbjct: 171 KILLDYATKISKFTKIPPTFNKGSIGPNNFIWPAEDALRRGMLAVASIHRSELTKLP 227

>KLLA0F20185g Chr6 complement(1882094..1882951) [858 bp, 285 aa]
           {ON} similar to uniprot|Q12343 Saccharomyces cerevisiae
           YOR174W MED4 Member of RNA Polymerase II transcriptional
           regulation mediator Stoichiometric member of mediator
           complex
          Length = 285

 Score =  191 bits (484), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 90/166 (54%), Positives = 116/166 (69%)

Query: 22  LSKAQIYSDICEFEETLGKLVASVDKFNPDLKIAESLIEVDKRLSKTLESLPRYDEIDLR 81
           L    IY D+  +EET+ +L  SVD F PDL + + +IE DK+L +TLE    Y +I+  
Sbjct: 32  LQSVGIYQDLERYEETIQQLSKSVDTFKPDLSLIDKVIECDKKLYETLEEFDEYYKIEEE 91

Query: 82  AKELDQKHLETDERMVRILETLTECSTDLNALPMLEQVEFERQTMLKQREKVFTNVLLDY 141
              LD++    D +   ILETL  C   LN LPMLEQVEFE++ MLKQREK+ + V+LDY
Sbjct: 92  LSRLDKEQKNIDNKTREILETLNTCYNSLNELPMLEQVEFEQKVMLKQREKIHSKVVLDY 151

Query: 142 AMKLAKFTHVPPTFDKGAVGPNNFVWPAEDAMRRGMLAIASLQASE 187
           AMKLAKFT  PPTFDK  +GPNNF+WPAED++R+GMLA+ASL+  E
Sbjct: 152 AMKLAKFTRFPPTFDKSMIGPNNFIWPAEDSLRKGMLAMASLKKKE 197

>TDEL0G04060 Chr7 complement(741796..742458) [663 bp, 220 aa] {ON}
           Anc_6.65 YOR174W
          Length = 220

 Score =  174 bits (442), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 84/163 (51%), Positives = 113/163 (69%), Gaps = 3/163 (1%)

Query: 25  AQIYSDICEFEETLGKLVASVDKFNPDLKIAESLIEVDKRLSKTLESLPRYDEIDLRAKE 84
           +Q+Y D+  +EE LG+LV SVD+F PDL  A  L+E D+ L K+L+    YDE+D   + 
Sbjct: 2   SQVYGDLTRYEEALGRLVESVDQFRPDLSCARELVEADRALGKSLDKFGLYDEVDKELQR 61

Query: 85  LDQKHLETDERMVRILETLTECSTDLNALPMLEQVEFERQTMLKQREKVFTNVLLDYAMK 144
           LD++    +    R LETL EC   L+ALPMLEQV+FE++ +L+QR +V + VLL+YA K
Sbjct: 62  LDRESERLNRHTARTLETLDECYRALSALPMLEQVKFEQRKVLEQRGRVNSAVLLEYATK 121

Query: 145 LAKFTHVPPTFDKGAVGPNNFVWPAEDAMRRGMLAIASLQASE 187
           L+KFT  P      AVGPNNFVWPAEDA+RRG LA+A+L + E
Sbjct: 122 LSKFTKAPAGV---AVGPNNFVWPAEDALRRGQLAVAALHSEE 161

>KLTH0F06006g Chr6 complement(534961..536163) [1203 bp, 400 aa] {ON}
           highly similar to uniprot|P46959 Saccharomyces
           cerevisiae YJL125C GCD14 Subunit of tRNA (1-
           methyladenosine) methyltransferase with Gcd10p required
           for the modification of the adenine at position 58 in
           tRNAs especially tRNAi-Met first identified as a
           negative regulator of GCN4 expression
          Length = 400

 Score = 34.7 bits (78), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 27/111 (24%), Positives = 53/111 (47%), Gaps = 16/111 (14%)

Query: 64  RLSKTLESLPRYDEIDLRAKELDQKHLETDERMVRILETLTECSTDLNALPMLEQVEFER 123
           ++ KTLE+L ++   ++   E+  +  E+  +MVR L+         +AL  L  V   +
Sbjct: 238 QVDKTLEALEKHGWTEVEMVEIQGRQYESRRQMVRHLD---------DALQRLRDVRERK 288

Query: 124 QTMLKQREKVFTNVLLDYAMKLAKFTHVPPT----FDKGAV---GPNNFVW 167
           Q  +++R+++F  ++ D      +    P T    F KG+    G +N+ W
Sbjct: 289 QVGVERRKRMFNKIISDQEEPYEERPETPKTQFNPFGKGSRVKEGDSNYSW 339

>Kwal_33.14099 s33 complement(528108..529292) [1185 bp, 394 aa] {ON}
           YJL125C (GCD14) - translational repressor of GCN4
           [contig 105] FULL
          Length = 394

 Score = 33.9 bits (76), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 27/111 (24%), Positives = 54/111 (48%), Gaps = 16/111 (14%)

Query: 64  RLSKTLESLPRYDEIDLRAKELDQKHLETDERMVRILETLTECSTDLNALPMLEQVEFER 123
           ++ KTLE+L ++   D+   E+  +  E+  +MVR L+         +AL  L+ V+  +
Sbjct: 238 QVDKTLEALEKHGWTDMEMVEIQGRQYESRRQMVRSLD---------DALQRLQDVKERK 288

Query: 124 QTMLKQREKVFTNVLLDYAMKLAKFTHVPPT----FDKGAV---GPNNFVW 167
           Q  +++R+++F  ++ +      +    P T    F KG+    G  N+ W
Sbjct: 289 QVGVERRKRMFNKLVSENEEPYEERPETPKTQFNPFGKGSRVKEGDKNYQW 339

>Skud_10.91 Chr10 complement(160617..161780) [1164 bp, 387 aa] {ON}
           YJL125C (REAL)
          Length = 387

 Score = 33.1 bits (74), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 41/75 (54%), Gaps = 9/75 (12%)

Query: 64  RLSKTLESLPRYDEIDLRAKELDQKHLETDERMVRILETLTECSTDLNALPMLEQVEFER 123
           ++ KTLE+L +Y   D+   E+  +  E+  +MVR L+         +AL  L  ++  +
Sbjct: 235 QVDKTLEALEKYGWTDVEMVEIQGRQYESRRQMVRSLD---------DALERLRDIKRHK 285

Query: 124 QTMLKQREKVFTNVL 138
              +++R+++F+N +
Sbjct: 286 LQGVERRKRMFSNTI 300

>Suva_6.204 Chr6 (363194..364357) [1164 bp, 387 aa] {ON} YJL125C
           (REAL)
          Length = 387

 Score = 31.6 bits (70), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 55/116 (47%), Gaps = 21/116 (18%)

Query: 64  RLSKTLESLPRYDEIDLRAKELDQKHLETDERMVRILETLTECSTDLNALPMLEQVEFER 123
           ++ KTLE+L +Y   D+   E+  +  E+  +MVR L+         +AL  L  ++  +
Sbjct: 235 QVDKTLEALEKYGWGDVEMVEIQGRQYESRRQMVRSLD---------DALERLRDIKRHK 285

Query: 124 QTMLKQREKVFTNVLLDYAMKLAKFT--HVPPT-------FDKGAV---GPNNFVW 167
              +++R+++F N +     K+ K     +P T       F KG+    G +N+ W
Sbjct: 286 LQGVERRKRMFDNTIDTSDEKIEKRNGDGIPLTEKAKFNPFGKGSRIKEGDSNYKW 341

>YJL125C Chr10 complement(185528..186679) [1152 bp, 383 aa] {ON}
           GCD14Subunit of tRNA (1-methyladenosine)
           methyltransferase, with Gcd10p, required for the
           modification of the adenine at position 58 in tRNAs,
           especially tRNAi-Met; first identified as a negative
           regulator of GCN4 expression
          Length = 383

 Score = 31.6 bits (70), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 33/136 (24%), Positives = 60/136 (44%), Gaps = 33/136 (24%)

Query: 56  ESLIEVDKRLS------------KTLESLPRYDEIDLRAKELDQKHLETDERMVRILETL 103
           +S+I VD+++             KTL+ L +Y   D+   E+  +  E+  +MVR L   
Sbjct: 215 DSVISVDEKVGLCCFSPCIEQVDKTLDVLEKYGWTDVEMVEIQGRQYESRRQMVRSLN-- 272

Query: 104 TECSTDLNALPMLEQVEFERQTMLKQREKVFTNVLLDYAMKLAKFTH--VPPT------- 154
                  +AL  L  ++  +   +++R+++F N +     K+ K     VP T       
Sbjct: 273 -------DALERLRDIKRHKLQGVERRKRMFNNTIDSNDEKVGKRNEDGVPLTEKAKFNP 325

Query: 155 FDKGAV---GPNNFVW 167
           F KG+    G +N+ W
Sbjct: 326 FGKGSRIKEGDSNYKW 341

>Kwal_55.20943 s55 complement(620378..624070) [3693 bp, 1230 aa]
           {ON} YER008C (SEC3) - SEC3 encodes the 144 kD and 91 kD
           components of the Exocyst complex; the 91 kD component
           is a C-terminal proteolytic breakdown product of full
           length Sec3p [contig 136] FULL
          Length = 1230

 Score = 30.4 bits (67), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 37/67 (55%), Gaps = 6/67 (8%)

Query: 13  ERPTNAESRLSKAQIYSDICEFEETLGKLVASVDKFNPDL--KIAESLIEVDKRLSKTLE 70
           + PT ++    KA I  D     +TL ++  SVD  + DL  K++  L E + ++++ L 
Sbjct: 503 QSPTGSQ----KAHIDVDNQALMDTLDEVNWSVDDCSSDLLFKLSNKLAETEHKMNQELL 558

Query: 71  SLPRYDE 77
           SLP YD+
Sbjct: 559 SLPGYDK 565

>TDEL0H01110 Chr8 complement(197953..199092) [1140 bp, 379 aa] {ON}
           Anc_1.229 YJL125C
          Length = 379

 Score = 30.0 bits (66), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 18/77 (23%), Positives = 42/77 (54%), Gaps = 9/77 (11%)

Query: 64  RLSKTLESLPRYDEIDLRAKELDQKHLETDERMVRILETLTECSTDLNALPMLEQVEFER 123
           ++ +T+E+L ++   DL+  E+  +  E+  +MVR ++         +A+  L  V+  +
Sbjct: 235 QVDRTIEALNKHGWDDLQMVEIQGRQYESRRQMVRTMD---------DAIERLRDVKRRK 285

Query: 124 QTMLKQREKVFTNVLLD 140
              L++R+++  N+L D
Sbjct: 286 NEGLERRKRMCDNILND 302

>Kpol_1031.31 s1031 (72969..74099) [1131 bp, 376 aa] {ON}
           (72969..74099) [1131 nt, 377 aa]
          Length = 376

 Score = 29.6 bits (65), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 23/38 (60%)

Query: 64  RLSKTLESLPRYDEIDLRAKELDQKHLETDERMVRILE 101
           ++ KTLE+L +Y   D+   E+  K  E+  +MVR L+
Sbjct: 240 QVDKTLEALEKYGWTDVEMVEVQGKQYESRRQMVRTLD 277

>Smik_10.110 Chr10 complement(183201..184364) [1164 bp, 387 aa] {ON}
           YJL125C (REAL)
          Length = 387

 Score = 29.6 bits (65), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 27/116 (23%), Positives = 55/116 (47%), Gaps = 21/116 (18%)

Query: 64  RLSKTLESLPRYDEIDLRAKELDQKHLETDERMVRILETLTECSTDLNALPMLEQVEFER 123
           ++ KTLE L ++   D+   E+  +  E+  +M+R L+         +AL  L  ++  +
Sbjct: 235 QVDKTLEILGKHGWTDVEMVEIQGRQYESRRQMIRSLD---------DALERLRDIKKHK 285

Query: 124 QTMLKQREKVFTNVLLDYAMKLAKFTH--VPPT-------FDKGAV---GPNNFVW 167
              +++R+++F N +     K+ K +   +P T       F KG+    G +N+ W
Sbjct: 286 IQGVERRKRMFNNTVDSSDEKIEKRSEEGIPLTEKAKFNPFGKGSRIKEGDDNYKW 341

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.128    0.351 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 23,790,133
Number of extensions: 915933
Number of successful extensions: 2716
Number of sequences better than 10.0: 94
Number of HSP's gapped: 2782
Number of HSP's successfully gapped: 94
Length of query: 256
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 149
Effective length of database: 41,212,137
Effective search space: 6140608413
Effective search space used: 6140608413
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 64 (29.3 bits)