Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_56.231123.190ON1351357281e-100
KLTH0G16082g3.190ON1351356466e-88
SAKL0C10516g3.190ON1441364628e-60
TDEL0H033703.190ON1531544124e-52
ZYRO0A04906g3.190ON1601604082e-51
TBLA0A002603.190ON1841454076e-51
AER016C3.190ON1471463873e-48
Kpol_1045.683.190ON1761313867e-48
Suva_4.2393.190ON1651653841e-47
Ecym_53123.190ON1481473794e-47
YDL008W (APC11)3.190ON1651223762e-46
Skud_4.2433.190ON1651653762e-46
Smik_4.2243.190ON1651653736e-46
NDAI0A065203.190ON2061413681e-44
KAFR0A012403.190ON1731443545e-43
CAGL0I04576g3.190ON1491163403e-41
KNAG0J012503.190ON2021573289e-39
TPHA0H006403.190ON1801533233e-38
KLLA0E17711g3.190ON1621583199e-38
NCAS0I019203.190ON1281222907e-34
NCAS0C044803.28ON109991332e-10
Kpol_1014.163.28ON107991305e-10
Kwal_55.220543.28ON111991297e-10
YOL133W (HRT1)3.28ON121991299e-10
NDAI0G038603.28ON123991291e-09
Smik_15.203.28ON121991291e-09
KLLA0E07151g3.28ON110981281e-09
CAGL0E01567g3.28ON102991271e-09
TDEL0A004703.28ON118991281e-09
Skud_15.203.28ON121991281e-09
ZYRO0C03058g3.28ON116991271e-09
Suva_15.263.28ON122991282e-09
KLTH0F19228g3.28ON110991236e-09
KNAG0A012803.28ON114991237e-09
TBLA0B087103.28ON122991237e-09
KAFR0C017803.28ON118901183e-08
Ecym_20293.28ON114991166e-08
ADL181W3.28ON108991131e-07
SAKL0C13178g3.28ON138901124e-07
TPHA0P014703.28ON111901104e-07
KLLA0F18458g3.279ON140841002e-05
TBLA0I019603.279ON18483994e-05
NCAS0A082803.279ON11880966e-05
ZYRO0E06996g3.279ON17273987e-05
TPHA0I005908.799ON159162971e-04
Kwal_55.21206singletonON275125962e-04
KLLA0C14344g8.799ON151847962e-04
Ecym_26583.279ON15968933e-04
CAGL0H10274g3.279ON17562933e-04
TBLA0D006508.799ON156847935e-04
SAKL0B06226g8.799ON155747936e-04
KLTH0F18502gsingletonON26794917e-04
TDEL0C027707.416ON20876917e-04
NDAI0K007108.799ON159147927e-04
Kpol_480.258.799ON157147927e-04
Kwal_27.105463.279ON10482878e-04
Kpol_1023.322.411ON117860910.001
Ecym_72442.542ON53247900.001
ZYRO0F12760g8.799ON155547910.001
TBLA0F032803.405ON55547900.001
KLTH0E13992g8.799ON155047900.001
Kwal_27.123278.799ON157447890.002
CAGL0K02563g2.542ON58655890.002
AGL217W8.808ON41479880.002
Skud_2.1863.279ON17865870.002
AGR034W3.279ON15972860.002
Ecym_74188.799ON154760880.002
TBLA0G023102.542ON67465880.002
TDEL0B009808.799ON155947880.003
AGL079C2.542ON50647870.003
KNAG0J008503.279ON16255850.003
NCAS0A04680singletonON27463860.003
NDAI0A074503.279ON17361850.004
Suva_13.4328.799ON155947870.004
YMR247C (RKR1)8.799ON156247870.004
Skud_13.4198.799ON156447870.004
KAFR0A019902.542ON56055860.004
KNAG0A074303.405ON10232820.004
Smik_13.4608.799ON156647860.004
KNAG0J005408.799ON156147860.004
NCAS0A041202.411ON113776860.004
NCAS0C006808.799ON156447860.005
TDEL0A031802.542ON56761850.005
KLLA0C15697g3.405ON30465850.006
Kpol_1052.193.279ON10352810.006
NCAS0B069902.157ON521105850.006
KAFR0C004603.279ON15776820.007
KLLA0C05874g6.45ON55362840.008
ABL058C8.799ON154647830.010
KAFR0F007402.157ON51077830.011
ZYRO0B02244g2.542ON56347830.012
KAFR0B036208.799ON156047830.012
TPHA0A039903.279ON17552800.015
TBLA0H002303.22ON133342820.016
KNAG0A070902.545ON76236810.017
Kwal_55.203188.761ON89967810.018
ABR104W3.405ON32878810.019
Suva_16.4203.405ON29085800.022
YBR062C3.279ON18065790.023
Suva_11.1892.545ON75836800.024
TBLA0H003202.411ON130162800.025
SAKL0E01958g6.45ON52445800.025
KAFR0B014602.545ON76136800.027
KAFR0I020901.389ON146644800.028
Kpol_505.182.157ON58564800.028
Suva_8.422.542ON58548800.029
TBLA0I014902.545ON75031800.029
Kpol_1002.72.545ON75432800.030
YHL010C (ETP1)2.542ON58548790.031
CAGL0A03432g2.411ON115192800.031
Smik_8.322.542ON58548790.033
Skud_8.352.542ON58548790.034
Ecym_54453.405ON32145790.034
TBLA0B005606.45ON49227790.036
Smik_11.2132.545ON75936790.036
SAKL0A09746g2.542ON54856790.037
TPHA0F018402.157ON52176790.038
YKL034W (TUL1)2.545ON75836790.039
NDAI0G052001.389ON158657790.039
YOL138C (RTC1)3.22ON134155790.040
Suva_4.3023.279ON15072770.042
KNAG0H035102.157ON55165780.044
CAGL0H02651g8.799ON154447780.045
Smik_2.1963.279ON18559770.047
ZYRO0B16258g2.157ON57959770.059
YMR231W (PEP5)8.761ON102949770.059
CAGL0L01947g2.545ON75736770.064
ZYRO0G13376g8.808ON44535770.065
NDAI0B018202.542ON62547770.065
SAKL0E04488g2.411ON112748770.069
NDAI0K018102.545ON76234770.071
TPHA0C042502.542ON55665760.075
KLTH0D07216g2.545ON74736770.076
YLR032W (RAD5)2.411ON116976770.079
Kwal_26.80992.545ON75031760.080
NCAS0G025202.157ON51838760.080
TBLA0B012602.157ON88548760.080
Ecym_26848.808ON38665760.081
Skud_15.163.22ON133255760.083
NCAS0A113503.405ON42852760.085
Suva_15.223.22ON133655760.087
TPHA0C042602.545ON75736760.089
TDEL0G042506.45ON51727760.089
KLLA0F25740g2.542ON51746760.090
TDEL0B061701.389ON1470101760.097
KLTH0C05258g3.279ON15277740.098
Skud_8.1762.157ON41338750.100
KLTH0D07150g2.542ON54065750.10
Skud_11.1922.545ON75836760.10
Smik_15.163.22ON132655760.10
KLTH0G18150g1.389ON155448760.10
SAKL0D02354g8.808ON33137750.10
NDAI0F027702.157ON55464750.11
KNAG0C056602.542ON50754750.11
KLLA0F25674g2.545ON75731750.12
SAKL0D03058g3.279ON15562730.12
TDEL0D034603.279ON14441730.13
YDR143C (SAN1)8.317ON61075750.14
CAGL0L03960g2.157ON60381750.14
Kwal_47.179042.157ON47038740.14
Kpol_1035.506.45ON60127740.15
Kpol_1002.82.542ON55847740.15
Suva_13.4158.761ON102849740.15
KAFR0A052406.45ON55327740.17
ADL186C3.22ON136142740.18
TDEL0B063402.545ON76227740.19
KAFR0A065304.129ON123338740.19
TPHA0F024806.45ON60573730.19
KLTH0F11044g3.405ON29196730.20
Smik_8.1932.157ON41632730.21
Kwal_55.220763.22ON128664730.21
ZYRO0E05632g2.545ON76536730.21
NCAS0D020106.45ON51027730.22
SAKL0B05104g8.761ON103882730.22
CAGL0E02299g6.45ON54527730.23
SAKL0A09812g2.545ON75131730.23
Skud_4.4028.317ON61245730.23
Suva_5.671.448ON26794720.23
Skud_15.1486.45ON54827730.24
YOL013C (HRD1)6.45ON55127730.24
ZYRO0C07194g6.45ON55827730.24
Kpol_1048.731.389ON154935730.25
Smik_15.1576.45ON55027720.25
TDEL0B052002.157ON52432720.26
YHR115C (DMA1)2.157ON41638720.26
Suva_15.1596.45ON55027720.26
SAKL0D10890g1.448ON265100720.28
KNAG0E027406.45ON55627720.29
Ecym_72412.545ON75831720.29
KLTH0C04664g8.808ON30666710.32
NCAS0A047602.545ON76136720.33
Kwal_26.80902.542ON52068710.34
NDAI0C027706.45ON63035710.35
Smik_4.3878.317ON63475710.35
TDEL0A004103.22ON126242710.37
Kpol_1072.552.157ON42033710.41
Kwal_56.225226.45ON51381710.43
TBLA0D040208.288ON117841700.52
KAFR0B034208.761ON103648700.58
Suva_2.3048.317ON62440700.62
Smik_15.1138.808ON40679690.62
Kwal_27.104198.808ON30032690.63
SAKL0E10824g2.157ON47532690.68
Kpol_538.53.405ON33541690.69
KLLA0F23892g2.157ON51832690.72
KLTH0C10604g6.45ON51539690.74
Kwal_14.12871.389ON151848690.77
KLTH0E09834g2.157ON47950690.79
NCAS0B009908.808ON39236690.80
SAKL0H15686g8.317ON59937690.82
NDAI0E018402.411ON115054690.83
YOL054W (PSH1)8.808ON40632680.83
NCAS0A125502.542ON57247680.85
Suva_15.3112.157ON26934680.85
KLLA0F12166g1.389ON152834680.92
ZYRO0C03190g3.22ON127362680.96
Kpol_478.85.190ON202234681.0
YEL019C (MMS21)1.448ON26794671.0
Ecym_54282.157ON47432681.0
Suva_10.1122.411ON116745681.0
Skud_15.1028.808ON40628681.1
ACR267C2.157ON46732671.2
Suva_14.2232.157ON58038671.2
YBR114W (RAD16)3.368ON79076671.2
TPHA0A033403.405ON38446671.2
ZYRO0A08932g2.411ON118832681.2
Smik_13.4398.761ON103051671.2
ZYRO0C17424g3.405ON27348671.3
Suva_1.694.129ON127139671.3
Skud_12.992.411ON117149671.3
Skud_14.2162.157ON53038671.3
TDEL0F02870na 1ON26059661.4
KAFR0B055808.288ON112056671.4
TBLA0B033708.761ON106472671.4
YNL116W (DMA2)2.157ON52238671.4
Skud_16.3793.405ON28831661.5
Smik_14.2122.157ON52938671.5
TBLA0C013301.389ON145230671.5
ACL019C6.45ON57583661.7
Kwal_47.177712.411ON97248661.7
SAKL0D08272g1.389ON149135661.8
YPR093C (ASR1)3.405ON28827661.8
CAGL0B05049g1.389ON147048661.8
TPHA0O008201.448ON294141661.8
KNAG0I013801.389ON149345661.9
Kwal_56.239008.317ON58964661.9
TDEL0C054203.405ON9327631.9
TDEL0B008908.808ON54032662.0
Smik_12.942.411ON117859662.0
NCAS0C044303.22ON131142662.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_56.23112
         (135 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_56.23112 s56 complement(406291..406698) [408 bp, 135 aa] {O...   285   e-100
KLTH0G16082g Chr7 (1407117..1407524) [408 bp, 135 aa] {ON} some ...   253   6e-88
SAKL0C10516g Chr3 (956666..957100) [435 bp, 144 aa] {ON} similar...   182   8e-60
TDEL0H03370 Chr8 complement(560397..560858) [462 bp, 153 aa] {ON...   163   4e-52
ZYRO0A04906g Chr1 complement(395608..396090) [483 bp, 160 aa] {O...   161   2e-51
TBLA0A00260 Chr1 complement(38358..38912) [555 bp, 184 aa] {ON} ...   161   6e-51
AER016C Chr5 complement(659572..660015) [444 bp, 147 aa] {ON} Sy...   153   3e-48
Kpol_1045.68 s1045 complement(160584..161114) [531 bp, 176 aa] {...   153   7e-48
Suva_4.239 Chr4 (426773..427270) [498 bp, 165 aa] {ON} YDL008W (...   152   1e-47
Ecym_5312 Chr5 complement(632833..633279) [447 bp, 148 aa] {ON} ...   150   4e-47
YDL008W Chr4 (433497..433994) [498 bp, 165 aa] {ON}  APC11Cataly...   149   2e-46
Skud_4.243 Chr4 (428190..428687) [498 bp, 165 aa] {ON} YDL008W (...   149   2e-46
Smik_4.224 Chr4 (415442..415939) [498 bp, 165 aa] {ON} YDL008W (...   148   6e-46
NDAI0A06520 Chr1 (1482275..1482895) [621 bp, 206 aa] {ON} Anc_3....   146   1e-44
KAFR0A01240 Chr1 (241805..242326) [522 bp, 173 aa] {ON} Anc_3.19...   140   5e-43
CAGL0I04576g Chr9 (408872..409321) [450 bp, 149 aa] {ON} similar...   135   3e-41
KNAG0J01250 Chr10 complement(225063..225671) [609 bp, 202 aa] {O...   130   9e-39
TPHA0H00640 Chr8 (126792..127334) [543 bp, 180 aa] {ON} Anc_3.19...   129   3e-38
KLLA0E17711g Chr5 complement(1571018..1571506) [489 bp, 162 aa] ...   127   9e-38
NCAS0I01920 Chr9 (352307..352693) [387 bp, 128 aa] {ON} Anc_3.19...   116   7e-34
NCAS0C04480 Chr3 (919123..919452) [330 bp, 109 aa] {ON} Anc_3.28       56   2e-10
Kpol_1014.16 s1014 complement(29615..29938) [324 bp, 107 aa] {ON...    55   5e-10
Kwal_55.22054 s55 complement(1091138..1091473) [336 bp, 111 aa] ...    54   7e-10
YOL133W Chr15 (70325..70690) [366 bp, 121 aa] {ON}  HRT1RING fin...    54   9e-10
NDAI0G03860 Chr7 (925672..926043) [372 bp, 123 aa] {ON} Anc_3.28...    54   1e-09
Smik_15.20 Chr15 (38383..38748) [366 bp, 121 aa] {ON} YOL133W (R...    54   1e-09
KLLA0E07151g Chr5 (651474..651806) [333 bp, 110 aa] {ON} similar...    54   1e-09
CAGL0E01567g Chr5 (148425..148733) [309 bp, 102 aa] {ON} similar...    54   1e-09
TDEL0A00470 Chr1 (82852..83208) [357 bp, 118 aa] {ON} Anc_3.28 Y...    54   1e-09
Skud_15.20 Chr15 (35550..35915) [366 bp, 121 aa] {ON} YOL133W (R...    54   1e-09
ZYRO0C03058g Chr3 complement(236925..237275) [351 bp, 116 aa] {O...    54   1e-09
Suva_15.26 Chr15 (48168..48536) [369 bp, 122 aa] {ON} YOL133W (R...    54   2e-09
KLTH0F19228g Chr6 complement(1556655..1556987) [333 bp, 110 aa] ...    52   6e-09
KNAG0A01280 Chr1 (27372..27716) [345 bp, 114 aa] {ON} Anc_3.28 Y...    52   7e-09
TBLA0B08710 Chr2 complement(2075746..2076114) [369 bp, 122 aa] {...    52   7e-09
KAFR0C01780 Chr3 complement(363161..363517) [357 bp, 118 aa] {ON...    50   3e-08
Ecym_2029 Chr2 (47083..47427) [345 bp, 114 aa] {ON} similar to A...    49   6e-08
ADL181W Chr4 (379682..380008) [327 bp, 108 aa] {ON} Syntenic hom...    48   1e-07
SAKL0C13178g Chr3 complement(1166576..1166992) [417 bp, 138 aa] ...    48   4e-07
TPHA0P01470 Chr16 complement(301305..301640) [336 bp, 111 aa] {O...    47   4e-07
KLLA0F18458g Chr6 complement(1697871..1698293) [423 bp, 140 aa] ...    43   2e-05
TBLA0I01960 Chr9 complement(444753..445291,445364..445379) [555 ...    43   4e-05
NCAS0A08280 Chr1 (1636423..1636779) [357 bp, 118 aa] {ON} Anc_3....    42   6e-05
ZYRO0E06996g Chr5 complement(530578..531080,531138..531153) [519...    42   7e-05
TPHA0I00590 Chr9 (117658..122433) [4776 bp, 1591 aa] {ON} Anc_8....    42   1e-04
Kwal_55.21206 s55 complement(730534..731361) [828 bp, 275 aa] {O...    42   2e-04
KLLA0C14344g Chr3 (1245226..1249782) [4557 bp, 1518 aa] {ON} sim...    42   2e-04
Ecym_2658 Chr2 (1270952..1271431) [480 bp, 159 aa] {ON} similar ...    40   3e-04
CAGL0H10274g Chr8 complement(1003801..1004312,1004468..1004483) ...    40   3e-04
TBLA0D00650 Chr4 (172839..177545) [4707 bp, 1568 aa] {ON} Anc_8....    40   5e-04
SAKL0B06226g Chr2 (524855..529528) [4674 bp, 1557 aa] {ON} simil...    40   6e-04
KLTH0F18502g Chr6 (1496235..1497038) [804 bp, 267 aa] {ON} conse...    40   7e-04
TDEL0C02770 Chr3 complement(486107..486733) [627 bp, 208 aa] {ON...    40   7e-04
NDAI0K00710 Chr11 (155351..160126) [4776 bp, 1591 aa] {ON} Anc_8...    40   7e-04
Kpol_480.25 s480 (57636..62351) [4716 bp, 1571 aa] {ON} (57636.....    40   7e-04
Kwal_27.10546 s27 complement(386744..387058) [315 bp, 104 aa] {O...    38   8e-04
Kpol_1023.32 s1023 complement(68737..72273) [3537 bp, 1178 aa] {...    40   0.001
Ecym_7244 Chr7 complement(512748..514346) [1599 bp, 532 aa] {ON}...    39   0.001
ZYRO0F12760g Chr6 complement(1037460..1042127) [4668 bp, 1555 aa...    40   0.001
TBLA0F03280 Chr6 complement(805882..807549) [1668 bp, 555 aa] {O...    39   0.001
KLTH0E13992g Chr5 (1234550..1239202) [4653 bp, 1550 aa] {ON} sim...    39   0.001
Kwal_27.12327 s27 (1178866..1183590) [4725 bp, 1574 aa] {ON} YMR...    39   0.002
CAGL0K02563g Chr11 complement(231812..233572) [1761 bp, 586 aa] ...    39   0.002
AGL217W Chr7 (290043..291287) [1245 bp, 414 aa] {ON} Syntenic ho...    39   0.002
Skud_2.186 Chr2 complement(334347..334867,334953..334968) [537 b...    38   0.002
AGR034W Chr7 (772766..773245) [480 bp, 159 aa] {ON} Syntenic hom...    38   0.002
Ecym_7418 Chr7 (853469..858112) [4644 bp, 1547 aa] {ON} similar ...    39   0.002
TBLA0G02310 Chr7 (598514..600538) [2025 bp, 674 aa] {ON} Anc_2.5...    39   0.002
TDEL0B00980 Chr2 (181064..185743) [4680 bp, 1559 aa] {ON} Anc_8....    39   0.003
AGL079C Chr7 complement(557422..558942) [1521 bp, 506 aa] {ON} S...    38   0.003
KNAG0J00850 Chr10 complement(146187..146675) [489 bp, 162 aa] {O...    37   0.003
NCAS0A04680 Chr1 complement(932306..933130) [825 bp, 274 aa] {ON}      38   0.003
NDAI0A07450 Chr1 complement(1699546..1700051,1700150..1700165) [...    37   0.004
Suva_13.432 Chr13 complement(744705..749384) [4680 bp, 1559 aa] ...    38   0.004
YMR247C Chr13 complement(763351..768039) [4689 bp, 1562 aa] {ON}...    38   0.004
Skud_13.419 Chr13 complement(738148..742842) [4695 bp, 1564 aa] ...    38   0.004
KAFR0A01990 Chr1 (418279..419961) [1683 bp, 560 aa] {ON} Anc_2.5...    38   0.004
KNAG0A07430 Chr1 complement(1165740..1166048) [309 bp, 102 aa] {...    36   0.004
Smik_13.460 Chr13 complement(747753..752453) [4701 bp, 1566 aa] ...    38   0.004
KNAG0J00540 Chr10 (86360..91045) [4686 bp, 1561 aa] {ON} Anc_8.7...    38   0.004
NCAS0A04120 Chr1 complement(833424..836837) [3414 bp, 1137 aa] {...    38   0.004
NCAS0C00680 Chr3 (109845..114539) [4695 bp, 1564 aa] {ON} Anc_8....    38   0.005
TDEL0A03180 Chr1 (569298..571001) [1704 bp, 567 aa] {ON} Anc_2.5...    37   0.005
KLLA0C15697g Chr3 (1360289..1361203) [915 bp, 304 aa] {ON} simil...    37   0.006
Kpol_1052.19 s1052 (60008..60319) [312 bp, 103 aa] {ON} (60008.....    36   0.006
NCAS0B06990 Chr2 complement(1330221..1331786) [1566 bp, 521 aa] ...    37   0.006
KAFR0C00460 Chr3 complement(94989..95446,95522..95537) [474 bp, ...    36   0.007
KLLA0C05874g Chr3 complement(520079..521740) [1662 bp, 553 aa] {...    37   0.008
ABL058C Chr2 complement(288353..292993) [4641 bp, 1546 aa] {ON} ...    37   0.010
KAFR0F00740 Chr6 (144375..145907) [1533 bp, 510 aa] {ON} Anc_2.1...    37   0.011
ZYRO0B02244g Chr2 (186386..188077) [1692 bp, 563 aa] {ON} simila...    37   0.012
KAFR0B03620 Chr2 complement(752307..756989) [4683 bp, 1560 aa] {...    37   0.012
TPHA0A03990 Chr1 (887214..887741) [528 bp, 175 aa] {ON} Anc_3.27...    35   0.015
TBLA0H00230 Chr8 complement(31016..35017) [4002 bp, 1333 aa] {ON...    36   0.016
KNAG0A07090 Chr1 complement(1110424..1112712) [2289 bp, 762 aa] ...    36   0.017
Kwal_55.20318 s55 complement(347619..350318) [2700 bp, 899 aa] {...    36   0.018
ABR104W Chr2 (574068..575054) [987 bp, 328 aa] {ON} Syntenic hom...    36   0.019
Suva_16.420 Chr16 complement(726959..727831) [873 bp, 290 aa] {O...    35   0.022
YBR062C Chr2 complement(365976..366502,366585..366600) [543 bp, ...    35   0.023
Suva_11.189 Chr11 (354713..356989) [2277 bp, 758 aa] {ON} YKL034...    35   0.024
TBLA0H00320 Chr8 complement(56811..60716) [3906 bp, 1301 aa] {ON...    35   0.025
SAKL0E01958g Chr5 (149087..150661) [1575 bp, 524 aa] {ON} simila...    35   0.025
KAFR0B01460 Chr2 (277155..279440) [2286 bp, 761 aa] {ON} Anc_2.5...    35   0.027
KAFR0I02090 Chr9 complement(427023..431423) [4401 bp, 1466 aa] {...    35   0.028
Kpol_505.18 s505 complement(48530..50287) [1758 bp, 585 aa] {ON}...    35   0.028
Suva_8.42 Chr8 complement(84493..86250) [1758 bp, 585 aa] {ON} Y...    35   0.029
TBLA0I01490 Chr9 (322980..325232) [2253 bp, 750 aa] {ON} Anc_2.5...    35   0.029
Kpol_1002.7 s1002 (19006..21270) [2265 bp, 754 aa] {ON} (19006.....    35   0.030
YHL010C Chr8 complement(81964..83721) [1758 bp, 585 aa] {ON}  ET...    35   0.031
CAGL0A03432g Chr1 (349884..353339) [3456 bp, 1151 aa] {ON} simil...    35   0.031
Smik_8.32 Chr8 complement(65542..67299) [1758 bp, 585 aa] {ON} Y...    35   0.033
Skud_8.35 Chr8 complement(70011..71768) [1758 bp, 585 aa] {ON} Y...    35   0.034
Ecym_5445 Chr5 complement(920562..921527) [966 bp, 321 aa] {ON} ...    35   0.034
TBLA0B00560 Chr2 (111412..112890) [1479 bp, 492 aa] {ON} Anc_6.4...    35   0.036
Smik_11.213 Chr11 (358262..360541) [2280 bp, 759 aa] {ON} YKL034...    35   0.036
SAKL0A09746g Chr1 (858392..860038) [1647 bp, 548 aa] {ON} simila...    35   0.037
TPHA0F01840 Chr6 complement(422396..423961) [1566 bp, 521 aa] {O...    35   0.038
YKL034W Chr11 (371829..374105) [2277 bp, 758 aa] {ON}  TUL1Golgi...    35   0.039
NDAI0G05200 Chr7 (1261661..1266421) [4761 bp, 1586 aa] {ON} Anc_...    35   0.039
YOL138C Chr15 complement(61325..65350) [4026 bp, 1341 aa] {ON}  ...    35   0.040
Suva_4.302 Chr4 complement(532902..533210,533286..533429) [453 b...    34   0.042
KNAG0H03510 Chr8 complement(654395..656050) [1656 bp, 551 aa] {O...    35   0.044
CAGL0H02651g Chr8 (238495..243129) [4635 bp, 1544 aa] {ON} simil...    35   0.045
Smik_2.196 Chr2 complement(347806..348363) [558 bp, 185 aa] {ON}...    34   0.047
ZYRO0B16258g Chr2 complement(1317605..1319344) [1740 bp, 579 aa]...    34   0.059
YMR231W Chr13 (733545..736634) [3090 bp, 1029 aa] {ON}  PEP5Comp...    34   0.059
CAGL0L01947g Chr12 (227996..230269) [2274 bp, 757 aa] {ON} simil...    34   0.064
ZYRO0G13376g Chr7 complement(1066321..1067658) [1338 bp, 445 aa]...    34   0.065
NDAI0B01820 Chr2 (433938..435815) [1878 bp, 625 aa] {ON} Anc_2.542     34   0.065
SAKL0E04488g Chr5 (359434..362817) [3384 bp, 1127 aa] {ON} simil...    34   0.069
NDAI0K01810 Chr11 (405118..407406) [2289 bp, 762 aa] {ON} Anc_2....    34   0.071
TPHA0C04250 Chr3 (915632..917302) [1671 bp, 556 aa] {ON} Anc_2.5...    34   0.075
KLTH0D07216g Chr4 complement(631219..633462) [2244 bp, 747 aa] {...    34   0.076
YLR032W Chr12 (204991..208500) [3510 bp, 1169 aa] {ON}  RAD5DNA ...    34   0.079
Kwal_26.8099 s26 complement(645436..647688) [2253 bp, 750 aa] {O...    34   0.080
NCAS0G02520 Chr7 (451683..453239) [1557 bp, 518 aa] {ON} Anc_2.1...    34   0.080
TBLA0B01260 Chr2 (266584..269241) [2658 bp, 885 aa] {ON} Anc_2.1...    34   0.080
Ecym_2684 Chr2 complement(1321556..1322716) [1161 bp, 386 aa] {O...    34   0.081
Skud_15.16 Chr15 complement(26552..30550) [3999 bp, 1332 aa] {ON...    34   0.083
NCAS0A11350 Chr1 complement(2249991..2251277) [1287 bp, 428 aa] ...    34   0.085
Suva_15.22 Chr15 complement(39171..43181) [4011 bp, 1336 aa] {ON...    34   0.087
TPHA0C04260 Chr3 complement(917526..919799) [2274 bp, 757 aa] {O...    34   0.089
TDEL0G04250 Chr7 complement(772180..773733) [1554 bp, 517 aa] {O...    34   0.089
KLLA0F25740g Chr6 complement(2389226..2390779) [1554 bp, 517 aa]...    34   0.090
TDEL0B06170 Chr2 (1088912..1093324) [4413 bp, 1470 aa] {ON} Anc_...    34   0.097
KLTH0C05258g Chr3 complement(455688..456130,456190..456205) [459...    33   0.098
Skud_8.176 Chr8 complement(313886..315127) [1242 bp, 413 aa] {ON...    33   0.100
KLTH0D07150g Chr4 (627115..628737) [1623 bp, 540 aa] {ON} simila...    33   0.10 
Skud_11.192 Chr11 (351379..353655) [2277 bp, 758 aa] {ON} YKL034...    34   0.10 
Smik_15.16 Chr15 complement(29410..33390) [3981 bp, 1326 aa] {ON...    34   0.10 
KLTH0G18150g Chr7 complement(1564780..1569444) [4665 bp, 1554 aa...    34   0.10 
SAKL0D02354g Chr4 (188524..189519) [996 bp, 331 aa] {ON} weakly ...    33   0.10 
NDAI0F02770 Chr6 complement(677011..678675) [1665 bp, 554 aa] {O...    33   0.11 
KNAG0C05660 Chr3 complement(1091851..1093374) [1524 bp, 507 aa] ...    33   0.11 
KLLA0F25674g Chr6 (2384293..2386566) [2274 bp, 757 aa] {ON} simi...    33   0.12 
SAKL0D03058g Chr4 complement(252198..252649,252717..252732) [468...    33   0.12 
TDEL0D03460 Chr4 (637921..638355) [435 bp, 144 aa] {ON} Anc_3.27...    33   0.13 
YDR143C Chr4 complement(742042..743874) [1833 bp, 610 aa] {ON}  ...    33   0.14 
CAGL0L03960g Chr12 complement(463751..465562) [1812 bp, 603 aa] ...    33   0.14 
Kwal_47.17904 s47 complement(602106..603518) [1413 bp, 470 aa] {...    33   0.14 
Kpol_1035.50 s1035 (124427..126232) [1806 bp, 601 aa] {ON} (1244...    33   0.15 
Kpol_1002.8 s1002 complement(21450..23126) [1677 bp, 558 aa] {ON...    33   0.15 
Suva_13.415 Chr13 (714887..717973) [3087 bp, 1028 aa] {ON} YMR23...    33   0.15 
KAFR0A05240 Chr1 (1036153..1037814) [1662 bp, 553 aa] {ON} Anc_6...    33   0.17 
ADL186C Chr4 complement(369320..373405) [4086 bp, 1361 aa] {ON} ...    33   0.18 
TDEL0B06340 Chr2 complement(1122797..1125085) [2289 bp, 762 aa] ...    33   0.19 
KAFR0A06530 Chr1 (1320422..1324123) [3702 bp, 1233 aa] {ON} Anc_...    33   0.19 
TPHA0F02480 Chr6 (546818..548635) [1818 bp, 605 aa] {ON} Anc_6.4...    33   0.19 
KLTH0F11044g Chr6 (937668..938543) [876 bp, 291 aa] {ON} weakly ...    33   0.20 
Smik_8.193 Chr8 complement(316475..317725) [1251 bp, 416 aa] {ON...    33   0.21 
Kwal_55.22076 s55 (1098857..1102717) [3861 bp, 1286 aa] {ON} YOL...    33   0.21 
ZYRO0E05632g Chr5 complement(434758..437055) [2298 bp, 765 aa] {...    33   0.21 
NCAS0D02010 Chr4 complement(371205..372737) [1533 bp, 510 aa] {O...    33   0.22 
SAKL0B05104g Chr2 (439233..442349) [3117 bp, 1038 aa] {ON} simil...    33   0.22 
CAGL0E02299g Chr5 complement(219246..220883) [1638 bp, 545 aa] {...    33   0.23 
SAKL0A09812g Chr1 complement(863141..865396) [2256 bp, 751 aa] {...    33   0.23 
Skud_4.402 Chr4 complement(713711..715549) [1839 bp, 612 aa] {ON...    33   0.23 
Suva_5.67 Chr5 (107941..108744) [804 bp, 267 aa] {ON} YEL019C (R...    32   0.23 
Skud_15.148 Chr15 complement(260982..262628) [1647 bp, 548 aa] {...    33   0.24 
YOL013C Chr15 complement(301380..303035) [1656 bp, 551 aa] {ON} ...    33   0.24 
ZYRO0C07194g Chr3 complement(542516..544192) [1677 bp, 558 aa] {...    33   0.24 
Kpol_1048.73 s1048 (207883..212532) [4650 bp, 1549 aa] {ON} (207...    33   0.25 
Smik_15.157 Chr15 complement(268666..270318) [1653 bp, 550 aa] {...    32   0.25 
TDEL0B05200 Chr2 (914227..915801) [1575 bp, 524 aa] {ON} Anc_2.1...    32   0.26 
YHR115C Chr8 complement(340109..341359) [1251 bp, 416 aa] {ON}  ...    32   0.26 
Suva_15.159 Chr15 complement(274570..276222) [1653 bp, 550 aa] {...    32   0.26 
SAKL0D10890g Chr4 (904673..905470) [798 bp, 265 aa] {ON} similar...    32   0.28 
KNAG0E02740 Chr5 complement(544981..546651) [1671 bp, 556 aa] {O...    32   0.29 
Ecym_7241 Chr7 (507764..510040) [2277 bp, 758 aa] {ON} similar t...    32   0.29 
KLTH0C04664g Chr3 (405366..406286) [921 bp, 306 aa] {ON} some si...    32   0.32 
NCAS0A04760 Chr1 (948786..951071) [2286 bp, 761 aa] {ON} Anc_2.5...    32   0.33 
Kwal_26.8090 s26 complement(641408..642970) [1563 bp, 520 aa] {O...    32   0.34 
NDAI0C02770 Chr3 (640635..642527) [1893 bp, 630 aa] {ON} Anc_6.4...    32   0.35 
Smik_4.387 Chr4 complement(702765..704669) [1905 bp, 634 aa] {ON...    32   0.35 
TDEL0A00410 Chr1 complement(70940..74728) [3789 bp, 1262 aa] {ON...    32   0.37 
Kpol_1072.55 s1072 (126281..127543) [1263 bp, 420 aa] {ON} (1262...    32   0.41 
Kwal_56.22522 s56 (166498..168039) [1542 bp, 513 aa] {ON} YOL013...    32   0.43 
TBLA0D04020 Chr4 complement(997081..1000617) [3537 bp, 1178 aa] ...    32   0.52 
KAFR0B03420 Chr2 (713034..716144) [3111 bp, 1036 aa] {ON} Anc_8....    32   0.58 
Suva_2.304 Chr2 complement(537292..539166) [1875 bp, 624 aa] {ON...    32   0.62 
Smik_15.113 Chr15 (194228..195448) [1221 bp, 406 aa] {ON} YOL054...    31   0.62 
Kwal_27.10419 s27 (337699..338601) [903 bp, 300 aa] {ON} YOL054W...    31   0.63 
SAKL0E10824g Chr5 complement(902623..904050) [1428 bp, 475 aa] {...    31   0.68 
Kpol_538.5 s538 (7029..8036) [1008 bp, 335 aa] {ON} (7029..8036)...    31   0.69 
KLLA0F23892g Chr6 complement(2229493..2231049) [1557 bp, 518 aa]...    31   0.72 
KLTH0C10604g Chr3 complement(878953..880500) [1548 bp, 515 aa] {...    31   0.74 
Kwal_14.1287 s14 (263082..267638) [4557 bp, 1518 aa] {ON} YLR247...    31   0.77 
KLTH0E09834g Chr5 complement(885503..886942) [1440 bp, 479 aa] {...    31   0.79 
NCAS0B00990 Chr2 complement(154925..156103) [1179 bp, 392 aa] {O...    31   0.80 
SAKL0H15686g Chr8 (1367935..1367948,1368042..1369827) [1800 bp, ...    31   0.82 
NDAI0E01840 Chr5 complement(367943..371395) [3453 bp, 1150 aa] {...    31   0.83 
YOL054W Chr15 (228614..229834) [1221 bp, 406 aa] {ON}  PSH1E3 ub...    31   0.83 
NCAS0A12550 Chr1 (2476209..2477927) [1719 bp, 572 aa] {ON} Anc_2...    31   0.85 
Suva_15.311 Chr15 complement(542475..543284) [810 bp, 269 aa] {O...    31   0.85 
KLLA0F12166g Chr6 complement(1116715..1121301) [4587 bp, 1528 aa...    31   0.92 
ZYRO0C03190g Chr3 (245542..249363) [3822 bp, 1273 aa] {ON} simil...    31   0.96 
Kpol_478.8 s478 complement(33393..38306,38308..39462) [6069 bp, ...    31   1.0  
YEL019C Chr5 complement(120498..121301) [804 bp, 267 aa] {ON}  M...    30   1.0  
Ecym_5428 Chr5 complement(881972..883396) [1425 bp, 474 aa] {ON}...    31   1.0  
Suva_10.112 Chr10 (211443..214946) [3504 bp, 1167 aa] {ON} YLR03...    31   1.0  
Skud_15.102 Chr15 (187319..188539) [1221 bp, 406 aa] {ON} YOL054...    31   1.1  
ACR267C Chr3 complement(841323..842726) [1404 bp, 467 aa] {ON} S...    30   1.2  
Suva_14.223 Chr14 (404941..406683) [1743 bp, 580 aa] {ON} YNL116...    30   1.2  
YBR114W Chr2 (467248..469620) [2373 bp, 790 aa] {ON}  RAD16Prote...    30   1.2  
TPHA0A03340 Chr1 (734754..735908) [1155 bp, 384 aa] {ON} Anc_3.4...    30   1.2  
ZYRO0A08932g Chr1 complement(712694..716260) [3567 bp, 1188 aa] ...    31   1.2  
Smik_13.439 Chr13 (717478..720570) [3093 bp, 1030 aa] {ON} YMR23...    30   1.2  
ZYRO0C17424g Chr3 complement(1357940..1358761) [822 bp, 273 aa] ...    30   1.3  
Suva_1.69 Chr1 (120731..124546) [3816 bp, 1271 aa] {ON} YAL002W ...    30   1.3  
Skud_12.99 Chr12 (196796..200311) [3516 bp, 1171 aa] {ON} YLR032...    30   1.3  
Skud_14.216 Chr14 (398407..399999) [1593 bp, 530 aa] {ON} YNL116...    30   1.3  
TDEL0F02870 Chr6 complement(518828..519610) [783 bp, 260 aa] {ON}      30   1.4  
KAFR0B05580 Chr2 (1142731..1146093) [3363 bp, 1120 aa] {ON} Anc_...    30   1.4  
TBLA0B03370 Chr2 complement(784352..787546) [3195 bp, 1064 aa] {...    30   1.4  
YNL116W Chr14 (408341..409909) [1569 bp, 522 aa] {ON}  DMA2Ubiqu...    30   1.4  
Skud_16.379 Chr16 complement(683736..684602) [867 bp, 288 aa] {O...    30   1.5  
Smik_14.212 Chr14 (387986..389575) [1590 bp, 529 aa] {ON} YNL116...    30   1.5  
TBLA0C01330 Chr3 (291659..296017) [4359 bp, 1452 aa] {ON} Anc_1....    30   1.5  
ACL019C Chr3 complement(328044..329771) [1728 bp, 575 aa] {ON} S...    30   1.7  
Kwal_47.17771 s47 (548453..551371) [2919 bp, 972 aa] {ON} YLR032...    30   1.7  
SAKL0D08272g Chr4 complement(687452..691927) [4476 bp, 1491 aa] ...    30   1.8  
YPR093C Chr16 complement(719558..720424) [867 bp, 288 aa] {ON}  ...    30   1.8  
CAGL0B05049g Chr2 (487186..491598) [4413 bp, 1470 aa] {ON} some ...    30   1.8  
TPHA0O00820 Chr15 complement(155829..156713) [885 bp, 294 aa] {O...    30   1.8  
KNAG0I01380 Chr9 (265230..269711) [4482 bp, 1493 aa] {ON} Anc_1....    30   1.9  
Kwal_56.23900 s56 complement(764530..766299) [1770 bp, 589 aa] {...    30   1.9  
TDEL0C05420 Chr3 complement(972821..973102) [282 bp, 93 aa] {ON}...    29   1.9  
TDEL0B00890 Chr2 (170522..172144) [1623 bp, 540 aa] {ON} Anc_8.8...    30   2.0  
Smik_12.94 Chr12 (191768..195304) [3537 bp, 1178 aa] {ON} YLR032...    30   2.0  
NCAS0C04430 Chr3 complement(905927..909862) [3936 bp, 1311 aa] {...    30   2.2  
NDAI0E00440 Chr5 (80965..82215) [1251 bp, 416 aa] {ON} Anc_8.808...    30   2.2  
YJL183W Chr10 (84068..85336) [1269 bp, 422 aa] {ON}  MNN11Subuni...    30   2.2  
TBLA0B02670 Chr2 (615206..616642) [1437 bp, 478 aa] {ON} Anc_8.8...    30   2.3  
Smik_16.333 Chr16 complement(596750..597622) [873 bp, 290 aa] {O...    30   2.4  
KLTH0E04312g Chr5 complement(388173..391268) [3096 bp, 1031 aa] ...    30   2.4  
TDEL0B03490 Chr2 complement(621849..624920) [3072 bp, 1023 aa] {...    30   2.4  
SAKL0C13332g Chr3 (1177358..1181419) [4062 bp, 1353 aa] {ON} sim...    30   2.5  
CAGL0H01595g Chr8 complement(155153..156436) [1284 bp, 427 aa] {...    30   2.5  
CAGL0K08052g Chr11 complement(800991..801908) [918 bp, 305 aa] {...    30   2.5  
NCAS0A08780 Chr1 (1735117..1739625) [4509 bp, 1502 aa] {ON} Anc_...    30   2.5  
KLTH0G12408g Chr7 (1055265..1057076) [1812 bp, 603 aa] {ON} weak...    30   2.5  
Kpol_1030.29 s1030 complement(56650..59700) [3051 bp, 1016 aa] {...    30   2.6  
Suva_15.115 Chr15 (200851..202086) [1236 bp, 411 aa] {ON} YOL054...    30   2.7  
Skud_5.77 Chr5 complement(119815..120618) [804 bp, 267 aa] {ON} ...    29   2.7  
Smik_5.88 Chr5 complement(126509..127312) [804 bp, 267 aa] {ON} ...    29   2.7  
AFR275W Chr6 (928482..930743) [2262 bp, 753 aa] {ON} Non-synteni...    29   3.0  
KLLA0E08317g Chr5 complement(747272..750037) [2766 bp, 921 aa] {...    29   3.0  
ZYRO0G15642g Chr7 complement(1271054..1274128) [3075 bp, 1024 aa...    29   3.2  
TDEL0F04440 Chr6 complement(833116..834780) [1665 bp, 554 aa] {O...    29   3.3  
KAFR0B04600 Chr2 complement(956458..957684) [1227 bp, 408 aa] {O...    29   3.6  
NDAI0G03810 Chr7 complement(911595..915776) [4182 bp, 1393 aa] {...    29   3.8  
KNAG0G03280 Chr7 complement(703783..704838) [1056 bp, 351 aa] {O...    29   4.0  
AAR049C Chr1 complement(428904..430235) [1332 bp, 443 aa] {ON} S...    29   4.2  
Smik_12.320 Chr12 complement(573526..578187) [4662 bp, 1553 aa] ...    29   4.3  
Kpol_480.22 s480 (52842..54119) [1278 bp, 425 aa] {ON} (52842..5...    29   4.7  
Kwal_56.23543 s56 complement(591514..594411) [2898 bp, 965 aa] {...    29   4.9  
Smik_1.66 Chr1 (126883..130701) [3819 bp, 1272 aa] {ON} YAL002W ...    29   5.1  
KNAG0A06030 Chr1 complement(909762..913214) [3453 bp, 1150 aa] {...    28   5.6  
CAGL0I09988g Chr9 complement(951638..952801) [1164 bp, 387 aa] {...    28   5.6  
KLTH0G10406g Chr7 (880042..882933) [2892 bp, 963 aa] {ON} simila...    28   5.9  
KAFR0H00710 Chr8 (132097..132783) [687 bp, 228 aa] {ON} Anc_3.40...    28   6.4  
Suva_16.520 Chr16 complement(894392..894883) [492 bp, 163 aa] {O...    28   6.7  
Suva_7.132 Chr7 complement(257924..262132) [4209 bp, 1402 aa] {O...    28   7.3  
Ecym_1358 Chr1 (737186..737980) [795 bp, 264 aa] {ON} similar to...    28   7.4  
TBLA0C02810 Chr3 complement(672074..673876) [1803 bp, 600 aa] {O...    28   7.6  
Ecym_2458 Chr2 (890326..893409) [3084 bp, 1027 aa] {ON} similar ...    28   7.7  
SAKL0B08976g Chr2 complement(766719..767687) [969 bp, 322 aa] {O...    28   7.9  
Ecym_3048 Chr3 (91031..93043) [2013 bp, 670 aa] {ON} similar to ...    28   8.4  
YJL157C Chr10 complement(123836..126328) [2493 bp, 830 aa] {ON} ...    28   8.7  
NDAI0K00900 Chr11 complement(199843..202959) [3117 bp, 1038 aa] ...    28   9.3  

>Kwal_56.23112 s56 complement(406291..406698) [408 bp, 135 aa] {ON}
           YDL008W (APC11) - subunit of the anaphase promoting
           complex (APC) [contig 183] FULL
          Length = 135

 Score =  285 bits (728), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 135/135 (100%), Positives = 135/135 (100%)

Query: 1   MKIEFKKVYPVFSWSWDIPGDDNADKEIGDEDLCGICRVSYNGTCPGCRFPGDNCPLVIG 60
           MKIEFKKVYPVFSWSWDIPGDDNADKEIGDEDLCGICRVSYNGTCPGCRFPGDNCPLVIG
Sbjct: 1   MKIEFKKVYPVFSWSWDIPGDDNADKEIGDEDLCGICRVSYNGTCPGCRFPGDNCPLVIG 60

Query: 61  ECNHNFHVHCIQQWLETATAKGLCPMCRQQFSLKRGVAINECQMDSLAKLLLQSQPAALT 120
           ECNHNFHVHCIQQWLETATAKGLCPMCRQQFSLKRGVAINECQMDSLAKLLLQSQPAALT
Sbjct: 61  ECNHNFHVHCIQQWLETATAKGLCPMCRQQFSLKRGVAINECQMDSLAKLLLQSQPAALT 120

Query: 121 TEDQDMMMDQEFIVR 135
           TEDQDMMMDQEFIVR
Sbjct: 121 TEDQDMMMDQEFIVR 135

>KLTH0G16082g Chr7 (1407117..1407524) [408 bp, 135 aa] {ON} some
           similarities with uniprot|Q12157 Saccharomyces
           cerevisiae YDL008W APC11 Catalytic core subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 135

 Score =  253 bits (646), Expect = 6e-88,   Method: Compositional matrix adjust.
 Identities = 116/135 (85%), Positives = 126/135 (93%)

Query: 1   MKIEFKKVYPVFSWSWDIPGDDNADKEIGDEDLCGICRVSYNGTCPGCRFPGDNCPLVIG 60
           M++EFKKVYPVFSWSWDIPGDD+AD+EIGDEDLCGICRVSYNGTCPGC++PGDNCPLVIG
Sbjct: 1   MQLEFKKVYPVFSWSWDIPGDDDADREIGDEDLCGICRVSYNGTCPGCKYPGDNCPLVIG 60

Query: 61  ECNHNFHVHCIQQWLETATAKGLCPMCRQQFSLKRGVAINECQMDSLAKLLLQSQPAALT 120
           ECNHNFHVHCIQQWL T TAKGLCPMCRQQFSLKRGVAINE Q++ LA LLLQ +PAAL 
Sbjct: 61  ECNHNFHVHCIQQWLATPTAKGLCPMCRQQFSLKRGVAINEGQVEKLANLLLQPRPAALA 120

Query: 121 TEDQDMMMDQEFIVR 135
            +DQDMMMDQEF VR
Sbjct: 121 ADDQDMMMDQEFAVR 135

>SAKL0C10516g Chr3 (956666..957100) [435 bp, 144 aa] {ON} similar to
           uniprot|Q12157 Saccharomyces cerevisiae YDL008W APC11
           Catalytic core subunit of the Anaphase- Promoting
           Complex/Cyclosome (APC/C) which is a ubiquitin- protein
           ligase required for degradation of anaphase inhibitors
           including mitotic cyclins during the metaphase/anaphase
           transition
          Length = 144

 Score =  182 bits (462), Expect = 8e-60,   Method: Compositional matrix adjust.
 Identities = 86/136 (63%), Positives = 102/136 (75%), Gaps = 9/136 (6%)

Query: 9   YPVFSWSWDIPGDDNADKEIGD--EDLCGICRVSYNGTCPGCRFPGDNCPLVIGECNHNF 66
           + V SWSW IP D     E  D  ED+CGICRVSYNGTCP C++PGD CPLV+GECNHNF
Sbjct: 9   HAVCSWSWHIPRDGTHQHEAADTEEDVCGICRVSYNGTCPSCKYPGDECPLVVGECNHNF 68

Query: 67  HVHCIQQWLETATAKGLCPMCRQQFSLKRGVAINECQMDSLAKLLLQSQPAALT------ 120
           HVHCI QWL+TAT++GLCPMCRQ FSLKRGVAIN+ Q+D  AKLL +   A  T      
Sbjct: 69  HVHCIVQWLDTATSRGLCPMCRQLFSLKRGVAINDSQLDHFAKLLNKVNRAGATELANAG 128

Query: 121 -TEDQDMMMDQEFIVR 135
             E+QD+MM+Q+F+VR
Sbjct: 129 LAEEQDLMMEQDFLVR 144

>TDEL0H03370 Chr8 complement(560397..560858) [462 bp, 153 aa] {ON}
           Anc_3.190 YDL008W
          Length = 153

 Score =  163 bits (412), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 81/154 (52%), Positives = 102/154 (66%), Gaps = 20/154 (12%)

Query: 1   MKIEFKKVYPVFSWSWDIPGD------DNADKEIGDEDLCGICRVSYNGTCPGCRFPGDN 54
           MK++ ++V+ VF+W+W IP +      +  D   GD D+CGICR SYN TCPGC+FPGD 
Sbjct: 1   MKVKLREVHSVFAWTWHIPKESQDAHAETIDDNDGD-DVCGICRASYNATCPGCKFPGDG 59

Query: 55  CPLVIGECNHNFHVHCIQQWLETATAKGLCPMCRQQFSLKRGVAINECQMDSLAKLLL-- 112
           CPLV+GECNHNFHVHCI +WL+TAT++GLCPMCRQ F LK+G+AIN+ Q+    +L    
Sbjct: 60  CPLVVGECNHNFHVHCIYRWLDTATSRGLCPMCRQTFQLKKGLAINDSQISKFQELRNKQ 119

Query: 113 ----------QSQPAALTTEDQ-DMMMDQEFIVR 135
                     Q  P     EDQ D MMDQ  IVR
Sbjct: 120 WQTRQQEFGDQQDPETNPLEDQDDPMMDQGLIVR 153

>ZYRO0A04906g Chr1 complement(395608..396090) [483 bp, 160 aa] {ON}
           similar to uniprot|Q12157 Saccharomyces cerevisiae
           YDL008W APC11 Catalytic core subunit of the Anaphase-
           Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin- protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 160

 Score =  161 bits (408), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 76/160 (47%), Positives = 105/160 (65%), Gaps = 25/160 (15%)

Query: 1   MKIEFKKVYPVFSWSWDIPGD--DNADKEIGDEDLCGICRVSYNGTCPGCRFPGDNCPLV 58
           MK++ ++V+ VF+W+W IP D  D + +   D+D+CGICR SYN TCP C++PGD C LV
Sbjct: 1   MKVDIEEVHSVFAWTWHIPKDNKDGSLEADDDDDVCGICRASYNATCPSCKYPGDECSLV 60

Query: 59  IGECNHNFHVHCIQQWLETATAKGLCPMCRQQFSLKRGVAINECQMDSLAKLLLQSQP-- 116
           +GECNHNFHVHCI +WL+T T+KGLCPMCRQ F LKRG+AIN+ Q++   +L L+ +   
Sbjct: 61  VGECNHNFHVHCIYRWLDTTTSKGLCPMCRQLFQLKRGLAINDSQLEKFKELQLRKRTNT 120

Query: 117 --------------AALTTEDQ-------DMMMDQEFIVR 135
                          A+  +DQ       D++MDQ  +VR
Sbjct: 121 AGEFADEDDEEAIERAMAQQDQAEVDDQGDVIMDQGLVVR 160

>TBLA0A00260 Chr1 complement(38358..38912) [555 bp, 184 aa] {ON}
           Anc_3.190 YDL008W
          Length = 184

 Score =  161 bits (407), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 75/145 (51%), Positives = 95/145 (65%), Gaps = 16/145 (11%)

Query: 1   MKIEFKKVYPVFSWSWDIPGDD----NADKEIG------------DEDLCGICRVSYNGT 44
           MKIE K +YPVF+W WDIP D+    N ++E+G            DED+CGICR +YN T
Sbjct: 1   MKIEVKGIYPVFAWKWDIPNDNHFIQNKERELGIDYSSGHNMVDEDEDVCGICRFNYNRT 60

Query: 45  CPGCRFPGDNCPLVIGECNHNFHVHCIQQWLETATAKGLCPMCRQQFSLKRGVAINECQM 104
           CP C+ PG  CPLV+G C HNFHVHCI +WL+T T+KGLCPMCRQ+F LK GVA+N+ Q 
Sbjct: 61  CPNCKVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKLKEGVALNKSQE 120

Query: 105 DSLAKLLLQSQPAALTTEDQDMMMD 129
           D    L L+         D+D+ +D
Sbjct: 121 DVFKSLELKQARQRFGAFDEDVDVD 145

>AER016C Chr5 complement(659572..660015) [444 bp, 147 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL008W
           (APC11)
          Length = 147

 Score =  153 bits (387), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 68/146 (46%), Positives = 98/146 (67%), Gaps = 13/146 (8%)

Query: 1   MKIEFKKVYPVFSWSWDIPGDDNADKEI----GDEDLCGICRVSYNGTCPGCRFPGDNCP 56
           M+++   +  V SW WD+P +   D  +     +ED+CGICR SYNGTCP C+ PG+ CP
Sbjct: 1   MQLQINNIQCVASWYWDVPKELKRDSPVYEDEDEEDVCGICRGSYNGTCPNCKLPGETCP 60

Query: 57  LVIGECNHNFHVHCIQQWLETATAKGLCPMCRQQFSLKRGVAINECQMDSLAKLLLQSQP 116
           L++G C+HNFHVHCI QWL T+T+KGLCPMCRQ FSL+ G+ INE   D   K+L++++ 
Sbjct: 61  LIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSLREGIRINEPHRDKFEKVLMKARQ 120

Query: 117 AALTT---------EDQDMMMDQEFI 133
            ++ +         +  D+++DQEFI
Sbjct: 121 QSVVSVAGANPVGPDQDDVIIDQEFI 146

>Kpol_1045.68 s1045 complement(160584..161114) [531 bp, 176 aa] {ON}
           complement(160586..161116) [531 nt, 177 aa]
          Length = 176

 Score =  153 bits (386), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 71/131 (54%), Positives = 91/131 (69%), Gaps = 16/131 (12%)

Query: 1   MKIEFKKVYPVFSWSWDIPGDDN------ADKEIGD----------EDLCGICRVSYNGT 44
           MK+E KKV+ VFSWSW IP +         +  IGD          ED+CGICR S+N T
Sbjct: 1   MKVEVKKVHCVFSWSWHIPKNAGTIESGLGEDAIGDIHGMVHEDDEEDVCGICRASFNRT 60

Query: 45  CPGCRFPGDNCPLVIGECNHNFHVHCIQQWLETATAKGLCPMCRQQFSLKRGVAINECQM 104
           CP C+FPGD CPLVIGEC HNFHVHCI +WL+T+T++GLCPMCRQ F LK+GV+IN+  +
Sbjct: 61  CPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCRQLFQLKKGVSINDSHI 120

Query: 105 DSLAKLLLQSQ 115
           +   +L ++ Q
Sbjct: 121 ERFRELAIKRQ 131

>Suva_4.239 Chr4 (426773..427270) [498 bp, 165 aa] {ON} YDL008W
           (REAL)
          Length = 165

 Score =  152 bits (384), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 71/165 (43%), Positives = 103/165 (62%), Gaps = 30/165 (18%)

Query: 1   MKIEFKKVYPVFSWSWDIP--GDDNADKEI-----GDEDLCGICRVSYNGTCPGCRFPGD 53
           MK++  +V+ VF+WSW IP   D+N   E+      DED+CGICR SYNGTCP C+FPGD
Sbjct: 1   MKVKINQVHSVFAWSWHIPRISDENETNEVTNENDDDEDVCGICRASYNGTCPSCKFPGD 60

Query: 54  NCPLVIGECNHNFHVHCIQQWLETATAKGLCPMCRQQFSLKRGVAINECQMDSLAKL--- 110
            CPLVIG C+HNFH HCI +WL+T+ +KGLCPMCRQ F L++G+AIN+  +    ++   
Sbjct: 61  QCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCRQVFQLQKGLAINDAHIRKFVEVVSR 120

Query: 111 --------------------LLQSQPAALTTEDQDMMMDQEFIVR 135
                               + Q+  +A+  +  D ++D++F++R
Sbjct: 121 RREEMIEEGVAEDFVDFDEPIRQNTDSAIDRQQVDTVLDEDFLLR 165

>Ecym_5312 Chr5 complement(632833..633279) [447 bp, 148 aa] {ON}
           similar to Ashbya gossypii AER016C
          Length = 148

 Score =  150 bits (379), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 73/147 (49%), Positives = 100/147 (68%), Gaps = 14/147 (9%)

Query: 1   MKIEFKKVYPVFSWSWDIPGDDNAD----KEIGDEDLCGICRVSYNGTCPGCRFPGDNCP 56
           M+++ K V  V SW WD+P +   D    ++  DED+CGICR SYNGTCP C+ PG+ CP
Sbjct: 1   MQLQIKNVQCVASWYWDVPKELKRDLHEGEDEDDEDVCGICRASYNGTCPNCKLPGETCP 60

Query: 57  LVIGECNHNFHVHCIQQWLETATAKGLCPMCRQQFSLKRGVAINECQMDSLAKLLLQSQP 116
           L++G C+HNFHVHCI QWL T+T+KGLCPMCRQ FSL+ G+ INE   +   K+L++++ 
Sbjct: 61  LIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSLRDGIRINEPHKEKFEKVLMKARQ 120

Query: 117 ----------AALTTEDQDMMMDQEFI 133
                     AA   + +D+M+DQEFI
Sbjct: 121 QNVVSVSGVNAAGGVDQEDVMIDQEFI 147

>YDL008W Chr4 (433497..433994) [498 bp, 165 aa] {ON}  APC11Catalytic
           core subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C), which is a ubiquitin-protein ligase required
           for degradation of anaphase inhibitors, including
           mitotic cyclins, during the metaphase/anaphase
           transition; contains a RING-H2 domain that is required
           for activity
          Length = 165

 Score =  149 bits (376), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 88/122 (72%), Gaps = 7/122 (5%)

Query: 1   MKIEFKKVYPVFSWSWDIPGDDNADKE----IG---DEDLCGICRVSYNGTCPGCRFPGD 53
           MK++  +V+ VF+WSW IP   + D      IG   DED+CGICR SYNGTCP C+FPGD
Sbjct: 1   MKVKINEVHSVFAWSWHIPSTSDEDAANNDPIGNDEDEDVCGICRASYNGTCPSCKFPGD 60

Query: 54  NCPLVIGECNHNFHVHCIQQWLETATAKGLCPMCRQQFSLKRGVAINECQMDSLAKLLLQ 113
            CPLVIG C+HNFH HCI +WL+T T+KGLCPMCRQ F L++G+AIN+  +    +++ +
Sbjct: 61  QCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQTFQLQKGLAINDAHVQKFVEIVSR 120

Query: 114 SQ 115
            +
Sbjct: 121 RR 122

>Skud_4.243 Chr4 (428190..428687) [498 bp, 165 aa] {ON} YDL008W
           (REAL)
          Length = 165

 Score =  149 bits (376), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 68/165 (41%), Positives = 102/165 (61%), Gaps = 30/165 (18%)

Query: 1   MKIEFKKVYPVFSWSWDIP-------GDDNADKEIGDEDLCGICRVSYNGTCPGCRFPGD 53
           MK++  +V+ VF+WSW IP       G++  ++   DED+CGICR SYNGTCP C++PGD
Sbjct: 1   MKVKINEVHSVFAWSWHIPSISDEVIGNEVPNENDEDEDVCGICRASYNGTCPSCKYPGD 60

Query: 54  NCPLVIGECNHNFHVHCIQQWLETATAKGLCPMCRQQFSLKRGVAINECQMDSLAKL--- 110
            CPLVIG C+HNFH HCI +WL+T+ +KGLCPMCRQ F L++G+AIN+  +     +   
Sbjct: 61  QCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCRQTFQLQKGLAINDAHIQKFVDIVSR 120

Query: 111 --------------------LLQSQPAALTTEDQDMMMDQEFIVR 135
                               + Q+  +A+  +  D ++D++F++R
Sbjct: 121 RREEMIEEGVAEDFVNFDEPMRQNTDSAIERQQIDTVLDEDFLLR 165

>Smik_4.224 Chr4 (415442..415939) [498 bp, 165 aa] {ON} YDL008W
           (REAL)
          Length = 165

 Score =  148 bits (373), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 68/165 (41%), Positives = 100/165 (60%), Gaps = 30/165 (18%)

Query: 1   MKIEFKKVYPVFSWSWDIPG-------DDNADKEIGDEDLCGICRVSYNGTCPGCRFPGD 53
           MK++  +V+ VF+W+W IP        +D  +    +ED+CGICR SYNGTCP C+FPGD
Sbjct: 1   MKVKINEVHSVFAWTWQIPSISDEKVTNDKLNDNDENEDVCGICRASYNGTCPSCKFPGD 60

Query: 54  NCPLVIGECNHNFHVHCIQQWLETATAKGLCPMCRQQFSLKRGVAINECQMDSLAKL--- 110
            CPLVIG C+HNFH HCI +WL+T T+KGLCPMCRQ+F L++G+AIN+  +    ++   
Sbjct: 61  QCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCRQRFQLQKGLAINDAHIQKFVEIVSR 120

Query: 111 --------------------LLQSQPAALTTEDQDMMMDQEFIVR 135
                               + Q+   A+     D ++D++F++R
Sbjct: 121 RREEMIEEGVAEDFVDFDEPIRQNTDNAIDRSQVDTVLDEDFLLR 165

>NDAI0A06520 Chr1 (1482275..1482895) [621 bp, 206 aa] {ON} Anc_3.190
           YDL008W
          Length = 206

 Score =  146 bits (368), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 68/141 (48%), Positives = 91/141 (64%), Gaps = 20/141 (14%)

Query: 1   MKIEFKKVYPVFSWSWDIPGD---------DNADKEIG----------DEDLCGICRVSY 41
           MKIE + +YP+ +WSWD+P +         DNA+   G           +D+CGICR SY
Sbjct: 1   MKIEVQNIYPLVAWSWDMPKNLDDPDSDEPDNANDSYGIRRRAPNKNAVDDVCGICRASY 60

Query: 42  NGTCPGCRFPGDNCPLVIGECNHNFHVHCIQQWLETATAKGLCPMCRQQFSLKRGVAINE 101
           NGTCP C+FPG +CPLV+G CNHNFH HCI QWL+T T+KGLCPMCRQ+F LK    +N 
Sbjct: 61  NGTCPNCKFPGTDCPLVLGRCNHNFHFHCIYQWLKTLTSKGLCPMCRQKFRLKPNATVNT 120

Query: 102 CQMDSLAKLLLQSQPAALTTE 122
             + +  +L + ++ A L +E
Sbjct: 121 DHLGAFKELAITTR-ARLISE 140

>KAFR0A01240 Chr1 (241805..242326) [522 bp, 173 aa] {ON} Anc_3.190
           YDL008W
          Length = 173

 Score =  140 bits (354), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 89/144 (61%), Gaps = 11/144 (7%)

Query: 1   MKIEFKKVYPVFSWSWDI---PGDDNAD-------KEIGDEDLCGICRVSYNGTCPGCRF 50
           MK+  KK+YPV++WSWDI    G+  +D            +D+CGICR SYNGTCP C+ 
Sbjct: 1   MKVTVKKIYPVYAWSWDIVTRKGEQKSDVYSVLDKYRSEKDDVCGICRASYNGTCPSCKI 60

Query: 51  PGDNCPLVIGECNHNFHVHCIQQWLETATAKGLCPMCRQQFSLKRGVAINECQMDSLAKL 110
           PG  CPL++G CNHNFH HCI +WL T  +KGLCPMCRQ+F L + + IN   +     L
Sbjct: 61  PGTMCPLIVGSCNHNFHYHCIFRWLNTLNSKGLCPMCRQEFKLDKKLVINSDYLQKFEVL 120

Query: 111 LLQSQP-AALTTEDQDMMMDQEFI 133
             +++   AL  +++D  +D   I
Sbjct: 121 ARKNRERRALNVDEEDNGIDNMII 144

>CAGL0I04576g Chr9 (408872..409321) [450 bp, 149 aa] {ON} similar to
           uniprot|Q12157 Saccharomyces cerevisiae YDL008w APC11
           subunit of the anaphase promoting complex
          Length = 149

 Score =  135 bits (340), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 83/116 (71%), Gaps = 3/116 (2%)

Query: 1   MKIEFKKVYPVFSWSWDIP-GDDNADKEIGDED--LCGICRVSYNGTCPGCRFPGDNCPL 57
           M+IE  +V+ VF+W WDIP  +D  D+ + DED  +CGICR SY+  CP CR+PG++C +
Sbjct: 1   MRIELTEVHGVFNWVWDIPKNEDRLDESMADEDEDVCGICRASYHAPCPNCRYPGESCAI 60

Query: 58  VIGECNHNFHVHCIQQWLETATAKGLCPMCRQQFSLKRGVAINECQMDSLAKLLLQ 113
           V+G C HNFHVHCI +W++T T+KGLCPMCRQ+F L +   INE  +    ++ ++
Sbjct: 61  VLGRCGHNFHVHCISRWVDTPTSKGLCPMCRQKFQLLQRTKINEPHIPLFKEIEIK 116

>KNAG0J01250 Chr10 complement(225063..225671) [609 bp, 202 aa] {ON}
           Anc_3.190 YDL008W
          Length = 202

 Score =  130 bits (328), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 69/157 (43%), Positives = 87/157 (55%), Gaps = 26/157 (16%)

Query: 1   MKIEFKKVYPVFSWSWDI------------------PGD-DNADKEIG-------DEDLC 34
           MK++ K+V PVF+WSWD                   P D + A  E G       DED+C
Sbjct: 1   MKLDIKRVNPVFTWSWDTRDPAAAKDRQYPFLYNYYPVDVEKAHLENGNAVDGDEDEDVC 60

Query: 35  GICRVSYNGTCPGCRFPGDNCPLVIGECNHNFHVHCIQQWLETATAKGLCPMCRQQFSLK 94
           GICR SYNGTCP C+ PGD+CPLV G C+H+FH HCI +WL+T T+KGLCPMCRQQF L 
Sbjct: 61  GICRASYNGTCPSCKIPGDSCPLVAGLCHHHFHYHCIFRWLDTNTSKGLCPMCRQQFQLN 120

Query: 95  RGVAINECQMDSLAKLLLQSQPAALTTEDQDMMMDQE 131
             + IN   ++    +    +      E  D    QE
Sbjct: 121 SKLPINRPYLEKFESITKAIRERVFLDEAFDGNSQQE 157

>TPHA0H00640 Chr8 (126792..127334) [543 bp, 180 aa] {ON} Anc_3.190
           YDL008W
          Length = 180

 Score =  129 bits (323), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 62/153 (40%), Positives = 84/153 (54%), Gaps = 26/153 (16%)

Query: 1   MKIEFKKVYPVFSWSWDIPGDDNADKEIGDEDL----------------------CGICR 38
           MK++ K V  VF+W W IP  D   K+  +  +                      CGICR
Sbjct: 1   MKVQIKNVNGVFAWGWQIPKHDQKVKKDHNNSIVSGSDVDHQEQNSDDEDDEEDFCGICR 60

Query: 39  VSYNGTCPGCRFPGDNCPLVIGECNHNFHVHCIQQWLETATAKGLCPMCRQQFSLKRGVA 98
            S+   CP C+FP D CP+VIG+C HNFHVHCI +WLET  ++GLCPMCRQ F L++GV 
Sbjct: 61  ASFIRACPNCKFPSDGCPIVIGKCKHNFHVHCIFEWLETEASRGLCPMCRQVFELRKGVV 120

Query: 99  INECQMDSLAKLLLQSQPA----ALTTEDQDMM 127
           IN+    +  +L+L+ Q        T ED + +
Sbjct: 121 INDLHYVTFKELILKRQKEQNEFEATAEDDEAL 153

>KLLA0E17711g Chr5 complement(1571018..1571506) [489 bp, 162 aa]
           {ON} similar to uniprot|Q12157 Saccharomyces cerevisiae
           YDL008W APC11 Catalytic core subunit of the Anaphase-
           Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin- protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 162

 Score =  127 bits (319), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 67/158 (42%), Positives = 86/158 (54%), Gaps = 29/158 (18%)

Query: 1   MKIEFKKVYPVFSWSWDIPGDDNADKE-IGDEDL------------------------CG 35
           M+IE   V  V +W+WDIP D +  K  + D+ +                        CG
Sbjct: 1   MRIEVTDVSLVSTWAWDIPKDLSKGKHGVADQTVHMEKWEDIQNEDEDAENDEEEYEVCG 60

Query: 36  ICRVSYNGTCPGCRFPGDNCPLVIGECNHNFHVHCIQQWLETATAKGLCPMCRQQFSLKR 95
           ICR  Y+ TCP C +PG  CP+V+G CNHNFHVHCI+QWL T T+KGLCP+CRQ F L+ 
Sbjct: 61  ICRNRYDATCPSCDYPGSGCPIVLGLCNHNFHVHCIKQWLSTETSKGLCPLCRQGFQLRP 120

Query: 96  GVAINECQMDSLAKLLLQSQ----PAALTTEDQDMMMD 129
            V IN+   D   KLL+  +    P      DQD+M D
Sbjct: 121 NVLINKMHHDEFQKLLMSVRQHNIPMGGGEIDQDVMDD 158

>NCAS0I01920 Chr9 (352307..352693) [387 bp, 128 aa] {ON} Anc_3.190
           YDL008W
          Length = 128

 Score =  116 bits (290), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 54/122 (44%), Positives = 70/122 (57%), Gaps = 12/122 (9%)

Query: 1   MKIEFKKVYPVFSWSWDIPGDDNADKE------------IGDEDLCGICRVSYNGTCPGC 48
           MK+E ++VYPVF WSWDI  +    +               D+++CGICR  YN  CP C
Sbjct: 1   MKLEVREVYPVFEWSWDITSETEQQQNHEPEEQPEDDDDDDDDEVCGICRAGYNAVCPSC 60

Query: 49  RFPGDNCPLVIGECNHNFHVHCIQQWLETATAKGLCPMCRQQFSLKRGVAINECQMDSLA 108
             PG  CP+V+G C H FHVHC+  WL TA A+G CPMCRQ F+L     +N     +L 
Sbjct: 61  SHPGVTCPVVVGTCQHAFHVHCVVPWLATAAARGACPMCRQPFALDPLRRVNRGATVTLP 120

Query: 109 KL 110
           +L
Sbjct: 121 QL 122

>NCAS0C04480 Chr3 (919123..919452) [330 bp, 109 aa] {ON} Anc_3.28
          Length = 109

 Score = 55.8 bits (133), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 44/99 (44%), Gaps = 19/99 (19%)

Query: 2   KIEFKKVYPVFSWSWDIPGDDNADKEIGDEDLCGICRVSYNGTCPGCRFPG-----DNCP 56
           K E KK   V  WSWDI  D+           C ICR      C  C+        + C 
Sbjct: 22  KFEIKKWTAVAFWSWDIAVDN-----------CAICRNHIMEPCIECQPKAMTDTDNECV 70

Query: 57  LVIGECNHNFHVHCIQQWLETATAKGLCPMCRQQFSLKR 95
              G CNH FH+HCI +W++T  A   CP+  Q + L R
Sbjct: 71  AAWGTCNHAFHLHCINKWIKTRDA---CPLDNQPWQLAR 106

>Kpol_1014.16 s1014 complement(29615..29938) [324 bp, 107 aa] {ON}
           complement(29615..29938) [324 nt, 108 aa]
          Length = 107

 Score = 54.7 bits (130), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 44/99 (44%), Gaps = 19/99 (19%)

Query: 2   KIEFKKVYPVFSWSWDIPGDDNADKEIGDEDLCGICRVSYNGTC----PGCRFPGDN-CP 56
           + E KK   V  WSWDI  D+           C ICR      C    P      DN C 
Sbjct: 20  RFEIKKWTAVAFWSWDIAVDN-----------CAICRNHIMEPCIECQPNAMTETDNECV 68

Query: 57  LVIGECNHNFHVHCIQQWLETATAKGLCPMCRQQFSLKR 95
              G CNH FH+HCI +W++T  A   CP+  Q + L R
Sbjct: 69  AAWGTCNHAFHLHCINKWIKTRDA---CPLDNQPWQLAR 104

>Kwal_55.22054 s55 complement(1091138..1091473) [336 bp, 111 aa]
           {ON} YOL133W (HRT1) - subunit of Skp1-Cullin-F-box
           ubiquitin protein ligase (SCF) [contig 124] FULL
          Length = 111

 Score = 54.3 bits (129), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 44/99 (44%), Gaps = 19/99 (19%)

Query: 2   KIEFKKVYPVFSWSWDIPGDDNADKEIGDEDLCGICRVSYNGTCPGCRFPG-----DNCP 56
           K E KK   V  WSWDI  ++           C ICR      C  C+        + C 
Sbjct: 24  KFEVKKWTAVAFWSWDIAVEN-----------CAICRNHIMEPCIQCQPTAMTDTDNECV 72

Query: 57  LVIGECNHNFHVHCIQQWLETATAKGLCPMCRQQFSLKR 95
              G CNH FH+HCI +WL+T  A   CP+  Q +S  +
Sbjct: 73  AAWGTCNHAFHLHCINKWLQTRNA---CPLDNQPWSFAK 108

>YOL133W Chr15 (70325..70690) [366 bp, 121 aa] {ON}  HRT1RING finger
           containing subunit of Skp1-Cullin-F-box ubiquitin
           protein ligases (SCF); required for Gic2p, Far1p, Sic1p
           and Cln2p degradation; may tether Cdc34p (a ubiquitin
           conjugating enzyme or E2) and Cdc53p (a cullin) subunits
           of SCF
          Length = 121

 Score = 54.3 bits (129), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 44/99 (44%), Gaps = 19/99 (19%)

Query: 2   KIEFKKVYPVFSWSWDIPGDDNADKEIGDEDLCGICRVSYNGTCPGCRFPG-----DNCP 56
           + E KK   V  WSWDI  D+           C ICR      C  C+        + C 
Sbjct: 34  RFEIKKWTAVAFWSWDIAVDN-----------CAICRNHIMEPCIECQPKAMTDTDNECV 82

Query: 57  LVIGECNHNFHVHCIQQWLETATAKGLCPMCRQQFSLKR 95
              G CNH FH+HCI +W++T  A   CP+  Q + L R
Sbjct: 83  AAWGVCNHAFHLHCINKWIKTRDA---CPLDNQPWQLAR 118

>NDAI0G03860 Chr7 (925672..926043) [372 bp, 123 aa] {ON} Anc_3.28
           YOL133W
          Length = 123

 Score = 54.3 bits (129), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 44/99 (44%), Gaps = 19/99 (19%)

Query: 2   KIEFKKVYPVFSWSWDIPGDDNADKEIGDEDLCGICRVSYNGTCPGCRFPG-----DNCP 56
           + E KK   V  WSWDI  D+           C ICR      C  C+        + C 
Sbjct: 36  RFEIKKWTAVAFWSWDIAVDN-----------CAICRNHIMEPCIECQPKAMTDTDNECV 84

Query: 57  LVIGECNHNFHVHCIQQWLETATAKGLCPMCRQQFSLKR 95
              G CNH FH+HCI +W++T  A   CP+  Q + L R
Sbjct: 85  AAWGVCNHAFHLHCINKWIQTRDA---CPLDNQPWQLAR 120

>Smik_15.20 Chr15 (38383..38748) [366 bp, 121 aa] {ON} YOL133W
           (REAL)
          Length = 121

 Score = 54.3 bits (129), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 44/99 (44%), Gaps = 19/99 (19%)

Query: 2   KIEFKKVYPVFSWSWDIPGDDNADKEIGDEDLCGICRVSYNGTCPGCRFPG-----DNCP 56
           + E KK   V  WSWDI  D+           C ICR      C  C+        + C 
Sbjct: 34  RFEIKKWTAVAFWSWDIAVDN-----------CAICRNHIMEPCIECQPKAMTDTDNECV 82

Query: 57  LVIGECNHNFHVHCIQQWLETATAKGLCPMCRQQFSLKR 95
              G CNH FH+HCI +W++T  A   CP+  Q + L R
Sbjct: 83  AAWGVCNHAFHLHCINKWIKTRDA---CPLDNQPWQLAR 118

>KLLA0E07151g Chr5 (651474..651806) [333 bp, 110 aa] {ON} similar to
           uniprot|Q08273 Saccharomyces cerevisiae YOL133W HRT1
           RING finger containing subunit of Skp1-Cullin- F-box
           ubiquitin protein ligases (SCF) required for Gic2p Far1p
           Sic1p and Cln2p degradation may tether Cdc34p (a
           ubiquitin conjugating enzyme or E2) and Cdc53p (a
           cullin) subunits of SCF
          Length = 110

 Score = 53.9 bits (128), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 34/98 (34%), Positives = 46/98 (46%), Gaps = 19/98 (19%)

Query: 3   IEFKKVYPVFSWSWDIPGDDNADKEIGDEDLCGICRVSYNGTCPGCR----FPGDN-CPL 57
            E  K   V  WSWDI           D D C ICR      C  C+    F  ++ C  
Sbjct: 24  FEITKWTAVAFWSWDI-----------DVDNCAICRNHIMEPCVNCQQEATFNSEHECVA 72

Query: 58  VIGECNHNFHVHCIQQWLETATAKGLCPMCRQQFSLKR 95
             GECNH FH+HCI QW+++   + +CP+  + + L R
Sbjct: 73  AWGECNHAFHLHCITQWIKS---RNVCPLDNKPWKLAR 107

>CAGL0E01567g Chr5 (148425..148733) [309 bp, 102 aa] {ON} similar
          to uniprot|Q08273 Saccharomyces cerevisiae YOL133w HRT1
          RING-box protein
          Length = 102

 Score = 53.5 bits (127), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 44/99 (44%), Gaps = 19/99 (19%)

Query: 2  KIEFKKVYPVFSWSWDIPGDDNADKEIGDEDLCGICRVSYNGTCPGCRFPG-----DNCP 56
          K + KK   V  WSWDI  D+           C ICR      C  C+        + C 
Sbjct: 15 KFQIKKWTAVAFWSWDIAVDN-----------CAICRNHIMEPCIECQPKAMTDTDNECV 63

Query: 57 LVIGECNHNFHVHCIQQWLETATAKGLCPMCRQQFSLKR 95
             G CNH FH+HCI +W++T  A   CP+  Q + L R
Sbjct: 64 AAWGTCNHAFHLHCINKWIKTRDA---CPLDNQPWHLAR 99

>TDEL0A00470 Chr1 (82852..83208) [357 bp, 118 aa] {ON} Anc_3.28
           YOL133W
          Length = 118

 Score = 53.9 bits (128), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 45/99 (45%), Gaps = 19/99 (19%)

Query: 2   KIEFKKVYPVFSWSWDIPGDDNADKEIGDEDLCGICRVSYNGTCPGCR----FPGDN-CP 56
           + E KK   V  WSWDI  D+           C ICR      C  C+       DN C 
Sbjct: 31  RFEIKKWTAVAFWSWDIAVDN-----------CAICRNHIMEPCIECQPLAMTDTDNECV 79

Query: 57  LVIGECNHNFHVHCIQQWLETATAKGLCPMCRQQFSLKR 95
              G CNH FH+HCI +W++T  A   CP+  Q + L R
Sbjct: 80  AAWGTCNHAFHLHCINKWIKTRDA---CPLDNQPWHLAR 115

>Skud_15.20 Chr15 (35550..35915) [366 bp, 121 aa] {ON} YOL133W
           (REAL)
          Length = 121

 Score = 53.9 bits (128), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 44/99 (44%), Gaps = 19/99 (19%)

Query: 2   KIEFKKVYPVFSWSWDIPGDDNADKEIGDEDLCGICRVSYNGTCPGCRFPG-----DNCP 56
           + E KK   V  WSWDI  D+           C ICR      C  C+        + C 
Sbjct: 34  RFEIKKWTAVAFWSWDIAVDN-----------CAICRNHIMEPCIECQPKAMTDTDNECV 82

Query: 57  LVIGECNHNFHVHCIQQWLETATAKGLCPMCRQQFSLKR 95
              G CNH FH+HCI +W++T  A   CP+  Q + L R
Sbjct: 83  AAWGVCNHAFHLHCINKWIKTRDA---CPLDNQPWQLAR 118

>ZYRO0C03058g Chr3 complement(236925..237275) [351 bp, 116 aa] {ON}
           highly similar to uniprot|Q08273 Saccharomyces
           cerevisiae YOL133W HRT1 RING finger containing subunit
           of Skp1-Cullin-F-box ubiquitin protein ligases (SCF)
           required for Gic2p Far1p Sic1p and Cln2p degradation may
           tether Cdc34p (a ubiquitin conjugating enzyme or E2) and
           Cdc53p (a cullin) subunits of SCF
          Length = 116

 Score = 53.5 bits (127), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 45/99 (45%), Gaps = 19/99 (19%)

Query: 2   KIEFKKVYPVFSWSWDIPGDDNADKEIGDEDLCGICRVSYNGTCPGCR----FPGDN-CP 56
           K E KK   V  WSWDI  D+           C ICR      C  C+       DN C 
Sbjct: 29  KFEIKKWTAVAFWSWDIAVDN-----------CAICRNHIMEPCIECQPMAMTDTDNECV 77

Query: 57  LVIGECNHNFHVHCIQQWLETATAKGLCPMCRQQFSLKR 95
              G CNH FH+HCI +W++T  A   CP+  Q + L R
Sbjct: 78  AAWGVCNHAFHLHCINKWIKTRDA---CPLDNQPWQLAR 113

>Suva_15.26 Chr15 (48168..48536) [369 bp, 122 aa] {ON} YOL133W
           (REAL)
          Length = 122

 Score = 53.9 bits (128), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 44/99 (44%), Gaps = 19/99 (19%)

Query: 2   KIEFKKVYPVFSWSWDIPGDDNADKEIGDEDLCGICRVSYNGTCPGCRFPG-----DNCP 56
           + E KK   V  WSWDI  D+           C ICR      C  C+        + C 
Sbjct: 35  RFEIKKWTAVAFWSWDIAVDN-----------CAICRNHIMEPCIECQPKAMTDTDNECV 83

Query: 57  LVIGECNHNFHVHCIQQWLETATAKGLCPMCRQQFSLKR 95
              G CNH FH+HCI +W++T  A   CP+  Q + L R
Sbjct: 84  AAWGVCNHAFHLHCINKWIKTRDA---CPLDNQPWQLAR 119

>KLTH0F19228g Chr6 complement(1556655..1556987) [333 bp, 110 aa]
           {ON} similar to uniprot|Q08273 Saccharomyces cerevisiae
           YOL133W HRT1 RING finger containing subunit of
           Skp1-Cullin- F-box ubiquitin protein ligases (SCF)
           required for Gic2p Far1p Sic1p and Cln2p degradation may
           tether Cdc34p (a ubiquitin conjugating enzyme or E2) and
           Cdc53p (a cullin) subunits of SCF
          Length = 110

 Score = 52.0 bits (123), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 43/99 (43%), Gaps = 19/99 (19%)

Query: 2   KIEFKKVYPVFSWSWDIPGDDNADKEIGDEDLCGICRVSYNGTCPGCRFPG-----DNCP 56
           + E KK   V  WSWDI  ++           C ICR      C  C+        + C 
Sbjct: 23  RFEVKKWTAVAFWSWDIAVEN-----------CAICRNHIMEPCIQCQPTAMTDTDNECV 71

Query: 57  LVIGECNHNFHVHCIQQWLETATAKGLCPMCRQQFSLKR 95
              G CNH FH+HCI +WL+T  A   CP+  Q +   +
Sbjct: 72  AAWGACNHAFHLHCINKWLQTRNA---CPLDNQTWQFAK 107

>KNAG0A01280 Chr1 (27372..27716) [345 bp, 114 aa] {ON} Anc_3.28
           YOL133W
          Length = 114

 Score = 52.0 bits (123), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 43/99 (43%), Gaps = 19/99 (19%)

Query: 2   KIEFKKVYPVFSWSWDIPGDDNADKEIGDEDLCGICRVSYNGTCPGCRFPG-----DNCP 56
           K + KK   V  WSWDI  D+           C ICR      C  C+        + C 
Sbjct: 27  KFQIKKWTAVAFWSWDIAVDN-----------CAICRNHIMEPCIECQPKAMTDTDNECV 75

Query: 57  LVIGECNHNFHVHCIQQWLETATAKGLCPMCRQQFSLKR 95
              G C H FH+HCI +W++T  A   CP+  Q + L R
Sbjct: 76  AAWGACGHAFHLHCINKWIKTRDA---CPLDNQPWQLAR 111

>TBLA0B08710 Chr2 complement(2075746..2076114) [369 bp, 122 aa] {ON}
           Anc_3.28 YOL133W
          Length = 122

 Score = 52.0 bits (123), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 44/99 (44%), Gaps = 19/99 (19%)

Query: 2   KIEFKKVYPVFSWSWDIPGDDNADKEIGDEDLCGICRVSYNGTCPGCRFPG-----DNCP 56
           + + KK   V  WSWDI  D+           C ICR      C  C+         +C 
Sbjct: 35  RFQVKKWTAVAFWSWDIAVDN-----------CAICRNHIMEPCIECQPKAMTDTDTDCV 83

Query: 57  LVIGECNHNFHVHCIQQWLETATAKGLCPMCRQQFSLKR 95
              G CNH FH+HCI +W++T  A   CP+  Q + L R
Sbjct: 84  AAWGTCNHAFHLHCINKWIKTREA---CPLDNQPWQLAR 119

>KAFR0C01780 Chr3 complement(363161..363517) [357 bp, 118 aa] {ON}
           Anc_3.28 YOL133W
          Length = 118

 Score = 50.1 bits (118), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 32/90 (35%), Positives = 41/90 (45%), Gaps = 19/90 (21%)

Query: 11  VFSWSWDIPGDDNADKEIGDEDLCGICRVSYNGTCPGCRF-----PGDNCPLVIGECNHN 65
           V  WSWDI  D+           C ICR      C  C+      P + C    G CNH 
Sbjct: 40  VAFWSWDIAVDN-----------CAICRNHIMEPCIECQPKAMTDPDNECVAAWGVCNHA 88

Query: 66  FHVHCIQQWLETATAKGLCPMCRQQFSLKR 95
           FH+HCI +W++T  A   CP+  Q + L R
Sbjct: 89  FHLHCINKWIKTRDA---CPLDNQPWQLAR 115

>Ecym_2029 Chr2 (47083..47427) [345 bp, 114 aa] {ON} similar to
           Ashbya gossypii ADL181W
          Length = 114

 Score = 49.3 bits (116), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 42/99 (42%), Gaps = 19/99 (19%)

Query: 2   KIEFKKVYPVFSWSWDIPGDDNADKEIGDEDLCGICRVSYNGTC----PGCRFPGDN-CP 56
           K + KK   V  WSWDI  ++           C ICR      C    P      DN C 
Sbjct: 27  KFQIKKWTAVAFWSWDIAVEN-----------CAICRNHIMEPCIQCQPNAMTDTDNECV 75

Query: 57  LVIGECNHNFHVHCIQQWLETATAKGLCPMCRQQFSLKR 95
              G CNH FH+HCI +WL T  A   CP+  + +   +
Sbjct: 76  AAWGTCNHAFHLHCINKWLLTRNA---CPLDNKTWQFAK 111

>ADL181W Chr4 (379682..380008) [327 bp, 108 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL133W (HRT1)
          Length = 108

 Score = 48.1 bits (113), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 42/99 (42%), Gaps = 19/99 (19%)

Query: 2   KIEFKKVYPVFSWSWDIPGDDNADKEIGDEDLCGICRVSYNGTCPGCRFPG-----DNCP 56
           K + KK   V  WSWDI  ++           C ICR      C  C+        + C 
Sbjct: 21  KFQIKKWIAVAFWSWDIAVEN-----------CAICRNHIMEPCIQCQPNAMTDTENECV 69

Query: 57  LVIGECNHNFHVHCIQQWLETATAKGLCPMCRQQFSLKR 95
              G CNH FH+HCI +WL T  A   CP+  + +   +
Sbjct: 70  AAWGTCNHAFHLHCINKWLLTRNA---CPLDNKTWQFAK 105

>SAKL0C13178g Chr3 complement(1166576..1166992) [417 bp, 138 aa]
           {ON} similar to uniprot|Q08273 Saccharomyces cerevisiae
           YOL133W HRT1 RING finger containing subunit of
           Skp1-Cullin- F-box ubiquitin protein ligases (SCF)
           required for Gic2p Far1p Sic1p and Cln2p degradation may
           tether Cdc34p (a ubiquitin conjugating enzyme or E2) and
           Cdc53p (a cullin) subunits of SCF
          Length = 138

 Score = 47.8 bits (112), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 39/90 (43%), Gaps = 19/90 (21%)

Query: 11  VFSWSWDIPGDDNADKEIGDEDLCGICRVSYNGTCPGCRFPG-----DNCPLVIGECNHN 65
           V  WSWDI  ++           C ICR      C  C+        + C    G CNH 
Sbjct: 60  VAFWSWDIAVEN-----------CAICRNHIMEPCIQCQPTAMTDTDNECVAAWGTCNHA 108

Query: 66  FHVHCIQQWLETATAKGLCPMCRQQFSLKR 95
           FH+HCI +WL+T   +  CP+  Q +   +
Sbjct: 109 FHLHCINKWLQT---RNACPLDNQPWQFAK 135

>TPHA0P01470 Chr16 complement(301305..301640) [336 bp, 111 aa] {ON}
           Anc_3.28 YOL133W
          Length = 111

 Score = 47.0 bits (110), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 41/90 (45%), Gaps = 19/90 (21%)

Query: 11  VFSWSWDIPGDDNADKEIGDEDLCGICRVSYNGTCPGCR----FPGDN-CPLVIGECNHN 65
           V  WSWDI  D+           C ICR      C  C+       DN C +    CNH 
Sbjct: 33  VAFWSWDIAVDN-----------CAICRNHIMEPCIECQPMAMTETDNECVVAWAACNHA 81

Query: 66  FHVHCIQQWLETATAKGLCPMCRQQFSLKR 95
           FH+HCI +W++T   +  CP+  Q + L R
Sbjct: 82  FHLHCINKWIKT---RDACPLDNQPWQLAR 108

>KLLA0F18458g Chr6 complement(1697871..1698293) [423 bp, 140 aa]
           {ON} similar to uniprot|P38239 Saccharomyces cerevisiae
           YBR062C Hypothetical ORF
          Length = 140

 Score = 43.1 bits (100), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 40/84 (47%), Gaps = 15/84 (17%)

Query: 25  DKEIGDEDLCGICRVSYNGTCPGCRFPGDNCPLV--IGECNHNFHVHCIQQWLETATAKG 82
           + ++  ED C IC+         C F  D  PLV  +  CNH F + C+  WL+      
Sbjct: 62  NSKLKAEDTCAICQ---------CNFLDDPYPLVAKVPRCNHKFDLECLSIWLQN---NH 109

Query: 83  LCPMCRQQFSLKR-GVAINECQMD 105
            CPMCR     K+  +  ++C+++
Sbjct: 110 TCPMCRDDLRSKKVEIDTSQCELE 133

>TBLA0I01960 Chr9 complement(444753..445291,445364..445379) [555 bp,
           184 aa] {ON} Anc_3.279 YBR062C
          Length = 184

 Score = 42.7 bits (99), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 44/83 (53%), Gaps = 16/83 (19%)

Query: 26  KEIGDED-LCGICRVSYNGTCPGCRFPGDNCPLVIG--ECNHNFHVHCIQQWLETATAKG 82
           K I ++D +C ICR         C+F  D+ PL+I    C H F + CI  WL+  ++  
Sbjct: 106 KSIKNKDEICSICR---------CKFFDDDYPLIIELPNCKHYFDLECITLWLQKNSS-- 154

Query: 83  LCPMCRQQFSLKRGVAINECQMD 105
            CP+CR    L++   I++ Q++
Sbjct: 155 -CPICRNDV-LEKKFKIDDSQVE 175

>NCAS0A08280 Chr1 (1636423..1636779) [357 bp, 118 aa] {ON}
          Anc_3.279 YBR062C
          Length = 118

 Score = 41.6 bits (96), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 36/80 (45%), Gaps = 10/80 (12%)

Query: 16 WDIPGDDNADKEIGDEDLCGICRVSY---NGTCP--GCRFPGDNCPLVIG--ECNHNFHV 68
          W    D+   K   +E +  + RV     N  CP   C+F  D  PL++    CNH F +
Sbjct: 17 WFEQMDEKNKKHCSEEFIASLPRVKSKHKNDECPICCCKFSEDKYPLIVELPRCNHRFDL 76

Query: 69 HCIQQWLETATAKGLCPMCR 88
           CI  WL  +     CP+CR
Sbjct: 77 ECISVWLSKSVT---CPLCR 93

>ZYRO0E06996g Chr5 complement(530578..531080,531138..531153) [519
           bp, 172 aa] {ON} similar to uniprot|P38239 Saccharomyces
           cerevisiae YBR062C Hypothetical ORF
          Length = 172

 Score = 42.4 bits (98), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 40/73 (54%), Gaps = 8/73 (10%)

Query: 38  RVSYNGTCPGC--RFPGDNCPLV--IGECNHNFHVHCIQQWLETATAKGLCPMCRQQ-FS 92
           ++  + +CP C   +  D+ PLV  +  CNH F + CI  WL  +T+   CP+CR    S
Sbjct: 96  KIKEDDSCPICCCTYKEDDHPLVAELPHCNHKFDLECISVWLSKSTS---CPLCRDDVMS 152

Query: 93  LKRGVAINECQMD 105
            K G+  ++ +++
Sbjct: 153 HKPGIDTSQVELE 165

>TPHA0I00590 Chr9 (117658..122433) [4776 bp, 1591 aa] {ON} Anc_8.799
            YMR247C
          Length = 1591

 Score = 42.0 bits (97), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 18/62 (29%), Positives = 30/62 (48%), Gaps = 7/62 (11%)

Query: 34   CGICRVSYNGTCPGCRFPGDNCPLVIGECNHNFHVHCIQQWLETATAKGLCPMCRQQFSL 93
            C IC  + +      + P   CP     CN+ FH  C+ +W  ++     CP+CR + +L
Sbjct: 1537 CAICYSTLHAV--DRKLPTKVCP----TCNNKFHGSCLYKWFRSSN-NNTCPLCRSEIAL 1589

Query: 94   KR 95
            +R
Sbjct: 1590 RR 1591

>Kwal_55.21206 s55 complement(730534..731361) [828 bp, 275 aa] {ON}
           [contig 295] FULL
          Length = 275

 Score = 41.6 bits (96), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 55/125 (44%), Gaps = 19/125 (15%)

Query: 5   FKKVYPVFSWSWDIPGDDNADKEIGDEDLCGICRVSYNGTCPGCRFPGDNCPLVIGECNH 64
           F +++P   +S        AD        C IC+  +N     C         ++G CNH
Sbjct: 95  FHRIFPTQQYSKVESLGPGADSRTT----CAICQEDFNKLNNVC---------LLG-CNH 140

Query: 65  NFHVHCIQQWLETATAKGLCPMCRQQFSLKRGVAINECQMDSLAKLLLQSQPAALTTEDQ 124
            FH +CI QW+   +A   CP+C++ +SL R   +   Q+  +   +  S  ++   E  
Sbjct: 141 VFHTYCIDQWICRNSA--CCPLCKRSYSLPR---VFHPQVRYIDDKIGASYNSSSRAEQA 195

Query: 125 DMMMD 129
           DM +D
Sbjct: 196 DMWLD 200

>KLLA0C14344g Chr3 (1245226..1249782) [4557 bp, 1518 aa] {ON} similar
            to uniprot|Q04781 Saccharomyces cerevisiae YMR247C
            Hypothetical ORF
          Length = 1518

 Score = 41.6 bits (96), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 15/47 (31%), Positives = 27/47 (57%), Gaps = 5/47 (10%)

Query: 49   RFPGDNCPLVIGECNHNFHVHCIQQWLETATAKGLCPMCRQQFSLKR 95
            + P   CP     CN+ FH  C+ +W ++ +    CP+CR +F+L++
Sbjct: 1477 KLPTKVCP----TCNNRFHGACLYKWFKS-SGNNTCPLCRGEFNLRK 1518

>Ecym_2658 Chr2 (1270952..1271431) [480 bp, 159 aa] {ON} similar to
           Ashbya gossypii AGR034W
          Length = 159

 Score = 40.4 bits (93), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 31/68 (45%), Gaps = 14/68 (20%)

Query: 24  ADKEIGDEDLCGICRVSYNGTCPGCRFPGDNCPLVIG--ECNHNFHVHCIQQWLETATAK 81
           A   +  +D C IC          C +  D+ PLV+    CNH F + CI  WL  ++  
Sbjct: 80  ATTHLSPDDTCAIC---------CCVYLEDSYPLVVKLPNCNHKFDLQCITLWLSKSST- 129

Query: 82  GLCPMCRQ 89
             CPMCR 
Sbjct: 130 --CPMCRN 135

>CAGL0H10274g Chr8 complement(1003801..1004312,1004468..1004483)
           [528 bp, 175 aa] {ON} similar to uniprot|P38239
           Saccharomyces cerevisiae YBR062c
          Length = 175

 Score = 40.4 bits (93), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 29/62 (46%), Gaps = 7/62 (11%)

Query: 38  RVSYNGTCPGC--RFPGDNCPLVIG--ECNHNFHVHCIQQWLETATAKGLCPMCRQQFSL 93
           ++  + TCP C   F  D  PLV+    C H F   C+  WL   T    CPMCR   + 
Sbjct: 97  KLKSDDTCPICCSNFIADEYPLVVELPHCGHKFDFECVSMWL---TKNTTCPMCRDDVTH 153

Query: 94  KR 95
           K+
Sbjct: 154 KK 155

>TBLA0D00650 Chr4 (172839..177545) [4707 bp, 1568 aa] {ON} Anc_8.799
            YMR247C
          Length = 1568

 Score = 40.4 bits (93), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 14/47 (29%), Positives = 23/47 (48%), Gaps = 5/47 (10%)

Query: 49   RFPGDNCPLVIGECNHNFHVHCIQQWLETATAKGLCPMCRQQFSLKR 95
            + P   CP     CN+ +H  C+ +W  + +    CPMCR +   +R
Sbjct: 1527 KLPSKTCP----TCNNKYHGACLYKWFRS-SGNNTCPMCRSEIPFRR 1568

>SAKL0B06226g Chr2 (524855..529528) [4674 bp, 1557 aa] {ON} similar to
            uniprot|Q04781 Saccharomyces cerevisiae YMR247C
            Hypothetical ORF
          Length = 1557

 Score = 40.4 bits (93), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 15/47 (31%), Positives = 22/47 (46%), Gaps = 5/47 (10%)

Query: 49   RFPGDNCPLVIGECNHNFHVHCIQQWLETATAKGLCPMCRQQFSLKR 95
            + P   CP     CN+ FH  C+ +W  + +    CPMCR +    R
Sbjct: 1516 KLPTKTCP----TCNNKFHGACLYKWFRS-SGNNTCPMCRSEIPFNR 1557

>KLTH0F18502g Chr6 (1496235..1497038) [804 bp, 267 aa] {ON}
           conserved hypothetical protein
          Length = 267

 Score = 39.7 bits (91), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 47/94 (50%), Gaps = 20/94 (21%)

Query: 4   EFKKVYPVFSWSWDIPGDDNADKEIGDED-LCGICRVSYNGTCPGCRFPGDNCPLVIGEC 62
           EF +V+P   ++       +  K + DE+  C IC+  +N           N   V+G C
Sbjct: 86  EFCEVFPTTQYA-------SFRKNVSDEEESCVICQEQFNEL---------NNIRVLG-C 128

Query: 63  NHNFHVHCIQQWLETATAKGLCPMCRQQFSLKRG 96
           +H FH HCI +W+   +A   CP+C++ +SL  G
Sbjct: 129 SHIFHSHCIDRWICRNSA--CCPLCKRSYSLPVG 160

>TDEL0C02770 Chr3 complement(486107..486733) [627 bp, 208 aa] {ON}
           Anc_7.416 YER116C
          Length = 208

 Score = 39.7 bits (91), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 37/76 (48%), Gaps = 11/76 (14%)

Query: 45  CPGCRFPGDNCPLVIGECNHNFHVHCIQQWLETATA---KGLCPMCRQQFSLKRGVAINE 101
           CP C  P +N   VI  C H F V C+ Q L ++      GLC +CR      + VAI +
Sbjct: 139 CPICFDPPENS--VITPCGHTFCVSCLFQMLNSSRGPKKNGLCALCR------KSVAIRD 190

Query: 102 CQMDSLAKLLLQSQPA 117
            +M  L K  ++  P+
Sbjct: 191 IKMIKLKKKRVRKNPS 206

>NDAI0K00710 Chr11 (155351..160126) [4776 bp, 1591 aa] {ON} Anc_8.799
            YMR247C
          Length = 1591

 Score = 40.0 bits (92), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 14/47 (29%), Positives = 25/47 (53%), Gaps = 5/47 (10%)

Query: 49   RFPGDNCPLVIGECNHNFHVHCIQQWLETATAKGLCPMCRQQFSLKR 95
            + P   CP     C + FH  C+ +W ++ +    CP+CR + +L+R
Sbjct: 1550 KLPTKTCP----TCKNKFHGACLYKWFKS-SGNNTCPLCRSEIALRR 1591

>Kpol_480.25 s480 (57636..62351) [4716 bp, 1571 aa] {ON}
            (57636..62351) [4716 nt, 1572 aa]
          Length = 1571

 Score = 40.0 bits (92), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 14/47 (29%), Positives = 24/47 (51%), Gaps = 5/47 (10%)

Query: 49   RFPGDNCPLVIGECNHNFHVHCIQQWLETATAKGLCPMCRQQFSLKR 95
            + P   CP     C + FH  C+ +W  + +    CPMCR + +++R
Sbjct: 1530 KLPTKTCP----TCRNKFHGACLYKWFRS-SGNNTCPMCRSEIAIRR 1571

>Kwal_27.10546 s27 complement(386744..387058) [315 bp, 104 aa] {ON}
           YBR062C - Hypothetical ORF [contig 35] FULL
          Length = 104

 Score = 38.1 bits (87), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 38/82 (46%), Gaps = 15/82 (18%)

Query: 27  EIGDEDLCGICRVSYNGTCPGCRFPGDNCPLVIG--ECNHNFHVHCIQQWLETATAKGLC 84
           ++ D + C IC          C +  D  PLV+    CNH F + C+  WL  +     C
Sbjct: 28  KLKDAEACSIC---------CCNYRDDKYPLVVELPHCNHRFDLECVAVWLSKSRT---C 75

Query: 85  PMCRQQ-FSLKRGVAINECQMD 105
           P+CR    S K  V +++ +M+
Sbjct: 76  PLCRDDVLSHKPNVDVSQVEME 97

>Kpol_1023.32 s1023 complement(68737..72273) [3537 bp, 1178 aa] {ON}
           complement(68737..72273) [3537 nt, 1179 aa]
          Length = 1178

 Score = 39.7 bits (91), Expect = 0.001,   Method: Composition-based stats.
 Identities = 21/60 (35%), Positives = 29/60 (48%), Gaps = 4/60 (6%)

Query: 45  CPGCRF-PGDNCPLVIGECNHNFHVHCIQQWLETATAKGL---CPMCRQQFSLKRGVAIN 100
           CP C   P D   ++  EC H F   C+Q++ +    K L   CP CRQ  S  R + +N
Sbjct: 925 CPICTTEPIDANNIIFTECGHCFCESCLQEYFDFQVQKKLETKCPNCRQIISTNRVLKLN 984

>Ecym_7244 Chr7 complement(512748..514346) [1599 bp, 532 aa] {ON}
           similar to Ashbya gossypii AGL079C
          Length = 532

 Score = 39.3 bits (90), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 22/47 (46%), Gaps = 7/47 (14%)

Query: 44  TCPGC--RFPGDNCPLVIGECNHNFHVHCIQQWLETATAKGLCPMCR 88
           TCP C  R   D   L+   C H FH  C+ QW       G CP+CR
Sbjct: 234 TCPVCLERMDSDTTGLITTACQHTFHCQCLDQW-----KGGRCPVCR 275

>ZYRO0F12760g Chr6 complement(1037460..1042127) [4668 bp, 1555 aa]
            {ON} similar to uniprot|Q04781 Saccharomyces cerevisiae
            YMR247C Hypothetical ORF
          Length = 1555

 Score = 39.7 bits (91), Expect = 0.001,   Method: Composition-based stats.
 Identities = 14/47 (29%), Positives = 23/47 (48%), Gaps = 5/47 (10%)

Query: 49   RFPGDNCPLVIGECNHNFHVHCIQQWLETATAKGLCPMCRQQFSLKR 95
            + P   CP     CN+ FH  C+ +W  + +    CP+CR +   +R
Sbjct: 1514 KLPTKTCP----TCNNKFHGSCLYKWFRS-SGNNTCPLCRGEIPFRR 1555

>TBLA0F03280 Chr6 complement(805882..807549) [1668 bp, 555 aa]
          {ON} Anc_3.405 YPR093C
          Length = 555

 Score = 39.3 bits (90), Expect = 0.001,   Method: Composition-based stats.
 Identities = 19/47 (40%), Positives = 27/47 (57%), Gaps = 13/47 (27%)

Query: 54 NCPLVIGE----------CNHNFHVHCIQQWLETATAKGL-CPMCRQ 89
          NCP+ + +          C HNFH +CI+QW    T+K L CP+CR+
Sbjct: 4  NCPICLEDITDILGSLKVCQHNFHFNCIRQW--HLTSKSLECPVCRR 48

>KLTH0E13992g Chr5 (1234550..1239202) [4653 bp, 1550 aa] {ON} similar
            to uniprot|Q04781 Saccharomyces cerevisiae YMR247C
            Hypothetical ORF
          Length = 1550

 Score = 39.3 bits (90), Expect = 0.001,   Method: Composition-based stats.
 Identities = 14/47 (29%), Positives = 23/47 (48%), Gaps = 5/47 (10%)

Query: 49   RFPGDNCPLVIGECNHNFHVHCIQQWLETATAKGLCPMCRQQFSLKR 95
            + P   CP     CN+ FH  C+ +W  + +    CP+CR +   +R
Sbjct: 1509 KLPSKVCP----TCNNRFHGACLYKWFRS-SGNNTCPLCRSEIPFRR 1550

>Kwal_27.12327 s27 (1178866..1183590) [4725 bp, 1574 aa] {ON} YMR247C
            - Hypothetical ORF [contig 20] FULL
          Length = 1574

 Score = 38.9 bits (89), Expect = 0.002,   Method: Composition-based stats.
 Identities = 14/47 (29%), Positives = 23/47 (48%), Gaps = 5/47 (10%)

Query: 49   RFPGDNCPLVIGECNHNFHVHCIQQWLETATAKGLCPMCRQQFSLKR 95
            + P   CP     CN+ FH  C+ +W  + +    CP+CR +   +R
Sbjct: 1533 KLPSKVCP----TCNNRFHGACLYKWFRS-SGNNTCPLCRSEIPFRR 1574

>CAGL0K02563g Chr11 complement(231812..233572) [1761 bp, 586 aa]
           {ON} similar to uniprot|P38748 Saccharomyces cerevisiae
           YHL010c
          Length = 586

 Score = 38.9 bits (89), Expect = 0.002,   Method: Composition-based stats.
 Identities = 19/55 (34%), Positives = 25/55 (45%), Gaps = 8/55 (14%)

Query: 44  TCPGC--RFPGDNCPLVIGECNHNFHVHCIQQWLETATAKGLCPMCR-QQFSLKR 95
           TCP C  R   +   L+   C H FH  C+ +W  +      CP+CR   F L R
Sbjct: 246 TCPVCLERMDSETTGLITIPCQHTFHCQCLDKWKNSK-----CPVCRLSSFRLSR 295

>AGL217W Chr7 (290043..291287) [1245 bp, 414 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL054W (PSH1)
          Length = 414

 Score = 38.5 bits (88), Expect = 0.002,   Method: Composition-based stats.
 Identities = 21/79 (26%), Positives = 40/79 (50%), Gaps = 3/79 (3%)

Query: 56  PLVIGECNHNFHVHCIQQWLETATAKGL-CPMCRQQFSLKRGVAINECQ-MDSLAKLLLQ 113
           P++ G C HN+   CI  WL   ++  L CP CR   +    + +   Q +D+L ++L +
Sbjct: 48  PVMTG-CGHNYCYFCISNWLNNTSSTELNCPQCRSSITSMPSLNVTLQQNLDALIEVLDK 106

Query: 114 SQPAALTTEDQDMMMDQEF 132
           ++P  +   D +    +E+
Sbjct: 107 AEPEVIALLDANAKSLKEY 125

>Skud_2.186 Chr2 complement(334347..334867,334953..334968) [537 bp,
           178 aa] {ON} YBR062C (REAL)
          Length = 178

 Score = 38.1 bits (87), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 30/65 (46%), Gaps = 14/65 (21%)

Query: 26  KEIGDEDLCGICRVSYNGTCPGCRFPGDNCPLVIG--ECNHNFHVHCIQQWLETATAKGL 83
           K++   D C IC  +Y           D  PLV+    CNH F + C+  WL  +T    
Sbjct: 99  KKLNSTDNCSICYTNY---------LEDEYPLVVELPHCNHRFDLECLSVWLSRSTT--- 146

Query: 84  CPMCR 88
           CP+CR
Sbjct: 147 CPLCR 151

>AGR034W Chr7 (772766..773245) [480 bp, 159 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR062C
          Length = 159

 Score = 37.7 bits (86), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 32/72 (44%), Gaps = 14/72 (19%)

Query: 26  KEIGDEDLCGICRVSYNGTCPGCRFPGDNCPLVI--GECNHNFHVHCIQQWLETATAKGL 83
           K + + D C IC          C +  D  PLV+    C H F + C+  WL  +T    
Sbjct: 82  KRLAEGDNCAIC---------CCGYLEDEYPLVVELPNCGHTFDLQCVSVWLSRSTT--- 129

Query: 84  CPMCRQQFSLKR 95
           CPMCR    +++
Sbjct: 130 CPMCRSDVLVRK 141

>Ecym_7418 Chr7 (853469..858112) [4644 bp, 1547 aa] {ON} similar to
            Ashbya gossypii ABL058C
          Length = 1547

 Score = 38.5 bits (88), Expect = 0.002,   Method: Composition-based stats.
 Identities = 18/60 (30%), Positives = 28/60 (46%), Gaps = 6/60 (10%)

Query: 37   CRVSYNGTCPGCR-FPGDNCPLVIGECNHNFHVHCIQQWLETATAKGLCPMCRQQFSLKR 95
            C + Y+   P  R  P   CP     CN+ FH  C+ +W  + +    CP+CR +   +R
Sbjct: 1493 CAICYSILHPVDRKLPTKVCP----TCNNRFHGACLYKWFRS-SGNNSCPLCRSEIPFRR 1547

>TBLA0G02310 Chr7 (598514..600538) [2025 bp, 674 aa] {ON} Anc_2.542
           YHL010C
          Length = 674

 Score = 38.5 bits (88), Expect = 0.002,   Method: Composition-based stats.
 Identities = 19/65 (29%), Positives = 30/65 (46%), Gaps = 8/65 (12%)

Query: 44  TCPGC--RFPGDNCPLVIGECNHNFHVHCIQQWLETATAKGLCPMCR-QQFSLKRGVAIN 100
           +CP C  R       L+   C H FH  C+ +W  +      CP+CR     + R + IN
Sbjct: 282 SCPVCLERMDSSITGLITIPCQHTFHCQCLNKWKNSK-----CPICRFSTLRISRDLVIN 336

Query: 101 ECQMD 105
           + Q++
Sbjct: 337 KKQVN 341

>TDEL0B00980 Chr2 (181064..185743) [4680 bp, 1559 aa] {ON} Anc_8.799
            YMR247C
          Length = 1559

 Score = 38.5 bits (88), Expect = 0.003,   Method: Composition-based stats.
 Identities = 13/47 (27%), Positives = 23/47 (48%), Gaps = 5/47 (10%)

Query: 49   RFPGDNCPLVIGECNHNFHVHCIQQWLETATAKGLCPMCRQQFSLKR 95
            + P   CP     CN+ FH  C+ +W  + +    CP+CR +   ++
Sbjct: 1518 KLPTKTCP----TCNNKFHGACLYKWFRS-SGNNTCPLCRSEIPFRK 1559

>AGL079C Chr7 complement(557422..558942) [1521 bp, 506 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHL010C
          Length = 506

 Score = 38.1 bits (87), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 22/47 (46%), Gaps = 7/47 (14%)

Query: 44  TCPGC--RFPGDNCPLVIGECNHNFHVHCIQQWLETATAKGLCPMCR 88
           TCP C  R   D   L+   C H FH  C+ +W       G CP+CR
Sbjct: 211 TCPVCLERMDSDTTGLITTACQHTFHCQCLDKW-----KDGRCPVCR 252

>KNAG0J00850 Chr10 complement(146187..146675) [489 bp, 162 aa] {ON}
           Anc_3.279 YBR062C
          Length = 162

 Score = 37.4 bits (85), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 26/55 (47%), Gaps = 7/55 (12%)

Query: 38  RVSYNGTCPGC--RFPGDNCPLV--IGECNHNFHVHCIQQWLETATAKGLCPMCR 88
           +V    TC  C  RF  DN PL+  +  C H F + CI  WL        CPMCR
Sbjct: 85  KVPLTDTCSICFERFGNDNYPLLAQLPHCGHIFDLQCISMWLSNQVT---CPMCR 136

>NCAS0A04680 Chr1 complement(932306..933130) [825 bp, 274 aa] {ON} 
          Length = 274

 Score = 37.7 bits (86), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 30/63 (47%), Gaps = 22/63 (34%)

Query: 32  DLCGICRVSYNG------TCPGCRFPGDNCPLVIGECNHNFHVHCIQQWLETATAKGLCP 85
           D C ICR++Y+       TC             +  C+H+FH  CI+ WL+      LCP
Sbjct: 208 DECPICRIAYSDDFETEITC-------------LPNCSHHFHFECIKLWLQ---KNSLCP 251

Query: 86  MCR 88
           +CR
Sbjct: 252 LCR 254

>NDAI0A07450 Chr1 complement(1699546..1700051,1700150..1700165) [522
           bp, 173 aa] {ON} Anc_3.279 YBR062C
          Length = 173

 Score = 37.4 bits (85), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 31/61 (50%), Gaps = 6/61 (9%)

Query: 48  CRFPGDNCPLV--IGECNHNFHVHCIQQWLETATAKGLCPMCRQQ-FSLKRGVAINECQM 104
           C+F  D  PLV  +  C H F + CI  WL  +     CP+CR    S K  + +++ +M
Sbjct: 109 CKFLEDKYPLVAELPHCGHRFDLECISVWLSKSDT---CPLCRDSVLSHKTDIDVSKTEM 165

Query: 105 D 105
           +
Sbjct: 166 E 166

>Suva_13.432 Chr13 complement(744705..749384) [4680 bp, 1559 aa] {ON}
            YMR247C (REAL)
          Length = 1559

 Score = 38.1 bits (87), Expect = 0.004,   Method: Composition-based stats.
 Identities = 13/47 (27%), Positives = 22/47 (46%), Gaps = 5/47 (10%)

Query: 49   RFPGDNCPLVIGECNHNFHVHCIQQWLETATAKGLCPMCRQQFSLKR 95
            + P   CP     C + FH  C+ +W  + +    CP+CR +   +R
Sbjct: 1518 KLPSKTCP----TCKNKFHGACLYKWFRS-SGNNTCPLCRSEIPFRR 1559

>YMR247C Chr13 complement(763351..768039) [4689 bp, 1562 aa] {ON}
            RKR1RING domain E3 ubiquitin ligase; involved in the
            ubiquitin-mediated degradation of non-stop proteins;
            functional connections to chromatin modification; nuclear
            protein that also co-localizes with ribosomes; homolog of
            mouse Listerin, whose mutation has been reported to cause
            neurodegeneration in mice
          Length = 1562

 Score = 38.1 bits (87), Expect = 0.004,   Method: Composition-based stats.
 Identities = 13/47 (27%), Positives = 22/47 (46%), Gaps = 5/47 (10%)

Query: 49   RFPGDNCPLVIGECNHNFHVHCIQQWLETATAKGLCPMCRQQFSLKR 95
            + P   CP     C + FH  C+ +W  + +    CP+CR +   +R
Sbjct: 1521 KLPSKTCP----TCKNKFHGACLYKWFRS-SGNNTCPLCRSEIPFRR 1562

>Skud_13.419 Chr13 complement(738148..742842) [4695 bp, 1564 aa] {ON}
            YMR247C (REAL)
          Length = 1564

 Score = 38.1 bits (87), Expect = 0.004,   Method: Composition-based stats.
 Identities = 13/47 (27%), Positives = 22/47 (46%), Gaps = 5/47 (10%)

Query: 49   RFPGDNCPLVIGECNHNFHVHCIQQWLETATAKGLCPMCRQQFSLKR 95
            + P   CP     C + FH  C+ +W  + +    CP+CR +   +R
Sbjct: 1523 KLPSKTCP----TCKNKFHGACLYKWFRS-SGNNTCPLCRSEIPFRR 1564

>KAFR0A01990 Chr1 (418279..419961) [1683 bp, 560 aa] {ON} Anc_2.542
           YHL010C
          Length = 560

 Score = 37.7 bits (86), Expect = 0.004,   Method: Composition-based stats.
 Identities = 18/55 (32%), Positives = 25/55 (45%), Gaps = 8/55 (14%)

Query: 44  TCPGC--RFPGDNCPLVIGECNHNFHVHCIQQWLETATAKGLCPMCR-QQFSLKR 95
           TCP C  R   +   L+   C H FH  C+ +W  +      CP+CR   F + R
Sbjct: 240 TCPVCLERMDSETTGLITIPCQHTFHCQCLDKWKNSQ-----CPVCRYSSFRISR 289

>KNAG0A07430 Chr1 complement(1165740..1166048) [309 bp, 102 aa]
          {ON} Anc_3.405 YPR093C
          Length = 102

 Score = 36.2 bits (82), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 20/32 (62%), Gaps = 3/32 (9%)

Query: 62 CNHNFHVHCIQQWLETATA---KGLCPMCRQQ 90
          C+H FH  CI++W  T T    + LCP CR+Q
Sbjct: 29 CHHKFHSDCIRKWHTTTTGEIRRPLCPFCREQ 60

>Smik_13.460 Chr13 complement(747753..752453) [4701 bp, 1566 aa] {ON}
            YMR247C (REAL)
          Length = 1566

 Score = 37.7 bits (86), Expect = 0.004,   Method: Composition-based stats.
 Identities = 13/47 (27%), Positives = 22/47 (46%), Gaps = 5/47 (10%)

Query: 49   RFPGDNCPLVIGECNHNFHVHCIQQWLETATAKGLCPMCRQQFSLKR 95
            + P   CP     C + FH  C+ +W  + +    CP+CR +   +R
Sbjct: 1525 KLPSKTCP----TCKNRFHGACLYKWFRS-SGNNTCPLCRSEIPFRR 1566

>KNAG0J00540 Chr10 (86360..91045) [4686 bp, 1561 aa] {ON} Anc_8.799
            YMR247C
          Length = 1561

 Score = 37.7 bits (86), Expect = 0.004,   Method: Composition-based stats.
 Identities = 13/47 (27%), Positives = 22/47 (46%), Gaps = 5/47 (10%)

Query: 49   RFPGDNCPLVIGECNHNFHVHCIQQWLETATAKGLCPMCRQQFSLKR 95
            + P   CP     C + FH  C+ +W  + +    CP+CR +   +R
Sbjct: 1520 KLPNKTCP----TCKNRFHGACLYKWFRS-SGNNTCPLCRNEIPFRR 1561

>NCAS0A04120 Chr1 complement(833424..836837) [3414 bp, 1137 aa] {ON}
           Anc_2.411
          Length = 1137

 Score = 37.7 bits (86), Expect = 0.004,   Method: Composition-based stats.
 Identities = 22/76 (28%), Positives = 33/76 (43%), Gaps = 14/76 (18%)

Query: 46  PGCRFPGDNC--------PL---VIGECNHNFHVHCIQQWLETATAKGL---CPMCRQQF 91
           P   FP   C        PL   V  EC H F   CI+++ E    K L   CP CR+Q 
Sbjct: 875 PQIDFPALECSICTTDPIPLDKIVFTECGHPFCESCIEEYFEFQAGKNLELKCPNCREQI 934

Query: 92  SLKRGVAINECQMDSL 107
           +  R + + + + ++ 
Sbjct: 935 NSNRLLTVEKIEAETF 950

>NCAS0C00680 Chr3 (109845..114539) [4695 bp, 1564 aa] {ON} Anc_8.799
            YMR247C
          Length = 1564

 Score = 37.7 bits (86), Expect = 0.005,   Method: Composition-based stats.
 Identities = 14/47 (29%), Positives = 22/47 (46%), Gaps = 5/47 (10%)

Query: 49   RFPGDNCPLVIGECNHNFHVHCIQQWLETATAKGLCPMCRQQFSLKR 95
            + P   CP     C + FH  C+ +W  + +    CP+CR +  L R
Sbjct: 1523 KLPTKTCP----TCKNKFHGACLYKWFRS-SGNNTCPLCRSEIPLHR 1564

>TDEL0A03180 Chr1 (569298..571001) [1704 bp, 567 aa] {ON} Anc_2.542
           YHL010C
          Length = 567

 Score = 37.4 bits (85), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 26/61 (42%), Gaps = 8/61 (13%)

Query: 44  TCPGC--RFPGDNCPLVIGECNHNFHVHCIQQWLETATAKGLCPMCR-QQFSLKRGVAIN 100
           TCP C  R   D   L+   C H FH  C+ +W         CP+CR     L R  A+ 
Sbjct: 233 TCPVCLERMDSDTTGLITIPCQHTFHCQCLDKW-----KNSRCPVCRYSSIRLSRNSAVR 287

Query: 101 E 101
           +
Sbjct: 288 Q 288

>KLLA0C15697g Chr3 (1360289..1361203) [915 bp, 304 aa] {ON}
          similar to uniprot|Q06834 Saccharomyces cerevisiae
          YPR093C ASR1 Protein involved in a putative alcohol-
          responsive signaling pathway accumulates in the nucleus
          under alcohol stress contains a Ring/PHD finger domain
          Length = 304

 Score = 37.4 bits (85), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 32/65 (49%), Gaps = 12/65 (18%)

Query: 32 DLCGICRVSYNGTCPGCRFPGDNCPLVIGECNHNFHVHCIQQWLETATAKGLCPMCRQQF 91
          ++CGIC  S N T  G   P          C H +HV CI++W    +    CP CR++ 
Sbjct: 3  EICGICLESMNETDQGELLP----------CEHRYHVSCIRKW-HLYSNDFKCPTCRKES 51

Query: 92 -SLKR 95
           SL+R
Sbjct: 52 KSLRR 56

>Kpol_1052.19 s1052 (60008..60319) [312 bp, 103 aa] {ON}
          (60008..60319) [312 nt, 104 aa]
          Length = 103

 Score = 35.8 bits (81), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 24/52 (46%), Gaps = 5/52 (9%)

Query: 48 CRFPGDNCPLV--IGECNHNFHVHCIQQWLETATAKGLCPMCRQQFSLKRGV 97
          C +  D  PL+  +  C HNF   C+  WL   +    CPMCR   +  + V
Sbjct: 39 CTYADDKYPLISKLPHCGHNFDYECLSIWL---SKNKTCPMCRDDITSHKEV 87

>NCAS0B06990 Chr2 complement(1330221..1331786) [1566 bp, 521 aa]
           {ON} Anc_2.157 YHR115C
          Length = 521

 Score = 37.4 bits (85), Expect = 0.006,   Method: Composition-based stats.
 Identities = 25/105 (23%), Positives = 40/105 (38%), Gaps = 26/105 (24%)

Query: 1   MKIEFKKVYPVFSWSWDIPGDDNADKEIGDEDLCGICRVSYNGTCPGCRFPGDNC----- 55
           MKIE          SW +P       +        + +V ++G  P      DNC     
Sbjct: 306 MKIELND-------SWKLP-----KTQFSTNAFKNVKKVLFSGDEPNAT---DNCSLCLS 350

Query: 56  ------PLVIGECNHNFHVHCIQQWLETATAKGLCPMCRQQFSLK 94
                 P+ I  C+H++H  C++  +        CP C+ QF L+
Sbjct: 351 KITEGKPIFISPCSHHWHYKCVKDLITVEYPFFFCPTCKNQFDLE 395

>KAFR0C00460 Chr3 complement(94989..95446,95522..95537) [474 bp, 157
           aa] {ON} Anc_3.279 YBR062C
          Length = 157

 Score = 36.2 bits (82), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 35/76 (46%), Gaps = 14/76 (18%)

Query: 32  DLCGICRVSYNGTCPGCRFPGDNCPLVI--GECNHNFHVHCIQQWLETATAKGLCPMCRQ 89
           DLC IC  +         F  D  PLVI    C+H F + CI  WL   ++   CP+CR 
Sbjct: 85  DLCSICFEN---------FREDEYPLVIELPHCSHKFDLQCISVWL---SSNSTCPVCRD 132

Query: 90  QFSLKRGVAINECQMD 105
           + +    + I+  + +
Sbjct: 133 KVNHNAKLDIDTTEAE 148

>KLLA0C05874g Chr3 complement(520079..521740) [1662 bp, 553 aa] {ON}
           weakly similar to uniprot|Q08109 Saccharomyces
           cerevisiae YOL013C HRD1 Ubiquitin-protein ligase
           required for endoplasmic reticulum-associated
           degradation (ERAD) of misfolded proteins genetically
           linked to the unfolded protein response (UPR) regulated
           through association with Hrd3p contains an H2 ring
           finger
          Length = 553

 Score = 37.0 bits (84), Expect = 0.008,   Method: Composition-based stats.
 Identities = 17/62 (27%), Positives = 29/62 (46%), Gaps = 6/62 (9%)

Query: 27  EIGDEDLCGICRVSYNGTCPGCRFPGDNCPLVIGECNHNFHVHCIQQWLETATAKGLCPM 86
           E G+ D+C +C   +    P  +   D   + I  C H  H+ C++ W+  +     CP+
Sbjct: 346 ESGEIDICIVCMEDF---LPSHQRKSDGKKVKILPCTHALHLSCLKNWIARSPT---CPI 399

Query: 87  CR 88
           CR
Sbjct: 400 CR 401

>ABL058C Chr2 complement(288353..292993) [4641 bp, 1546 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YMR247C
          Length = 1546

 Score = 36.6 bits (83), Expect = 0.010,   Method: Composition-based stats.
 Identities = 13/47 (27%), Positives = 24/47 (51%), Gaps = 5/47 (10%)

Query: 49   RFPGDNCPLVIGECNHNFHVHCIQQWLETATAKGLCPMCRQQFSLKR 95
            + P   CP     C++ FH  C+ +W ++ +    CP+CR +   +R
Sbjct: 1505 KLPSKVCP----TCSNRFHGACLYKWFKS-SGNNTCPLCRGEIPFRR 1546

>KAFR0F00740 Chr6 (144375..145907) [1533 bp, 510 aa] {ON} Anc_2.157
           YHR115C
          Length = 510

 Score = 36.6 bits (83), Expect = 0.011,   Method: Composition-based stats.
 Identities = 20/77 (25%), Positives = 37/77 (48%), Gaps = 10/77 (12%)

Query: 30  DEDLCGICRVSYNGTCPGCRFPGDNCPLVIGECNHNFHVHCIQQWLETATAKGLCPMCRQ 89
           D++ C IC +S    C           + I  C+H++H HCI++ +  +  + +CP CR 
Sbjct: 399 DQEDCSIC-LSKIKPCQA---------IFISPCSHSWHFHCIRRLVMVSYPQFVCPNCRA 448

Query: 90  QFSLKRGVAINECQMDS 106
              L+  +   + + DS
Sbjct: 449 SCDLEATLESEDGEEDS 465

>ZYRO0B02244g Chr2 (186386..188077) [1692 bp, 563 aa] {ON} similar
           to uniprot|P38748 YHL010C Saccharomyces cerevisiae
           Hypothetical ORF
          Length = 563

 Score = 36.6 bits (83), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 22/47 (46%), Gaps = 7/47 (14%)

Query: 44  TCPGC--RFPGDNCPLVIGECNHNFHVHCIQQWLETATAKGLCPMCR 88
           TCP C  R   D   L+   C H FH  C+ +W  +      CP+CR
Sbjct: 233 TCPVCLERMDSDTTGLITIPCQHTFHCQCLDKWKNSK-----CPVCR 274

>KAFR0B03620 Chr2 complement(752307..756989) [4683 bp, 1560 aa] {ON}
            Anc_8.799 YMR247C
          Length = 1560

 Score = 36.6 bits (83), Expect = 0.012,   Method: Composition-based stats.
 Identities = 12/47 (25%), Positives = 22/47 (46%), Gaps = 5/47 (10%)

Query: 49   RFPGDNCPLVIGECNHNFHVHCIQQWLETATAKGLCPMCRQQFSLKR 95
            + P   CP     C + FH  C+ +W  + +    CP+CR +   ++
Sbjct: 1519 KLPSKTCP----TCKNRFHGACLYKWFRS-SGNNTCPLCRSEIPFRK 1560

>TPHA0A03990 Chr1 (887214..887741) [528 bp, 175 aa] {ON} Anc_3.279
           YBR062C
          Length = 175

 Score = 35.4 bits (80), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 26/52 (50%), Gaps = 5/52 (9%)

Query: 48  CRFPGDNCPLV--IGECNHNFHVHCIQQWLETATAKGLCPMCRQQFSLKRGV 97
           C++  D+ PL+  +  C H+F   CI  WL   +    CP+CR   +  + V
Sbjct: 111 CKYTDDDYPLIAQLPHCGHHFDFECISIWL---SKNETCPICRDNLTSHKEV 159

>TBLA0H00230 Chr8 complement(31016..35017) [4002 bp, 1333 aa] {ON}
            Anc_3.22 YOL138C
          Length = 1333

 Score = 36.2 bits (82), Expect = 0.016,   Method: Composition-based stats.
 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 1/42 (2%)

Query: 34   CGICRVSYNGTCPGCRFPGDNCPLVIGECNHNFHVHCIQQWL 75
            C  CR   N  C  C  P     + + EC H FH  C QQW 
Sbjct: 1275 CDSCRKP-NTLCVICEQPMKKLAICLLECGHEFHFECGQQWF 1315

>KNAG0A07090 Chr1 complement(1110424..1112712) [2289 bp, 762 aa]
           {ON} Anc_2.545 YKL034W
          Length = 762

 Score = 35.8 bits (81), Expect = 0.017,   Method: Composition-based stats.
 Identities = 13/36 (36%), Positives = 20/36 (55%), Gaps = 3/36 (8%)

Query: 53  DNCPLVIGECNHNFHVHCIQQWLETATAKGLCPMCR 88
           D    ++  CNH FH  C++ W+   + K  CP+CR
Sbjct: 724 DQYSYMVTPCNHIFHTECLENWM---SYKLQCPVCR 756

>Kwal_55.20318 s55 complement(347619..350318) [2700 bp, 899 aa] {ON}
           YMR231W (PEP5) - peripheral vaculor membrane protein;
           putative Zn-finger protein [contig 151] PARTIAL
          Length = 899

 Score = 35.8 bits (81), Expect = 0.018,   Method: Composition-based stats.
 Identities = 23/67 (34%), Positives = 34/67 (50%), Gaps = 5/67 (7%)

Query: 54  NCPLVIGECNHNFHVHCI--QQWLETATAKGLCPMCRQQFSLKRGV--AINECQMDS-LA 108
           N P+V  +C H +H  C+  ++ LE  +    CP C   F    G+  A  + QMD+ L 
Sbjct: 808 NAPIVYFKCGHIYHQRCLNEEESLERGSRFFKCPQCVIDFETSEGMKNAQIKAQMDADLL 867

Query: 109 KLLLQSQ 115
           KL L+ Q
Sbjct: 868 KLALKDQ 874

>ABR104W Chr2 (574068..575054) [987 bp, 328 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR093C
          Length = 328

 Score = 35.8 bits (81), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 39/78 (50%), Gaps = 10/78 (12%)

Query: 62  CNHNFHVHCIQQWLETATAKGLCPMCRQQFSLKRGVAINECQMD-SLAKLL--------L 112
           C H +H+ CI++W    +    CP+CR + S+      +E ++D S+ +LL        +
Sbjct: 35  CGHEYHLACIRKWFHLHSGNRSCPVCRTEASVLVDTD-HEVKIDLSVGQLLDFYGLLDEI 93

Query: 113 QSQPAALTTEDQDMMMDQ 130
            SQ  A+T +D     D+
Sbjct: 94  GSQLLAITLQDHSTQDDE 111

>Suva_16.420 Chr16 complement(726959..727831) [873 bp, 290 aa] {ON}
           YPR093C (REAL)
          Length = 290

 Score = 35.4 bits (80), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 41/85 (48%), Gaps = 8/85 (9%)

Query: 45  CPGCRFPGDNCPLVIG---ECNHNFHVHCIQQWLETATAKGLCPMCRQQFS-LKRGVAIN 100
           CP C F GD      G    C H FH++CI++W + +     CP+CR + S LK G   N
Sbjct: 4   CPIC-FEGDQDGEQFGCLEVCRHEFHLNCIREWHKYSIDLK-CPICRTESSHLKVGEGQN 61

Query: 101 ECQMDSLAKLLLQS--QPAALTTED 123
              +D     +++   + A  TT D
Sbjct: 62  AVSVDLKMGFMIKHALEHAEATTTD 86

>YBR062C Chr2 complement(365976..366502,366585..366600) [543 bp, 180
           aa] {ON} Protein of unknown function that interacts with
           Msb2p; may play a role in activation of the filamentous
           growth pathway.
          Length = 180

 Score = 35.0 bits (79), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 30/65 (46%), Gaps = 14/65 (21%)

Query: 26  KEIGDEDLCGICRVSYNGTCPGCRFPGDNCPLVIG--ECNHNFHVHCIQQWLETATAKGL 83
           K++   D C IC  +Y           D  PLV+    C+H F + C+  WL  +T    
Sbjct: 101 KKLKATDNCSICYTNY---------LEDEYPLVVELPHCHHKFDLECLSVWLSRSTT--- 148

Query: 84  CPMCR 88
           CP+CR
Sbjct: 149 CPLCR 153

>Suva_11.189 Chr11 (354713..356989) [2277 bp, 758 aa] {ON} YKL034W
           (REAL)
          Length = 758

 Score = 35.4 bits (80), Expect = 0.024,   Method: Composition-based stats.
 Identities = 13/36 (36%), Positives = 20/36 (55%), Gaps = 3/36 (8%)

Query: 53  DNCPLVIGECNHNFHVHCIQQWLETATAKGLCPMCR 88
           D    ++  CNH FH  C++ W+   + K  CP+CR
Sbjct: 720 DQHSYMVTPCNHVFHTSCLENWM---SYKLQCPVCR 752

>TBLA0H00320 Chr8 complement(56811..60716) [3906 bp, 1301 aa] {ON}
            Anc_2.411 YLR032W
          Length = 1301

 Score = 35.4 bits (80), Expect = 0.025,   Method: Composition-based stats.
 Identities = 19/62 (30%), Positives = 29/62 (46%), Gaps = 4/62 (6%)

Query: 42   NGTCPGCRF-PGDNCPLVIGECNHNFHVHCIQQWLETATAKGL---CPMCRQQFSLKRGV 97
            N  CP C   P D    +  EC H F   C++ +L+  + KG    CP CR++    R +
Sbjct: 1043 NMECPICTTDPIDFTDSLFTECGHAFCKSCLEDYLKFQSEKGRDHNCPTCRKEIDSDRLI 1102

Query: 98   AI 99
             +
Sbjct: 1103 TL 1104

>SAKL0E01958g Chr5 (149087..150661) [1575 bp, 524 aa] {ON} similar
           to uniprot|Q08109 Saccharomyces cerevisiae YOL013C HRD1
           Ubiquitin-protein ligase required for endoplasmic
           reticulum-associated degradation (ERAD) of misfolded
           proteins genetically linked to the unfolded protein
           response (UPR) regulated through association with Hrd3p
           contains an H2 ring finger
          Length = 524

 Score = 35.4 bits (80), Expect = 0.025,   Method: Composition-based stats.
 Identities = 16/45 (35%), Positives = 24/45 (53%), Gaps = 6/45 (13%)

Query: 62  CNHNFHVHCIQQWLETATAKGLCPMCRQQFSLKRGVAINECQMDS 106
           C H  H+ C++ W+E +     CP+CR     +RG   N  +MDS
Sbjct: 337 CGHILHLSCLKSWMERSQT---CPICRLPVFDERG---NVTRMDS 375

>KAFR0B01460 Chr2 (277155..279440) [2286 bp, 761 aa] {ON} Anc_2.545
           YKL034W
          Length = 761

 Score = 35.4 bits (80), Expect = 0.027,   Method: Composition-based stats.
 Identities = 13/36 (36%), Positives = 20/36 (55%), Gaps = 3/36 (8%)

Query: 53  DNCPLVIGECNHNFHVHCIQQWLETATAKGLCPMCR 88
           D    ++  CNH FH  C++ W+   + K  CP+CR
Sbjct: 723 DQHSYMVTPCNHIFHTSCLENWM---SYKLQCPVCR 755

>KAFR0I02090 Chr9 complement(427023..431423) [4401 bp, 1466 aa] {ON}
            Anc_1.389 YLR247C
          Length = 1466

 Score = 35.4 bits (80), Expect = 0.028,   Method: Composition-based stats.
 Identities = 15/44 (34%), Positives = 23/44 (52%), Gaps = 11/44 (25%)

Query: 54   NCPLVIG--------ECNHNFHVHCIQQWLETATAKGLCPMCRQ 89
            NCP+ +         +C H F  HCI  WL+    K +CP+C++
Sbjct: 1150 NCPICLNTIYMGSIIKCGHFFCKHCIFSWLKN---KSVCPICKK 1190

>Kpol_505.18 s505 complement(48530..50287) [1758 bp, 585 aa] {ON}
           complement(48530..50287) [1758 nt, 586 aa]
          Length = 585

 Score = 35.4 bits (80), Expect = 0.028,   Method: Composition-based stats.
 Identities = 18/64 (28%), Positives = 31/64 (48%), Gaps = 10/64 (15%)

Query: 30  DEDLCGICRVSYNGTCPGCRFPGDNCPLVIGECNHNFHVHCIQQWLETATAKGLCPMCRQ 89
           +E+ C IC +S    C           + I  C+H++H HCI++ +  +  + +CP CR 
Sbjct: 498 EEEDCSIC-LSAIKPCQA---------IFISPCSHSWHFHCIRRLVMMSYPQFVCPNCRS 547

Query: 90  QFSL 93
              L
Sbjct: 548 SCDL 551

>Suva_8.42 Chr8 complement(84493..86250) [1758 bp, 585 aa] {ON}
           YHL010C (REAL)
          Length = 585

 Score = 35.4 bits (80), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 21/48 (43%), Gaps = 7/48 (14%)

Query: 44  TCPGC--RFPGDNCPLVIGECNHNFHVHCIQQWLETATAKGLCPMCRQ 89
           TCP C  R   +   LV   C H FH  C+ +W         CP+CR 
Sbjct: 239 TCPVCLERMDSETSGLVTIPCQHTFHCQCLNKW-----KNSRCPVCRH 281

>TBLA0I01490 Chr9 (322980..325232) [2253 bp, 750 aa] {ON} Anc_2.545
           YKL034W
          Length = 750

 Score = 35.4 bits (80), Expect = 0.029,   Method: Composition-based stats.
 Identities = 13/31 (41%), Positives = 19/31 (61%), Gaps = 3/31 (9%)

Query: 58  VIGECNHNFHVHCIQQWLETATAKGLCPMCR 88
           +I  CNH FH  C++ W+   + K  CP+CR
Sbjct: 717 MITPCNHIFHTTCLENWM---SYKLQCPVCR 744

>Kpol_1002.7 s1002 (19006..21270) [2265 bp, 754 aa] {ON}
           (19006..21270) [2265 nt, 755 aa]
          Length = 754

 Score = 35.4 bits (80), Expect = 0.030,   Method: Composition-based stats.
 Identities = 13/32 (40%), Positives = 18/32 (56%), Gaps = 3/32 (9%)

Query: 57  LVIGECNHNFHVHCIQQWLETATAKGLCPMCR 88
            +I  CNH FH  C++ W+     K  CP+CR
Sbjct: 720 FMITPCNHVFHTQCLENWM---GYKLQCPVCR 748

>YHL010C Chr8 complement(81964..83721) [1758 bp, 585 aa] {ON}
           ETP1Putative protein of unknown function that is
           required for growth on ethanol; contains a zinc finger
           region and has homology to human BRAP2, which is a
           cytoplasmic protein that binds nuclear localization
           sequences
          Length = 585

 Score = 35.0 bits (79), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 21/48 (43%), Gaps = 7/48 (14%)

Query: 44  TCPGC--RFPGDNCPLVIGECNHNFHVHCIQQWLETATAKGLCPMCRQ 89
           TCP C  R   +   LV   C H FH  C+ +W         CP+CR 
Sbjct: 239 TCPVCLERMDSETTGLVTIPCQHTFHCQCLNKW-----KNSRCPVCRH 281

>CAGL0A03432g Chr1 (349884..353339) [3456 bp, 1151 aa] {ON} similar
           to uniprot|P32849 Saccharomyces cerevisiae YLR032w RAD5
          Length = 1151

 Score = 35.4 bits (80), Expect = 0.031,   Method: Composition-based stats.
 Identities = 26/92 (28%), Positives = 40/92 (43%), Gaps = 17/92 (18%)

Query: 34  CGICRVSYNGTCPGCRFPGDNCPLVIGECNHNFHVHCIQQWLETATAKGL---CPMCRQQ 90
           C IC             P ++   V+ EC H F   C++++      K L   CP CR+ 
Sbjct: 897 CSICTAE----------PIESSSAVVTECEHVFCKECLEEYGNFQKEKSLQQKCPNCRRD 946

Query: 91  FSLKRGVAINECQMDSLAKLL---LQSQPAAL 119
            +L R +A  E   D + KL+    + +PA L
Sbjct: 947 INLNRCLAF-EKGSDGILKLIHFDRKERPAKL 977

>Smik_8.32 Chr8 complement(65542..67299) [1758 bp, 585 aa] {ON}
           YHL010C (REAL)
          Length = 585

 Score = 35.0 bits (79), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 21/48 (43%), Gaps = 7/48 (14%)

Query: 44  TCPGC--RFPGDNCPLVIGECNHNFHVHCIQQWLETATAKGLCPMCRQ 89
           TCP C  R   +   LV   C H FH  C+ +W         CP+CR 
Sbjct: 239 TCPVCLERMDSETTGLVTIPCQHTFHCQCLNKW-----KNSRCPVCRH 281

>Skud_8.35 Chr8 complement(70011..71768) [1758 bp, 585 aa] {ON}
           YHL010C (REAL)
          Length = 585

 Score = 35.0 bits (79), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 21/48 (43%), Gaps = 7/48 (14%)

Query: 44  TCPGC--RFPGDNCPLVIGECNHNFHVHCIQQWLETATAKGLCPMCRQ 89
           TCP C  R   +   LV   C H FH  C+ +W         CP+CR 
Sbjct: 239 TCPVCLERMDSETTGLVTIPCQHTFHCQCLNKW-----KNSRCPVCRH 281

>Ecym_5445 Chr5 complement(920562..921527) [966 bp, 321 aa] {ON}
          similar to Ashbya gossypii ABR104W
          Length = 321

 Score = 35.0 bits (79), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 23/45 (51%), Gaps = 2/45 (4%)

Query: 45 CPGC-RFPGDNCPLVIGECNHNFHVHCIQQWLETATAKGLCPMCR 88
          CP C     DN   +I  C H FH+ CI++W  +  +   CP CR
Sbjct: 9  CPICWDSMADNVAKLIP-CQHEFHLSCIRKWYHSRISDRTCPNCR 52

>TBLA0B00560 Chr2 (111412..112890) [1479 bp, 492 aa] {ON} Anc_6.45
           YOL013C
          Length = 492

 Score = 35.0 bits (79), Expect = 0.036,   Method: Composition-based stats.
 Identities = 11/27 (40%), Positives = 17/27 (62%), Gaps = 3/27 (11%)

Query: 62  CNHNFHVHCIQQWLETATAKGLCPMCR 88
           C H  H++C++ W+E +     CPMCR
Sbjct: 352 CGHILHMNCLKNWMERSQT---CPMCR 375

>Smik_11.213 Chr11 (358262..360541) [2280 bp, 759 aa] {ON} YKL034W
           (REAL)
          Length = 759

 Score = 35.0 bits (79), Expect = 0.036,   Method: Composition-based stats.
 Identities = 13/36 (36%), Positives = 20/36 (55%), Gaps = 3/36 (8%)

Query: 53  DNCPLVIGECNHNFHVHCIQQWLETATAKGLCPMCR 88
           D    ++  CNH FH  C++ W+   + K  CP+CR
Sbjct: 721 DQHSYMVTPCNHVFHTPCLENWM---SYKLQCPVCR 753

>SAKL0A09746g Chr1 (858392..860038) [1647 bp, 548 aa] {ON} similar
           to uniprot|P38748 Saccharomyces cerevisiae YHL010C
           Hypothetical ORF
          Length = 548

 Score = 35.0 bits (79), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 26/56 (46%), Gaps = 8/56 (14%)

Query: 44  TCPGC--RFPGDNCPLVIGECNHNFHVHCIQQWLETATAKGLCPMCR-QQFSLKRG 96
           +CP C  R   D   L+   C H FH  C+ +W ++      CP+CR     L RG
Sbjct: 236 SCPVCLERMDSDITGLITIPCQHTFHCQCLDKWKDSR-----CPVCRYSNLKLTRG 286

>TPHA0F01840 Chr6 complement(422396..423961) [1566 bp, 521 aa] {ON}
           Anc_2.157 YHR115C
          Length = 521

 Score = 35.0 bits (79), Expect = 0.038,   Method: Composition-based stats.
 Identities = 20/76 (26%), Positives = 37/76 (48%), Gaps = 21/76 (27%)

Query: 57  LVIGECNHNFHVHCIQQWLETATAKGLCPMCRQQFSLKRGVAINECQMDSLAKLLLQSQP 116
           + I  C+H++H HCI++ +  +  + +CP CR    L       E  ++S          
Sbjct: 426 IFISPCSHSWHFHCIRRLVMMSYPQFVCPNCRSSCDL-------EASLES---------- 468

Query: 117 AALTTEDQ-DMMMDQE 131
              ++ED+ DM++D E
Sbjct: 469 ---SSEDEGDMLIDDE 481

>YKL034W Chr11 (371829..374105) [2277 bp, 758 aa] {ON}
           TUL1Golgi-localized RING-finger ubiquitin ligase (E3),
           involved in ubiquitinating and sorting membrane proteins
           that contain polar transmembrane domains to
           multivesicular bodies for delivery to the vacuole for
           quality control purposes
          Length = 758

 Score = 35.0 bits (79), Expect = 0.039,   Method: Composition-based stats.
 Identities = 13/36 (36%), Positives = 19/36 (52%), Gaps = 3/36 (8%)

Query: 53  DNCPLVIGECNHNFHVHCIQQWLETATAKGLCPMCR 88
           D    ++  CNH FH  C++ W+     K  CP+CR
Sbjct: 720 DQHSYMVTPCNHVFHTSCLENWM---NYKLQCPVCR 752

>NDAI0G05200 Chr7 (1261661..1266421) [4761 bp, 1586 aa] {ON} Anc_1.389
          Length = 1586

 Score = 35.0 bits (79), Expect = 0.039,   Method: Composition-based stats.
 Identities = 17/57 (29%), Positives = 25/57 (43%), Gaps = 13/57 (22%)

Query: 37   CRVSYNGTCPGCRFPGDNCPLVIGECNHNFHVHCIQQWLETATAKGLCPMCRQQFSL 93
            C +  +    GC            +C H F   CI  WL+T T   +CP+C+ + SL
Sbjct: 1267 CTICLDAITKGCML----------KCGHFFCEDCIYDWLQTRT---ICPICKHKASL 1310

>YOL138C Chr15 complement(61325..65350) [4026 bp, 1341 aa] {ON}
            RTC1Subunit of the SEA (Seh1-associated) complex, a
            coatomer-related complex that associates dynamically with
            the vacuole; null mutation suppresses cdc13-1 temperature
            sensitivity; has N-terminal WD-40 repeats and a
            C-terminal RING motif
          Length = 1341

 Score = 35.0 bits (79), Expect = 0.040,   Method: Composition-based stats.
 Identities = 18/55 (32%), Positives = 22/55 (40%), Gaps = 4/55 (7%)

Query: 34   CGICRVSYNGTCPGCRFPGDNCPLVIGECNHNFHVHCIQQWL---ETATAKGLCP 85
            C  C+   N +C  C  P     +VI  C H  H  CIQ+W          G CP
Sbjct: 1283 CDSCK-KKNTSCVLCERPLKKLTMVILPCGHEGHFQCIQEWFLDENEQECPGGCP 1336

>Suva_4.302 Chr4 complement(532902..533210,533286..533429) [453 bp,
           150 aa] {ON} YBR062C (REAL)
          Length = 150

 Score = 34.3 bits (77), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 31/72 (43%), Gaps = 16/72 (22%)

Query: 32  DLCGICRVSYNGTCPGCRFPGDNCPLVIG--ECNHNFHVHCIQQWLETATAKGLCPMCRQ 89
           D C IC  +Y           D  PLV+    C+H F + C+  WL  +T    CP+CR 
Sbjct: 77  DNCSICYTNY---------LEDKYPLVVELPHCHHKFDLECLSVWLSRSTT---CPLCRD 124

Query: 90  QFSLKRGVAINE 101
                R   INE
Sbjct: 125 DVMGHR--VINE 134

>KNAG0H03510 Chr8 complement(654395..656050) [1656 bp, 551 aa] {ON}
           Anc_2.157 YHR115C
          Length = 551

 Score = 34.7 bits (78), Expect = 0.044,   Method: Composition-based stats.
 Identities = 17/65 (26%), Positives = 32/65 (49%), Gaps = 10/65 (15%)

Query: 30  DEDLCGICRVSYNGTCPGCRFPGDNCPLVIGECNHNFHVHCIQQWLETATAKGLCPMCRQ 89
           +E+ C IC +S    C           + I  C+H++H HC+++ +  +  + +CP CR 
Sbjct: 447 EEEDCSIC-LSKIKPCQA---------IFISPCSHSWHFHCVRRLVMLSYPQFVCPNCRS 496

Query: 90  QFSLK 94
              L+
Sbjct: 497 ACDLE 501

>CAGL0H02651g Chr8 (238495..243129) [4635 bp, 1544 aa] {ON} similar to
            uniprot|Q04781 Saccharomyces cerevisiae YMR247c
          Length = 1544

 Score = 34.7 bits (78), Expect = 0.045,   Method: Composition-based stats.
 Identities = 12/47 (25%), Positives = 22/47 (46%), Gaps = 5/47 (10%)

Query: 49   RFPGDNCPLVIGECNHNFHVHCIQQWLETATAKGLCPMCRQQFSLKR 95
            + P   C      C + FH  C+ +W  + +    CP+CR + + +R
Sbjct: 1503 KLPTKTC----STCKNKFHGACLYKWFRS-SGNNTCPLCRSEINFRR 1544

>Smik_2.196 Chr2 complement(347806..348363) [558 bp, 185 aa] {ON}
           YBR062C (REAL)
          Length = 185

 Score = 34.3 bits (77), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 27/59 (45%), Gaps = 14/59 (23%)

Query: 32  DLCGICRVSYNGTCPGCRFPGDNCPLVIG--ECNHNFHVHCIQQWLETATAKGLCPMCR 88
           D C IC  +Y           D  PLV+    C+H F + C+  WL  +T    CP+CR
Sbjct: 112 DNCSICYTNY---------LEDEYPLVVELPHCHHKFDLECLSVWLSRSTT---CPLCR 158

>ZYRO0B16258g Chr2 complement(1317605..1319344) [1740 bp, 579 aa]
           {ON} similar to uniprot|P53924 Saccharomyces cerevisiae
           YNL116W DMA2 Protein involved in regulating spindle
           position and orientation functionally redundant with
           Dma1p homolog of S. pombe Dma1 and H. sapiens Chfr
          Length = 579

 Score = 34.3 bits (77), Expect = 0.059,   Method: Composition-based stats.
 Identities = 17/59 (28%), Positives = 30/59 (50%), Gaps = 10/59 (16%)

Query: 30  DEDLCGICRVSYNGTCPGCRFPGDNCPLVIGECNHNFHVHCIQQWLETATAKGLCPMCR 88
           +E+ C IC +S    C           + I  C+H++H  CI++ + T+  + +CP CR
Sbjct: 489 EEEDCSIC-LSKIKPCQA---------MFISPCSHSWHFQCIRRLVMTSYPQFVCPNCR 537

>YMR231W Chr13 (733545..736634) [3090 bp, 1029 aa] {ON}
           PEP5Component of CORVET tethering complex; peripheral
           vacuolar membrane protein required for protein
           trafficking and vacuole biogenesis; interacts with Pep7p
          Length = 1029

 Score = 34.3 bits (77), Expect = 0.059,   Method: Composition-based stats.
 Identities = 18/49 (36%), Positives = 24/49 (48%), Gaps = 4/49 (8%)

Query: 42  NGTCPGCRFPGDNCPLVIGECNHNFHVHCIQQ---WLETATAKGLCPMC 87
           N TC  CR   D  P+V  +C H +H HC+ +    LE+      CP C
Sbjct: 925 NQTCFMCRLTLD-IPVVFFKCGHIYHQHCLNEEEDTLESERKLFKCPKC 972

>CAGL0L01947g Chr12 (227996..230269) [2274 bp, 757 aa] {ON} similar
           to uniprot|P36096 Saccharomyces cerevisiae YKL034w
          Length = 757

 Score = 34.3 bits (77), Expect = 0.064,   Method: Composition-based stats.
 Identities = 13/36 (36%), Positives = 20/36 (55%), Gaps = 3/36 (8%)

Query: 53  DNCPLVIGECNHNFHVHCIQQWLETATAKGLCPMCR 88
           D    +I  C+H FH  C++ W+   + K  CP+CR
Sbjct: 719 DKDSYMITPCDHMFHTSCLESWM---SYKLQCPVCR 751

>ZYRO0G13376g Chr7 complement(1066321..1067658) [1338 bp, 445 aa]
          {ON} some similarities with uniprot|Q12161
          Saccharomyces cerevisiae YOL054W PSH1 Nuclear protein
          putative RNA polymerase II elongation factor isolated
          as Pob3p/Spt16p- binding protein
          Length = 445

 Score = 34.3 bits (77), Expect = 0.065,   Method: Composition-based stats.
 Identities = 11/35 (31%), Positives = 19/35 (54%)

Query: 58 VIGECNHNFHVHCIQQWLETATAKGLCPMCRQQFS 92
          V+ +C HN+   C+  W ++ + +  CP CR   S
Sbjct: 41 VMTQCGHNYCYDCLSSWFDSNSNELSCPQCRASIS 75

>NDAI0B01820 Chr2 (433938..435815) [1878 bp, 625 aa] {ON} Anc_2.542
          Length = 625

 Score = 34.3 bits (77), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 7/47 (14%)

Query: 44  TCPGC--RFPGDNCPLVIGECNHNFHVHCIQQWLETATAKGLCPMCR 88
           TCP C  R   +   L+   C H FH  C+ +W ++      CP+CR
Sbjct: 267 TCPVCLERMDSETTGLITIPCQHTFHCSCLDKWNDSR-----CPVCR 308

>SAKL0E04488g Chr5 (359434..362817) [3384 bp, 1127 aa] {ON} similar
           to uniprot|P32849 Saccharomyces cerevisiae YLR032W RAD5
           Single-stranded DNA-dependent ATPase involved in
           postreplication repair contains RING finger domain
          Length = 1127

 Score = 34.3 bits (77), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 26/48 (54%), Gaps = 3/48 (6%)

Query: 57  LVIGECNHNFHVHCIQQWLETATAKGL---CPMCRQQFSLKRGVAINE 101
           ++  EC H F  HC+ ++++  T K L   CP CR+    KR + + E
Sbjct: 888 VIFTECAHAFCEHCLLEYIDFQTQKKLELKCPNCRESIDPKRLLTLKE 935

>NDAI0K01810 Chr11 (405118..407406) [2289 bp, 762 aa] {ON} Anc_2.545
           YKL034W
          Length = 762

 Score = 34.3 bits (77), Expect = 0.071,   Method: Composition-based stats.
 Identities = 12/34 (35%), Positives = 18/34 (52%), Gaps = 3/34 (8%)

Query: 58  VIGECNHNFHVHCIQQWLETATAKGLCPMCRQQF 91
           ++  CNH FH  C++ W+     K  CP+CR   
Sbjct: 729 MVTPCNHIFHTECLENWM---GYKLQCPVCRSSL 759

>TPHA0C04250 Chr3 (915632..917302) [1671 bp, 556 aa] {ON} Anc_2.542
           YHL010C
          Length = 556

 Score = 33.9 bits (76), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 30/65 (46%), Gaps = 8/65 (12%)

Query: 44  TCPGCRFPGDN--CPLVIGECNHNFHVHCIQQWLETATAKGLCPMCRQ-QFSLKRGVAIN 100
           TCP C    D+    L+   C+H FH  C+ +W  +      CP+CR    ++ R + I 
Sbjct: 240 TCPVCLEKMDSLVTGLITIPCSHTFHCQCLDKWKNSK-----CPVCRHTNLNISRKLLIE 294

Query: 101 ECQMD 105
           +   D
Sbjct: 295 QATSD 299

>KLTH0D07216g Chr4 complement(631219..633462) [2244 bp, 747 aa] {ON}
           similar to uniprot|P36096 Saccharomyces cerevisiae
           YKL034W TUL1 Transmembrane Ubiquitin Ligase
          Length = 747

 Score = 34.3 bits (77), Expect = 0.076,   Method: Composition-based stats.
 Identities = 13/36 (36%), Positives = 20/36 (55%), Gaps = 3/36 (8%)

Query: 53  DNCPLVIGECNHNFHVHCIQQWLETATAKGLCPMCR 88
           D    +I  C+H FH  C++ W+   + K  CP+CR
Sbjct: 709 DKESYMITPCSHIFHTQCLESWM---SYKLQCPVCR 741

>YLR032W Chr12 (204991..208500) [3510 bp, 1169 aa] {ON}  RAD5DNA
           helicase proposed to promote replication fork regression
           during postreplication repair by template switching;
           RING finger containing ubiquitin ligase; stimulates the
           synthesis of free and PCNA-bound polyubiquitin chains by
           Ubc13p-Mms2p
          Length = 1169

 Score = 34.3 bits (77), Expect = 0.079,   Method: Composition-based stats.
 Identities = 21/76 (27%), Positives = 32/76 (42%), Gaps = 13/76 (17%)

Query: 34  CGICRVSYNGTCPGCRFPGDNCPLVIGECNHNFHVHCIQQWLETATAKGL---CPMCRQQ 90
           C IC             P D    +  EC H+F   C+ +++E   +K L   CP CR Q
Sbjct: 914 CSICTTE----------PMDLDKALFTECGHSFCEKCLFEYIEFQNSKNLGLKCPNCRNQ 963

Query: 91  FSLKRGVAINECQMDS 106
               R +A+ +   +S
Sbjct: 964 IDACRLLALVQTNSNS 979

>Kwal_26.8099 s26 complement(645436..647688) [2253 bp, 750 aa] {ON}
           YKL034W (TUL1) -  [contig 55] FULL
          Length = 750

 Score = 33.9 bits (76), Expect = 0.080,   Method: Composition-based stats.
 Identities = 12/31 (38%), Positives = 19/31 (61%), Gaps = 3/31 (9%)

Query: 58  VIGECNHNFHVHCIQQWLETATAKGLCPMCR 88
           +I  C+H FH  C++ W+   + K  CP+CR
Sbjct: 717 MITPCSHIFHTQCLESWM---SYKLQCPVCR 744

>NCAS0G02520 Chr7 (451683..453239) [1557 bp, 518 aa] {ON} Anc_2.157
           YHR115C
          Length = 518

 Score = 33.9 bits (76), Expect = 0.080,   Method: Composition-based stats.
 Identities = 12/38 (31%), Positives = 22/38 (57%)

Query: 57  LVIGECNHNFHVHCIQQWLETATAKGLCPMCRQQFSLK 94
           + I  C H++H HCI++ +  +  + +CP CR    L+
Sbjct: 442 IFISPCAHSWHFHCIRRLVMLSYPQFVCPNCRSACDLE 479

>TBLA0B01260 Chr2 (266584..269241) [2658 bp, 885 aa] {ON} Anc_2.157
           YHR115C
          Length = 885

 Score = 33.9 bits (76), Expect = 0.080,   Method: Composition-based stats.
 Identities = 14/48 (29%), Positives = 24/48 (50%), Gaps = 11/48 (22%)

Query: 52  GDNCPLV-----------IGECNHNFHVHCIQQWLETATAKGLCPMCR 88
           GD+C +            I  C+H++H HCI++ +     + +CP CR
Sbjct: 766 GDDCSICLSKIKPCQAIFISPCSHSWHFHCIRRLVMLQYPQFVCPNCR 813

>Ecym_2684 Chr2 complement(1321556..1322716) [1161 bp, 386 aa] {ON}
           similar to Ashbya gossypii AGL217W
          Length = 386

 Score = 33.9 bits (76), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 30/65 (46%), Gaps = 2/65 (3%)

Query: 58  VIGECNHNFHVHCIQQWLETATAKGL-CPMCRQQFSLKRGVAINECQ-MDSLAKLLLQSQ 115
           V+  C HN+  +CI  WL    A  L CP CR        + ++  Q ++SL  +L +  
Sbjct: 5   VMTSCGHNYCYYCISNWLNNNNATELNCPQCRTTIGAMPALNVSLLQTLESLIDVLDKGD 64

Query: 116 PAALT 120
           P   +
Sbjct: 65  PEVAS 69

>Skud_15.16 Chr15 complement(26552..30550) [3999 bp, 1332 aa] {ON}
            YOL138C (REAL)
          Length = 1332

 Score = 33.9 bits (76), Expect = 0.083,   Method: Composition-based stats.
 Identities = 18/55 (32%), Positives = 22/55 (40%), Gaps = 4/55 (7%)

Query: 34   CGICRVSYNGTCPGCRFPGDNCPLVIGECNHNFHVHCIQQWL---ETATAKGLCP 85
            C  C+   N  C  C  P     +VI  C H  H  CIQ+W    +     G CP
Sbjct: 1274 CDSCK-KKNTPCILCERPLKKLTMVILPCGHEGHFQCIQEWFLDEKEHECPGGCP 1327

>NCAS0A11350 Chr1 complement(2249991..2251277) [1287 bp, 428 aa]
          {ON} Anc_3.405 YPR093C
          Length = 428

 Score = 33.9 bits (76), Expect = 0.085,   Method: Composition-based stats.
 Identities = 16/52 (30%), Positives = 27/52 (51%), Gaps = 4/52 (7%)

Query: 42 NGTCPGCRFPGDNCPLVIGE---CNHNFHVHCIQQWLETATAKGLCPMCRQQ 90
          +  CP C    ++  ++ G+   CNH +H  CI++W    +    CP+CR Q
Sbjct: 9  DNICPICFDDLNDTDILQGKLKPCNHKYHYDCIRRW-HGYSDNSDCPLCRCQ 59

>Suva_15.22 Chr15 complement(39171..43181) [4011 bp, 1336 aa] {ON}
            YOL138C (REAL)
          Length = 1336

 Score = 33.9 bits (76), Expect = 0.087,   Method: Composition-based stats.
 Identities = 17/55 (30%), Positives = 22/55 (40%), Gaps = 4/55 (7%)

Query: 34   CGICRVSYNGTCPGCRFPGDNCPLVIGECNHNFHVHCIQQWLETATAK---GLCP 85
            C  C+   N  C  C  P     +V+  C H  H  CIQ+W      +   G CP
Sbjct: 1278 CDSCK-KRNSLCVLCERPLKKLTMVLLPCGHEGHFQCIQEWFLNEKERECPGGCP 1331

>TPHA0C04260 Chr3 complement(917526..919799) [2274 bp, 757 aa] {ON}
           Anc_2.545 YKL034W
          Length = 757

 Score = 33.9 bits (76), Expect = 0.089,   Method: Composition-based stats.
 Identities = 13/36 (36%), Positives = 19/36 (52%), Gaps = 3/36 (8%)

Query: 53  DNCPLVIGECNHNFHVHCIQQWLETATAKGLCPMCR 88
           D    ++  CNH FH  C++ W+     K  CP+CR
Sbjct: 719 DQQSYMVTPCNHIFHTACLENWM---GYKLQCPVCR 751

>TDEL0G04250 Chr7 complement(772180..773733) [1554 bp, 517 aa] {ON}
           Anc_6.45 YOL013C
          Length = 517

 Score = 33.9 bits (76), Expect = 0.089,   Method: Composition-based stats.
 Identities = 10/27 (37%), Positives = 17/27 (62%), Gaps = 3/27 (11%)

Query: 62  CNHNFHVHCIQQWLETATAKGLCPMCR 88
           C H  H++C++ W+E +     CP+CR
Sbjct: 347 CGHVLHLYCLKNWMERSQT---CPICR 370

>KLLA0F25740g Chr6 complement(2389226..2390779) [1554 bp, 517 aa]
           {ON} similar to uniprot|P38748 YHL010C Saccharomyces
           cerevisiae Hypothetical ORF
          Length = 517

 Score = 33.9 bits (76), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 21/46 (45%), Gaps = 7/46 (15%)

Query: 45  CPGC--RFPGDNCPLVIGECNHNFHVHCIQQWLETATAKGLCPMCR 88
           CP C  +   +   LV   C H FH  C+ QW       G CP+CR
Sbjct: 215 CPVCLEKLDSEVTGLVTTPCQHTFHCKCLDQW-----KNGNCPVCR 255

>TDEL0B06170 Chr2 (1088912..1093324) [4413 bp, 1470 aa] {ON} Anc_1.389
            YLR247C
          Length = 1470

 Score = 33.9 bits (76), Expect = 0.097,   Method: Composition-based stats.
 Identities = 24/101 (23%), Positives = 41/101 (40%), Gaps = 23/101 (22%)

Query: 54   NCPLVIGE--------CNHNFHVHCIQQWLETATAKGLCPMCRQQFSLKR---------G 96
            +CP+ +G+        C H F   CI  WL+   +   CPMC+   S+            
Sbjct: 1153 SCPICLGKITMGAIIKCGHFFCRSCIHSWLKNHNS---CPMCKTSTSIMEVYNFKFQNDD 1209

Query: 97   VAINECQMDSLAKLLLQSQPAALTT---EDQDMMMDQEFIV 134
              +NE Q +S      + + +AL     +D D +  + + V
Sbjct: 1210 AEVNEPQNESSQDFEKKPKSSALAKKVGDDYDSVFKERYSV 1250

>KLTH0C05258g Chr3 complement(455688..456130,456190..456205) [459
           bp, 152 aa] {ON} similar to uniprot|P38239 Saccharomyces
           cerevisiae YBR062C Hypothetical ORF
          Length = 152

 Score = 33.1 bits (74), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 34/77 (44%), Gaps = 15/77 (19%)

Query: 32  DLCGICRVSYNGTCPGCRFPGDNCPLVIG--ECNHNFHVHCIQQWLETATAKGLCPMCRQ 89
           D C IC          C +  D  PLV+    C+H F + C+  WL  +     CP+CR 
Sbjct: 81  DACSIC---------CCGYLDDTHPLVVKLPHCSHRFDLECVAVWLSKSRT---CPLCRD 128

Query: 90  Q-FSLKRGVAINECQMD 105
              S K  V I+  +++
Sbjct: 129 DVLSHKPKVDISNVELE 145

>Skud_8.176 Chr8 complement(313886..315127) [1242 bp, 413 aa] {ON}
           YHR115C (REAL)
          Length = 413

 Score = 33.5 bits (75), Expect = 0.100,   Method: Composition-based stats.
 Identities = 11/38 (28%), Positives = 22/38 (57%)

Query: 57  LVIGECNHNFHVHCIQQWLETATAKGLCPMCRQQFSLK 94
           + I  C H++H HC+++ +  +  + +CP CR    L+
Sbjct: 335 IFISPCAHSWHFHCVRRLVIMSYPQFMCPNCRSNCDLE 372

>KLTH0D07150g Chr4 (627115..628737) [1623 bp, 540 aa] {ON} similar
           to uniprot|P38748 Saccharomyces cerevisiae YHL010C
           Hypothetical ORF
          Length = 540

 Score = 33.5 bits (75), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 28/65 (43%), Gaps = 16/65 (24%)

Query: 26  KEIGDEDLCGICRVSYNGTCPGC--RFPGDNCPLVIGECNHNFHVHCIQQWLETATAKGL 83
           KE GD +L          TCP C  R   +   L    C H FH  C+ +W ++      
Sbjct: 237 KETGDVEL---------PTCPVCLERLDSEVTGLATIPCQHTFHCQCLNKWKDSR----- 282

Query: 84  CPMCR 88
           CP+CR
Sbjct: 283 CPVCR 287

>Skud_11.192 Chr11 (351379..353655) [2277 bp, 758 aa] {ON} YKL034W
           (REAL)
          Length = 758

 Score = 33.9 bits (76), Expect = 0.10,   Method: Composition-based stats.
 Identities = 12/36 (33%), Positives = 20/36 (55%), Gaps = 3/36 (8%)

Query: 53  DNCPLVIGECNHNFHVHCIQQWLETATAKGLCPMCR 88
           D    ++  C+H FH  C++ W+   + K  CP+CR
Sbjct: 720 DQHSYMVTPCDHVFHTSCLENWM---SYKLQCPVCR 752

>Smik_15.16 Chr15 complement(29410..33390) [3981 bp, 1326 aa] {ON}
            YOL138C (REAL)
          Length = 1326

 Score = 33.9 bits (76), Expect = 0.10,   Method: Composition-based stats.
 Identities = 18/55 (32%), Positives = 21/55 (38%), Gaps = 4/55 (7%)

Query: 34   CGICRVSYNGTCPGCRFPGDNCPLVIGECNHNFHVHCIQQWL---ETATAKGLCP 85
            C  C+   N  C  C  P     +VI  C H  H  CIQ+W          G CP
Sbjct: 1268 CDSCK-KKNTLCVLCERPLKKLTMVILPCGHEGHFQCIQEWFLNENEHECPGGCP 1321

>KLTH0G18150g Chr7 complement(1564780..1569444) [4665 bp, 1554 aa]
            {ON} similar to uniprot|Q06554 Saccharomyces cerevisiae
            YLR247C Hypothetical ORF
          Length = 1554

 Score = 33.9 bits (76), Expect = 0.10,   Method: Composition-based stats.
 Identities = 16/48 (33%), Positives = 23/48 (47%), Gaps = 11/48 (22%)

Query: 54   NCPLVIGE--------CNHNFHVHCIQQWLETATAKGLCPMCRQQFSL 93
            NC + +GE        C H F   CI  WL+   +   CP+C+ Q S+
Sbjct: 1222 NCTICLGEIYMGSVIKCGHFFCQSCIFSWLKNHAS---CPLCKMQTSM 1266

>SAKL0D02354g Chr4 (188524..189519) [996 bp, 331 aa] {ON} weakly
          similar to uniprot|Q12161 Saccharomyces cerevisiae
          YOL054W PSH1 Nuclear protein putative RNA polymerase II
          elongation factor isolated as Pob3p/Spt16p- binding
          protein
          Length = 331

 Score = 33.5 bits (75), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 18/37 (48%), Gaps = 1/37 (2%)

Query: 58 VIGECNHNFHVHCIQQWLETATAKGL-CPMCRQQFSL 93
          V+  C HN+   CI  WL    A  L CP CR   S+
Sbjct: 5  VMTSCGHNYCYDCISNWLNNNNATELTCPQCRTSVSV 41

>NDAI0F02770 Chr6 complement(677011..678675) [1665 bp, 554 aa] {ON}
           Anc_2.157 YHR115C
          Length = 554

 Score = 33.5 bits (75), Expect = 0.11,   Method: Composition-based stats.
 Identities = 20/64 (31%), Positives = 29/64 (45%), Gaps = 11/64 (17%)

Query: 30  DEDLCGICRVSYNGTCPGCRFPGDNCPLVIGECNHNFHVHCIQQWLETATAKGLCPMCRQ 89
           DED C IC +S    C           + I  C H++H HCI++ +     + +CP CR 
Sbjct: 468 DED-CSIC-LSKIKACQA---------IFISPCAHSWHFHCIRRLVMLTYPQFVCPNCRS 516

Query: 90  QFSL 93
              L
Sbjct: 517 ACDL 520

>KNAG0C05660 Chr3 complement(1091851..1093374) [1524 bp, 507 aa]
           {ON} Anc_2.542 YHL010C
          Length = 507

 Score = 33.5 bits (75), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 24/54 (44%), Gaps = 8/54 (14%)

Query: 45  CPGC--RFPGDNCPLVIGECNHNFHVHCIQQWLETATAKGLCPMCR-QQFSLKR 95
           CP C  R   +   L+   C H FH  C+ +W  +      CP+CR   F L R
Sbjct: 171 CPVCLERMDSETTGLITIPCQHTFHCQCLNRWKNSK-----CPVCRYSSFRLSR 219

>KLLA0F25674g Chr6 (2384293..2386566) [2274 bp, 757 aa] {ON} similar
           to uniprot|P36096 Saccharomyces cerevisiae YKL034W TUL1
           Transmembrane Ubiquitin Ligase
          Length = 757

 Score = 33.5 bits (75), Expect = 0.12,   Method: Composition-based stats.
 Identities = 12/31 (38%), Positives = 19/31 (61%), Gaps = 3/31 (9%)

Query: 58  VIGECNHNFHVHCIQQWLETATAKGLCPMCR 88
           +I  C+H FH  C++ W+   + K  CP+CR
Sbjct: 724 MITPCSHIFHTECLENWM---SYKLQCPVCR 751

>SAKL0D03058g Chr4 complement(252198..252649,252717..252732) [468
           bp, 155 aa] {ON} similar to uniprot|P38239 Saccharomyces
           cerevisiae YBR062C Hypothetical ORF
          Length = 155

 Score = 32.7 bits (73), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 28/62 (45%), Gaps = 16/62 (25%)

Query: 29  GDEDLCGICRVSYNGTCPGCRFPGDNCPLVIG--ECNHNFHVHCIQQWLETATAKGLCPM 86
           GDE  C IC   YN          D+ PLV+    C+H F + C+  WL        CP+
Sbjct: 83  GDE--CSICCSKYNE---------DDYPLVVELPHCSHRFDLECLTPWL---LKNSTCPL 128

Query: 87  CR 88
           CR
Sbjct: 129 CR 130

>TDEL0D03460 Chr4 (637921..638355) [435 bp, 144 aa] {ON} Anc_3.279
           YBR062C
          Length = 144

 Score = 32.7 bits (73), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 22/41 (53%), Gaps = 5/41 (12%)

Query: 50  FPGDNCPLVIG--ECNHNFHVHCIQQWLETATAKGLCPMCR 88
           +  D  PLV+    C H+F + C+  W   +T+   CP+CR
Sbjct: 82  YLNDGYPLVVRLPHCGHDFDLECLSVWFSKSTS---CPLCR 119

>YDR143C Chr4 complement(742042..743874) [1833 bp, 610 aa] {ON}
           SAN1Ubiquitin-protein ligase; involved in the
           proteasome-dependent degradation of aberrant nuclear
           proteins; targets substrates with regions of exposed
           hydrophobicity containing 5 or more contiguous
           hydrophobic residues; contains intrinsically disordered
           regions that contribute to substrate recognition
          Length = 610

 Score = 33.5 bits (75), Expect = 0.14,   Method: Composition-based stats.
 Identities = 20/75 (26%), Positives = 33/75 (44%), Gaps = 16/75 (21%)

Query: 62  CNHNFHVHCIQQWLETATAKGLCPMCRQQFSLKRG-----------VAINECQMDSLAKL 110
           C H F   CI +W     +   CP+CRQ+ S   G           VA NE   + + ++
Sbjct: 257 CGHIFGRECIYKWSRLENS---CPLCRQKISESVGVQRAAQQDTDEVAANEAAFERIRRV 313

Query: 111 LLQSQPAALTTEDQD 125
           L    P A+ + +++
Sbjct: 314 LY--DPTAVNSTNEN 326

>CAGL0L03960g Chr12 complement(463751..465562) [1812 bp, 603 aa]
           {ON} similar to uniprot|P53924 Saccharomyces cerevisiae
           YNL116w
          Length = 603

 Score = 33.5 bits (75), Expect = 0.14,   Method: Composition-based stats.
 Identities = 22/81 (27%), Positives = 36/81 (44%), Gaps = 14/81 (17%)

Query: 30  DEDLCGICRVSYNGTCPGCRFPGDNCPLVIGECNHNFHVHCIQQWLETATAKGLCPMCRQ 89
           DE+ C IC +S    C           + I  C H +H  C+++ +  A  + +CP CR 
Sbjct: 511 DEEDCSIC-LSKIKPCQA---------IFISPCAHTWHFRCVRRLVMLAYPQFVCPNCRS 560

Query: 90  ----QFSLKRGVAINECQMDS 106
               + SL    + +E  +DS
Sbjct: 561 TCDLEASLDNSDSESESDLDS 581

>Kwal_47.17904 s47 complement(602106..603518) [1413 bp, 470 aa] {ON}
           YNL116W - Hypothetical ORF [contig 204] FULL
          Length = 470

 Score = 33.1 bits (74), Expect = 0.14,   Method: Composition-based stats.
 Identities = 11/38 (28%), Positives = 22/38 (57%)

Query: 57  LVIGECNHNFHVHCIQQWLETATAKGLCPMCRQQFSLK 94
           + I  C+H++H  C+++ + T   + +CP CR    L+
Sbjct: 402 IFISPCSHSWHYQCVRRLVMTTYPQFVCPNCRSSCDLE 439

>Kpol_1035.50 s1035 (124427..126232) [1806 bp, 601 aa] {ON}
           (124427..126232) [1806 nt, 602 aa]
          Length = 601

 Score = 33.1 bits (74), Expect = 0.15,   Method: Composition-based stats.
 Identities = 10/27 (37%), Positives = 17/27 (62%), Gaps = 3/27 (11%)

Query: 62  CNHNFHVHCIQQWLETATAKGLCPMCR 88
           C H  H++C++ W+E +     CP+CR
Sbjct: 371 CGHILHLNCLKNWMERSQT---CPICR 394

>Kpol_1002.8 s1002 complement(21450..23126) [1677 bp, 558 aa] {ON}
           complement(21450..23126) [1677 nt, 559 aa]
          Length = 558

 Score = 33.1 bits (74), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 21/47 (44%), Gaps = 7/47 (14%)

Query: 44  TCPGC--RFPGDNCPLVIGECNHNFHVHCIQQWLETATAKGLCPMCR 88
           TCP C  R       L+   C H FH  C+ +W  +      CP+CR
Sbjct: 234 TCPVCLERLDDGTTGLITIPCQHTFHCQCLDKWKNSK-----CPVCR 275

>Suva_13.415 Chr13 (714887..717973) [3087 bp, 1028 aa] {ON} YMR231W
           (REAL)
          Length = 1028

 Score = 33.1 bits (74), Expect = 0.15,   Method: Composition-based stats.
 Identities = 17/49 (34%), Positives = 23/49 (46%), Gaps = 4/49 (8%)

Query: 42  NGTCPGCRFPGDNCPLVIGECNHNFHVHCIQQ---WLETATAKGLCPMC 87
           N TC  C    D  P+V  +C H +H HC+ +    LE+      CP C
Sbjct: 923 NQTCFMCNLTLD-IPVVFFKCGHTYHQHCLNEEEDTLESERKLFKCPKC 970

>KAFR0A05240 Chr1 (1036153..1037814) [1662 bp, 553 aa] {ON} Anc_6.45
           YOL013C
          Length = 553

 Score = 33.1 bits (74), Expect = 0.17,   Method: Composition-based stats.
 Identities = 10/27 (37%), Positives = 16/27 (59%), Gaps = 3/27 (11%)

Query: 62  CNHNFHVHCIQQWLETATAKGLCPMCR 88
           C H  H+ C++ W+E +     CP+CR
Sbjct: 392 CGHMLHLSCLKNWMERSQT---CPICR 415

>ADL186C Chr4 complement(369320..373405) [4086 bp, 1361 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YOL138C
          Length = 1361

 Score = 33.1 bits (74), Expect = 0.18,   Method: Composition-based stats.
 Identities = 15/42 (35%), Positives = 16/42 (38%), Gaps = 1/42 (2%)

Query: 34   CGICRVSYNGTCPGCRFPGDNCPLVIGECNHNFHVHCIQQWL 75
            C  CR   N  C  C  P     L    C H  H  C+QQW 
Sbjct: 1304 CDSCRKP-NSLCVYCEQPMKKLALSFLNCGHGGHFECLQQWF 1344

>TDEL0B06340 Chr2 complement(1122797..1125085) [2289 bp, 762 aa]
           {ON} Anc_2.545 YKL034W
          Length = 762

 Score = 33.1 bits (74), Expect = 0.19,   Method: Composition-based stats.
 Identities = 11/27 (40%), Positives = 16/27 (59%), Gaps = 3/27 (11%)

Query: 62  CNHNFHVHCIQQWLETATAKGLCPMCR 88
           C H FH  C++ W+   + K  CP+CR
Sbjct: 733 CGHVFHTQCLENWM---SYKLQCPVCR 756

>KAFR0A06530 Chr1 (1320422..1324123) [3702 bp, 1233 aa] {ON} Anc_4.129
            YAL002W
          Length = 1233

 Score = 33.1 bits (74), Expect = 0.19,   Method: Composition-based stats.
 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 1/38 (2%)

Query: 53   DNCPLVIGECNHNFHVHCIQQWLETATAKGLCPMCRQQ 90
            +N  LVI +CNH FH  C++  L        C +C +Q
Sbjct: 1197 ENAKLVIFKCNHGFHTKCLEN-LGQKNGNYECLLCNEQ 1233

>TPHA0F02480 Chr6 (546818..548635) [1818 bp, 605 aa] {ON} Anc_6.45
           YOL013C
          Length = 605

 Score = 32.7 bits (73), Expect = 0.19,   Method: Composition-based stats.
 Identities = 20/73 (27%), Positives = 32/73 (43%), Gaps = 8/73 (10%)

Query: 62  CNHNFHVHCIQQWLETATAKGLCPMCRQQFSLKRG--VAINECQMDSLAKLLL---QSQP 116
           C H  H+ C++ W+E +     CP+CR       G  +  N  + D++    L    S  
Sbjct: 371 CCHILHLGCLKNWMERSQT---CPICRLSVFDSNGNILPFNNTRSDTMRNTELTATNSND 427

Query: 117 AALTTEDQDMMMD 129
           AA  + + D  MD
Sbjct: 428 AADESTENDTEMD 440

>KLTH0F11044g Chr6 (937668..938543) [876 bp, 291 aa] {ON} weakly
           similar to uniprot|Q06834 Saccharomyces cerevisiae
           YPR093C ASR1 Protein involved in a putative
           alcohol-responsive signaling pathway accumulates in the
           nucleus under alcohol stress contains a Ring/PHD finger
           domain
          Length = 291

 Score = 32.7 bits (73), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 45/96 (46%), Gaps = 13/96 (13%)

Query: 44  TCPGC--RFPGDNCPLVIGECNHNFHVHCIQQWLETATAKGL-CPMCRQQFS----LKRG 96
           +CP C        C LV  EC H +H +CI++W     +K L CP CR +      ++R 
Sbjct: 3   SCPICFESLSKGACRLV--ECGHKYHFNCIRRW--HYHSKNLQCPTCRIKSRHLEDIERK 58

Query: 97  VAINECQMD--SLAKLLLQSQPAALTTEDQDMMMDQ 130
           V IN  +    +LA   + +Q  +L     ++  ++
Sbjct: 59  VTINLAEFSDANLAISEISAQMGSLEIRSNEVRQEE 94

>Smik_8.193 Chr8 complement(316475..317725) [1251 bp, 416 aa] {ON}
           YHR115C (REAL)
          Length = 416

 Score = 32.7 bits (73), Expect = 0.21,   Method: Composition-based stats.
 Identities = 10/32 (31%), Positives = 20/32 (62%)

Query: 57  LVIGECNHNFHVHCIQQWLETATAKGLCPMCR 88
           + I  C H++H HC+++ +  +  + +CP CR
Sbjct: 340 IFISPCAHSWHFHCVRRLVIMSYPQFMCPNCR 371

>Kwal_55.22076 s55 (1098857..1102717) [3861 bp, 1286 aa] {ON} YOL138C
            - Hypothetical ORF [contig 124] FULL
          Length = 1286

 Score = 32.7 bits (73), Expect = 0.21,   Method: Composition-based stats.
 Identities = 19/64 (29%), Positives = 23/64 (35%), Gaps = 2/64 (3%)

Query: 12   FSWSWDIPGDDNADKEIGDEDLCGICRVSYNGTCPGCRFPGDNCPLVIGECNHNFHVHCI 71
            F+  W   G   A K  G    C +C    N  C  C  P     + I  C H  H  C 
Sbjct: 1207 FTEEWKRTGRQEAMKRFGYW-YCDLCS-RMNTLCALCERPLKKLTMCILSCGHEGHPECF 1264

Query: 72   QQWL 75
            Q+W 
Sbjct: 1265 QRWF 1268

>ZYRO0E05632g Chr5 complement(434758..437055) [2298 bp, 765 aa] {ON}
           similar to uniprot|P36096 Saccharomyces cerevisiae
           YKL034W TUL1 Transmembrane Ubiquitin Ligase
          Length = 765

 Score = 32.7 bits (73), Expect = 0.21,   Method: Composition-based stats.
 Identities = 12/36 (33%), Positives = 19/36 (52%), Gaps = 3/36 (8%)

Query: 53  DNCPLVIGECNHNFHVHCIQQWLETATAKGLCPMCR 88
           D    ++  C H FH  C++ W+   + K  CP+CR
Sbjct: 727 DEQTYMVTPCAHIFHTQCLENWM---SYKLQCPVCR 759

>NCAS0D02010 Chr4 complement(371205..372737) [1533 bp, 510 aa] {ON}
           Anc_6.45 YOL013C
          Length = 510

 Score = 32.7 bits (73), Expect = 0.22,   Method: Composition-based stats.
 Identities = 10/27 (37%), Positives = 16/27 (59%), Gaps = 3/27 (11%)

Query: 62  CNHNFHVHCIQQWLETATAKGLCPMCR 88
           C H  H+ C++ W+E +     CP+CR
Sbjct: 375 CGHFLHLSCLKNWMERSQT---CPICR 398

>SAKL0B05104g Chr2 (439233..442349) [3117 bp, 1038 aa] {ON} similar to
            uniprot|P12868 Saccharomyces cerevisiae YMR231W PEP5
            Peripheral vacuolar membrane protein required for protein
            trafficking and vacuole biogenesis forms complex with
            Pep3p that promotes vesicular docking/fusion reactions in
            conjunction with SNARE proteins also interacts with Pep7p
          Length = 1038

 Score = 32.7 bits (73), Expect = 0.22,   Method: Composition-based stats.
 Identities = 20/82 (24%), Positives = 40/82 (48%), Gaps = 3/82 (3%)

Query: 56   PLVIGECNHNFHVHCIQQWLETATAKGL--CPMCRQQFSLKRGVAINECQMDSLAKLLLQ 113
            P+V  +C H +H  C+ +    + A  L  CP C  +      + I + +M++  +LL  
Sbjct: 948  PIVYFKCGHTYHQRCLSEEDILSEADKLFKCPQCIVELETSNKMKIAQSEMETKTELLRV 1007

Query: 114  SQPAALTTEDQDMMMDQEFIVR 135
            +  +   ++D+  ++  EFI R
Sbjct: 1008 ALSSKENSKDRFKVV-TEFIGR 1028

>CAGL0E02299g Chr5 complement(219246..220883) [1638 bp, 545 aa] {ON}
           similar to uniprot|Q08109 Saccharomyces cerevisiae
           YOL013c HRD1
          Length = 545

 Score = 32.7 bits (73), Expect = 0.23,   Method: Composition-based stats.
 Identities = 10/27 (37%), Positives = 16/27 (59%), Gaps = 3/27 (11%)

Query: 62  CNHNFHVHCIQQWLETATAKGLCPMCR 88
           C H  H+ C++ W+E +     CP+CR
Sbjct: 377 CGHVLHLSCLKNWMERSQT---CPICR 400

>SAKL0A09812g Chr1 complement(863141..865396) [2256 bp, 751 aa] {ON}
           similar to uniprot|P36096 Saccharomyces cerevisiae
           YKL034W TUL1 Transmembrane Ubiquitin Ligase
          Length = 751

 Score = 32.7 bits (73), Expect = 0.23,   Method: Composition-based stats.
 Identities = 11/31 (35%), Positives = 18/31 (58%), Gaps = 3/31 (9%)

Query: 58  VIGECNHNFHVHCIQQWLETATAKGLCPMCR 88
           ++  C H FH  C++ W+   + K  CP+CR
Sbjct: 718 MVTPCGHIFHTQCLESWM---SYKLQCPVCR 745

>Skud_4.402 Chr4 complement(713711..715549) [1839 bp, 612 aa] {ON}
           YDR143C (REAL)
          Length = 612

 Score = 32.7 bits (73), Expect = 0.23,   Method: Composition-based stats.
 Identities = 15/45 (33%), Positives = 22/45 (48%), Gaps = 4/45 (8%)

Query: 62  CNHNFHVHCIQQWLETATAKGLCPMCRQQFSLKRGVAINECQMDS 106
           C H F   CI +W +   +   CP+CR + S   G+  N  Q D+
Sbjct: 256 CGHIFGRECIYKWSKLENS---CPLCRHKISESAGIQ-NTAQQDT 296

>Suva_5.67 Chr5 (107941..108744) [804 bp, 267 aa] {ON} YEL019C
           (REAL)
          Length = 267

 Score = 32.3 bits (72), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 42/94 (44%), Gaps = 5/94 (5%)

Query: 7   KVYPVFSWSWDIPGDDNAD-KEIGDEDLCGICRVSYNGTCPGCRFPGDNCPLVIGECNHN 65
           K+  V  + W+ P     D +   DED   I    +  TCP    P +  PL+  +CNH 
Sbjct: 145 KILKVLPYIWNDPTCVIPDLQNPADEDDLQIEGGKFELTCPITCKPYE-TPLISKKCNHV 203

Query: 66  FHVHCIQQWLETATAKGLCPM--CRQQFSLKRGV 97
           F    IQ +L+  T +  CP   C Q  S++  V
Sbjct: 204 FDKDGIQNYLQGYTTRD-CPQAACSQVVSMRDFV 236

>Skud_15.148 Chr15 complement(260982..262628) [1647 bp, 548 aa] {ON}
           YOL013C (REAL)
          Length = 548

 Score = 32.7 bits (73), Expect = 0.24,   Method: Composition-based stats.
 Identities = 10/27 (37%), Positives = 16/27 (59%), Gaps = 3/27 (11%)

Query: 62  CNHNFHVHCIQQWLETATAKGLCPMCR 88
           C H  H+ C++ W+E +     CP+CR
Sbjct: 372 CGHILHLSCLKNWMERSQT---CPICR 395

>YOL013C Chr15 complement(301380..303035) [1656 bp, 551 aa] {ON}
           HRD1Ubiquitin-protein ligase; required for endoplasmic
           reticulum-associated degradation (ERAD) of misfolded
           proteins; genetically linked to the unfolded protein
           response (UPR); regulated through association with
           Hrd3p; contains an H2 ring finger; likely plays a
           general role in targeting proteins that persistently
           associate with and potentially obstruct the ER-localized
           translocon
          Length = 551

 Score = 32.7 bits (73), Expect = 0.24,   Method: Composition-based stats.
 Identities = 10/27 (37%), Positives = 16/27 (59%), Gaps = 3/27 (11%)

Query: 62  CNHNFHVHCIQQWLETATAKGLCPMCR 88
           C H  H+ C++ W+E +     CP+CR
Sbjct: 377 CGHILHLSCLKNWMERSQT---CPICR 400

>ZYRO0C07194g Chr3 complement(542516..544192) [1677 bp, 558 aa] {ON}
           similar to uniprot|Q08109 Saccharomyces cerevisiae
           YOL013C HRD1 Ubiquitin-protein ligase required for
           endoplasmic reticulum-associated degradation (ERAD) of
           misfolded proteins genetically linked to the unfolded
           protein response (UPR) regulated through association
           with Hrd3p contains an H2 ring finger
          Length = 558

 Score = 32.7 bits (73), Expect = 0.24,   Method: Composition-based stats.
 Identities = 10/27 (37%), Positives = 16/27 (59%), Gaps = 3/27 (11%)

Query: 62  CNHNFHVHCIQQWLETATAKGLCPMCR 88
           C H  H+ C++ W+E +     CP+CR
Sbjct: 367 CGHVLHLFCLKNWMERSQT---CPICR 390

>Kpol_1048.73 s1048 (207883..212532) [4650 bp, 1549 aa] {ON}
            (207883..212532) [4650 nt, 1550 aa]
          Length = 1549

 Score = 32.7 bits (73), Expect = 0.25,   Method: Composition-based stats.
 Identities = 14/35 (40%), Positives = 19/35 (54%), Gaps = 3/35 (8%)

Query: 59   IGECNHNFHVHCIQQWLETATAKGLCPMCRQQFSL 93
            I +C H F   CIQ WL+    K  CP+C+ +  L
Sbjct: 1238 IIKCGHFFCKKCIQSWLKN---KNSCPLCKTETGL 1269

>Smik_15.157 Chr15 complement(268666..270318) [1653 bp, 550 aa] {ON}
           YOL013C (REAL)
          Length = 550

 Score = 32.3 bits (72), Expect = 0.25,   Method: Composition-based stats.
 Identities = 10/27 (37%), Positives = 16/27 (59%), Gaps = 3/27 (11%)

Query: 62  CNHNFHVHCIQQWLETATAKGLCPMCR 88
           C H  H+ C++ W+E +     CP+CR
Sbjct: 376 CGHILHLSCLKNWMERSQT---CPICR 399

>TDEL0B05200 Chr2 (914227..915801) [1575 bp, 524 aa] {ON} Anc_2.157
           YHR115C
          Length = 524

 Score = 32.3 bits (72), Expect = 0.26,   Method: Composition-based stats.
 Identities = 11/32 (34%), Positives = 20/32 (62%)

Query: 57  LVIGECNHNFHVHCIQQWLETATAKGLCPMCR 88
           + I  C+H +H  CI++ + T+  + +CP CR
Sbjct: 449 MFISPCSHCWHFQCIRRLVMTSYPQFVCPNCR 480

>YHR115C Chr8 complement(340109..341359) [1251 bp, 416 aa] {ON}
           DMA1Ubiquitin-protein ligase (E3); controls septin
           dynamics and the spindle position checkpoint (SPOC)
           along with functionally redundant ligase Dma2p by
           regulating the recruitment of Elm1p to the bud neck;
           regulates levels of the translation initiation factor
           eIF2 subunit Gcd11p, as well as abundance, localization,
           and ubiquitination of Cdk inhibitory kinase Swe1p;
           ortholog of human RNF8 protein, with sequence similarity
           to human Chfr; contains FHA and RING finger domains
          Length = 416

 Score = 32.3 bits (72), Expect = 0.26,   Method: Composition-based stats.
 Identities = 11/38 (28%), Positives = 21/38 (55%)

Query: 57  LVIGECNHNFHVHCIQQWLETATAKGLCPMCRQQFSLK 94
           + I  C H++H HC+++ +     + +CP CR    L+
Sbjct: 340 IFISPCAHSWHFHCVRRLVIMNYPQFMCPNCRTNCDLE 377

>Suva_15.159 Chr15 complement(274570..276222) [1653 bp, 550 aa] {ON}
           YOL013C (REAL)
          Length = 550

 Score = 32.3 bits (72), Expect = 0.26,   Method: Composition-based stats.
 Identities = 10/27 (37%), Positives = 16/27 (59%), Gaps = 3/27 (11%)

Query: 62  CNHNFHVHCIQQWLETATAKGLCPMCR 88
           C H  H+ C++ W+E +     CP+CR
Sbjct: 375 CGHILHLSCLKNWMERSQT---CPICR 398

>SAKL0D10890g Chr4 (904673..905470) [798 bp, 265 aa] {ON} similar to
           uniprot|P38632 Saccharomyces cerevisiae YEL019C MMS21
           Protein involved in DNA repair mutants are sensitive to
           the alkylating agent methyl methanesulfonate and show
           increased spontaneous mutation and mitotic recombination
          Length = 265

 Score = 32.3 bits (72), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 41/100 (41%), Gaps = 12/100 (12%)

Query: 4   EFKKVYPVFSWSWDIPG----DDNADKEIGDEDLCGICRVSYNGTCPGCRFPGDNCPLVI 59
           +  KV     + W  P     DDN D     ED   I   S   TCP    P +  P++ 
Sbjct: 142 DISKVLKALPYIWQDPTCVIPDDNMD-----EDDLQIAGGSIELTCPITCKPYEK-PMIS 195

Query: 60  GECNHNFHVHCIQQWLETATAKGLCPM--CRQQFSLKRGV 97
            +C H F +  IQ++L+       CP   C Q+  ++  V
Sbjct: 196 KKCGHVFDLSGIQEYLKDHRGPKKCPQGACGQEVEMRDFV 235

>KNAG0E02740 Chr5 complement(544981..546651) [1671 bp, 556 aa] {ON}
           Anc_6.45 YOL013C
          Length = 556

 Score = 32.3 bits (72), Expect = 0.29,   Method: Composition-based stats.
 Identities = 10/27 (37%), Positives = 15/27 (55%), Gaps = 3/27 (11%)

Query: 62  CNHNFHVHCIQQWLETATAKGLCPMCR 88
           C H  H  C++ W+E +     CP+CR
Sbjct: 400 CGHMLHFSCLKNWMERSQT---CPICR 423

>Ecym_7241 Chr7 (507764..510040) [2277 bp, 758 aa] {ON} similar to
           Ashbya gossypii AFR275W
          Length = 758

 Score = 32.3 bits (72), Expect = 0.29,   Method: Composition-based stats.
 Identities = 11/31 (35%), Positives = 18/31 (58%), Gaps = 3/31 (9%)

Query: 58  VIGECNHNFHVHCIQQWLETATAKGLCPMCR 88
           ++  C H FH  C++ W+   + K  CP+CR
Sbjct: 725 MVTPCAHVFHTECLENWM---SYKLQCPVCR 752

>KLTH0C04664g Chr3 (405366..406286) [921 bp, 306 aa] {ON} some
           similarities with uniprot|Q12161 Saccharomyces
           cerevisiae YOL054W PSH1 Nuclear protein putative RNA
           polymerase II elongation factor isolated as
           Pob3p/Spt16p- binding protein
          Length = 306

 Score = 32.0 bits (71), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 31/66 (46%), Gaps = 3/66 (4%)

Query: 58  VIGECNHNFHVHCIQQWLETATAKGL-CPMCRQQFSLKRGVAINECQMDSLAKLLLQSQP 116
           V+  C HN+   CI  WL +  A  L CP CR    LK   A+N    + L  ++     
Sbjct: 5   VMTSCGHNYCYECISNWLVSNNANELTCPQCRS--PLKEPPALNVALQNLLNYVVDNYAI 62

Query: 117 AALTTE 122
           ++L T+
Sbjct: 63  SSLQTD 68

>NCAS0A04760 Chr1 (948786..951071) [2286 bp, 761 aa] {ON} Anc_2.545
           YKL034W
          Length = 761

 Score = 32.3 bits (72), Expect = 0.33,   Method: Composition-based stats.
 Identities = 12/36 (33%), Positives = 19/36 (52%), Gaps = 3/36 (8%)

Query: 53  DNCPLVIGECNHNFHVHCIQQWLETATAKGLCPMCR 88
           D    ++  C+H FH  C++ W+     K  CP+CR
Sbjct: 723 DQHSYMVTPCDHIFHTDCLENWM---GYKLQCPVCR 755

>Kwal_26.8090 s26 complement(641408..642970) [1563 bp, 520 aa] {ON}
           YHL010C - Hypothetical ORF [contig 55] FULL
          Length = 520

 Score = 32.0 bits (71), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 27/68 (39%), Gaps = 16/68 (23%)

Query: 23  NADKEIGDEDLCGICRVSYNGTCPGC--RFPGDNCPLVIGECNHNFHVHCIQQWLETATA 80
            A KE+ D +L          TCP C  R   +   L    C H FH  C+ +W      
Sbjct: 214 TAKKEVQDTEL---------PTCPVCLERLDSEVTGLATIPCQHTFHCVCLNKW-----G 259

Query: 81  KGLCPMCR 88
              CP+CR
Sbjct: 260 DNRCPVCR 267

>NDAI0C02770 Chr3 (640635..642527) [1893 bp, 630 aa] {ON} Anc_6.45
           YOL013C
          Length = 630

 Score = 32.0 bits (71), Expect = 0.35,   Method: Composition-based stats.
 Identities = 12/35 (34%), Positives = 17/35 (48%), Gaps = 3/35 (8%)

Query: 62  CNHNFHVHCIQQWLETATAKGLCPMCRQQFSLKRG 96
           C H  H  C++ W+E +     CP+CR     K G
Sbjct: 425 CGHFLHFSCLKNWMERSQT---CPICRLDVFDKNG 456

>Smik_4.387 Chr4 complement(702765..704669) [1905 bp, 634 aa] {ON}
           YDR143C (REAL)
          Length = 634

 Score = 32.0 bits (71), Expect = 0.35,   Method: Composition-based stats.
 Identities = 19/75 (25%), Positives = 30/75 (40%), Gaps = 14/75 (18%)

Query: 62  CNHNFHVHCIQQWLETATAKGLCPMCRQQFSLKRG-----------VAINECQMDSLAKL 110
           C H F   CI +W     +   CP+CR + S   G           VA NE   + + ++
Sbjct: 267 CGHIFGRECIYKWSRLENS---CPLCRHKISENAGVQRAAEQDTDEVAANEAAFERIRRV 323

Query: 111 LLQSQPAALTTEDQD 125
           L        T+E+ +
Sbjct: 324 LYDPTAGNNTSENAN 338

>TDEL0A00410 Chr1 complement(70940..74728) [3789 bp, 1262 aa] {ON}
            Anc_3.22 YOL138C
          Length = 1262

 Score = 32.0 bits (71), Expect = 0.37,   Method: Composition-based stats.
 Identities = 13/42 (30%), Positives = 18/42 (42%), Gaps = 1/42 (2%)

Query: 34   CGICRVSYNGTCPGCRFPGDNCPLVIGECNHNFHVHCIQQWL 75
            C  C+   N  C  C  P  N  + + EC H  H  C++ W 
Sbjct: 1204 CDSCKKP-NSLCVMCEQPMKNLTMTLLECGHEGHFECLKGWF 1244

>Kpol_1072.55 s1072 (126281..127543) [1263 bp, 420 aa] {ON}
           (126281..127543) [1263 nt, 421 aa]
          Length = 420

 Score = 32.0 bits (71), Expect = 0.41,   Method: Composition-based stats.
 Identities = 12/33 (36%), Positives = 18/33 (54%)

Query: 56  PLVIGECNHNFHVHCIQQWLETATAKGLCPMCR 88
           P+ I  C H +H +CI   ++T   +  CP CR
Sbjct: 356 PVFISHCFHFWHFNCIMPIIQTTYPQFNCPNCR 388

>Kwal_56.22522 s56 (166498..168039) [1542 bp, 513 aa] {ON} YOL013C
           (HRD1) - required to degrade misfolded ER lumenal and
           integral membrane proteins [contig 185] FULL
          Length = 513

 Score = 32.0 bits (71), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 20/81 (24%), Positives = 33/81 (40%), Gaps = 10/81 (12%)

Query: 18  IPGDDNADKEIGDEDLCGICR--VSYNGTCPGCRFPGDNCPLVIGECNHNFHVHCIQQWL 75
           +P    A     D+ +C +C   +     C   +      P     CNH  H+ C++ W+
Sbjct: 300 LPDVSEAQLAASDDKMCIVCMDDMLAPSECTNAKQKPKRLP-----CNHCLHLGCLKSWM 354

Query: 76  ETATAKGLCPMCRQQFSLKRG 96
           E +     CP+CR     K+G
Sbjct: 355 ERSQT---CPICRVPVFDKKG 372

>TBLA0D04020 Chr4 complement(997081..1000617) [3537 bp, 1178 aa] {ON}
            Anc_8.288 YDR128W
          Length = 1178

 Score = 31.6 bits (70), Expect = 0.52,   Method: Composition-based stats.
 Identities = 13/41 (31%), Positives = 16/41 (39%), Gaps = 3/41 (7%)

Query: 45   CPGCRFPGDNCPLVIGECNHNFHVHCIQQWLETATAKGLCP 85
            C  C  P D    + G C H  H  C Q W +  +    CP
Sbjct: 1127 CVYCNHPADRSVFICGNCQHIMHPKCAQVWWKVDSE---CP 1164

>KAFR0B03420 Chr2 (713034..716144) [3111 bp, 1036 aa] {ON} Anc_8.761
           YMR231W
          Length = 1036

 Score = 31.6 bits (70), Expect = 0.58,   Method: Composition-based stats.
 Identities = 15/48 (31%), Positives = 25/48 (52%), Gaps = 3/48 (6%)

Query: 42  NGTCPGCRFPGDNCPLVIGECNHNFHVHCIQQWLETATAKGL--CPMC 87
           N TC  C+ P  + P+V  +C H +H +C+ +   T   + +  CP C
Sbjct: 933 NQTCFMCKLPM-HLPMVYFKCGHIYHQNCMDEEYSTEENELIFKCPKC 979

>Suva_2.304 Chr2 complement(537292..539166) [1875 bp, 624 aa] {ON}
           YDR143C (REAL)
          Length = 624

 Score = 31.6 bits (70), Expect = 0.62,   Method: Composition-based stats.
 Identities = 12/40 (30%), Positives = 19/40 (47%), Gaps = 3/40 (7%)

Query: 62  CNHNFHVHCIQQWLETATAKGLCPMCRQQFSLKRGVAINE 101
           C H F   C+ +W     +   CP+CR + S   GV + +
Sbjct: 275 CGHVFGRECLYKWSRLENS---CPLCRHKISESAGVPVQQ 311

>Smik_15.113 Chr15 (194228..195448) [1221 bp, 406 aa] {ON} YOL054W
           (REAL)
          Length = 406

 Score = 31.2 bits (69), Expect = 0.62,   Method: Composition-based stats.
 Identities = 23/79 (29%), Positives = 34/79 (43%), Gaps = 9/79 (11%)

Query: 62  CNHNFHVHCIQQWLETATAKGL-CPMCRQQFSLKRGVAINECQ-----MDSLAKLLLQSQ 115
           C HN+   C+  W  + T K L CP CR   +    +     Q     +D L+    +S 
Sbjct: 45  CGHNYCYGCLNTWFASNTQKELACPQCRSDITTIPALNTTLQQYLSFILDKLSSENDESF 104

Query: 116 PAALTT---EDQDMMMDQE 131
              LTT   E+ D  +D+E
Sbjct: 105 KKLLTTKIREETDYKLDKE 123

>Kwal_27.10419 s27 (337699..338601) [903 bp, 300 aa] {ON} YOL054W
          - Hypothetical ORF [contig 36] FULL
          Length = 300

 Score = 31.2 bits (69), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 17/32 (53%), Gaps = 1/32 (3%)

Query: 58 VIGECNHNFHVHCIQQWLETATAKGL-CPMCR 88
          V+  C HN+   CI  WL +  A  L CP CR
Sbjct: 5  VMTTCGHNYCYDCISNWLVSNNANELTCPQCR 36

>SAKL0E10824g Chr5 complement(902623..904050) [1428 bp, 475 aa] {ON}
           similar to uniprot|Q75BK4 Ashbya gossypii ACR267C
           ACR267Cp and some similarites with YNL116W
           uniprot|P53924 Saccharomyces cerevisiae YNL116W DMA2
           Protein involved in regulating spindle position and
           orientation functionally redundant with Dma1p homolog of
           S. pombe Dma1 and H. sapiens Chfr
          Length = 475

 Score = 31.2 bits (69), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 10/32 (31%), Positives = 21/32 (65%)

Query: 57  LVIGECNHNFHVHCIQQWLETATAKGLCPMCR 88
           + I  C+H++H  C+++ + T+  + +CP CR
Sbjct: 402 IFISPCSHSWHYQCVRRLVMTSYPQFVCPNCR 433

>Kpol_538.5 s538 (7029..8036) [1008 bp, 335 aa] {ON} (7029..8036)
          [1008 nt, 336 aa]
          Length = 335

 Score = 31.2 bits (69), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 20/41 (48%), Gaps = 3/41 (7%)

Query: 50 FPGDNCPLVIGECNHNFHVHCIQQWLETATAKGLCPMCRQQ 90
          F  D C L    C+H FH+ CI+ W   A     CP CR +
Sbjct: 13 FKEDRCAL--NPCHHTFHLECIRIWHSYADDLK-CPTCRTE 50

>KLLA0F23892g Chr6 complement(2229493..2231049) [1557 bp, 518 aa]
           {ON} some similarities with uniprot|P53924 Saccharomyces
           cerevisiae YNL116W DMA2 Protein involved in regulating
           spindle position and orientation functionally redundant
           with Dma1p homolog of S. pombe Dma1 and H. sapiens Chfr
          Length = 518

 Score = 31.2 bits (69), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 11/32 (34%), Positives = 19/32 (59%)

Query: 57  LVIGECNHNFHVHCIQQWLETATAKGLCPMCR 88
           + I  C+H++H  CI+Q +     + +CP CR
Sbjct: 405 VFIAPCSHSWHFKCIRQLVSKTYPQFVCPNCR 436

>KLTH0C10604g Chr3 complement(878953..880500) [1548 bp, 515 aa] {ON}
           similar to uniprot|Q08109 Saccharomyces cerevisiae
           YOL013C HRD1 Ubiquitin-protein ligase required for
           endoplasmic reticulum-associated degradation (ERAD) of
           misfolded proteins genetically linked to the unfolded
           protein response (UPR) regulated through association
           with Hrd3p contains an H2 ring finger
          Length = 515

 Score = 31.2 bits (69), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 22/39 (56%), Gaps = 4/39 (10%)

Query: 62  CNHNFHVHCIQQWLETATAKGLCPMCR-QQFSLKRGVAI 99
           CNH  H+ C++ W+E +     CP+CR   F  K  VA+
Sbjct: 339 CNHCLHLGCLKSWMERSQT---CPICRVSVFDSKGNVAL 374

>Kwal_14.1287 s14 (263082..267638) [4557 bp, 1518 aa] {ON} YLR247C -
            Hypothetical ORF [contig 244] FULL
          Length = 1518

 Score = 31.2 bits (69), Expect = 0.77,   Method: Composition-based stats.
 Identities = 14/48 (29%), Positives = 24/48 (50%), Gaps = 11/48 (22%)

Query: 54   NCPLVIGE--------CNHNFHVHCIQQWLETATAKGLCPMCRQQFSL 93
            +C + +GE        C H F   CI  WL+  ++   CP+C+ Q ++
Sbjct: 1188 SCTICLGEIYMGSVIKCGHFFCQDCICSWLKNHSS---CPLCKMQTTM 1232

>KLTH0E09834g Chr5 complement(885503..886942) [1440 bp, 479 aa] {ON}
           some similarities with uniprot|P53924 Saccharomyces
           cerevisiae YNL116W DMA2 Protein involved in regulating
           spindle position and orientation functionally redundant
           with Dma1p homolog of S. pombe Dma1 and H. sapiens Chfr
          Length = 479

 Score = 31.2 bits (69), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 14/50 (28%), Positives = 27/50 (54%), Gaps = 3/50 (6%)

Query: 57  LVIGECNHNFHVHCIQQWLETATAKGLCPMCRQQFSLKRGVAINECQMDS 106
           + I  C+H++H  C+++ + T   + +CP CR    L+  +   +  MDS
Sbjct: 411 IFISPCSHSWHYQCVRRLVMTTYPQFVCPNCRSSCDLEASL---DSDMDS 457

>NCAS0B00990 Chr2 complement(154925..156103) [1179 bp, 392 aa]
          {ON} Anc_8.808 YOL054W
          Length = 392

 Score = 31.2 bits (69), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 12/36 (33%), Positives = 20/36 (55%), Gaps = 1/36 (2%)

Query: 58 VIGECNHNFHVHCIQQWLETATAKGL-CPMCRQQFS 92
          ++  C HN+   C++ W+ T + K L CP CR   +
Sbjct: 41 MMTSCGHNYCYGCLKSWISTNSKKELACPQCRSDIT 76

>SAKL0H15686g Chr8 (1367935..1367948,1368042..1369827) [1800 bp, 599
           aa] {ON} some similarities with uniprot|P22470
           Saccharomyces cerevisiae YDR143C SAN1 Ubiquitin-protein
           ligase controls turnover of a specific class of unstable
           nuclear proteins including Sir4p but not Sir2p or Sir3p
           san1 mutations suppress sir4 spt16 and cdc68 mutations
           suggesting a role in chromatin silencing
          Length = 599

 Score = 31.2 bits (69), Expect = 0.82,   Method: Composition-based stats.
 Identities = 12/37 (32%), Positives = 19/37 (51%), Gaps = 3/37 (8%)

Query: 61  ECNHNFHVHCIQQWLETATAKGLCPMCRQQFSLKRGV 97
           +C H F   CI QW +   +   CP+CR +   + G+
Sbjct: 246 KCGHRFGRMCIYQWTKEHNS---CPICRAEIVGREGL 279

>NDAI0E01840 Chr5 complement(367943..371395) [3453 bp, 1150 aa] {ON}
           Anc_2.411
          Length = 1150

 Score = 31.2 bits (69), Expect = 0.83,   Method: Composition-based stats.
 Identities = 16/54 (29%), Positives = 27/54 (50%), Gaps = 3/54 (5%)

Query: 57  LVIGECNHNFHVHCIQQWLETATAKGL---CPMCRQQFSLKRGVAINECQMDSL 107
           +V  EC H F  +C+ ++    + K L   CP CR+  S  R + + + +  SL
Sbjct: 910 VVFTECGHPFCENCLDEYFAFQSQKKLDFNCPNCREGISPSRLLTLYKDESQSL 963

>YOL054W Chr15 (228614..229834) [1221 bp, 406 aa] {ON}  PSH1E3
          ubiquitin ligase that mediates poyubiquitination and
          degradation of centromere-binding protein Cse4p and
          prevents Cse4p from mislocalizing to euchromatin;
          ubiquitylation of Cse4p may be antagonized by Scm3p
          Length = 406

 Score = 30.8 bits (68), Expect = 0.83,   Method: Composition-based stats.
 Identities = 12/32 (37%), Positives = 16/32 (50%), Gaps = 1/32 (3%)

Query: 62 CNHNFHVHCIQQWLETATAKGL-CPMCRQQFS 92
          C HN+   C+  W  + T K L CP CR   +
Sbjct: 45 CGHNYCYGCLNTWFASNTQKELACPQCRSDIT 76

>NCAS0A12550 Chr1 (2476209..2477927) [1719 bp, 572 aa] {ON}
           Anc_2.542
          Length = 572

 Score = 30.8 bits (68), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 21/47 (44%), Gaps = 7/47 (14%)

Query: 44  TCPGC--RFPGDNCPLVIGECNHNFHVHCIQQWLETATAKGLCPMCR 88
           TCP C  +   +   L+   C H FH  C+ +W         CP+CR
Sbjct: 237 TCPVCLEQLDCETTGLITIPCQHTFHCQCLDKW-----KNSRCPVCR 278

>Suva_15.311 Chr15 complement(542475..543284) [810 bp, 269 aa] {ON}
           YHR115C (REAL)
          Length = 269

 Score = 30.8 bits (68), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 10/34 (29%), Positives = 20/34 (58%)

Query: 57  LVIGECNHNFHVHCIQQWLETATAKGLCPMCRQQ 90
           + I  C H++H HC+++ +  +  + +CP CR  
Sbjct: 193 IFISPCAHSWHFHCVRRLVILSYPQFMCPNCRSN 226

>KLLA0F12166g Chr6 complement(1116715..1121301) [4587 bp, 1528 aa]
            {ON} similar to uniprot|Q06554 Saccharomyces cerevisiae
            YLR247C Hypothetical ORF
          Length = 1528

 Score = 30.8 bits (68), Expect = 0.92,   Method: Composition-based stats.
 Identities = 12/34 (35%), Positives = 18/34 (52%), Gaps = 3/34 (8%)

Query: 59   IGECNHNFHVHCIQQWLETATAKGLCPMCRQQFS 92
            I +C H F   C+  W +  T+   CPMC+ + S
Sbjct: 1220 ILKCGHFFCKDCVTHWFKKNTS---CPMCKNRMS 1250

>ZYRO0C03190g Chr3 (245542..249363) [3822 bp, 1273 aa] {ON} similar to
            uniprot|Q92271 Saccharomyces cerevisiae YOL138C
            Hypothetical ORF
          Length = 1273

 Score = 30.8 bits (68), Expect = 0.96,   Method: Composition-based stats.
 Identities = 20/62 (32%), Positives = 26/62 (41%), Gaps = 5/62 (8%)

Query: 34   CGICRVSYNGTCPGCRFPGDNCPLVIGECNHNFHVHCIQQW-LETATAKGLCP-MCRQQF 91
            C  C+   N  C  C  P     + + EC H  H  C+Q W L+   A+  CP  C  Q 
Sbjct: 1215 CDSCKKP-NTLCVFCERPIKTLAIGLLECGHEGHFQCLQSWFLDEGMAE--CPGGCMNQI 1271

Query: 92   SL 93
             L
Sbjct: 1272 RL 1273

>Kpol_478.8 s478 complement(33393..38306,38308..39462) [6069 bp, 2022
            aa] {ON} complement(33393..38306,38308..39462) [6069 nt,
            2023 aa]
          Length = 2022

 Score = 30.8 bits (68), Expect = 1.0,   Method: Composition-based stats.
 Identities = 12/34 (35%), Positives = 20/34 (58%), Gaps = 3/34 (8%)

Query: 58   VIGECNHNFHVHCIQQWL---ETATAKGLCPMCR 88
            V   CNH FH+ C+ ++L   +   A  +CP+C+
Sbjct: 1333 VFVSCNHKFHLKCVDRYLAKKKFKFAAFICPLCQ 1366

>YEL019C Chr5 complement(120498..121301) [804 bp, 267 aa] {ON}
           MMS21SUMO ligase and component of the SMC5-SMC6 complex;
           this complex plays a key role in the removal of X-shaped
           DNA structures that arise between sister chromatids
           during DNA replication and repair; mutants are sensitive
           to methyl methanesulfonate and show increased
           spontaneous mutation and mitotic recombination
          Length = 267

 Score = 30.4 bits (67), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 41/94 (43%), Gaps = 5/94 (5%)

Query: 7   KVYPVFSWSWDIPGDDNAD-KEIGDEDLCGICRVSYNGTCPGCRFPGDNCPLVIGECNHN 65
           K+  V  + W+ P     D +   DED   I       TCP    P +  PL+  +CNH 
Sbjct: 145 KILKVLPYIWNDPTCVIPDLQNPADEDDLQIEGGKIELTCPITCKPYE-APLISRKCNHV 203

Query: 66  FHVHCIQQWLETATAKGLCPM--CRQQFSLKRGV 97
           F    IQ +L+  T +  CP   C Q  S++  V
Sbjct: 204 FDRDGIQNYLQGYTTRD-CPQAACSQVVSMRDFV 236

>Ecym_5428 Chr5 complement(881972..883396) [1425 bp, 474 aa] {ON}
           similar to Ashbya gossypii ACR267C
          Length = 474

 Score = 30.8 bits (68), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 11/32 (34%), Positives = 20/32 (62%)

Query: 57  LVIGECNHNFHVHCIQQWLETATAKGLCPMCR 88
           + I  C+H++H  CI++ + T   + +CP CR
Sbjct: 390 IFISPCSHSWHYQCIRRLVMTQYPQFVCPNCR 421

>Suva_10.112 Chr10 (211443..214946) [3504 bp, 1167 aa] {ON} YLR032W
           (REAL)
          Length = 1167

 Score = 30.8 bits (68), Expect = 1.0,   Method: Composition-based stats.
 Identities = 15/45 (33%), Positives = 23/45 (51%), Gaps = 3/45 (6%)

Query: 58  VIGECNHNFHVHCIQQWLETATAKGL---CPMCRQQFSLKRGVAI 99
           V  EC H+F   C+ +++E    K L   CP CR+     R +A+
Sbjct: 928 VFTECGHSFCEKCLFEYIEFQNGKQLSLKCPNCREPIDGGRLLAL 972

>Skud_15.102 Chr15 (187319..188539) [1221 bp, 406 aa] {ON} YOL054W
          (REAL)
          Length = 406

 Score = 30.8 bits (68), Expect = 1.1,   Method: Composition-based stats.
 Identities = 12/28 (42%), Positives = 15/28 (53%), Gaps = 1/28 (3%)

Query: 62 CNHNFHVHCIQQWLETATAKGL-CPMCR 88
          C HN+   C+  W  + T K L CP CR
Sbjct: 45 CGHNYCYGCLNTWFASNTQKELACPQCR 72

>ACR267C Chr3 complement(841323..842726) [1404 bp, 467 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL116W and
           YHR115C
          Length = 467

 Score = 30.4 bits (67), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 11/32 (34%), Positives = 20/32 (62%)

Query: 57  LVIGECNHNFHVHCIQQWLETATAKGLCPMCR 88
           + I  C+H++H  CI++ + T   + +CP CR
Sbjct: 381 IFISPCSHSWHYQCIRRLVMTQYPQFICPNCR 412

>Suva_14.223 Chr14 (404941..406683) [1743 bp, 580 aa] {ON} YNL116W
           (REAL)
          Length = 580

 Score = 30.4 bits (67), Expect = 1.2,   Method: Composition-based stats.
 Identities = 10/38 (26%), Positives = 21/38 (55%)

Query: 57  LVIGECNHNFHVHCIQQWLETATAKGLCPMCRQQFSLK 94
           + I  C H++H  C+++ +  +  + +CP CR    L+
Sbjct: 504 IFISPCAHSWHFRCVRRLVMLSYPQFICPNCRSSCDLE 541

>YBR114W Chr2 (467248..469620) [2373 bp, 790 aa] {ON}  RAD16Protein
           that recognizes and binds damaged DNA in an
           ATP-dependent manner (with Rad7p) during nucleotide
           excision repair; subunit of Nucleotide Excision Repair
           Factor 4 (NEF4) and the Elongin-Cullin-Socs (ECS) ligase
           complex
          Length = 790

 Score = 30.4 bits (67), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 33/76 (43%), Gaps = 16/76 (21%)

Query: 50  FPGDNCPLVI-------------GECNHNFHVHCIQQWLET---ATAKGLCPMCRQQFSL 93
           FPGD+  +VI              +C+H F   CI++++E+      K  CP+C    S+
Sbjct: 527 FPGDDIGVVICQLCNDEAEEPIESKCHHKFCRLCIKEYVESFMENNNKLTCPVCHIGLSI 586

Query: 94  KRGVAINECQMDSLAK 109
                  E  +DS  K
Sbjct: 587 DLSQPALEVDLDSFKK 602

>TPHA0A03340 Chr1 (734754..735908) [1155 bp, 384 aa] {ON}
          Anc_3.405 YPR093C
          Length = 384

 Score = 30.4 bits (67), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 19/46 (41%), Gaps = 1/46 (2%)

Query: 43 GTCPGCRFPGDNCPLVIGECNHNFHVHCIQQWLETATAKGLCPMCR 88
            C  C    D     +  CNH +H+ CI+ W   +     CP CR
Sbjct: 17 SICAICLDAIDKSIAKLEPCNHKYHIDCIRTWHNYSNDLN-CPTCR 61

>ZYRO0A08932g Chr1 complement(712694..716260) [3567 bp, 1188 aa]
           {ON} similar to uniprot|P32849 Saccharomyces cerevisiae
           YLR032W RAD5 Single-stranded DNA-dependent ATPase
           involved in postreplication repair contains RING finger
           domain
          Length = 1188

 Score = 30.8 bits (68), Expect = 1.2,   Method: Composition-based stats.
 Identities = 13/32 (40%), Positives = 19/32 (59%), Gaps = 3/32 (9%)

Query: 61  ECNHNFHVHCIQQWLETATAKGL---CPMCRQ 89
           EC H+F   C++++LE    K L   CP CR+
Sbjct: 952 ECCHSFCEECLKEYLEFQKQKELELKCPNCRE 983

>Smik_13.439 Chr13 (717478..720570) [3093 bp, 1030 aa] {ON} YMR231W
           (REAL)
          Length = 1030

 Score = 30.4 bits (67), Expect = 1.2,   Method: Composition-based stats.
 Identities = 18/51 (35%), Positives = 23/51 (45%), Gaps = 8/51 (15%)

Query: 42  NGTCPGCRFPGDNCPLVIGECNHNFHVHCIQQWLETATAKG-----LCPMC 87
           N TC  C    D  P+V  +C H +H HC+ +  E  T K       CP C
Sbjct: 926 NQTCFMCNLTLD-VPVVFFKCGHIYHQHCLNE--EEDTLKNERKLFKCPKC 973

>ZYRO0C17424g Chr3 complement(1357940..1358761) [822 bp, 273 aa]
          {ON} weakly similar to uniprot|Q06834 Saccharomyces
          cerevisiae YPR093C ASR1 Protein involved in a putative
          alcohol-responsive signaling pathway accumulates in the
          nucleus under alcohol stress contains a Ring/PHD finger
          domain
          Length = 273

 Score = 30.4 bits (67), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 22/48 (45%), Gaps = 4/48 (8%)

Query: 44 TCPGCRFPGDNCPLVIGE---CNHNFHVHCIQQWLETATAKGLCPMCR 88
          TCP C          IG    CNH FH  C+++W        +CP+CR
Sbjct: 4  TCPICLDDDRTNIESIGTLQPCNHKFHRDCLRRW-HLYAHDLVCPICR 50

>Suva_1.69 Chr1 (120731..124546) [3816 bp, 1271 aa] {ON} YAL002W
            (REAL)
          Length = 1271

 Score = 30.4 bits (67), Expect = 1.3,   Method: Composition-based stats.
 Identities = 15/39 (38%), Positives = 21/39 (53%), Gaps = 1/39 (2%)

Query: 56   PLVIGECNHNFHVHCIQQWLETATAKGLCPMCRQQFSLK 94
            PLVI +C+H FH  C++  L     K  C +C  + S K
Sbjct: 1234 PLVIFKCHHGFHQTCLEN-LAQKPNKYTCLICETKSSPK 1271

>Skud_12.99 Chr12 (196796..200311) [3516 bp, 1171 aa] {ON} YLR032W
           (REAL)
          Length = 1171

 Score = 30.4 bits (67), Expect = 1.3,   Method: Composition-based stats.
 Identities = 15/49 (30%), Positives = 24/49 (48%), Gaps = 3/49 (6%)

Query: 61  ECNHNFHVHCIQQWLETATAKGL---CPMCRQQFSLKRGVAINECQMDS 106
           EC H+F   C+ ++++    K L   CP CR      R +A+   + DS
Sbjct: 933 ECGHSFCEKCLFEYIDFQNGKKLCLKCPNCRDSIDGGRLLALGRQRSDS 981

>Skud_14.216 Chr14 (398407..399999) [1593 bp, 530 aa] {ON} YNL116W
           (REAL)
          Length = 530

 Score = 30.4 bits (67), Expect = 1.3,   Method: Composition-based stats.
 Identities = 10/38 (26%), Positives = 21/38 (55%)

Query: 57  LVIGECNHNFHVHCIQQWLETATAKGLCPMCRQQFSLK 94
           + I  C H++H  C+++ +  +  + +CP CR    L+
Sbjct: 454 IFISPCAHSWHFRCVRRLVMLSYPQFVCPNCRSSCDLE 491

>TDEL0F02870 Chr6 complement(518828..519610) [783 bp, 260 aa] {ON} 
          Length = 260

 Score = 30.0 bits (66), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 15/59 (25%), Positives = 32/59 (54%), Gaps = 12/59 (20%)

Query: 57  LVIGECNHNFHVHCIQQWLETATAKG-----LCPMCR------QQFSLKRGVAINECQM 104
           +V+  C H FH  C+++W  +   +G     +CP+CR      + F ++ G+ ++E ++
Sbjct: 180 IVMIPCQHYFHAGCLKEWF-SPQRRGKRRPLVCPLCRMDIVKCKAFCMRLGLLMSELKV 237

>KAFR0B05580 Chr2 (1142731..1146093) [3363 bp, 1120 aa] {ON} Anc_8.288
            YDR128W
          Length = 1120

 Score = 30.4 bits (67), Expect = 1.4,   Method: Composition-based stats.
 Identities = 14/56 (25%), Positives = 22/56 (39%), Gaps = 8/56 (14%)

Query: 44   TCPGCRFPGDNCPLVIGECNHNFHVHCIQQWLETATAKGLCP-----MCRQQFSLK 94
            +C  C         + G C H  H  C ++W  T    G CP     +C + + L+
Sbjct: 1068 SCNYCNLKVKGTAFICGSCQHILHSSCAKEWWTTG---GECPAGCGCICPEMYDLE 1120

>TBLA0B03370 Chr2 complement(784352..787546) [3195 bp, 1064 aa] {ON}
            Anc_8.761 YMR231W
          Length = 1064

 Score = 30.4 bits (67), Expect = 1.4,   Method: Composition-based stats.
 Identities = 18/72 (25%), Positives = 31/72 (43%), Gaps = 3/72 (4%)

Query: 42   NGTCPGCRFPGDNCPLVIGECNHNFHVHCIQQWLETATAKGL--CPMCRQQFSLKRGVAI 99
            N TC  C    D  P+V   CNH +H  C+ +       + L  CP C       + +  
Sbjct: 961  NETCRMCHSSLD-LPIVFFRCNHIYHQKCLNEETNFKDGEKLFRCPKCVIDLQTSQKLVS 1019

Query: 100  NECQMDSLAKLL 111
             + ++ + +K+L
Sbjct: 1020 TQNEIANQSKIL 1031

>YNL116W Chr14 (408341..409909) [1569 bp, 522 aa] {ON}
           DMA2Ubiquitin-protein ligase (E3); controls septin
           dynamics and the spindle position checkpoint (SPOC)
           along with functionally redundant ligase Dma1p by
           regulating the recruitment of Elm1p to the bud neck;
           regulates levels of the translation initiation factor
           eIF2 subunit Gcd11p, as well as abundance, localization,
           and ubiquitination of Cdk inhibitory kinase Swe1p;
           ortholog of human RNF8 protein, with sequence similarity
           to human Chfr; contains FHA and RING finger domains
          Length = 522

 Score = 30.4 bits (67), Expect = 1.4,   Method: Composition-based stats.
 Identities = 10/38 (26%), Positives = 21/38 (55%)

Query: 57  LVIGECNHNFHVHCIQQWLETATAKGLCPMCRQQFSLK 94
           + I  C H++H  C+++ +  +  + +CP CR    L+
Sbjct: 446 IFISPCAHSWHFRCVRRLVMLSYPQFVCPNCRSSCDLE 483

>Skud_16.379 Chr16 complement(683736..684602) [867 bp, 288 aa]
          {ON} YPR093C (REAL)
          Length = 288

 Score = 30.0 bits (66), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 20/31 (64%), Gaps = 1/31 (3%)

Query: 62 CNHNFHVHCIQQWLETATAKGLCPMCRQQFS 92
          C H FH++CI++W + +     CP+CR + S
Sbjct: 23 CKHKFHLNCIREWHKYSIDLK-CPICRIESS 52

>Smik_14.212 Chr14 (387986..389575) [1590 bp, 529 aa] {ON} YNL116W
           (REAL)
          Length = 529

 Score = 30.4 bits (67), Expect = 1.5,   Method: Composition-based stats.
 Identities = 10/38 (26%), Positives = 21/38 (55%)

Query: 57  LVIGECNHNFHVHCIQQWLETATAKGLCPMCRQQFSLK 94
           + I  C H++H  C+++ +  +  + +CP CR    L+
Sbjct: 453 IFISPCAHSWHFRCVRRLVMLSYPQFVCPNCRSSCDLE 490

>TBLA0C01330 Chr3 (291659..296017) [4359 bp, 1452 aa] {ON} Anc_1.389
            YLR247C
          Length = 1452

 Score = 30.4 bits (67), Expect = 1.5,   Method: Composition-based stats.
 Identities = 12/30 (40%), Positives = 17/30 (56%), Gaps = 1/30 (3%)

Query: 59   IGECNHNFHVHCIQQWLETATAKGLCPMCR 88
            I +C H +   CI  WLE +  K  CP+C+
Sbjct: 1149 ILKCGHYYCQDCIWNWLEKSKKKN-CPICK 1177

>ACL019C Chr3 complement(328044..329771) [1728 bp, 575 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL013C
           (HRD1)
          Length = 575

 Score = 30.0 bits (66), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 20/83 (24%), Positives = 35/83 (42%), Gaps = 13/83 (15%)

Query: 6   KKVYPVFSWSWDIPGDDNADKEIGDEDLCGICRVSYNGTCPGCRFPGDNCPLVIGECNHN 65
           KK+Y   S        D +++++ D D   +C +  +   P       N    +  C H 
Sbjct: 299 KKLYEKLS--------DVSEEQLDDTD--SMCIICMDDMLPTTETTKMNRRAKMLPCGHM 348

Query: 66  FHVHCIQQWLETATAKGLCPMCR 88
            H  C++ W+E +     CP+CR
Sbjct: 349 LHFGCLKSWMERSQT---CPICR 368

>Kwal_47.17771 s47 (548453..551371) [2919 bp, 972 aa] {ON} YLR032W
           (RAD5) - putative ATPase/DNA helicase [contig 204]
           PARTIAL
          Length = 972

 Score = 30.0 bits (66), Expect = 1.7,   Method: Composition-based stats.
 Identities = 14/48 (29%), Positives = 24/48 (50%), Gaps = 3/48 (6%)

Query: 57  LVIGECNHNFHVHCIQQWLETATAKGL---CPMCRQQFSLKRGVAINE 101
           ++  EC H F   CI +++   T +     CP CR + + KR + I +
Sbjct: 733 VIFTECGHAFCELCILEYIRFQTERQQDIKCPNCRHEINPKRLLTIKQ 780

>SAKL0D08272g Chr4 complement(687452..691927) [4476 bp, 1491 aa] {ON}
            similar to uniprot|Q06554 Saccharomyces cerevisiae
            YLR247C Hypothetical ORF
          Length = 1491

 Score = 30.0 bits (66), Expect = 1.8,   Method: Composition-based stats.
 Identities = 12/35 (34%), Positives = 18/35 (51%), Gaps = 3/35 (8%)

Query: 59   IGECNHNFHVHCIQQWLETATAKGLCPMCRQQFSL 93
            I +C H F   CI  WL    A   CP+C+ + ++
Sbjct: 1176 IIKCGHFFCKSCIHSWLRNKNA---CPLCKMETNI 1207

>YPR093C Chr16 complement(719558..720424) [867 bp, 288 aa] {ON}
          ASR1Ubiquitin ligase that modifies and regulates RNA
          Pol II; involved in a putative alcohol-responsive
          signaling pathway; accumulates in the nucleus under
          alcohol stress; contains a Ring/PHD finger domain
          similar to the mammalian rA9 protein
          Length = 288

 Score = 30.0 bits (66), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 18/27 (66%), Gaps = 1/27 (3%)

Query: 62 CNHNFHVHCIQQWLETATAKGLCPMCR 88
          C H FH++CI++W + +     CP+CR
Sbjct: 23 CGHKFHLNCIREWHKYSINLK-CPICR 48

>CAGL0B05049g Chr2 (487186..491598) [4413 bp, 1470 aa] {ON} some
            similarities with uniprot|Q06554 Saccharomyces cerevisiae
            YLR247c
          Length = 1470

 Score = 30.0 bits (66), Expect = 1.8,   Method: Composition-based stats.
 Identities = 16/48 (33%), Positives = 21/48 (43%), Gaps = 5/48 (10%)

Query: 45   CPGCRFPGDNCPLVIGECNHNFHVHCIQQWLETATAKGLCPMCRQQFS 92
            C  C  P  N  +V   C H F   CI  WL+    +  CP+C+   S
Sbjct: 1164 CSICLQPITNGAMV--NCGHLFCTSCIFSWLKN---RKTCPLCKHPTS 1206

>TPHA0O00820 Chr15 complement(155829..156713) [885 bp, 294 aa] {ON}
           Anc_1.448 YEL019C
          Length = 294

 Score = 30.0 bits (66), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 34/141 (24%), Positives = 61/141 (43%), Gaps = 26/141 (18%)

Query: 1   MKIEFKKVYPVFSWSWDIPGDDNADKEI---------GDEDLC---GICRVSYNGTCPGC 48
           +++E  K+  V  + W  P +   D+ I          D+DL    G+  ++   TC   
Sbjct: 157 IELEKDKLLRVLPYLWQNPANVIPDEVIRGAPINQSNTDDDLKIEGGVIELTCPITCKTY 216

Query: 49  RFPGDNCPLVIGECNHNFHVHCIQQWLETATAKGLCPM--CRQQ-----FSLKRGVAINE 101
           R P     ++  +C H F    I+ +LET   +  CP   C Q+     FSL + + I  
Sbjct: 217 RRP-----MISKKCGHVFDEQGIKSYLETQGERD-CPQAACSQKVKLSDFSLDK-IMILR 269

Query: 102 CQMDSLAKLLLQSQPAALTTE 122
           C+++ + +L ++     L  E
Sbjct: 270 CKINKIKQLRVKEDNDKLNQE 290

>KNAG0I01380 Chr9 (265230..269711) [4482 bp, 1493 aa] {ON} Anc_1.389
            YLR247C
          Length = 1493

 Score = 30.0 bits (66), Expect = 1.9,   Method: Composition-based stats.
 Identities = 13/45 (28%), Positives = 21/45 (46%), Gaps = 11/45 (24%)

Query: 54   NCPLVIG--------ECNHNFHVHCIQQWLETATAKGLCPMCRQQ 90
            NC + +G        +C H F   CI  WL+       CP+C+++
Sbjct: 1176 NCSICLGIIHHGSIMKCGHFFCRDCIHSWLKNQRT---CPICKRE 1217

>Kwal_56.23900 s56 complement(764530..766299) [1770 bp, 589 aa] {ON}
           YDR143C (SAN1) - (putative) transcriptional regulator
           [contig 171] FULL
          Length = 589

 Score = 30.0 bits (66), Expect = 1.9,   Method: Composition-based stats.
 Identities = 16/64 (25%), Positives = 27/64 (42%), Gaps = 11/64 (17%)

Query: 62  CNHNFHVHCIQQWLETATAKGLCPMCRQQFSLKRGVAIN--------ECQMDSLAKLLLQ 113
           C+H F   CI+QW         CP+CR       G+  N        +  ++ + +LL  
Sbjct: 227 CSHVFGRECIRQW---TNLHNTCPICRANIVGADGLNNNFAMDDLEDQASLERIRRLLYD 283

Query: 114 SQPA 117
           + P+
Sbjct: 284 TAPS 287

>TDEL0C05420 Chr3 complement(972821..973102) [282 bp, 93 aa] {ON}
          Anc_3.405 YPR093C
          Length = 93

 Score = 28.9 bits (63), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 14/27 (51%), Gaps = 1/27 (3%)

Query: 62 CNHNFHVHCIQQWLETATAKGLCPMCR 88
          C H FH  CI++W  T      CP CR
Sbjct: 26 CRHKFHKECIRRW-HTGAIDLKCPTCR 51

>TDEL0B00890 Chr2 (170522..172144) [1623 bp, 540 aa] {ON}
          Anc_8.808 YOL054W
          Length = 540

 Score = 30.0 bits (66), Expect = 2.0,   Method: Composition-based stats.
 Identities = 11/32 (34%), Positives = 18/32 (56%), Gaps = 1/32 (3%)

Query: 58 VIGECNHNFHVHCIQQWLETATAKGL-CPMCR 88
          ++ +C HN+   C+  W E+   + L CP CR
Sbjct: 41 MMTQCGHNYCYDCLLAWFESNPEEELSCPQCR 72

>Smik_12.94 Chr12 (191768..195304) [3537 bp, 1178 aa] {ON} YLR032W
           (REAL)
          Length = 1178

 Score = 30.0 bits (66), Expect = 2.0,   Method: Composition-based stats.
 Identities = 17/59 (28%), Positives = 25/59 (42%), Gaps = 13/59 (22%)

Query: 34  CGICRVSYNGTCPGCRFPGDNCPLVIGECNHNFHVHCIQQWLETATAKGL---CPMCRQ 89
           C IC             P D   ++  EC H+F   C+ +++E    K L   CP CR+
Sbjct: 923 CSICTAE----------PIDIDKVLFTECGHSFCEKCLFEYIEFQKGKNLCLKCPNCRK 971

>NCAS0C04430 Chr3 complement(905927..909862) [3936 bp, 1311 aa] {ON}
            Anc_3.22 YOL138C
          Length = 1311

 Score = 30.0 bits (66), Expect = 2.2,   Method: Composition-based stats.
 Identities = 12/42 (28%), Positives = 16/42 (38%), Gaps = 1/42 (2%)

Query: 34   CGICRVSYNGTCPGCRFPGDNCPLVIGECNHNFHVHCIQQWL 75
            C  C+   N  C  C  P     + I +C H  H  C + W 
Sbjct: 1253 CDSCKKP-NSLCIFCERPMKKLTMAILQCGHEAHFQCFRSWF 1293

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.139    0.466 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 14,911,420
Number of extensions: 590367
Number of successful extensions: 2087
Number of sequences better than 10.0: 332
Number of HSP's gapped: 1984
Number of HSP's successfully gapped: 332
Length of query: 135
Length of database: 53,481,399
Length adjustment: 97
Effective length of query: 38
Effective length of database: 42,358,797
Effective search space: 1609634286
Effective search space used: 1609634286
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)
S2: 59 (27.3 bits)