Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_56.231143.189ON21021011151e-157
KLTH0G16060g3.189ON2132156011e-78
SAKL0C10494g3.189ON2302315231e-66
KAFR0A012303.189ON2202194595e-57
Skud_4.2423.189ON2322324335e-53
YDL010W (GRX6)3.189ON2312314302e-52
Suva_4.2383.189ON2332324266e-52
ZYRO0A04928g3.189ON2512474277e-52
TDEL0D043203.189ON2432214242e-51
KLLA0E17733g3.189ON2112124193e-51
TBLA0F007503.189ON2341674136e-50
Smik_4.2233.189ON2322294041e-48
AER017C3.189ON2162114003e-48
YBR014C (GRX7)3.189ON2031953994e-48
Skud_2.1263.189ON2042003985e-48
NCAS0E016003.189ON2292103798e-45
Suva_2.1413.189ON2041943715e-44
NDAI0G018003.189ON2222183701e-43
KNAG0J012603.189ON1941133592e-42
Smik_2.1333.189ON2041073482e-40
Ecym_53133.189ON2482233461e-39
Kpol_1045.693.189ON2622673452e-39
CAGL0I04554g3.189ON2261512771e-29
TPHA0H006303.189ON1911472741e-29
SAKL0H06468g8.679ON2581362188e-21
NCAS0C013408.679ON3572582167e-20
NDAI0E011508.679ON2362282047e-19
Kpol_1072.148.679ON2501291952e-17
TPHA0G015908.679ON2971331953e-17
KAFR0A038708.679ON2671301926e-17
NCAS0B016408.679ON2402181906e-17
KLLA0D05973g8.679ON2811351901e-16
Ecym_23948.679ON2811431778e-15
NDAI0K013508.679ON2711321742e-14
Kpol_2002.361.38ON109921592e-13
CAGL0M02167g8.679ON2331361643e-13
YPL156C (PRM4)8.679ON2841341654e-13
Skud_16.1268.679ON2871361611e-12
KNAG0G025808.679ON2782181592e-12
TBLA0B038208.679ON251971583e-12
Kwal_33.131661.38ON138901514e-12
TPHA0B03560singletonON106941479e-12
Suva_16.1548.679ON2831351514e-11
KLTH0D11308g8.679ON2711361504e-11
ACR146W8.679ON2131331469e-11
Smik_6.3538.679ON2861361471e-10
YDR513W (GRX2)1.38ON1431091402e-10
Smik_4.7941.38ON1431091402e-10
Suva_2.6931.38ON1431091392e-10
KLLA0C01298g1.38ON107971372e-10
Skud_4.7881.38ON1451091393e-10
TPHA0E037301.38ON1061001355e-10
KNAG0C004501.38ON157921377e-10
KLTH0F01276g1.38ON138951341e-09
CAGL0K05813g1.38ON1421011332e-09
KAFR0D003601.38ON109881293e-09
NCAS0B088701.38ON109951293e-09
Kwal_26.88148.679ON2751301355e-09
TBLA0A050801.38ON1181081277e-09
NDAI0F044301.38ON1361081288e-09
Kpol_2000.991.38ON141951289e-09
TDEL0C066401.38ON1431191253e-08
NCAS0A003601.38ON138941234e-08
SAKL0C01320g1.38ON165901211e-07
ZYRO0F17732g1.38ON1391041192e-07
Ecym_10441.38ON1581031174e-07
AFR710W1.38ON111991102e-06
Smik_3.421.38ON110821092e-06
Skud_3.271.38ON110821092e-06
NDAI0A003801.38ON109901093e-06
Suva_3.1781.38ON316951126e-06
TDEL0E05740singletonON108891031e-05
KNAG0F002501.38ON1421051042e-05
YCL035C (GRX1)1.38ON11080996e-05
TPHA0B048201.38ON13887981e-04
KNAG0J017308.679ON196125750.26
NDAI0E028908.519ON155104681.6
ZYRO0C15884g3.339ON142261701.7
Ecym_28227.548ON36691673.6
Kpol_1050.615.98ON31046663.9
KNAG0F033005.281ON20790654.6
Kpol_312.87.147ON43027665.1
TPHA0A050905.98ON31046655.9
KLTH0A05104g7.276ON43961648.1
TPHA0G022002.402ON1032177648.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_56.23114
         (210 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_56.23114 s56 complement(406920..407552) [633 bp, 210 aa] {O...   434   e-157
KLTH0G16060g Chr7 (1406291..1406932) [642 bp, 213 aa] {ON} simil...   236   1e-78
SAKL0C10494g Chr3 (955694..956386) [693 bp, 230 aa] {ON} similar...   206   1e-66
KAFR0A01230 Chr1 (240673..241335) [663 bp, 220 aa] {ON} Anc_3.18...   181   5e-57
Skud_4.242 Chr4 (427070..427768) [699 bp, 232 aa] {ON} YDL010W (...   171   5e-53
YDL010W Chr4 (432330..433025) [696 bp, 231 aa] {ON}  GRX6Cis-gol...   170   2e-52
Suva_4.238 Chr4 (425601..426302) [702 bp, 233 aa] {ON} YDL010W (...   168   6e-52
ZYRO0A04928g Chr1 complement(396257..397012) [756 bp, 251 aa] {O...   169   7e-52
TDEL0D04320 Chr4 complement(789241..789972) [732 bp, 243 aa] {ON...   167   2e-51
KLLA0E17733g Chr5 complement(1571724..1572359) [636 bp, 211 aa] ...   166   3e-51
TBLA0F00750 Chr6 (190701..191405) [705 bp, 234 aa] {ON} Anc_3.18...   163   6e-50
Smik_4.223 Chr4 (414277..414975) [699 bp, 232 aa] {ON} YDL010W (...   160   1e-48
AER017C Chr5 complement(660137..660787) [651 bp, 216 aa] {ON} Sy...   158   3e-48
YBR014C Chr2 complement(266725..267336) [612 bp, 203 aa] {ON}  G...   158   4e-48
Skud_2.126 Chr2 complement(240244..240858) [615 bp, 204 aa] {ON}...   157   5e-48
NCAS0E01600 Chr5 complement(304962..305651) [690 bp, 229 aa] {ON...   150   8e-45
Suva_2.141 Chr2 complement(245683..246297) [615 bp, 204 aa] {ON}...   147   5e-44
NDAI0G01800 Chr7 complement(394930..395598) [669 bp, 222 aa] {ON...   147   1e-43
KNAG0J01260 Chr10 complement(225941..226525) [585 bp, 194 aa] {O...   142   2e-42
Smik_2.133 Chr2 complement(246955..247569) [615 bp, 204 aa] {ON}...   138   2e-40
Ecym_5313 Chr5 complement(633521..634267) [747 bp, 248 aa] {ON} ...   137   1e-39
Kpol_1045.69 s1045 complement(161501..162289) [789 bp, 262 aa] {...   137   2e-39
CAGL0I04554g Chr9 (407790..408470) [681 bp, 226 aa] {ON} some si...   111   1e-29
TPHA0H00630 Chr8 (125748..126323) [576 bp, 191 aa] {ON} Anc_3.18...   110   1e-29
SAKL0H06468g Chr8 complement(569965..570741) [777 bp, 258 aa] {O...    89   8e-21
NCAS0C01340 Chr3 complement(245717..246790) [1074 bp, 357 aa] {O...    88   7e-20
NDAI0E01150 Chr5 complement(228591..229301) [711 bp, 236 aa] {ON...    83   7e-19
Kpol_1072.14 s1072 complement(30780..31532) [753 bp, 250 aa] {ON...    80   2e-17
TPHA0G01590 Chr7 complement(326061..326954) [894 bp, 297 aa] {ON...    80   3e-17
KAFR0A03870 Chr1 (787414..788217) [804 bp, 267 aa] {ON} Anc_8.67...    79   6e-17
NCAS0B01640 Chr2 (268028..268750) [723 bp, 240 aa] {ON} Anc_8.679      78   6e-17
KLLA0D05973g Chr4 (512611..513456) [846 bp, 281 aa] {ON} some si...    78   1e-16
Ecym_2394 Chr2 complement(763799..764644) [846 bp, 281 aa] {ON} ...    73   8e-15
NDAI0K01350 Chr11 complement(308152..308967) [816 bp, 271 aa] {O...    72   2e-14
Kpol_2002.36 s2002 complement(73659..73988) [330 bp, 109 aa] {ON...    66   2e-13
CAGL0M02167g Chr13 complement(259132..259833) [702 bp, 233 aa] {...    68   3e-13
YPL156C Chr16 complement(255913..256767) [855 bp, 284 aa] {ON}  ...    68   4e-13
Skud_16.126 Chr16 complement(227492..228355) [864 bp, 287 aa] {O...    67   1e-12
KNAG0G02580 Chr7 (585685..586521) [837 bp, 278 aa] {ON} Anc_8.67...    66   2e-12
TBLA0B03820 Chr2 complement(878781..879536) [756 bp, 251 aa] {ON...    65   3e-12
Kwal_33.13166 s33 complement(102922..103338) [417 bp, 138 aa] {O...    63   4e-12
TPHA0B03560 Chr2 complement(832814..833134) [321 bp, 106 aa] {ON}      61   9e-12
Suva_16.154 Chr16 complement(265047..265898) [852 bp, 283 aa] {O...    63   4e-11
KLTH0D11308g Chr4 (925622..926437) [816 bp, 271 aa] {ON} some si...    62   4e-11
ACR146W Chr3 (607725..608366) [642 bp, 213 aa] {ON} Syntenic hom...    61   9e-11
Smik_6.353 Chr6 (567550..568410) [861 bp, 286 aa] {ON} YPL156C (...    61   1e-10
YDR513W Chr4 (1471017..1471448) [432 bp, 143 aa] {ON}  GRX2Cytop...    59   2e-10
Smik_4.794 Chr4 (1393831..1394262) [432 bp, 143 aa] {ON} YDR513W...    59   2e-10
Suva_2.693 Chr2 (1223806..1224237) [432 bp, 143 aa] {ON} YDR513W...    58   2e-10
KLLA0C01298g Chr3 complement(101676..101999) [324 bp, 107 aa] {O...    57   2e-10
Skud_4.788 Chr4 (1391142..1391579) [438 bp, 145 aa] {ON} YDR513W...    58   3e-10
TPHA0E03730 Chr5 (787911..788231) [321 bp, 106 aa] {ON} Anc_1.38...    57   5e-10
KNAG0C00450 Chr3 complement(77334..77807) [474 bp, 157 aa] {ON} ...    57   7e-10
KLTH0F01276g Chr6 complement(101034..101450) [417 bp, 138 aa] {O...    56   1e-09
CAGL0K05813g Chr11 (570054..570482) [429 bp, 142 aa] {ON} highly...    56   2e-09
KAFR0D00360 Chr4 complement(54064..54393) [330 bp, 109 aa] {ON} ...    54   3e-09
NCAS0B08870 Chr2 (1703167..1703496) [330 bp, 109 aa] {ON} Anc_1....    54   3e-09
Kwal_26.8814 s26 (953489..954316) [828 bp, 275 aa] {ON} YPL156C ...    57   5e-09
TBLA0A05080 Chr1 complement(1251350..1251706) [357 bp, 118 aa] {...    54   7e-09
NDAI0F04430 Chr6 complement(1083612..1084022) [411 bp, 136 aa] {...    54   8e-09
Kpol_2000.99 s2000 (219541..219966) [426 bp, 141 aa] {ON} (21954...    54   9e-09
TDEL0C06640 Chr3 (1213768..1214199) [432 bp, 143 aa] {ON} Anc_1....    53   3e-08
NCAS0A00360 Chr1 complement(54875..55291) [417 bp, 138 aa] {ON} ...    52   4e-08
SAKL0C01320g Chr3 complement(118401..118898) [498 bp, 165 aa] {O...    51   1e-07
ZYRO0F17732g Chr6 (1469710..1470129) [420 bp, 139 aa] {ON} simil...    50   2e-07
Ecym_1044 Chr1 complement(84062..84538) [477 bp, 158 aa] {ON} si...    50   4e-07
AFR710W Chr6 (1744868..1745203) [336 bp, 111 aa] {ON} Syntenic h...    47   2e-06
Smik_3.42 Chr3 complement(62546..62878) [333 bp, 110 aa] {ON} YC...    47   2e-06
Skud_3.27 Chr3 complement(48731..49063) [333 bp, 110 aa] {ON} YC...    47   2e-06
NDAI0A00380 Chr1 complement(64438..64767) [330 bp, 109 aa] {ON} ...    47   3e-06
Suva_3.178 Chr3 complement(270878..271828) [951 bp, 316 aa] {ON}...    48   6e-06
TDEL0E05740 Chr5 complement(1072231..1072557) [327 bp, 108 aa] {...    44   1e-05
KNAG0F00250 Chr6 complement(26606..27034) [429 bp, 142 aa] {ON} ...    45   2e-05
YCL035C Chr3 complement(60841..61173) [333 bp, 110 aa] {ON}  GRX...    43   6e-05
TPHA0B04820 Chr2 (1130278..1130694) [417 bp, 138 aa] {ON} Anc_1....    42   1e-04
KNAG0J01730 Chr10 (316411..317001) [591 bp, 196 aa] {ON} Anc_8.6...    33   0.26 
NDAI0E02890 Chr5 (610133..610600) [468 bp, 155 aa] {ON} Anc_8.519      31   1.6  
ZYRO0C15884g Chr3 (1241605..1245873) [4269 bp, 1422 aa] {ON} sim...    32   1.7  
Ecym_2822 Chr2 (1596949..1598049) [1101 bp, 366 aa] {ON} similar...    30   3.6  
Kpol_1050.61 s1050 complement(135758..136690) [933 bp, 310 aa] {...    30   3.9  
KNAG0F03300 Chr6 complement(624228..624851) [624 bp, 207 aa] {ON...    30   4.6  
Kpol_312.8 s312 complement(17724..19016) [1293 bp, 430 aa] {ON} ...    30   5.1  
TPHA0A05090 Chr1 complement(1146837..1147769) [933 bp, 310 aa] {...    30   5.9  
KLTH0A05104g Chr1 (426808..428127) [1320 bp, 439 aa] {ON} weakly...    29   8.1  
TPHA0G02200 Chr7 (450927..454025) [3099 bp, 1032 aa] {ON} Anc_2....    29   8.9  

>Kwal_56.23114 s56 complement(406920..407552) [633 bp, 210 aa] {ON}
           YBR014C - Hypothetical ORF [contig 183] FULL
          Length = 210

 Score =  434 bits (1115), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 210/210 (100%), Positives = 210/210 (100%)

Query: 1   MPSKRNLRVFSFTAVLIFLIYFIVQNAQTSSDVGKAINRKPETLIGDGVVAKAKETTKID 60
           MPSKRNLRVFSFTAVLIFLIYFIVQNAQTSSDVGKAINRKPETLIGDGVVAKAKETTKID
Sbjct: 1   MPSKRNLRVFSFTAVLIFLIYFIVQNAQTSSDVGKAINRKPETLIGDGVVAKAKETTKID 60

Query: 61  EDVDQAIRNIQEEVGIKEGSSGKSEPTRKAFDPAMEYQQILSNSPMIVFSKSMCPYSAKM 120
           EDVDQAIRNIQEEVGIKEGSSGKSEPTRKAFDPAMEYQQILSNSPMIVFSKSMCPYSAKM
Sbjct: 61  EDVDQAIRNIQEEVGIKEGSSGKSEPTRKAFDPAMEYQQILSNSPMIVFSKSMCPYSAKM 120

Query: 121 KELLKQEYEFTPDYLVVELDRHDHGKELQDYIGKVTNRATVPNVVIHGVSRGGYDDFKAL 180
           KELLKQEYEFTPDYLVVELDRHDHGKELQDYIGKVTNRATVPNVVIHGVSRGGYDDFKAL
Sbjct: 121 KELLKQEYEFTPDYLVVELDRHDHGKELQDYIGKVTNRATVPNVVIHGVSRGGYDDFKAL 180

Query: 181 LDKGKLLESLQDWSDGKTLSVSKKEKPSNN 210
           LDKGKLLESLQDWSDGKTLSVSKKEKPSNN
Sbjct: 181 LDKGKLLESLQDWSDGKTLSVSKKEKPSNN 210

>KLTH0G16060g Chr7 (1406291..1406932) [642 bp, 213 aa] {ON} similar
           to Saccharomyces cerevisiae YDL010W Hypothetical ORF or
           YBR014C uniprot|P38068 Saccharomyces cerevisiae YBR014C
           Hypothetical ORF
          Length = 213

 Score =  236 bits (601), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 122/215 (56%), Positives = 156/215 (72%), Gaps = 7/215 (3%)

Query: 1   MPSKRNLRVFSFTAVLIFLIYFIVQNAQTSSDVGKAINRKPETLIGDGVVAKA--KETTK 58
           M SKRNLRVF FT VL+ LIYFI+QNA T+   G + +   +T  G  + +K   K + +
Sbjct: 1   MLSKRNLRVFVFTGVLLVLIYFIIQNAHTTVTSGNS-SLSGQTASGAVIHSKGNHKSSGE 59

Query: 59  IDEDVDQAIRNIQEEVGIKE---GSSGKSEPTRKAFDPAMEYQQILSNSPMIVFSKSMCP 115
           +D  VD+ I+ I+ EVGIK     SSG      K FDPA EYQ IL+N PMIVFSKS CP
Sbjct: 60  VDPSVDKEIQEIKNEVGIKGDDGASSGTDFTQEKEFDPAKEYQYILANRPMIVFSKSRCP 119

Query: 116 YSAKMKELLKQEYEFTPDYLVVELDRHDHGKELQDYIGKVTNRATVPNVVIHGVSRGGYD 175
           +S K+K+LL +E+EF+P Y+VVELD+H+HG ELQ +IG +T R+TVPNV+I+GVSRGG D
Sbjct: 120 FSKKLKDLLAKEFEFSPSYMVVELDKHEHGAELQKHIGSLTGRSTVPNVIINGVSRGGCD 179

Query: 176 DFKALLDKGKLLESLQDWSDGKTLSVSKKEKPSNN 210
           DF+ L +KG+LL SL+ W D K L+VSKKEKPSNN
Sbjct: 180 DFEKLQEKGELLSSLKTWCD-KALTVSKKEKPSNN 213

>SAKL0C10494g Chr3 (955694..956386) [693 bp, 230 aa] {ON} similar to
           Saccharomyces cerevisiae YDL010W Hypothetical ORF or
           YBR014C uniprot|P38068 Saccharomyces cerevisiae YBR014C
           Hypothetical ORF
          Length = 230

 Score =  206 bits (523), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 114/231 (49%), Positives = 149/231 (64%), Gaps = 22/231 (9%)

Query: 1   MPSKRNLRVFSFTAVLIFLIYFIVQNAQT----SSDVGKAINRKPETLI--GDG---VVA 51
           M +KRNLRV + T  L+FLI+FIVQNA T    + + G+A    P + +   DG    VA
Sbjct: 1   MLTKRNLRVLTITGFLVFLIFFIVQNANTVAVANKNSGRANGVPPSSKLIHSDGDEQEVA 60

Query: 52  KAKETTKIDEDVDQAIRNIQEEVGI----------KEGS--SGKSEPTRKAFDPAMEYQQ 99
             K+  K D  V+  I  IQ+E+            + G+  S   + +   F+ A EY  
Sbjct: 61  VQKQQEKEDSAVNAEIAQIQQEIAGNQGGGGSNSGRTGNKVSAAKDSSSVEFNAAKEYAS 120

Query: 100 ILSNSPMIVFSKSMCPYSAKMKELLKQEYEFTPDYLVVELDRHDHGKELQDYIGKVTNRA 159
           IL  SPM+VFSKS CP+S K+K+LL QEY+FTP Y+V+ELD+H+HG ELQ YIG VT R+
Sbjct: 121 ILEESPMVVFSKSYCPFSTKLKDLLAQEYQFTPSYVVLELDKHEHGAELQKYIGDVTGRS 180

Query: 160 TVPNVVIHGVSRGGYDDFKALLDKGKLLESLQDWSDGKTLSVSKKEKPSNN 210
           TVPNVVI+ VSRGG DD +AL   GKLL+SL++W  GK L+VSK +KPSNN
Sbjct: 181 TVPNVVINRVSRGGSDDLRALHKDGKLLDSLKEWG-GKQLTVSKNQKPSNN 230

>KAFR0A01230 Chr1 (240673..241335) [663 bp, 220 aa] {ON} Anc_3.189
           YDL010W
          Length = 220

 Score =  181 bits (459), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 100/219 (45%), Positives = 139/219 (63%), Gaps = 15/219 (6%)

Query: 3   SKRNLRVFSFTAVLIFLIYFIVQNAQTSSDVGKAINRKPETLIG---DGVVAKAKETTKI 59
           +KRN+R+ S T++L+ L++F++++A  S  + ++I+   ET+     DG  A  K+ T  
Sbjct: 6   NKRNIRIVSVTSILLLLVFFVIRDAN-SITLSQSISNS-ETVAKTDLDGASASNKKKTDN 63

Query: 60  DEDVDQAIRNIQEEVGIKEGS--------SGKSEPTRKAFDPAMEYQQILSNSPMIVFSK 111
            E  ++ I  I++E+GI + S            E T   F+ A EY  IL  SPM+VFSK
Sbjct: 64  SEATEE-IDRIKQEIGITDDSPVPATNANEQNEENTAVTFNAAKEYASILELSPMVVFSK 122

Query: 112 SMCPYSAKMKELLKQEYEFTPDYLVVELDRHDHGKELQDYIGKVTNRATVPNVVIHGVSR 171
           S CP+SAK+KEL   EY+FTP++ +VELD+H HG  LQ YI + T R TVPNVVI+GVSR
Sbjct: 123 SFCPFSAKLKELFANEYQFTPNFYIVELDKHQHGDLLQAYIKEKTGRGTVPNVVINGVSR 182

Query: 172 GGYDDFKALLDKGKLLESLQDWSDGKTLSVSKKEKPSNN 210
           GG DD +AL   GKLL+SL+ W  G    V + EKPSNN
Sbjct: 183 GGSDDLRALHADGKLLDSLKTWGSGN-FQVKQIEKPSNN 220

>Skud_4.242 Chr4 (427070..427768) [699 bp, 232 aa] {ON} YDL010W
           (REAL)
          Length = 232

 Score =  171 bits (433), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 98/232 (42%), Positives = 142/232 (61%), Gaps = 26/232 (11%)

Query: 2   PSKRNLRVFSFTAVLIFLIYFIVQNAQTSSDVGKAINRKPETL---------IGDGVVAK 52
           P+KRN R+ S T +L+ L++FIVQNA   +   K    KP  +         +G      
Sbjct: 4   PNKRNARILSITMLLLLLVFFIVQNANFLTIETKE--EKPFQVFSTNMDSLSVGSSKKLA 61

Query: 53  AKETTKI---DEDVDQAIRNIQEEVGIKEG-----------SSGKSEPTRKAFDPAMEYQ 98
            + T+ I     +VD+ I  I+++VG+++             S K   T K F+   EY 
Sbjct: 62  TEPTSAIKKGSSEVDEEINEIKQKVGLQQPIASADDSLSALKSDKGSGTGKGFNVQKEYS 121

Query: 99  QILSNSPMIVFSKSMCPYSAKMKELLKQEYEFTPDYLVVELDRHDHGKELQDYIGKVTNR 158
            +L  SP+I+FSKS+CPYS  MKELL+ EY+F P+Y ++ELD+H HG+ELQ+YI  +T R
Sbjct: 122 LMLDLSPVIIFSKSVCPYSRNMKELLENEYQFLPNYYIIELDKHGHGEELQEYIRLMTGR 181

Query: 159 ATVPNVVIHGVSRGGYDDFKALLDKGKLLESLQDWSDGKTLSVSKKEKPSNN 210
             VPN++I+G+SRGG ++ + L  +GKLL SLQ WS+GK  SV ++EKPSNN
Sbjct: 182 GAVPNLLINGISRGGNEEIRGLHSQGKLLGSLQAWSNGK-FSVEQREKPSNN 232

>YDL010W Chr4 (432330..433025) [696 bp, 231 aa] {ON}  GRX6Cis-golgi
           localized monothiol glutaredoxin that binds an
           iron-sulfur cluster; more similar in activity to dithiol
           than other monothiol glutaredoxins; involved in the
           oxidative stress response; functional overlap with GRX7
          Length = 231

 Score =  170 bits (430), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 100/231 (43%), Positives = 141/231 (61%), Gaps = 22/231 (9%)

Query: 1   MPS-KRNLRVFSFTAVLIFLIYFIVQNA-----QTSSDVGKAINRKPETLIGDG----VV 50
           +PS KRN R+ S T +L+ L++F+ QNA     +   +  KA +   + + G        
Sbjct: 2   IPSNKRNARILSITTLLLLLVFFVAQNANFLTVEIKEETSKAFSTNMDNMAGGSSREYAA 61

Query: 51  AKAKETTKIDEDVDQAIRNIQEEVGIKEGSSG-----------KSEPTRKAFDPAMEYQQ 99
                T K   +VD+ I  I+++VG+++  +            K     KAF+   EY  
Sbjct: 62  MPTSTTNKGSSEVDEEINEIKQKVGLQQPIASVDDSLSAIKNDKGSRITKAFNVQKEYSL 121

Query: 100 ILSNSPMIVFSKSMCPYSAKMKELLKQEYEFTPDYLVVELDRHDHGKELQDYIGKVTNRA 159
           IL  SP+I+FSKS C YS  MKELL+ EY+F P+Y ++ELD+H HG+ELQ+YI  VT R 
Sbjct: 122 ILDLSPIIIFSKSTCSYSKGMKELLENEYQFIPNYYIIELDKHGHGEELQEYIKLVTGRG 181

Query: 160 TVPNVVIHGVSRGGYDDFKALLDKGKLLESLQDWSDGKTLSVSKKEKPSNN 210
           TVPN++++GVSRGG ++ K L  +GKLLESLQ WSDGK  SV ++EKPSNN
Sbjct: 182 TVPNLLVNGVSRGGNEEIKKLHTQGKLLESLQVWSDGK-FSVEQREKPSNN 231

>Suva_4.238 Chr4 (425601..426302) [702 bp, 233 aa] {ON} YDL010W
           (REAL)
          Length = 233

 Score =  168 bits (426), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 93/232 (40%), Positives = 140/232 (60%), Gaps = 23/232 (9%)

Query: 1   MPSKRNLRVFSFTAVLIFLIYFIVQNAQTSSDVGKAINRKPETLIGDGVVAKAKETTKI- 59
           + +KRN R+ S T +L+ L++FI QNA   +   K   + P+ L  D      + + +I 
Sbjct: 3   LSNKRNARILSITMLLLLLVFFIAQNANFLAIETKEEEKPPQLLDIDKNSISGRSSRRIA 62

Query: 60  ----------DEDVDQAIRNIQEEVGIKEG-----------SSGKSEPTRKAFDPAMEYQ 98
                     + +VD+ I  I+++VG+++             S K   T K F+   EY 
Sbjct: 63  SVPTSTTNKGNSEVDEEINEIKQKVGLQQPIASADDSLSAIKSDKGTGTGKGFNVQQEYS 122

Query: 99  QILSNSPMIVFSKSMCPYSAKMKELLKQEYEFTPDYLVVELDRHDHGKELQDYIGKVTNR 158
            +L  +P+I+FSKS C YS  +KELL+ EY+F P+Y ++ELD+H HG+EL++YI   T R
Sbjct: 123 LMLDLAPVIIFSKSTCSYSKGLKELLESEYQFVPNYYIIELDKHAHGEELREYIKSTTGR 182

Query: 159 ATVPNVVIHGVSRGGYDDFKALLDKGKLLESLQDWSDGKTLSVSKKEKPSNN 210
            TVPN++I+GVSRGG ++ K L  +GKLL SLQ+WS GK  +V ++EKPSNN
Sbjct: 183 GTVPNLLINGVSRGGSEEIKRLHSQGKLLSSLQEWSGGK-FTVEQREKPSNN 233

>ZYRO0A04928g Chr1 complement(396257..397012) [756 bp, 251 aa] {ON}
           weakly similar to Saccharomyces cerevisiae YDL010W
           Hypothetical ORF or YBR014C uniprot|P38068 Saccharomyces
           cerevisiae YBR014C Hypothetical ORF
          Length = 251

 Score =  169 bits (427), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 110/247 (44%), Positives = 147/247 (59%), Gaps = 40/247 (16%)

Query: 3   SKRNLRVFSFTAVLIFLIYFIVQNAQT-----SSDVGKAINRKPETLIGDG--------- 48
           +KRNLRV S T++L+ L++F+VQNA +     SS +  A + + +TL   G         
Sbjct: 6   NKRNLRVLSITSLLLLLVFFVVQNANSVSIGESSSLANANSNEDQTLTSAGTSINKESKE 65

Query: 49  -VVA---KAKETT-KIDEDVDQAIRNIQEEVGIKE--------------------GSSGK 83
            VV    KAKE   + D  VD  I  I++EVGI +                    G S  
Sbjct: 66  EVVTEKQKAKEKQPEGDSVVDAEIGKIKQEVGIGKTDDLETGSSGSISGGGVVGKGGSAS 125

Query: 84  SEPTRKAFDPAMEYQQILSNSPMIVFSKSMCPYSAKMKELLKQEYEFTPDYLVVELDRHD 143
               +  FDP  EY  IL  SP+IVFSKS CPYS K+KELL +EY FTP Y V+ELDRH 
Sbjct: 126 EHAQQTEFDPVKEYAMILDFSPIIVFSKSTCPYSKKLKELLDKEYSFTPSYFVIELDRHH 185

Query: 144 HGKELQDYIGKVTNRATVPNVVIHGVSRGGYDDFKALLDKGKLLESLQDWSDGKTLSVSK 203
           +G ELQ Y+ + T R+TVPNV+I+G SRGG D+F++L ++GKLL S +DWS G T +V +
Sbjct: 186 NGAELQKYVEQKTGRSTVPNVIINGKSRGGNDEFRSLHNEGKLLSSFKDWSQG-TFTVLQ 244

Query: 204 KEKPSNN 210
            ++PSNN
Sbjct: 245 LDRPSNN 251

>TDEL0D04320 Chr4 complement(789241..789972) [732 bp, 243 aa] {ON}
           Anc_3.189 YDL010W
          Length = 243

 Score =  167 bits (424), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 95/221 (42%), Positives = 131/221 (59%), Gaps = 20/221 (9%)

Query: 5   RNLRVFSFTAVLIFLIYFIVQNAQTSSDVGKAINRKPETLIG--DGVVAKAKETTKIDED 62
           +N    SF    +    F+   A   +  G A++   E ++    G   K +E+  +D +
Sbjct: 28  QNANSISFGEEELKAATFVNPVASGLTSAGTAVHNNDEIVVDKESGKKGKDQESALVDAE 87

Query: 63  VDQAIRNIQEEVGIKEGSSGKSEPTRKA-------------FDPAMEYQQILSNSPMIVF 109
           +D+    I++EV    G+S  +  ++KA             FDPA EY  IL  SP+IVF
Sbjct: 88  IDK----IKQEVNSGSGASKDNSISQKAGSGSKDGTVSEGEFDPAKEYSMILGISPVIVF 143

Query: 110 SKSMCPYSAKMKELLKQEYEFTPDYLVVELDRHDHGKELQDYIGKVTNRATVPNVVIHGV 169
           SKS CPYS+++KELL +EY  TP Y+V+ELD+H HG  LQ +I K T RATVPN++I+G 
Sbjct: 144 SKSFCPYSSRLKELLTKEYTITPSYVVIELDKHKHGVALQKFIEKKTGRATVPNLMINGK 203

Query: 170 SRGGYDDFKALLDKGKLLESLQDWSDGKTLSVSKKEKPSNN 210
           SRGG+DD KAL  KG+LLESL  W DG   +V + EKPSNN
Sbjct: 204 SRGGFDDIKALHSKGELLESLNKWGDG-DFTVKQLEKPSNN 243

>KLLA0E17733g Chr5 complement(1571724..1572359) [636 bp, 211 aa]
           {ON} similar to Saccharomyces cerevisiae YDL010W
           Hypothetical ORF or YBR014C uniprot|P38068 Saccharomyces
           cerevisiae YBR014C Hypothetical ORF
          Length = 211

 Score =  166 bits (419), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 95/212 (44%), Positives = 136/212 (64%), Gaps = 15/212 (7%)

Query: 1   MPSKRNLRVFSFTAVLIFLIYFIVQNAQ--TSSDVGK-----AINRKPETLIGD--GVVA 51
           M SKR+LR+ S T ++IF+++FI  NA+  T S VGK     A + K E+ I +    +A
Sbjct: 1   MLSKRSLRLVSLTGMVIFVLFFIRHNAESVTRSYVGKESSNLANDAKVESDINNIQEGIA 60

Query: 52  KAKETTKIDEDVDQAIRNIQEEVGIKEGSSGKSEPTRKAFDPAMEYQQILSNSPMIVFSK 111
           + K +  +  D   A++N+    G+K+        T   ++   EY+ ILS SP++VFSK
Sbjct: 61  ETK-SNAVVADTSNAVKNMAGPNGVKDSDFAAEVET---YNAEAEYKNILSQSPIVVFSK 116

Query: 112 SMCPYSAKMKELLKQEYEFTPDYLVVELDRHDHGKELQDYIGKVTNRATVPNVVIHGVSR 171
           S CP+S ++K LLK EYEF P Y +VELD+H++G ELQ YIG  T R+TVPNV+I+G+SR
Sbjct: 117 SYCPFSTRLKNLLK-EYEFDPIYTIVELDKHENGAELQKYIGSKTGRSTVPNVIINGISR 175

Query: 172 GGYDDFKALLDKGKLLESLQDWSDGKTLSVSK 203
           GG D+F  L +   LL+SL+ W+ G TLSV K
Sbjct: 176 GGSDEFAGLHEDNSLLQSLKTWA-GSTLSVKK 206

>TBLA0F00750 Chr6 (190701..191405) [705 bp, 234 aa] {ON} Anc_3.189
           YDL010W
          Length = 234

 Score =  163 bits (413), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 80/167 (47%), Positives = 108/167 (64%), Gaps = 17/167 (10%)

Query: 60  DEDVDQAIRNIQEEVGIKEGSSGK----------------SEPTRKAFDPAMEYQQILSN 103
           D  VD     I++EVG+  G + +                +      FD A EY  IL  
Sbjct: 69  DAGVDAQFDKIKQEVGLDTGKTTQGGLPSSIGTATDNKISNNDENGTFDAAKEYAMILDL 128

Query: 104 SPMIVFSKSMCPYSAKMKELLKQEYEFTPDYLVVELDRHDHGKELQDYIGKVTNRATVPN 163
           SP+I+FSKS CP+S+ +K+LL +E+ FTP+Y V+ELDRH HG ELQ YI K T+R+TVPN
Sbjct: 129 SPVIIFSKSYCPFSSNLKQLLSKEFSFTPNYYVIELDRHSHGAELQAYIAKKTDRSTVPN 188

Query: 164 VVIHGVSRGGYDDFKALLDKGKLLESLQDWSDGKTLSVSKKEKPSNN 210
           ++++G+SRGG D+  AL D+GKLLE+L DWSD  T +V + EKPSNN
Sbjct: 189 MIVNGISRGGRDEIVALNDEGKLLEALNDWSD-NTFTVKQAEKPSNN 234

>Smik_4.223 Chr4 (414277..414975) [699 bp, 232 aa] {ON} YDL010W
           (REAL)
          Length = 232

 Score =  160 bits (404), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 95/229 (41%), Positives = 134/229 (58%), Gaps = 22/229 (9%)

Query: 3   SKRNLRVFSFTAVLIFLIYFIVQNA----------QTSSDVGKAINRKPETLIGDGVVAK 52
           +KRN R+ S T +L+ L++F+ QNA          ++S      +N          V   
Sbjct: 5   NKRNARILSITMLLLLLVFFVAQNANFLTLETKERESSELFDSEMNNLAAESTRKYVAVP 64

Query: 53  AKETTKIDEDVDQAIRNIQEEVGIKEG-----------SSGKSEPTRKAFDPAMEYQQIL 101
              T K   +VD+ I  I+++VG++              S K   T K F+   EY  +L
Sbjct: 65  TSATNKGSSEVDEEINEIKQKVGLQRPILSDDDSLSAIKSDKQSGTGKLFNVQKEYSLML 124

Query: 102 SNSPMIVFSKSMCPYSAKMKELLKQEYEFTPDYLVVELDRHDHGKELQDYIGKVTNRATV 161
             SP+I+FSKS C YS  MKELL+ EY+F P+Y ++ELD+H HG+ELQ+YI   T R TV
Sbjct: 125 DLSPVIIFSKSSCSYSKGMKELLENEYQFVPNYYIIELDKHGHGEELQEYIKLKTGRGTV 184

Query: 162 PNVVIHGVSRGGYDDFKALLDKGKLLESLQDWSDGKTLSVSKKEKPSNN 210
           PN++++G+SRGG ++ + L  +GKLLESLQ WSDGK  SV + EKPSNN
Sbjct: 185 PNLLVNGISRGGNEEIRKLHSQGKLLESLQSWSDGK-FSVEQHEKPSNN 232

>AER017C Chr5 complement(660137..660787) [651 bp, 216 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL010W and
           YBR014C
          Length = 216

 Score =  158 bits (400), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 90/211 (42%), Positives = 130/211 (61%), Gaps = 8/211 (3%)

Query: 3   SKRNLRVFSFTAVLIFLIYFIVQNAQTSSDVGKAINRKP---ETLIGDGVVAKAKETTKI 59
           S+R +R+   T VL+ L YFI+QN  TS      I  +P      + D V A+      +
Sbjct: 11  SRRGMRMLLVTGVLLVLTYFIIQNGTTSDQFVTPIAPRPVPNAPSVQDTVEAEEPSVQLL 70

Query: 60  DEDVDQAIRNIQEEVGIKEGSSGKSEPTRKAFDPAMEYQQILSNSPMIVFSKSMCPYSAK 119
            +  + A+   +E+V +        + ++  FD A  Y +ILS S M+VFSKS CP S+ 
Sbjct: 71  SKGAEGAVAASKEDVDVARAQ----QQSKVLFDAAKTYNEILSLSSMVVFSKSTCPLSSG 126

Query: 120 MKELLKQEYEFTPDYLVVELDRHDHGKELQDYIGKVTNRATVPNVVIHGVSRGGYDDFKA 179
           +K+LL   YEF PDY VVELD+H +G ELQ Y+ K T R+TVPN+VI+GVSRGG+D    
Sbjct: 127 LKQLLNNNYEFLPDYQVVELDKHANGAELQKYVTKTTARSTVPNLVINGVSRGGHDSIME 186

Query: 180 LLDKGKLLESLQDWSDGKTLSVSKKEKPSNN 210
           L   G+LLESL+ W++GK  +V++K++PSN+
Sbjct: 187 LHKTGELLESLRKWANGKH-AVTQKQRPSNS 216

>YBR014C Chr2 complement(266725..267336) [612 bp, 203 aa] {ON}
           GRX7Cis-golgi localized monothiol glutaredoxin; more
           similar in activity to dithiol than other monothiol
           glutaredoxins; involved in the oxidative stress
           response; does not bind metal ions; functional overlap
           with GRX6
          Length = 203

 Score =  158 bits (399), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 87/195 (44%), Positives = 118/195 (60%), Gaps = 11/195 (5%)

Query: 3   SKRNLRVFSFTAVLIFLIYFIVQNAQTSSDVGKAIN-RKPETLIGDGVVAKAKETTKIDE 61
           +KRN+RV   T +L+ +++F+++N+  S  V ++I    P++L+       A  T +   
Sbjct: 6   NKRNVRVLVITNLLLIVVFFVLRNSNAS--VNESITTHHPDSLVTFDNSGNAPGTHQSVH 63

Query: 62  DVDQAIRNIQEEVGIKEGSSGKSEPTRKAFDPAMEYQQILSNSPMIVFSKSMCPYSAKMK 121
           D         EEV   + +SG +E     FD A EY +I+  SPMIVFSK+ CPYS K+K
Sbjct: 64  DTVNTQDKEAEEV---DKNSGDAE-----FDAAAEYNKIMEQSPMIVFSKTGCPYSKKLK 115

Query: 122 ELLKQEYEFTPDYLVVELDRHDHGKELQDYIGKVTNRATVPNVVIHGVSRGGYDDFKALL 181
            LL   Y F+P Y VVELDRH+H KELQD I KVT R TVPNV+I G SRGGY +   L 
Sbjct: 116 ALLTNSYTFSPSYYVVELDRHEHTKELQDQIEKVTGRRTVPNVIIGGTSRGGYTEIAELH 175

Query: 182 DKGKLLESLQDWSDG 196
              +LL+S + WSDG
Sbjct: 176 KNDELLDSFKKWSDG 190

>Skud_2.126 Chr2 complement(240244..240858) [615 bp, 204 aa] {ON}
           YBR014C (REAL)
          Length = 204

 Score =  157 bits (398), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 87/200 (43%), Positives = 125/200 (62%), Gaps = 18/200 (9%)

Query: 3   SKRNLRVFSFTAVLIFLIYFIVQNAQTSSDVGKAINRKPETLIGDGVVA---KAKETTKI 59
           +KRN+RV   T +L+ L++ +V++  +++D  +A+      +I  G +A   ++      
Sbjct: 6   NKRNVRVLVITNILLILVFLVVRS--SNADASEAVK-----IIHPGSLATFDQSGNAPGT 58

Query: 60  DEDVDQAIRNIQE-EVG-IKEGSSGKSEPTRKAFDPAMEYQQILSNSPMIVFSKSMCPYS 117
            E  D+A+ N Q+ EVG   E S G +      FD A EY +IL  SP +VFSK+ CPYS
Sbjct: 59  PESADKAVTNKQDKEVGETNEDSKGVT------FDAAAEYGKILEYSPFVVFSKTGCPYS 112

Query: 118 AKMKELLKQEYEFTPDYLVVELDRHDHGKELQDYIGKVTNRATVPNVVIHGVSRGGYDDF 177
            K+K LL + Y  TP Y VVELD H+HGKEL+DYIG  T R+TVPNVVI+G+SRGGY + 
Sbjct: 113 KKLKSLLAESYAITPSYYVVELDEHEHGKELKDYIGDKTGRSTVPNVVINGISRGGYTEM 172

Query: 178 KALLDKGKLLESLQDWSDGK 197
            AL +   L++S ++WS  K
Sbjct: 173 AALHENDTLVDSFKEWSSDK 192

>NCAS0E01600 Chr5 complement(304962..305651) [690 bp, 229 aa] {ON}
           Anc_3.189
          Length = 229

 Score =  150 bits (379), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 78/210 (37%), Positives = 124/210 (59%), Gaps = 16/210 (7%)

Query: 3   SKRNLRVFSFTAVLIFLIYFIVQNAQTSSDVGKAINR---KP--ETLIG----------- 46
           +KRN+RV   TA L+ L++FI+Q+A  S+   ++ ++   KP   +L+G           
Sbjct: 6   NKRNIRVVGITAALLCLVFFIIQSANNSAFTTESPSKQSNKPALNSLVGAHGDDLNIPAT 65

Query: 47  DGVVAKAKETTKIDEDVDQAIRNIQEEVGIKEGSSGKSEPTRKAFDPAMEYQQILSNSPM 106
             V+    E+    E   ++  N++ +          +  T   FD A EY  IL+  PM
Sbjct: 66  HNVLQDNVESAPTVETESESNNNMELDESADSAQEKDASTTAPDFDVAKEYAAILAKGPM 125

Query: 107 IVFSKSMCPYSAKMKELLKQEYEFTPDYLVVELDRHDHGKELQDYIGKVTNRATVPNVVI 166
           ++FSKS CPYS+K+K+LL+  ++F+P+ ++VELD+H+HG  LQ YI + T R TVPN+++
Sbjct: 126 VIFSKSTCPYSSKLKKLLRTNFQFSPEPVIVELDKHEHGDVLQGYIKEETGRGTVPNLIV 185

Query: 167 HGVSRGGYDDFKALLDKGKLLESLQDWSDG 196
            G+SRGG DD + L D+G LL+ L+ W  G
Sbjct: 186 GGLSRGGSDDIQKLFDEGTLLKELKTWGFG 215

>Suva_2.141 Chr2 complement(245683..246297) [615 bp, 204 aa] {ON}
           YBR014C (REAL)
          Length = 204

 Score =  147 bits (371), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 86/194 (44%), Positives = 119/194 (61%), Gaps = 8/194 (4%)

Query: 3   SKRNLRVFSFTAVLIFLIYFIVQNAQTSSDVGKAINRKPETLIGDGVVAKAKETTKIDED 62
           +KRN+RV   T +L+ L++ +++N+ TS+     +N  P +L+       A  T    E 
Sbjct: 6   NKRNVRVLVITNLLLVLVFLVIRNSSTSAG-ESGVNYHPGSLVTFDESGNAPGTP---ES 61

Query: 63  VDQAIRNIQEEVGIKEGSSGKSEPTRKAFDPAMEYQQILSNSPMIVFSKSMCPYSAKMKE 122
           +  ++ N Q+    KE            FD A EY+ IL  S M+VFSKS CP+S K+K 
Sbjct: 62  IHGSVANKQD----KEVDEVNENSKEVKFDAATEYETILKQSHMVVFSKSYCPFSKKLKN 117

Query: 123 LLKQEYEFTPDYLVVELDRHDHGKELQDYIGKVTNRATVPNVVIHGVSRGGYDDFKALLD 182
           LL + Y+F+P Y VVELD+H H  ELQDYI KVT R TVPNV+I+GVS+GG DD   L  
Sbjct: 118 LLAESYKFSPSYHVVELDQHGHTDELQDYIEKVTGRRTVPNVIINGVSKGGCDDMVTLHK 177

Query: 183 KGKLLESLQDWSDG 196
           + KLLESL++WS+G
Sbjct: 178 EDKLLESLKEWSNG 191

>NDAI0G01800 Chr7 complement(394930..395598) [669 bp, 222 aa] {ON}
           Anc_3.189
          Length = 222

 Score =  147 bits (370), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 85/218 (38%), Positives = 119/218 (54%), Gaps = 18/218 (8%)

Query: 3   SKRNLRVFSFTAVLIFLIYFIVQNAQTSSDVGKAINRKPETLIGDGVVAKAKETTKIDED 62
           +KRN+RV   T VLI +  F+ QNA  S+       +   T     V A  +     DE+
Sbjct: 6   NKRNIRVLITTCVLIVIGVFVFQNANASTYTSSKALKSTITDTNSIVQAHGE-----DEN 60

Query: 63  VDQAIRNI-----------QEEVGIKEGSSGKSEPTRKAFDPAMEYQQILSNSPMIVFSK 111
           +  A++N+           +E+  I   SS         FD A EY  IL   PM++FSK
Sbjct: 61  I-PALKNVDNSPVSTEITSEEDSKINADSSIVQAEAEVPFDVAKEYTSILQRGPMVIFSK 119

Query: 112 SMCPYSAKMKELLKQEYEFTPDYLVVELDRHDHGKELQDYIGKVTNRATVPNVVIHGVSR 171
           + CPYS  +KELL   ++  P  +V+ELD+H+HG+ELQ YI + T R TVPN++I+G S+
Sbjct: 120 TFCPYSKALKELLSTNFQINPQPIVIELDKHEHGEELQAYIKEQTGRGTVPNLIINGNSK 179

Query: 172 GGYDDFKALLDKGKLLESLQDWSDGKTLSVSKKEKPSN 209
           GG DD K L D+  LL+SL +WS+G    V   E  SN
Sbjct: 180 GGSDDMKKLFDENVLLDSLNEWSNG-AYEVQATETASN 216

>KNAG0J01260 Chr10 complement(225941..226525) [585 bp, 194 aa] {ON}
           Anc_3.189 YDL010W
          Length = 194

 Score =  142 bits (359), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 63/113 (55%), Positives = 83/113 (73%)

Query: 81  SGKSEPTRKAFDPAMEYQQILSNSPMIVFSKSMCPYSAKMKELLKQEYEFTPDYLVVELD 140
           SG++      F PA+EY  ILS SP+++FSKS CPYSAK+K+LL   ++FTP Y VVELD
Sbjct: 72  SGQAPEPAGVFSPAVEYDSILSRSPVVIFSKSYCPYSAKLKKLLAAGFKFTPAYTVVELD 131

Query: 141 RHDHGKELQDYIGKVTNRATVPNVVIHGVSRGGYDDFKALLDKGKLLESLQDW 193
            H+HG ELQ YI + T R+TVPN++++GVS GG DD  AL + GKLL+ L +W
Sbjct: 132 EHEHGPELQKYIAEKTGRSTVPNLIVNGVSHGGCDDIVALSENGKLLDRLNEW 184

>Smik_2.133 Chr2 complement(246955..247569) [615 bp, 204 aa] {ON}
           YBR014C (REAL)
          Length = 204

 Score =  138 bits (348), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 63/107 (58%), Positives = 77/107 (71%)

Query: 91  FDPAMEYQQILSNSPMIVFSKSMCPYSAKMKELLKQEYEFTPDYLVVELDRHDHGKELQD 150
           FD A EY +IL  SPMIVFSKS CP+S K+K LL + Y F+P Y VVELD+ +H  ELQ+
Sbjct: 86  FDAAAEYDKILKKSPMIVFSKSFCPFSKKLKTLLAESYTFSPSYYVVELDKREHTSELQE 145

Query: 151 YIGKVTNRATVPNVVIHGVSRGGYDDFKALLDKGKLLESLQDWSDGK 197
           +I K T R TVPNVVI G+SRGG D+  AL +  KLL S ++WS GK
Sbjct: 146 HIEKSTGRRTVPNVVIDGISRGGCDEITALHENDKLLNSFKEWSSGK 192

>Ecym_5313 Chr5 complement(633521..634267) [747 bp, 248 aa] {ON}
           similar to Ashbya gossypii AER017C
          Length = 248

 Score =  137 bits (346), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 83/223 (37%), Positives = 128/223 (57%), Gaps = 25/223 (11%)

Query: 3   SKRNLRVFSFTAVLIFLIYFIVQNAQTSSDV--------GKAINRKP--ETLIG------ 46
           +K+  R+   T VL  + + + Q++ T + +        G+   ++P  E  I       
Sbjct: 30  TKKAGRILLVTTVLFIVSFLLFQHSTTGNSLFNSPFPGEGRKQPKRPIAEEDIATEANSN 89

Query: 47  -DGVVAKAKETTKIDEDV--DQAIRNIQEEVGIKEGSSGKSEPTRKAFDPAMEYQQILSN 103
            DG ++  K    +D     D+A +    +  I E SS         ++PA  YQ+IL  
Sbjct: 90  KDGQISNRKNDHVVDVTTVNDKAKKPSSNQPNIAEDSSDNI-----GYNPADRYQKILDM 144

Query: 104 SPMIVFSKSMCPYSAKMKELLKQEYEFTPDYLVVELDRHDHGKELQDYIGKVTNRATVPN 163
           +P+I+FSK+ CPYS K+K LL Q Y+FTPDY+V+ELD     KELQ YI + T R TVPN
Sbjct: 145 APVIIFSKTTCPYSLKLKSLLTQNYQFTPDYVVIELDLEKRTKELQFYISQQTGRKTVPN 204

Query: 164 VVIHGVSRGGYDDFKALLDKGKLLESLQDWSDGKTLSVSKKEK 206
           ++++G S GG+D+  AL  KG+LL+S++DWSD K ++V+ K+K
Sbjct: 205 LLVNGKSMGGHDEISALHSKGELLKSIEDWSD-KKVTVTPKQK 246

>Kpol_1045.69 s1045 complement(161501..162289) [789 bp, 262 aa] {ON}
           complement(161503..162291) [789 nt, 263 aa]
          Length = 262

 Score =  137 bits (345), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 89/267 (33%), Positives = 129/267 (48%), Gaps = 69/267 (25%)

Query: 3   SKRNLRVFSFTAVLIFLIYFIVQNAQTSSDVGKAINRKPETLIGDG-------------- 48
           +KRN+R+ S T VL+F+I+ I QN          +   P  LI D               
Sbjct: 6   NKRNIRILSITGVLLFVIFLISQN-------NNGMLTDPSGLISDAFESTSVKGMIDSDN 58

Query: 49  --VVAKAKET-------TKIDEDVDQAIRNIQEEVGI----------------------- 76
             V  K + +       T  D+ V+  I  I+EEVG+                       
Sbjct: 59  VRVGGKVRYSSDDLVKGTAKDDKVNAEIDKIKEEVGLPFNDNNNNNIANKKLTTDNNKNN 118

Query: 77  -------------KEGSSGKSEPTRKAFDPAMEYQQILSNSPMIVFSKSMCPYSAKMKEL 123
                        +    G SEP +  FDPA EY  I   SP+I+++K+ CPY  ++ +L
Sbjct: 119 VVNEKSTVQNNAAQRAVQGGSEPVK--FDPAQEYAIISELSPIILYTKTFCPYCKRLAKL 176

Query: 124 LKQEYEFTPDYLVVELDRHDHGKELQDYIGKVTNRATVPNVVIHGVSRGGYDDFKALLDK 183
           L++ Y F P++  V+LD+H HG ELQ ++ K T   TVPN VI+G S GGYDD   L + 
Sbjct: 177 LEESYSFQPEFHAVKLDKHTHGDELQQFVNKQTGHNTVPNFVINGKSLGGYDDILKLHEA 236

Query: 184 GKLLESLQDWSDGKTLSVSKKEKPSNN 210
           GKL+E++Q+ SD  ++ V   EKPSN+
Sbjct: 237 GKLIETIQEMSD-YSVVVKAIEKPSNS 262

>CAGL0I04554g Chr9 (407790..408470) [681 bp, 226 aa] {ON} some
           similarities with uniprot|P38068 Saccharomyces
           cerevisiae YBR014c
          Length = 226

 Score =  111 bits (277), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 57/151 (37%), Positives = 90/151 (59%), Gaps = 2/151 (1%)

Query: 53  AKETTKIDEDVDQAIRNIQEEVGIKEGSSGKSEPTRKAFDPAMEYQQILSNSPMIVFSKS 112
           + E  ++    DQ   N    +  KEG     E     + PA E+Q+++ ++P+++FSKS
Sbjct: 77  SNENAQLPGSKDQTDSN-SNSLSNKEGQEDAEEAADAEYSPAKEFQKLVKSAPIVIFSKS 135

Query: 113 MCPYSAKMKELLKQEYEFTPDYLVVELDRHDHGKELQDYIGKVTNRATVPNVVIHGVSRG 172
            CP+S  +K+LL + Y   P Y+ VE+D+H +G +L  YI K+T R TVPN++ +G S+G
Sbjct: 136 YCPFSKNLKKLLDKNYRLDPAYVAVEVDQHPNGDKLYSYIKKLTGRNTVPNLIANGDSKG 195

Query: 173 GYDDFKALLDKGKLLESLQDWSDGKTLSVSK 203
           G+DD  AL +  +L   L +W  G+ L VSK
Sbjct: 196 GFDDMLALHNSNELESKLIEWGVGE-LQVSK 225

>TPHA0H00630 Chr8 (125748..126323) [576 bp, 191 aa] {ON} Anc_3.189
           YDL010W
          Length = 191

 Score =  110 bits (274), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 58/147 (39%), Positives = 87/147 (59%), Gaps = 8/147 (5%)

Query: 65  QAIRNIQEEVGIKEGSS-GKSEPTRKAFDPAMEYQQILSNSPMIVFSKSMCPYSAKMKEL 123
           + +RN +    I  GSS GK       FDPA EY  I+  +P+++FSK+ CPY  ++K+L
Sbjct: 50  ERVRNNEAPRPIVGGSSSGK-------FDPAQEYINIMEMAPVVLFSKTFCPYCKRLKKL 102

Query: 124 LKQEYEFTPDYLVVELDRHDHGKELQDYIGKVTNRATVPNVVIHGVSRGGYDDFKALLDK 183
           L   Y F+PD  ++ELD+H +G EL  YI + T+  TVPN++++G S GG+D  K L D 
Sbjct: 103 LADNYRFSPDIKIIELDKHPNGDELFSYIKQQTSHTTVPNLIVNGKSLGGFDSIKKLQDD 162

Query: 184 GKLLESLQDWSDGKTLSVSKKEKPSNN 210
             + +++Q  SD   +  SK   P  N
Sbjct: 163 KLVEQTIQKDSDFSVIVSSKDAAPKPN 189

>SAKL0H06468g Chr8 complement(569965..570741) [777 bp, 258 aa] {ON}
           weakly similar to uniprot|Q12498 Saccharomyces
           cerevisiae YPL156C PRM4 Pheromone-regulated protein
           predicted to have 1 transmembrane segment
           transcriptionally regulated by Ste12p during mating and
           by Cat8p during the diauxic shift
          Length = 258

 Score = 88.6 bits (218), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 55/136 (40%), Positives = 81/136 (59%), Gaps = 16/136 (11%)

Query: 90  AFDPAMEYQQILSNSPMIVFSKSMCPYSAKMKELLKQEYEFTPDYLVVELDRHDHGKELQ 149
           AFDP++ +++ILS SP+++F+KS    S  +K LL +EY+ +P   VVELD+H  GKELQ
Sbjct: 124 AFDPSINFKEILSTSPVVIFTKSSDLGSQYLKNLLTKEYQISPQVAVVELDKHAKGKELQ 183

Query: 150 DYI--GKVTNRAT----------VPNVVIHGVS---RGGYDDFKALLDKGKLLESLQDWS 194
           DYI   K+T   +          VP + I+GVS   +G  DD K L   G LL+ L+ ++
Sbjct: 184 DYIKLNKLTAYKSNLSPSDDIPEVPYLFINGVSIINKGLKDDIKKLHKDGSLLDKLRSFA 243

Query: 195 DGKTLSVSKKEKPSNN 210
            G+ +   K   PSN+
Sbjct: 244 -GEKVMFEKANLPSNS 258

>NCAS0C01340 Chr3 complement(245717..246790) [1074 bp, 357 aa] {ON}
           Anc_8.679
          Length = 357

 Score = 87.8 bits (216), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 76/258 (29%), Positives = 118/258 (45%), Gaps = 52/258 (20%)

Query: 3   SKRNLRVFSFTAVLIFLIYFIVQNAQTSSDVG------KAINRK-PETLIGDGVVAKAKE 55
           +KRN R+ S T  L+ L+ FI+     S +        K +  K P+TL+         +
Sbjct: 100 AKRNTRIVSATLALLGLVAFIMFTWNDSFEASIDMLPFKDVPFKLPDTLVSGSAAEDTDK 159

Query: 56  TT--KID--EDVDQAIRNIQEEVGIKEGSSG---------------KSEPTR-------- 88
           T   +ID  E  D  ++  +E   I+   SG               K +P++        
Sbjct: 160 TNTPRIDVKETNDNVLKVWEEITNIRNELSGSDKGNFNLNDGAMNTKKKPSQGNAMRTKE 219

Query: 89  ------KAFDPAMEYQQILSNSPMIVFSKSMCPYSAKMKELLKQEYEFTPDYLVVELDRH 142
                 K FDP   + QI+  SP ++F KS    S  +++LLK+EYE +P+  VV+LD+H
Sbjct: 220 SSKLNVKPFDPERSFNQIIHTSPAVLFIKSSSTDSLNLRKLLKEEYEISPELAVVDLDKH 279

Query: 143 DHGKELQDYIG--------KVTNRATVPNVVIHG---VSRGGYDDFKALLDKGKLLESLQ 191
            +G EL+ YI         +  +   VP + ++G   ++ G   D   L   G LLE L+
Sbjct: 280 SNGVELEQYIKQNKLLTEERTNSPINVPYLFLNGNSVINNGLSKDISKLHKNGHLLEKLR 339

Query: 192 DWSDGKTLSVSKKEKPSN 209
             SDG  + V KK+ PSN
Sbjct: 340 SLSDGHIMFV-KKDHPSN 356

>NDAI0E01150 Chr5 complement(228591..229301) [711 bp, 236 aa] {ON}
           Anc_8.679
          Length = 236

 Score = 83.2 bits (204), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 67/228 (29%), Positives = 119/228 (52%), Gaps = 25/228 (10%)

Query: 3   SKRNLRVFSFTAVLIF----LIYFIVQN-----AQTSSDVGKAINRKPETLIGDGVV--A 51
           SKRNLRV S +A+L+      +YF   +     +  S++    I+    TLI   ++  +
Sbjct: 12  SKRNLRVIS-SALLLLGVTSFLYFTWNDYSEKLSNPSTNASSVISSTQSTLISQNILDES 70

Query: 52  KAKETTKIDEDVDQAIRNIQEEVGIKEGSSGKSEPTRKAFDPAMEYQQILSNSPMIVFSK 111
           + +   K+++++   I+N  +   I       S P + +F+P + + QIL  SPM++F K
Sbjct: 71  QLRNIQKVNDEI-LTIKNQIKTTSILSPIPTSSSPIQ-SFNPEVNFFQILETSPMVLFIK 128

Query: 112 SMCPYSAKMKELLKQEYEFTPDYLVVELDRHDHGKELQDYI--GKVTNR-------ATVP 162
           S    S  ++++L +EYE +P+  VV+LD+H HG EL+++I   K+  +       A++P
Sbjct: 129 SSERDSKIIRDILTKEYEISPELAVVDLDKHKHGDELEEFIRLNKLNEQAIFSSSLASLP 188

Query: 163 NVVIHGVSRG-GYDDFKALLDKGKLLESLQDWSDGKTLSVSKKEKPSN 209
            + ++ VS        K L  K  L++  +  S+GK L   +K  PSN
Sbjct: 189 YLFVNEVSMEIDTATIKDLHSKNFLIKKFELMSNGKVL-FERKNPPSN 235

>Kpol_1072.14 s1072 complement(30780..31532) [753 bp, 250 aa] {ON}
           complement(30780..31532) [753 nt, 251 aa]
          Length = 250

 Score = 79.7 bits (195), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 49/129 (37%), Positives = 73/129 (56%), Gaps = 11/129 (8%)

Query: 91  FDPAMEYQQILSNSPMIVFSKSMCPYSAKMKELLKQEYEFTPDYLVVELDRHDHGKELQD 150
           FD    +++I++ SP+++F KS  P S  +K LL +EYE +P+  VV+LDRH  G+ LQ 
Sbjct: 122 FDAERNFKEIINTSPVVIFIKSSDPASHYLKNLLLREYEVSPEMAVVDLDRHVQGQLLQK 181

Query: 151 YI-------GKVTNRATVPNVVIHGVS---RGGYDDFKALLDKGKLLESLQDWSDGKTLS 200
           YI       G+  N   VP + I+GVS    G   D K    KG LL+ L+ ++    + 
Sbjct: 182 YIKAYQLTSGENGNPPEVPYLFINGVSVINNGIEKDIKQAQTKGILLDKLKSFASDNVM- 240

Query: 201 VSKKEKPSN 209
           + KK+ PSN
Sbjct: 241 IQKKDMPSN 249

>TPHA0G01590 Chr7 complement(326061..326954) [894 bp, 297 aa] {ON}
           Anc_8.679 YPL156C
          Length = 297

 Score = 79.7 bits (195), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 50/133 (37%), Positives = 78/133 (58%), Gaps = 14/133 (10%)

Query: 90  AFDPAMEYQQILSNSPMIVFSKSMCPYSAKMKELLKQEYEFTPDYLVVELDRHDHGKELQ 149
           AFD A  Y++I++ S +++F KS    S ++K+LL   YE  P+  +V+LDRH  G  L 
Sbjct: 165 AFDAAANYKEIINTSRVVLFMKSSDSQSNEIKKLLLNSYEILPEIAIVDLDRHVQGALLH 224

Query: 150 DYIGK---VTN--------RATVPNVVIHGVS--RGGYDDFKALLDKGKLLESLQDWSDG 196
           DYI K   +TN        +  VP +VI+GVS       +F  L ++G LL+ L++ + G
Sbjct: 225 DYIAKKKILTNQLGYHKDDQLEVPFLVINGVSFVTSSNKNFHKLHNEGLLLQKLKNLA-G 283

Query: 197 KTLSVSKKEKPSN 209
            ++ +SKK+ PSN
Sbjct: 284 DSVMISKKDSPSN 296

>KAFR0A03870 Chr1 (787414..788217) [804 bp, 267 aa] {ON} Anc_8.679
           YPL156C
          Length = 267

 Score = 78.6 bits (192), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 46/130 (35%), Positives = 72/130 (55%), Gaps = 4/130 (3%)

Query: 83  KSEPTRKAFDPAMEYQQILSNSPMIVFSKSMCPYSAKMKELLKQEYEFTPDYLVVELDRH 142
           K  P   +FD    + +IL+ SP+++F K+    S   K LL +EYE +P+  VV+LD+H
Sbjct: 138 KLNPESASFDVETNFNEILNTSPVVLFIKTSDKQSNYFKNLLLREYEISPEVAVVDLDKH 197

Query: 143 DHGKELQDYIGK---VTNRATVPNVVIHGVSRGGYDDFKALLDKGKLLESLQDWSDGKTL 199
            +G +LQ+YI K   +T    +P + I+ V+    D+ K     G LLE+ +   +GK +
Sbjct: 198 SNGAKLQEYIRKNKLMTKDQKLPYLFINSVAITNNDNLKKFHKDGTLLENFKKLGNGKIM 257

Query: 200 SVSKKEKPSN 209
              K E PSN
Sbjct: 258 -FKKIEAPSN 266

>NCAS0B01640 Chr2 (268028..268750) [723 bp, 240 aa] {ON} Anc_8.679
          Length = 240

 Score = 77.8 bits (190), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 65/218 (29%), Positives = 114/218 (52%), Gaps = 16/218 (7%)

Query: 2   PSKRNLRVFSFTAVLIFLIYFIVQNAQTSSDVGKAINRKP-ETLIGDGVVAKAKETTKID 60
           P+ R  R+ S T +++ LI F+V      S+   A +  P  +L+ + ++  A    +I 
Sbjct: 30  PATRTARIVSSTLLVLGLITFLVFTWNDYSEQNIANDPNPTRSLLSEDLLMLANTFDEIK 89

Query: 61  EDVDQAIRNIQEEVGIKEGSSGKSEPTRKA-FDPAMEYQQILSNSPMIVFSKSMCPYSAK 119
                +I + QE    +  ++ ++ P+  A F+    + QI+  SP+++F KS    S  
Sbjct: 90  SRT--SIVSHQE----RPTTTLQALPSHAAAFNVQQHFTQIIHTSPVVLFMKSSQDDSRL 143

Query: 120 MKELLKQEYEFTPDYLVVELDRHDHGKELQDYI--GKVTNRAT----VPNVVIH-GVSRG 172
           M++LL++EYE +P+  VV+LD+H HG  LQDYI   K+ NR T    +P + I+      
Sbjct: 144 MRDLLQKEYEISPEIAVVDLDKHTHGAALQDYIRLNKLDNRGTAYVKLPYLFINEQFVHV 203

Query: 173 GYDDFKALLDKGKLLESLQDWSDGKTLSVSKKEKPSNN 210
              + K+L   G LL++ +D + G+ +   K   PSN+
Sbjct: 204 DVKNVKSLHKDGALLKTFKD-AAGENVFWHKTGVPSNS 240

>KLLA0D05973g Chr4 (512611..513456) [846 bp, 281 aa] {ON} some
           similarities with uniprot|Q12498 Saccharomyces
           cerevisiae YPL156C PRM4 Pheromone-regulated protein
           predicted to have 1 transmembrane segment
           transcriptionally regulated by Ste12p during mating and
           by Cat8p during the diauxic shift
          Length = 281

 Score = 77.8 bits (190), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 75/135 (55%), Gaps = 16/135 (11%)

Query: 91  FDPAMEYQQILSNSPMIVFSKSMCPYSAKMKELLKQEYEFTPDYLVVELDRHDHGKELQD 150
           F P++ +QQIL+ SP+I+F KS    S  +K +L  EY F+P+ +VV+LD+H  G  +Q+
Sbjct: 148 FSPSLGFQQILNTSPVILFIKSSEKNSVDLKNVLTLEYTFSPEIIVVDLDKHQFGDSMQE 207

Query: 151 YI------------GKVTNRATVPNVVIHGVS---RGGYDDFKALLDKGKLLESLQDWSD 195
           YI            G+ +    VP + I+GVS   +   DD       G LL  L+  +D
Sbjct: 208 YIQLNRLATYKSNYGESSKSPDVPYLFINGVSLINKSLKDDILNKHADGSLLSKLRHVAD 267

Query: 196 GKTLSVSKKEKPSNN 210
            K +S+SK + PSN+
Sbjct: 268 SK-VSISKVDIPSNS 281

>Ecym_2394 Chr2 complement(763799..764644) [846 bp, 281 aa] {ON}
           similar to Ashbya gossypii ACR146W
          Length = 281

 Score = 72.8 bits (177), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 50/143 (34%), Positives = 75/143 (52%), Gaps = 16/143 (11%)

Query: 83  KSEPTRKAFDPAMEYQQILSNSPMIVFSKSMCPYSAKMKELLKQEYEFTPDYLVVELDRH 142
           +S   +  F PA+ +Q+IL+ SP++VF+K M   S  +K LL  EYE TP+  +V+L +H
Sbjct: 140 RSGGMKNEFMPAIAFQEILNTSPVVVFAKGMNRDSEYLKNLLHAEYEVTPEIAIVDLMKH 199

Query: 143 DHGKELQDYI--GKVTNRAT----------VPNVVIHGVSRGGYD---DFKALLDKGKLL 187
           D G ELQ YI   K+    T          VP + I+GVS        D K     G L+
Sbjct: 200 DQGDELQKYIMLNKLNTYNTHYDASDDIPDVPYLFINGVSVINVSLEKDIKLQHTSGLLI 259

Query: 188 ESLQDWSDGKTLSVSKKEKPSNN 210
           E L+ ++ G+ +   +   PSN+
Sbjct: 260 EKLRSFA-GEKVKFKRLSPPSNS 281

>NDAI0K01350 Chr11 complement(308152..308967) [816 bp, 271 aa] {ON}
           Anc_8.679
          Length = 271

 Score = 71.6 bits (174), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 72/132 (54%), Gaps = 13/132 (9%)

Query: 90  AFDPAMEYQQILSNSPMIVFSKSMCPYSAKMKELLKQEYEFTPDYLVVELDRHDHGKELQ 149
           +F+    ++QIL+ SP ++F KS    S  +K LL  EYE +P   +V+L++H +G +L 
Sbjct: 140 SFNAEDNFKQILNTSPAVLFIKSSEWDSQYLKNLLSIEYEISPQLAIVDLEKHSNGNQLL 199

Query: 150 DYIGK-----VTNRAT----VPNVVIHGVS---RGGYDDFKALLDKGKLLESLQDWSDGK 197
           +YI K      +N+A+    +P + I+GVS    G   D K L   G LL  L+ +SDG 
Sbjct: 200 NYIKKNKLLPPSNKASSTPNLPYLFINGVSIINNGLSKDIKQLHSNGHLLNKLKSYSDGH 259

Query: 198 TLSVSKKEKPSN 209
                KK  PSN
Sbjct: 260 IF-FEKKNFPSN 270

>Kpol_2002.36 s2002 complement(73659..73988) [330 bp, 109 aa] {ON}
           complement(73659..73988) [330 nt, 110 aa]
          Length = 109

 Score = 65.9 bits (159), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 34/92 (36%), Positives = 54/92 (58%), Gaps = 1/92 (1%)

Query: 100 ILSNSPMIVFSKSMCPYSAKMKELLKQEYEFTPD-YLVVELDRHDHGKELQDYIGKVTNR 158
           ++   P+ V +KS CP+    +E L +EY    +  LV+ELD    G E+Q+ + ++T++
Sbjct: 13  MIGEKPVFVAAKSYCPHCRATRETLFEEYNLPREKALVLELDLMTDGAEIQEALAEITHQ 72

Query: 159 ATVPNVVIHGVSRGGYDDFKALLDKGKLLESL 190
            TVPN+ I+G   GG  D +AL   G+L E L
Sbjct: 73  DTVPNIFIYGQHVGGNSDLQALKKDGQLKEML 104

>CAGL0M02167g Chr13 complement(259132..259833) [702 bp, 233 aa] {ON}
           some similarities with uniprot|Q12498 Saccharomyces
           cerevisiae YPL156c PRM4
          Length = 233

 Score = 67.8 bits (164), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 40/136 (29%), Positives = 74/136 (54%), Gaps = 18/136 (13%)

Query: 91  FDPAMEYQQILSNSPMIVFSKSMCPYSAKMKELLKQEYEFTPDYLVVELDRHDHGKELQD 150
           +DP   ++QI++ SP ++F +S    S  +++LL ++YE TP+  +V+LD+HDH   L+ 
Sbjct: 98  YDPEKNFKQIINTSPAVLFIRSSEYESNILRKLLTRDYEITPELAIVDLDKHDHDVLLER 157

Query: 151 YI--------------GKVTNRATVPNVVIHG---VSRGGYDDFKALLDKGKLLESLQDW 193
           +I                   +A  P + I+G   ++ G  DD     +KG+LL  L+ +
Sbjct: 158 HILSHKIKSTKVEVLKSTSVKQAKAPYLFINGHSLINNGIADDILKFHEKGQLLTKLKAF 217

Query: 194 SDGKTLSVSKKEKPSN 209
           + G+ +  +K++ PSN
Sbjct: 218 A-GENIVFNKRDLPSN 232

>YPL156C Chr16 complement(255913..256767) [855 bp, 284 aa] {ON}
           PRM4Pheromone-regulated protein proposed to be involved
           in mating; predicted to have 1 transmembrane segment;
           transcriptionally regulated by Ste12p during mating and
           by Cat8p during the diauxic shift
          Length = 284

 Score = 68.2 bits (165), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 71/134 (52%), Gaps = 13/134 (9%)

Query: 88  RKAFDPAMEYQQILSNSPMIVFSKSMCPYSAKMKELLKQEYEFTPDYLVVELDRHDHGKE 147
            K FDP  ++  I+  SP ++F KS    S  +K LL++E+E +P+   V+L++H HG E
Sbjct: 151 HKKFDPRTDFLDIIRTSPAVLFIKSSQADSIFLKNLLQREFEISPELATVDLEKHSHGYE 210

Query: 148 LQDYIGK----VTNRATV-----PNVVIHGVS---RGGYDDFKALLDKGKLLESLQDWSD 195
           L+ YI +    +   A +     P + ++G+S   RG   D      KG LL  L+  + 
Sbjct: 211 LEKYIKQNKLNIDTSAALESIQSPYLFLNGISVINRGMVRDIIEPHSKGLLLPLLKSEAR 270

Query: 196 GKTLSVSKKEKPSN 209
           G  L V KK+ PSN
Sbjct: 271 GNLL-VEKKDIPSN 283

>Skud_16.126 Chr16 complement(227492..228355) [864 bp, 287 aa] {ON}
           YPL156C (REAL)
          Length = 287

 Score = 66.6 bits (161), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 73/136 (53%), Gaps = 17/136 (12%)

Query: 88  RKAFDPAMEYQQILSNSPMIVFSKSMCPYSAKMKELLKQEYEFTPDYLVVELDRHDHGKE 147
           +K FDP + +  I+S SP ++F KS    S  +K LL++E+E +P+   V+L++H HG +
Sbjct: 154 QKEFDPKVSFLDIISTSPAVLFIKSSQMDSIFLKNLLQREFEISPELATVDLEKHSHGYQ 213

Query: 148 LQDYIGKVTNRATV-----------PNVVIHGVS---RGGYDDFKALLDKGKLLESLQDW 193
           L+ YI +  N+ ++           P + ++GVS    G   D      +G LL  L+  
Sbjct: 214 LEKYIKQ--NKLSINPSTALESIHSPYLFLNGVSVINNGMAKDIIEPHSEGLLLSILKSE 271

Query: 194 SDGKTLSVSKKEKPSN 209
           + G  L V KK+ PSN
Sbjct: 272 ARGNLL-VEKKDIPSN 286

>KNAG0G02580 Chr7 (585685..586521) [837 bp, 278 aa] {ON} Anc_8.679
           YPL156C
          Length = 278

 Score = 65.9 bits (159), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 56/218 (25%), Positives = 104/218 (47%), Gaps = 30/218 (13%)

Query: 20  IYFIVQNAQTSSDVGKAINRKPETLIGDGVVAKAKETTKIDEDVDQAIRNIQEEVGIKEG 79
           +Y   + A T+      ++ K  + I    V  +KE     + VDQ I  +++E+  +  
Sbjct: 64  LYSDARTATTTLYASTTVSAKTTSTITAAAVVDSKEAQLNSQKVDQEISAVRKEIDAQTQ 123

Query: 80  SSGKSEPTRK-------------AFDPAMEYQQILSNSPMIVFSKS--MCPYSAKMKELL 124
            + + +  +K              +DP   + ++++ SP+++F KS      +  ++++L
Sbjct: 124 PTARGDRRKKKKVLATELLADDAPWDPLSTFTEVMNMSPVVLFIKSSERNSLADHVRKVL 183

Query: 125 KQEYEFTPDYLVVELDRHDHGKELQDYI------GKVTNRATVPNVVIHGV---SRGGYD 175
             EYE +P   VV+LD+H +G+ELQ+YI      G  + +  +P + ++ V     G  D
Sbjct: 184 STEYEISPGAAVVDLDKHRYGEELQNYIETQKLPGGSSQQ--LPYLFVNRVPVIGAGEID 241

Query: 176 ---DFKALLDKGKLLESLQDWSDGKTLSVSKKEKPSNN 210
              +FK L   G LL+  +  ++ K L   K E PSNN
Sbjct: 242 SVAEFKRLHSTGALLDRFKQLAERKVL-FEKIELPSNN 278

>TBLA0B03820 Chr2 complement(878781..879536) [756 bp, 251 aa] {ON}
           Anc_8.679 YPL156C
          Length = 251

 Score = 65.5 bits (158), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 60/97 (61%), Gaps = 6/97 (6%)

Query: 79  GSSGKSEPTRKAFDPAMEYQQILSNSPMIVFSKSMCPYSAKMKELLKQEYEFTPDYLVVE 138
            S+    PT  +++P + ++QIL+ SPM++F +S    S  +K+L   EYE +P++ +V+
Sbjct: 114 SSTRDPNPT-GSYNPELNFKQILNTSPMVLFIRSSQKSSKFIKKLFLNEYEISPEFAIVD 172

Query: 139 LDRHDHGKELQDYI--GKVTNR---ATVPNVVIHGVS 170
           LD H +G  LQ+YI   K+ N+     VP + I+GVS
Sbjct: 173 LDLHKNGNILQNYIQTKKIINKDDTLDVPYLFINGVS 209

>Kwal_33.13166 s33 complement(102922..103338) [417 bp, 138 aa] {ON}
           YCL035C (GRX1) - Glutaredoxin [contig 121] FULL
          Length = 138

 Score = 62.8 bits (151), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 34/90 (37%), Positives = 53/90 (58%), Gaps = 1/90 (1%)

Query: 98  QQILSNSPMIVFSKSMCPYSAKMKELLKQEYEFTPDYL-VVELDRHDHGKELQDYIGKVT 156
           Q ++ N+ + V SK+ CPY     +LL ++ + T D + VV+LD    G E+Q+ + +++
Sbjct: 40  QGLIKNNKIFVASKTYCPYCQATLKLLFEDKKLTKDQVYVVQLDTIKEGSEIQEALAEIS 99

Query: 157 NRATVPNVVIHGVSRGGYDDFKALLDKGKL 186
            + TVPNV I G   GG  D +AL   GKL
Sbjct: 100 GQKTVPNVYISGEHIGGNSDLQALESSGKL 129

>TPHA0B03560 Chr2 complement(832814..833134) [321 bp, 106 aa] {ON} 
          Length = 106

 Score = 61.2 bits (147), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 53/94 (56%), Gaps = 1/94 (1%)

Query: 94  AMEYQQILSNSPMIVFSKSMCPYSAKMKELLKQEYEFTPD-YLVVELDRHDHGKELQDYI 152
           A   +++++  P+ V +KS CPY    K  L +E     D   V++LD+   G+ +Q  +
Sbjct: 6   AQSVKELIAAKPIFVAAKSYCPYCQASKSTLFKELNVPADKATVLDLDQMQDGQAIQAIL 65

Query: 153 GKVTNRATVPNVVIHGVSRGGYDDFKALLDKGKL 186
            ++T + TVPN+ I+G   GG  D +AL + G+L
Sbjct: 66  AELTQQNTVPNIFINGKHIGGNSDLQALKNNGEL 99

>Suva_16.154 Chr16 complement(265047..265898) [852 bp, 283 aa] {ON}
           YPL156C (REAL)
          Length = 283

 Score = 62.8 bits (151), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 72/135 (53%), Gaps = 17/135 (12%)

Query: 89  KAFDPAMEYQQILSNSPMIVFSKSMCPYSAKMKELLKQEYEFTPDYLVVELDRHDHGKEL 148
           K FDP + +  I++ SP ++F KS    S  +K LL++E+E +P+  +V+L++H +G EL
Sbjct: 151 KKFDPKVNFLDIINTSPAVLFIKSSQMDSVFLKRLLQREFETSPELAIVDLEKHSYGYEL 210

Query: 149 QDYIGKVTNRATV-----------PNVVIHGVS---RGGYDDFKALLDKGKLLESLQDWS 194
           + YI +  N+  V           P + ++GVS    G   D      KG LL  L+  +
Sbjct: 211 EKYIKE--NKLDVDPSTALEAIHSPYLFLNGVSVINNGIARDIIEPHSKGLLLPVLKSKA 268

Query: 195 DGKTLSVSKKEKPSN 209
            G  L V K++ PSN
Sbjct: 269 GGNLL-VEKRDIPSN 282

>KLTH0D11308g Chr4 (925622..926437) [816 bp, 271 aa] {ON} some
           similarities with uniprot|Q12498 Saccharomyces
           cerevisiae YPL156C PRM4 Pheromone-regulated protein
           predicted to have 1 transmembrane segment
           transcriptionally regulated by Ste12p during mating and
           by Cat8p during the diauxic shift
          Length = 271

 Score = 62.4 bits (150), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 42/136 (30%), Positives = 73/136 (53%), Gaps = 13/136 (9%)

Query: 86  PTRKAFDPAMEYQQILSNSPMIVFSKSMCPYSAKMKELLKQEYEFTPDYLVVELDRHDHG 145
           P    FDPA  +Q+ILS SP+++F  S    S +++ LL+++YE +P   VV+L++H  G
Sbjct: 138 PPSADFDPAANFQEILSASPVVLFVDS-AQDSERLRALLQRDYEVSPAPAVVDLEKHSRG 196

Query: 146 KELQDYI----GKVTNRATVPN----VVIHGVSRGGYD---DFKALLDKGKLLESLQDWS 194
            +L+ YI     K  +   VP     + ++G S    D   D + L  + +LL  L+  +
Sbjct: 197 AQLETYIRYYRTKPASATAVPRQPPYLFVNGNSVINSDFQSDIQDLHAQNELLAKLKTVA 256

Query: 195 DGKTLSVSKKEKPSNN 210
           +G  +  ++   PSN+
Sbjct: 257 EGNVM-FARNNAPSNS 271

>ACR146W Chr3 (607725..608366) [642 bp, 213 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL156C (PRM4)
          Length = 213

 Score = 60.8 bits (146), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 65/133 (48%), Gaps = 14/133 (10%)

Query: 91  FDPAMEYQQILSNSPMIVFSKSMCPYSAKMKELLKQEYEFTPDYLVVELDRHDHGKELQD 150
           F PA  +Q+I+S SP ++F K     S  ++ LL  EYE TP+  VV+L +H +  +LQ 
Sbjct: 82  FRPAQNFQEIISTSPFVLFVKGTDESSRYLRHLLTNEYEVTPEIAVVDLSKHRYSGDLQR 141

Query: 151 YIGK----------VTNRATVPNVVIHG---VSRGGYDDFKALLDKGKLLESLQDWSDGK 197
           YI +            N   VP + + G   ++     D +   ++G+L   LQ  + G 
Sbjct: 142 YIREHKLHGPLFQLTENTPDVPYLFVKGESVINTSVEKDIREPHERGQLQAELQRHA-GL 200

Query: 198 TLSVSKKEKPSNN 210
              + K+  PSN+
Sbjct: 201 DAVIKKRSPPSNS 213

>Smik_6.353 Chr6 (567550..568410) [861 bp, 286 aa] {ON} YPL156C
           (REAL)
          Length = 286

 Score = 61.2 bits (147), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 44/136 (32%), Positives = 69/136 (50%), Gaps = 17/136 (12%)

Query: 89  KAFDPAMEYQQILSNSPMIVFSKSMCPYSAKMKELLKQEYEFTPDYLVVELDRHDHGKEL 148
           K FDP   +  I+  SP ++F KS    S  ++ LL++E+E +P+   V+L++H  G EL
Sbjct: 154 KNFDPKANFLDIIKTSPAVLFIKSSQSDSIFLRNLLQKEFEISPELATVDLEKHSRGYEL 213

Query: 149 QDYIGKVTNRATV-----------PNVVIHGVS---RGGYDDFKALLDKGKLLESLQDWS 194
           + YI +  N+  +           P + ++GVS    G   D      KG LL  L+  +
Sbjct: 214 EKYIKQ--NKLNIDPDIALESIHPPYLFLNGVSLINNGIEKDIIEPHSKGSLLSVLKSEA 271

Query: 195 DGKTLSVSKKEKPSNN 210
            G  L V KK+ PSN+
Sbjct: 272 RGNLL-VEKKDIPSNS 286

>YDR513W Chr4 (1471017..1471448) [432 bp, 143 aa] {ON}
           GRX2Cytoplasmic glutaredoxin, thioltransferase,
           glutathione-dependent disulfide oxidoreductase involved
           in maintaining redox state of target proteins, also
           exhibits glutathione peroxidase activity, expression
           induced in response to stress
          Length = 143

 Score = 58.5 bits (140), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 54/109 (49%), Gaps = 1/109 (0%)

Query: 84  SEPTRKAFDPAMEYQQILSNSPMIVFSKSMCPYSAKMKELLKQEYEFTPD-YLVVELDRH 142
           S P   + +     + ++    + V +K+ CPY       L QE        LV+ELD  
Sbjct: 31  STPKMVSQETVAHVKDLIGQKEVFVAAKTYCPYCKATLSTLFQELNVPKSKALVLELDEM 90

Query: 143 DHGKELQDYIGKVTNRATVPNVVIHGVSRGGYDDFKALLDKGKLLESLQ 191
            +G E+QD + +++ + TVPNV I+G   GG  D + L   GKL E L+
Sbjct: 91  SNGSEIQDALEEISGQKTVPNVYINGKHIGGNSDLETLKKNGKLAEILK 139

>Smik_4.794 Chr4 (1393831..1394262) [432 bp, 143 aa] {ON} YDR513W
           (REAL)
          Length = 143

 Score = 58.5 bits (140), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 55/109 (50%), Gaps = 1/109 (0%)

Query: 84  SEPTRKAFDPAMEYQQILSNSPMIVFSKSMCPYSAKMKELLKQEYEF-TPDYLVVELDRH 142
           S P   + +     + +++   + V +K+ CPY       L QE        LV+ELD  
Sbjct: 31  SSPKMVSQETVSHVKDLIAQKDVFVAAKTYCPYCKATLSTLFQELNVPKSKALVLELDEM 90

Query: 143 DHGKELQDYIGKVTNRATVPNVVIHGVSRGGYDDFKALLDKGKLLESLQ 191
            +G E+QD + +++ + TVPNV I+G   GG  D + L   GKL E L+
Sbjct: 91  SNGSEIQDALEEISGQKTVPNVYINGKHIGGNSDLETLKKNGKLAEILK 139

>Suva_2.693 Chr2 (1223806..1224237) [432 bp, 143 aa] {ON} YDR513W
           (REAL)
          Length = 143

 Score = 58.2 bits (139), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 55/109 (50%), Gaps = 1/109 (0%)

Query: 84  SEPTRKAFDPAMEYQQILSNSPMIVFSKSMCPYSAKMKELLKQEYEFTPD-YLVVELDRH 142
           S P   + +     + ++    + V +K+ CPY       L QE        +V+ELD  
Sbjct: 31  STPKMVSQETIAHVKDLIGQKEVFVAAKTYCPYCKATLSTLFQELNVPKSKAVVLELDEM 90

Query: 143 DHGKELQDYIGKVTNRATVPNVVIHGVSRGGYDDFKALLDKGKLLESLQ 191
            +G E+QD + +++ + TVPNV I+G   GG  D +AL   GKL E L+
Sbjct: 91  SNGSEIQDALEEISGQKTVPNVYINGKHIGGNSDLEALKKNGKLAELLK 139

>KLLA0C01298g Chr3 complement(101676..101999) [324 bp, 107 aa] {ON}
           weakly similar to uniprot|P25567 Saccharomyces
           cerevisiae YCL037C SRO9 Associates with translating
           ribosomes and weakly similar to uniprot|Q12034
           Saccharomyces cerevisiae YDR515W SLF1 RNA binding
           protein that associates with polysomes
          Length = 107

 Score = 57.4 bits (137), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 58/97 (59%), Gaps = 4/97 (4%)

Query: 98  QQILSNSPMIVFSKSMCPYS-AKMKELLKQEYEFTPDYLVVELDRHDHGKELQDYIGKVT 156
           Q ++++S + V SK+ CPY  A +K L +++        V++L++ + G ++QD + ++T
Sbjct: 11  QGLINSSKIFVASKTYCPYCQATLKTLFEEKKVDKKLATVLQLNQLEDGSDIQDALAEIT 70

Query: 157 NRATVPNVVIHGVSRGGYDDFKALLDKG---KLLESL 190
            + TVPN+ I+G   GG  D + L + G   KLL SL
Sbjct: 71  GQKTVPNIFINGKHIGGNSDLQELNNSGDLDKLLASL 107

>Skud_4.788 Chr4 (1391142..1391579) [438 bp, 145 aa] {ON} YDR513W
           (REAL)
          Length = 145

 Score = 58.2 bits (139), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 55/109 (50%), Gaps = 1/109 (0%)

Query: 84  SEPTRKAFDPAMEYQQILSNSPMIVFSKSMCPYSAKMKELLKQEYEFTPD-YLVVELDRH 142
           S P   + +     + ++    + V +K+ CPY       L QE        LV+ELD  
Sbjct: 31  STPKMVSQETIAHVKDLIGQKEVFVAAKTYCPYCKATLSTLFQELNVPKSKALVLELDEM 90

Query: 143 DHGKELQDYIGKVTNRATVPNVVIHGVSRGGYDDFKALLDKGKLLESLQ 191
            +G E+QD + +++ + TVPNV I+G   GG  D ++L   GKL E L+
Sbjct: 91  SNGSEIQDALEEISGQRTVPNVYINGKHIGGNSDLESLKKSGKLAEILK 139

>TPHA0E03730 Chr5 (787911..788231) [321 bp, 106 aa] {ON} Anc_1.38
           YCL035C
          Length = 106

 Score = 56.6 bits (135), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 55/100 (55%), Gaps = 4/100 (4%)

Query: 95  MEYQQILSNSPMIVFSKSMCPYSAKMKELLKQEYEFTPD-YLVVELDRHDHGKELQDYIG 153
           +E Q+++   P+ + +KS C  S   K  L  EY    D   V+ELD+   G+ +   + 
Sbjct: 7   LEVQKMIDEKPVFIATKSYCNESNAAKGTLFDEYSILDDEATVLELDKMSDGEAVLFALS 66

Query: 154 KVTNRATVPNVVIHGVSRGGYDDFKALLDKG---KLLESL 190
           K++ ++T+PN+ I G   GGY D K + + G   KLL+S+
Sbjct: 67  KISQQSTLPNIFIKGKHIGGYQDLKEMNESGELEKLLDSI 106

>KNAG0C00450 Chr3 complement(77334..77807) [474 bp, 157 aa] {ON}
           Anc_1.38 YCL035C
          Length = 157

 Score = 57.4 bits (137), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 31/92 (33%), Positives = 51/92 (55%), Gaps = 1/92 (1%)

Query: 96  EYQQILSNSPMIVFSKSMCPYS-AKMKELLKQEYEFTPDYLVVELDRHDHGKELQDYIGK 154
           + ++++   P+ V SK+ CPY  A +K L K+      + +V++LD    G E+Q+ +  
Sbjct: 57  QVKELIGEKPIFVASKTYCPYCRATLKTLFKELEIPESEAVVLQLDEMPDGPEIQEALFD 116

Query: 155 VTNRATVPNVVIHGVSRGGYDDFKALLDKGKL 186
           +  + TVPN+ I G   GG DD + L   GKL
Sbjct: 117 INGQKTVPNIYIKGQHIGGNDDLQTLKKAGKL 148

>KLTH0F01276g Chr6 complement(101034..101450) [417 bp, 138 aa] {ON}
           similar to uniprot|P25373 Saccharomyces cerevisiae
           YCL035C GRX1 and similar to uniprot|P17695 Saccharomyces
           cerevisiae YDR513w TTR1
          Length = 138

 Score = 56.2 bits (134), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 55/95 (57%), Gaps = 1/95 (1%)

Query: 98  QQILSNSPMIVFSKSMCPYSAKMKELLKQEYEFTPD-YLVVELDRHDHGKELQDYIGKVT 156
           + ++ ++ + V +K+ CPY     +LL Q+ +   D  L+++LD    G E+Q+ + +++
Sbjct: 40  RSLIKDNKIFVAAKTYCPYCNATLKLLFQDKKLRKDQVLLLQLDTMKEGSEIQEALTEIS 99

Query: 157 NRATVPNVVIHGVSRGGYDDFKALLDKGKLLESLQ 191
            + TVPN+ I G   GG  D +AL   GKL E L+
Sbjct: 100 GQRTVPNIYILGEHIGGNSDLQALEASGKLDELLE 134

>CAGL0K05813g Chr11 (570054..570482) [429 bp, 142 aa] {ON} highly
           similar to uniprot|P17695 Saccharomyces cerevisiae
           YDR513w TTR1
          Length = 142

 Score = 55.8 bits (133), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 33/101 (32%), Positives = 51/101 (50%), Gaps = 1/101 (0%)

Query: 92  DPAMEYQQILSNSPMIVFSKSMCPYSAKMKELLKQEYEFTPD-YLVVELDRHDHGKELQD 150
           D     + ++    + V SKS CPY    K+ L +E +   D  +V+ELD  + G ++Q 
Sbjct: 38  DTVNSVKNMIGQKKIFVASKSYCPYCRAAKQTLFEELKVPMDKAVVLELDEIEEGSDIQQ 97

Query: 151 YIGKVTNRATVPNVVIHGVSRGGYDDFKALLDKGKLLESLQ 191
            + ++  + TVPN+ I G   GG  D + L   GKL   LQ
Sbjct: 98  ALAEINGQNTVPNIYIDGQHIGGNSDLQKLKQTGKLQPLLQ 138

>KAFR0D00360 Chr4 complement(54064..54393) [330 bp, 109 aa] {ON}
           Anc_1.38 YCL035C
          Length = 109

 Score = 54.3 bits (129), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 50/88 (56%), Gaps = 1/88 (1%)

Query: 100 ILSNSPMIVFSKSMCPYS-AKMKELLKQEYEFTPDYLVVELDRHDHGKELQDYIGKVTNR 158
           +++   + V SKS CPYS A +  L  +    T   LV+++++   G ++QD + ++T +
Sbjct: 13  LINEKDVFVASKSYCPYSKAALNTLFTELNVPTSKALVLQVNQLPEGSDIQDALLELTGQ 72

Query: 159 ATVPNVVIHGVSRGGYDDFKALLDKGKL 186
            TVPN+ I G   GG DD + L   GKL
Sbjct: 73  RTVPNIYIKGKHIGGNDDLQILKQSGKL 100

>NCAS0B08870 Chr2 (1703167..1703496) [330 bp, 109 aa] {ON} Anc_1.38
           YCL035C
          Length = 109

 Score = 54.3 bits (129), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 54/95 (56%), Gaps = 1/95 (1%)

Query: 98  QQILSNSPMIVFSKSMCPYS-AKMKELLKQEYEFTPDYLVVELDRHDHGKELQDYIGKVT 156
           +Q+++   + V SK+ CPY  A +K L K+        LV++L+  D G E+Q  + ++ 
Sbjct: 11  KQLINEKEIFVASKTYCPYCHATIKTLFKELNVPKSKALVLQLNEMDDGAEIQQALFEIN 70

Query: 157 NRATVPNVVIHGVSRGGYDDFKALLDKGKLLESLQ 191
            + TVPN+ I+G   GG D  + L + G+L + L+
Sbjct: 71  GQKTVPNIYINGKHVGGNDKLQDLKESGELEDLLE 105

>Kwal_26.8814 s26 (953489..954316) [828 bp, 275 aa] {ON} YPL156C
           (PRM4) -  [contig 68] FULL
          Length = 275

 Score = 56.6 bits (135), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 38/130 (29%), Positives = 67/130 (51%), Gaps = 12/130 (9%)

Query: 91  FDPAMEYQQILSNSPMIVFSKSMCPYSAKMKELLKQEYEFTPDYLVVELDRHDHGKELQD 150
           FD A  + +IL+ SP+++F  S    S  ++ LL + YE +P   VV+L++H  G +L+ 
Sbjct: 148 FDAAASFSEILNTSPVVIFVDS-AQDSELLRSLLHRHYEVSPAPAVVDLEKHSRGAQLES 206

Query: 151 YIGKVTNRATV-------PNVVIHGVSRGGYD---DFKALLDKGKLLESLQDWSDGKTLS 200
           +I       T        P + ++G S    D   D + L  + KLLE L+  ++G+ + 
Sbjct: 207 FIRLYKTDQTSNPSPREPPYLFVNGQSVINTDFKSDIQDLHAQNKLLEKLRSVAEGQVM- 265

Query: 201 VSKKEKPSNN 210
            ++   PSN+
Sbjct: 266 FTRNNAPSNS 275

>TBLA0A05080 Chr1 complement(1251350..1251706) [357 bp, 118 aa] {ON}
           Anc_1.38 YCL035C
          Length = 118

 Score = 53.5 bits (127), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 54/108 (50%), Gaps = 4/108 (3%)

Query: 85  EPTRKAFDPAMEYQQILSNSPMIVFSKSMCPYSAKMKELLKQEYEFTPD-YLVVELDRHD 143
           +P+    D    +   ++  P+ V  KS CPYS K  E L  +     D  L++ +D  +
Sbjct: 11  KPSHAVLDQVKAW---INAKPIFVARKSDCPYSKKTLETLFDDLHVPKDKVLLITVDEIE 67

Query: 144 HGKELQDYIGKVTNRATVPNVVIHGVSRGGYDDFKALLDKGKLLESLQ 191
           +G E++  I   T + TVPN  I+G   GG DD + L   G+L E L+
Sbjct: 68  NGAEVKQAIIDYTGQKTVPNTYINGRHIGGNDDLQKLKQTGELQELLR 115

>NDAI0F04430 Chr6 complement(1083612..1084022) [411 bp, 136 aa] {ON}
           Anc_1.38 YCL035C
          Length = 136

 Score = 53.9 bits (128), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 32/108 (29%), Positives = 57/108 (52%), Gaps = 2/108 (1%)

Query: 81  SGKSEPTRKAFDPAMEY-QQILSNSPMIVFSKSMCPYSAKMKELLKQEYEF-TPDYLVVE 138
           S K    +      +EY Q+++  + +I+F+KS CPY    K  + +E        LV++
Sbjct: 22  SRKQNTNKMVSQQTVEYVQKLIKENKVIIFAKSYCPYCKAAKHTIFEEINVPKSKALVLD 81

Query: 139 LDRHDHGKELQDYIGKVTNRATVPNVVIHGVSRGGYDDFKALLDKGKL 186
           LD  D+G+E+Q  +  +  + TVP+V I+G   GG  + + +   G+L
Sbjct: 82  LDLMDNGQEIQQALLAINGQKTVPHVYINGEFIGGNSEVQKIYKSGEL 129

>Kpol_2000.99 s2000 (219541..219966) [426 bp, 141 aa] {ON}
           (219541..219966) [426 nt, 142 aa]
          Length = 141

 Score = 53.9 bits (128), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 52/95 (54%), Gaps = 1/95 (1%)

Query: 98  QQILSNSPMIVFSKSMCPYSAKMKELLKQEYEFTPD-YLVVELDRHDHGKELQDYIGKVT 156
           ++++    + V +KS CPY     + L  +Y    D  LV++L++ + G ++Q  + ++T
Sbjct: 43  KELIGQKKVFVAAKSYCPYCQASLQTLFTDYHVPKDKSLVLQLNQMEDGDDIQAALAEIT 102

Query: 157 NRATVPNVVIHGVSRGGYDDFKALLDKGKLLESLQ 191
            + TVPN+ I G   GG  D + L   GKL E L+
Sbjct: 103 GQRTVPNIYIDGKHIGGNSDLQQLKSSGKLDELLK 137

>TDEL0C06640 Chr3 (1213768..1214199) [432 bp, 143 aa] {ON} Anc_1.38
           YCL035C
          Length = 143

 Score = 52.8 bits (125), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 60/119 (50%), Gaps = 13/119 (10%)

Query: 87  TRKAFDPA-----MEYQQ-------ILSNSPMIVFSKSMCPYS-AKMKELLKQEYEFTPD 133
           TR+ F  A     M  QQ       +++ + + V SK+ CPY  A +K L          
Sbjct: 22  TRRLFSKATTAKKMVSQQTITRVKDLIAKNKIFVASKTYCPYCQATLKTLFDDLNVPKSK 81

Query: 134 YLVVELDRHDHGKELQDYIGKVTNRATVPNVVIHGVSRGGYDDFKALLDKGKLLESLQD 192
            LV++L+  D G E+Q+ + ++  + +VPN+ I G   GG  D + L + GKL E L++
Sbjct: 82  SLVLQLNTMDDGAEIQEALFEINGQKSVPNIYIDGKHIGGNSDLQELKNAGKLDEVLKE 140

>NCAS0A00360 Chr1 complement(54875..55291) [417 bp, 138 aa] {ON}
           Anc_1.38 YCL035C
          Length = 138

 Score = 52.0 bits (123), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 51/94 (54%), Gaps = 1/94 (1%)

Query: 98  QQILSNSPMIVFSKSMCPYSAKMKELLKQEYEF-TPDYLVVELDRHDHGKELQDYIGKVT 156
           Q+++  + +IVF+KS CPYS   +  L  + +      LV+ELD    G+E+Q  +  + 
Sbjct: 40  QKLIKENKIIVFAKSYCPYSIATRRTLFNDCKVPQSKALVLELDLMQDGQEIQQALLAIN 99

Query: 157 NRATVPNVVIHGVSRGGYDDFKALLDKGKLLESL 190
            + TVP+V I G   GG  + + +   G+L + L
Sbjct: 100 GQKTVPHVYIAGEFIGGNHELQQIFQSGELQKKL 133

>SAKL0C01320g Chr3 complement(118401..118898) [498 bp, 165 aa] {ON}
           similar to uniprot|P25373 Saccharomyces cerevisiae
           YCL035C GRX1 Hydroperoxide and superoxide-radical
           responsive heat-stable glutathione-dependent disulfide
           oxidoreductase with active site cysteine pair protects
           cells from oxidative damage and similar to
           uniprot|P17695 Saccharomyces cerevisiae YDR513w
           cytoplasmic glutaredoxin, thioltransferase,
           glutathione-dependent disulfide oxidoreductase
          Length = 165

 Score = 51.2 bits (121), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 49/90 (54%), Gaps = 1/90 (1%)

Query: 98  QQILSNSPMIVFSKSMCPYSAKMKELLKQEYEFTPDYL-VVELDRHDHGKELQDYIGKVT 156
           Q ++  S + V SK+ CPY       L  + +   D + V++L++ D G E+QD + +++
Sbjct: 67  QTLIKQSKIFVASKTYCPYCQATLRTLFDDKKVPNDKIKVLQLNQLDDGAEIQDALQEIS 126

Query: 157 NRATVPNVVIHGVSRGGYDDFKALLDKGKL 186
            + TVPN+ I G   GG  D + L   G+L
Sbjct: 127 GQRTVPNIYILGKHIGGNSDLQELAAAGEL 156

>ZYRO0F17732g Chr6 (1469710..1470129) [420 bp, 139 aa] {ON} similar
           to uniprot|P17695 Saccharomyces cerevisiae YDR513W TTR1
           Glutaredoxin (thioltransferase) (glutathione
           reductase)and similar to uniprot|P25373 Saccharomyces
           cerevisiae YCL035c
          Length = 139

 Score = 50.4 bits (119), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 52/104 (50%), Gaps = 1/104 (0%)

Query: 84  SEPTRKAFDPAMEYQQILSNSPMIVFSKSMCPYSAKMKELLKQEYEF-TPDYLVVELDRH 142
           + P   + D     + ++    + V SK+ CPY     + L  + +F     +V++L+  
Sbjct: 31  ATPRMVSQDTIQRVKGLIGQKKLFVASKTYCPYCQATLKTLFTDLQFPEAQAIVLQLNTI 90

Query: 143 DHGKELQDYIGKVTNRATVPNVVIHGVSRGGYDDFKALLDKGKL 186
           D G+++QD + ++  + TVPN+ I G   GG  D + L   GKL
Sbjct: 91  DDGQDIQDALYEINGQRTVPNIYIDGKHIGGNSDLQELNASGKL 134

>Ecym_1044 Chr1 complement(84062..84538) [477 bp, 158 aa] {ON}
           similar to Ashbya gossypii AFR710W
          Length = 158

 Score = 49.7 bits (117), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 56/103 (54%), Gaps = 4/103 (3%)

Query: 88  RKAFDPA--MEYQQILSNSPMIVFSKSMCPYSAKMKELLKQEYEF-TPDYLVVELD-RHD 143
           +K   PA   + Q ++  S + V SK+ CPY  + K+ L ++ +   P+  V+ELD    
Sbjct: 47  KKMVSPATVQQVQSLIKQSKIFVASKTYCPYCRRAKKTLFEDKKIPLPEAKVLELDIMGQ 106

Query: 144 HGKELQDYIGKVTNRATVPNVVIHGVSRGGYDDFKALLDKGKL 186
            G ++Q  + +++ + TVPN+ I G   GG  + +AL   G+L
Sbjct: 107 EGVDIQAALLELSGQRTVPNIYIGGKHIGGNSELQALESSGEL 149

>AFR710W Chr6 (1744868..1745203) [336 bp, 111 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCL035C (GRX1) and
           YDR513W (TTR1)
          Length = 111

 Score = 47.0 bits (110), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 53/99 (53%), Gaps = 2/99 (2%)

Query: 96  EYQQILSNSPMIVFSKSMCPYSAKMKELLKQEYEFTPDYL-VVELDRH-DHGKELQDYIG 153
           + Q ++  + + + SK+ CPY    K  L +E       + ++ELD   + G  +Q  + 
Sbjct: 9   QVQALIQQNRVFIASKTYCPYCQAAKRTLLEEKRVPASAVKLLELDTMGEEGAVIQAALQ 68

Query: 154 KVTNRATVPNVVIHGVSRGGYDDFKALLDKGKLLESLQD 192
           +++ + TVPN+ I+G   GG  D +AL   G+L + L++
Sbjct: 69  ELSGQRTVPNIYINGRHVGGNSDLEALKASGELDQLLEE 107

>Smik_3.42 Chr3 complement(62546..62878) [333 bp, 110 aa] {ON}
           YCL035C (REAL)
          Length = 110

 Score = 46.6 bits (109), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 47/82 (57%), Gaps = 1/82 (1%)

Query: 98  QQILSNSPMIVFSKSMCPYS-AKMKELLKQEYEFTPDYLVVELDRHDHGKELQDYIGKVT 156
           +++++++ + V SK+ CPY  A +  L ++        LV++L+    G E+Q  + ++ 
Sbjct: 11  KELIADNEIFVASKTYCPYCHAALNTLFEKLKVPRSKVLVLQLNEMKDGAEIQAALCEIN 70

Query: 157 NRATVPNVVIHGVSRGGYDDFK 178
            + TVPN+ I+G   GG DD +
Sbjct: 71  GQRTVPNIYINGKHIGGNDDLQ 92

>Skud_3.27 Chr3 complement(48731..49063) [333 bp, 110 aa] {ON}
           YCL035C (REAL)
          Length = 110

 Score = 46.6 bits (109), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 46/82 (56%), Gaps = 1/82 (1%)

Query: 98  QQILSNSPMIVFSKSMCPYS-AKMKELLKQEYEFTPDYLVVELDRHDHGKELQDYIGKVT 156
           +++++   + V SK+ CPY  A +  L +Q        LV++L+  + G ++Q  + ++ 
Sbjct: 11  KELIAEKEIFVASKTYCPYCHAALNTLFQQLKVPKSKVLVLQLNEMEDGADIQAALYEIN 70

Query: 157 NRATVPNVVIHGVSRGGYDDFK 178
            + TVPNV I+G   GG DD +
Sbjct: 71  GQRTVPNVYINGKHIGGNDDLQ 92

>NDAI0A00380 Chr1 complement(64438..64767) [330 bp, 109 aa] {ON}
           Anc_1.38 YCL035C
          Length = 109

 Score = 46.6 bits (109), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 51/90 (56%), Gaps = 1/90 (1%)

Query: 98  QQILSNSPMIVFSKSMCPYS-AKMKELLKQEYEFTPDYLVVELDRHDHGKELQDYIGKVT 156
           +++++   + + SK+ CPY  + +K L ++        LV++L+  D G ++Q+ + ++ 
Sbjct: 11  KEMINEKEIFIASKTYCPYCFSTIKTLFEELKVPKSKALVLQLNEMDDGADIQEALFEIN 70

Query: 157 NRATVPNVVIHGVSRGGYDDFKALLDKGKL 186
            + TVPN+ I+G   GG    + L + G+L
Sbjct: 71  GQKTVPNIYINGKHIGGNSQLQDLKESGEL 100

>Suva_3.178 Chr3 complement(270878..271828) [951 bp, 316 aa] {ON}
           YCL035C (REAL)
          Length = 316

 Score = 47.8 bits (112), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 53/95 (55%), Gaps = 1/95 (1%)

Query: 98  QQILSNSPMIVFSKSMCPYS-AKMKELLKQEYEFTPDYLVVELDRHDHGKELQDYIGKVT 156
           +++++   + V SK+ CPY  A +  L ++        LV++L+    G ++Q  + ++ 
Sbjct: 217 KELIAEKEIFVASKTYCPYCHAALNTLFQKMNVPKSKVLVLQLNEMKDGVDIQAALYQLN 276

Query: 157 NRATVPNVVIHGVSRGGYDDFKALLDKGKLLESLQ 191
            + TVPN+ I+G   GG DD + L + G+L + L+
Sbjct: 277 GQRTVPNIYINGKHIGGNDDLQELRETGELEDLLE 311

>TDEL0E05740 Chr5 complement(1072231..1072557) [327 bp, 108 aa] {ON}
           Anc_1.38 YCL035C
          Length = 108

 Score = 44.3 bits (103), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 48/89 (53%)

Query: 98  QQILSNSPMIVFSKSMCPYSAKMKELLKQEYEFTPDYLVVELDRHDHGKELQDYIGKVTN 157
           ++++ ++ +++FSK+ CPY     +   +         V++LD+ D G E+QD + ++  
Sbjct: 11  KELVEDNKVVIFSKTFCPYCKATLKTFDEARLPVGLVRVLQLDKLDDGSEIQDALYELNG 70

Query: 158 RATVPNVVIHGVSRGGYDDFKALLDKGKL 186
           + TVP++ I     GG  + + L  +G L
Sbjct: 71  QKTVPSIYILKRHIGGNSELQKLKHEGVL 99

>KNAG0F00250 Chr6 complement(26606..27034) [429 bp, 142 aa] {ON}
           Anc_1.38 YCL035C
          Length = 142

 Score = 44.7 bits (104), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 53/105 (50%), Gaps = 1/105 (0%)

Query: 83  KSEPTRKAFDPAMEYQQILSNSPMIVFSKSMCPYS-AKMKELLKQEYEFTPDYLVVELDR 141
           K EP     +     ++ + ++ + V  K+ CPY  A +  LL Q         V++L+ 
Sbjct: 25  KEEPVVVTEETLRYVKKQIDDNAVFVAVKTWCPYCKATIVTLLDQMKVPASKIKVLKLNE 84

Query: 142 HDHGKELQDYIGKVTNRATVPNVVIHGVSRGGYDDFKALLDKGKL 186
             HG+E+Q+ + ++  + TVP++ I+ +  GG  D + L   GKL
Sbjct: 85  LKHGREIQEALFQMNGQKTVPHIYINQIFIGGNSDLEELRVSGKL 129

>YCL035C Chr3 complement(60841..61173) [333 bp, 110 aa] {ON}
           GRX1Hydroperoxide and superoxide-radical responsive
           heat-stable glutathione-dependent disulfide
           oxidoreductase with active site cysteine pair; protects
           cells from oxidative damage
          Length = 110

 Score = 42.7 bits (99), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 44/80 (55%), Gaps = 1/80 (1%)

Query: 100 ILSNSPMIVFSKSMCPYS-AKMKELLKQEYEFTPDYLVVELDRHDHGKELQDYIGKVTNR 158
           +++ + + V SK+ CPY  A +  L ++        LV++L+    G ++Q  + ++  +
Sbjct: 13  LIAENEIFVASKTYCPYCHAALNTLFEKLKVPRSKVLVLQLNDMKEGADIQAALYEINGQ 72

Query: 159 ATVPNVVIHGVSRGGYDDFK 178
            TVPN+ I+G   GG DD +
Sbjct: 73  RTVPNIYINGKHIGGNDDLQ 92

>TPHA0B04820 Chr2 (1130278..1130694) [417 bp, 138 aa] {ON} Anc_1.38
           YCL035C
          Length = 138

 Score = 42.4 bits (98), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 42/87 (48%), Gaps = 1/87 (1%)

Query: 100 ILSNSPMIVFSKSMCPYSAKMKELLKQEYEFTPD-YLVVELDRHDHGKELQDYIGKVTNR 158
           ++    + V +KS CPY       L  E +   +  LV++LD    G ELQD + ++  +
Sbjct: 42  LIKQKSVFVAAKSYCPYCKNTLITLFDELKVPKEKALVLQLDGMSDGLELQDTLQQINGQ 101

Query: 159 ATVPNVVIHGVSRGGYDDFKALLDKGK 185
            TVP + I G   GG  + + L   G+
Sbjct: 102 RTVPQIYIDGKHVGGNSELQKLKKSGE 128

>KNAG0J01730 Chr10 (316411..317001) [591 bp, 196 aa] {ON} Anc_8.679
           YPL156C
          Length = 196

 Score = 33.5 bits (75), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 28/125 (22%), Positives = 59/125 (47%), Gaps = 8/125 (6%)

Query: 92  DPAMEYQQILSNSPMIVFSKSMCPYSAKMKELLKQEYEFTPDYLVVELDRHDHGKE---- 147
           D    +  + + +P+++   S  P +  +++   QEYE +P   VV L+ +   +E    
Sbjct: 72  DGMFPFLDLFAVTPIVLLVDSTDPRAVDLEKTFMQEYEVSPPLTVVNLNSYPESRELRLF 131

Query: 148 LQDYIGKVTNRATVPNVVIHGVSRGGYDDFKALLDKG---KLLESLQDWSDGKTLSVSKK 204
           LQ Y  +     ++  + I+     G+  F++ L      KL ++   +S+G+ + ++K 
Sbjct: 132 LQLYYTQDIMDRSLAYLFINNHPSVGFVMFESYLSLAQFRKLRKAKGVYSEGRVV-INKI 190

Query: 205 EKPSN 209
             PSN
Sbjct: 191 ALPSN 195

>NDAI0E02890 Chr5 (610133..610600) [468 bp, 155 aa] {ON} Anc_8.519
          Length = 155

 Score = 30.8 bits (68), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 49/104 (47%), Gaps = 16/104 (15%)

Query: 98  QQILSNSPMIVFSKSM-----CPYSAKMKELLKQE----YEFTPDYLVVELDRHDHGKEL 148
           Q  + ++P+++F K       C +S    +LL Q+     +F   Y V+E        EL
Sbjct: 37  QDAIGSAPVVLFMKGTPEFPKCGFSKATIQLLGQQGVDPAKFA-AYNVLE------DPEL 89

Query: 149 QDYIGKVTNRATVPNVVIHGVSRGGYDDFKALLDKGKLLESLQD 192
           +D I + T   T+P + ++    GG D   ++   G+L E L++
Sbjct: 90  RDAIKEFTEWPTIPQLFVNKEFVGGCDVITSMSRSGELAEVLEE 133

>ZYRO0C15884g Chr3 (1241605..1245873) [4269 bp, 1422 aa] {ON} similar
            to uniprot|P22219 Saccharomyces cerevisiae YBR097W VPS15
            Myristoylated Serine/threonine protein kinase involved in
            vacuolar protein sorting
          Length = 1422

 Score = 31.6 bits (70), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 31/61 (50%), Gaps = 2/61 (3%)

Query: 135  LVVELDRHDHGKELQDYIGKVTNRATVPNVVIHGVSRGGYDDFKALLDKGKLLESLQDWS 194
            + V+L+   H KE+ D++ + TN  T P  +IH    G     K  L    +L SL+D+ 
Sbjct: 961  IYVQLEPTAHHKEVPDHVLERTN--TEPRFIIHDSYEGDSSTIKKFLSNITVLPSLKDYE 1018

Query: 195  D 195
            +
Sbjct: 1019 E 1019

>Ecym_2822 Chr2 (1596949..1598049) [1101 bp, 366 aa] {ON} similar to
           Ashbya gossypii ACL199C
          Length = 366

 Score = 30.4 bits (67), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 42/91 (46%), Gaps = 8/91 (8%)

Query: 107 IVFSKSMCPYSAKMKELLKQEYEFTPDYLVVELDRHDHGKELQDYIGKVTNRATVPNVVI 166
           +++  S  PY      L   E+    D LV E D     +EL   +  VT R  + N V+
Sbjct: 107 VLYKTSFRPYELPESVLPAAEH----DLLVAEADAITKAEEL---LYSVTFRKDLGNPVL 159

Query: 167 H-GVSRGGYDDFKALLDKGKLLESLQDWSDG 196
           + GV++ G DD KA  DK    E++Q    G
Sbjct: 160 YDGVAKIGLDDIKAYADKVYTKENVQVIGQG 190

>Kpol_1050.61 s1050 complement(135758..136690) [933 bp, 310 aa] {ON}
           complement(135758..136690) [933 nt, 311 aa]
          Length = 310

 Score = 30.0 bits (66), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 25/46 (54%), Gaps = 2/46 (4%)

Query: 118 AKMKELLKQEYEFTPDYLVVELDRHDHGKELQDYIGKVTNRATVPN 163
           AK  EL+ +  + + DY  VEL R D  +E+ D + K  NR  + N
Sbjct: 252 AKSAELIGEAIKKSKDY--VELKRLDTAREIADILAKSPNRVVLDN 295

>KNAG0F03300 Chr6 complement(624228..624851) [624 bp, 207 aa] {ON}
           Anc_5.281 YKL159C
          Length = 207

 Score = 29.6 bits (65), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 22/90 (24%), Positives = 39/90 (43%), Gaps = 2/90 (2%)

Query: 42  ETLIGDGVVAKAKETTKIDEDVDQAIRNIQEEVGIKEGSSGKSEPTRKAFDPAMEYQQIL 101
           E L  D +V   ++   ID D    I+N   +  +   +  +  P +       ++Q+IL
Sbjct: 3   EVLATDTIVITGRKGVLIDNDAVSLIQNWLSDTVLLSHTVLRDNPLQLIV--LRKFQKIL 60

Query: 102 SNSPMIVFSKSMCPYSAKMKELLKQEYEFT 131
             SP    S+S+   +    ELL   ++FT
Sbjct: 61  LISPATDLSRSIMHVAENDDELLSSNFQFT 90

>Kpol_312.8 s312 complement(17724..19016) [1293 bp, 430 aa] {ON}
          complement(17724..19016) [1293 nt, 431 aa]
          Length = 430

 Score = 30.0 bits (66), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 10/27 (37%), Positives = 22/27 (81%)

Query: 33 VGKAINRKPETLIGDGVVAKAKETTKI 59
          + + I+ KPET++G+G++++ K T++I
Sbjct: 67 LNELISEKPETMLGNGIISQYKSTSEI 93

>TPHA0A05090 Chr1 complement(1146837..1147769) [933 bp, 310 aa] {ON}
           Anc_5.98 YGR231C
          Length = 310

 Score = 29.6 bits (65), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 25/46 (54%), Gaps = 2/46 (4%)

Query: 118 AKMKELLKQEYEFTPDYLVVELDRHDHGKELQDYIGKVTNRATVPN 163
           AK  EL+ +  + + DY  VEL R D  K++ D + K  NR  + N
Sbjct: 250 AKSAELIGEAIKKSKDY--VELKRLDTAKDIADILAKSPNRVVLDN 293

>KLTH0A05104g Chr1 (426808..428127) [1320 bp, 439 aa] {ON} weakly
           similar to uniprot|P28272 Saccharomyces cerevisiae
           YKL216W URA1 The enzyme catalyzes the conversion of
           dihydroorotic acid to orotic acid
          Length = 439

 Score = 29.3 bits (64), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 32/61 (52%)

Query: 135 LVVELDRHDHGKELQDYIGKVTNRATVPNVVIHGVSRGGYDDFKALLDKGKLLESLQDWS 194
           L + L ++ +G E+QDY+  V    ++ +V++  VS       + L ++ KL + LQ   
Sbjct: 212 LAINLGKNKNGDEVQDYLKGVETFQSLADVLVINVSSPNTPGLRDLQNESKLADLLQKVV 271

Query: 195 D 195
           D
Sbjct: 272 D 272

>TPHA0G02200 Chr7 (450927..454025) [3099 bp, 1032 aa] {ON} Anc_2.402
           YLR039C
          Length = 1032

 Score = 29.3 bits (64), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 39/177 (22%), Positives = 74/177 (41%), Gaps = 22/177 (12%)

Query: 41  PETLIGDGVVAKAKETTKIDEDVDQAIRNIQEEVGIKEGSSGKSEPTRKAFDPAME--YQ 98
           PET   D  +   +  TK+ E+  Q  + I  ++ +    +  S   +  F    E  + 
Sbjct: 130 PETFFNDYALPVIQNDTKLVEEESQYDQVIDNDILVVFEKNKHSRVIQNGFGTRREIGFL 189

Query: 99  QILSNSPMIVFSKSMCPYSAKMKELLKQEYEFTPDYLVVELDRHDHGKELQDYIGKVTNR 158
           Q L++SP +++   +     ++K +LK +Y+         LD         D +G + N 
Sbjct: 190 QYLTSSPEMLYEMPVRRVELRLKVILKFDYKI--------LDFMGFKSHKMDNVGILENG 241

Query: 159 ATVPNVVIHGVSRGGYDDFK------ALLDKGKLLESLQDWSDGKTLSVSKKEKPSN 209
             +  +  HG+      DFK        +D G  LE+ +D    K L +S+K + ++
Sbjct: 242 LFL--LFPHGLQVLNLKDFKLSDYELLSIDDGIKLETFKD----KLLIISQKSETND 292

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.132    0.367 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 22,174,438
Number of extensions: 932407
Number of successful extensions: 2656
Number of sequences better than 10.0: 104
Number of HSP's gapped: 2604
Number of HSP's successfully gapped: 105
Length of query: 210
Length of database: 53,481,399
Length adjustment: 105
Effective length of query: 105
Effective length of database: 41,441,469
Effective search space: 4351354245
Effective search space used: 4351354245
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 63 (28.9 bits)