Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_56.227993.160ON53153126160.0
KLTH0C08888g3.160ON50648216260.0
SAKL0C08800g3.160ON60150411441e-150
Ecym_35493.160ON53250610531e-137
ZYRO0B04950g3.160ON5064909811e-127
TDEL0D046203.160ON5164949801e-127
KAFR0C010503.160ON5064879691e-125
NCAS0C035403.160ON5184969541e-123
Kpol_479.263.160ON5175029521e-122
AEL085W3.160ON5275059371e-120
Skud_4.2213.160ON5315129311e-119
YDL030W (PRP9)3.160ON5305119061e-115
NDAI0G028903.160ON5365118981e-114
Smik_4.2053.160ON5315168871e-113
TPHA0A009103.160ON5275078791e-111
Suva_4.2193.160ON5315118621e-109
CAGL0K01573g3.160ON5165097738e-96
KLLA0F24662g3.160ON5305087677e-95
KNAG0K011203.160ON5275097624e-94
TBLA0B016003.160ON4863542177e-18
KLTH0H09922gna 1ON57497751.5
KLLA0E01409g2.359ON18676694.7
TPHA0G019202.359ON16440676.9
KNAG0C014701.259ON532102689.4
Kpol_499.154.165ON1063218689.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_56.22799
         (531 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_56.22799 s56 complement(284859..286454) [1596 bp, 531 aa] {...  1012   0.0  
KLTH0C08888g Chr3 (745663..747183) [1521 bp, 506 aa] {ON} simila...   630   0.0  
SAKL0C08800g Chr3 (807712..809517) [1806 bp, 601 aa] {ON} simila...   445   e-150
Ecym_3549 Chr3 complement(1038111..1039709) [1599 bp, 532 aa] {O...   410   e-137
ZYRO0B04950g Chr2 complement(399973..401493) [1521 bp, 506 aa] {...   382   e-127
TDEL0D04620 Chr4 complement(847509..849059) [1551 bp, 516 aa] {O...   382   e-127
KAFR0C01050 Chr3 complement(214128..215648) [1521 bp, 506 aa] {O...   377   e-125
NCAS0C03540 Chr3 (707075..708631) [1557 bp, 518 aa] {ON} Anc_3.1...   372   e-123
Kpol_479.26 s479 complement(50993..52546) [1554 bp, 517 aa] {ON}...   371   e-122
AEL085W Chr5 (467583..469166) [1584 bp, 527 aa] {ON} Syntenic ho...   365   e-120
Skud_4.221 Chr4 (392347..393942) [1596 bp, 531 aa] {ON} YDL030W ...   363   e-119
YDL030W Chr4 (397537..399129) [1593 bp, 530 aa] {ON}  PRP9Subuni...   353   e-115
NDAI0G02890 Chr7 (669498..671108) [1611 bp, 536 aa] {ON} Anc_3.1...   350   e-114
Smik_4.205 Chr4 (377655..379250) [1596 bp, 531 aa] {ON} YDL030W ...   346   e-113
TPHA0A00910 Chr1 (179145..180728) [1584 bp, 527 aa] {ON} Anc_3.1...   343   e-111
Suva_4.219 Chr4 (387976..389571) [1596 bp, 531 aa] {ON} YDL030W ...   336   e-109
CAGL0K01573g Chr11 (139809..141359) [1551 bp, 516 aa] {ON} simil...   302   8e-96
KLLA0F24662g Chr6 complement(2292807..2294399) [1593 bp, 530 aa]...   300   7e-95
KNAG0K01120 Chr11 (218749..220332) [1584 bp, 527 aa] {ON} Anc_3....   298   4e-94
TBLA0B01600 Chr2 (352382..353842) [1461 bp, 486 aa] {ON} Anc_3.1...    88   7e-18
KLTH0H09922g Chr8 complement(852480..854204) [1725 bp, 574 aa] {...    33   1.5  
KLLA0E01409g Chr5 (140505..141065) [561 bp, 186 aa] {ON} similar...    31   4.7  
TPHA0G01920 Chr7 complement(398453..398947) [495 bp, 164 aa] {ON...    30   6.9  
KNAG0C01470 Chr3 (292959..294557) [1599 bp, 532 aa] {ON} Anc_1.2...    31   9.4  
Kpol_499.15 s499 (44708..47899) [3192 bp, 1063 aa] {ON} (44708.....    31   9.9  

>Kwal_56.22799 s56 complement(284859..286454) [1596 bp, 531 aa] {ON}
           YDL030W (PRP9) - RNA splicing factor [contig 184] FULL
          Length = 531

 Score = 1012 bits (2616), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 498/531 (93%), Positives = 498/531 (93%)

Query: 1   MIKFNRIAKKMNSKWSSKEKEKDLMVTYXXXXXXXXXXXXXXXXXXXXXRRNPEIFYRNV 60
           MIKFNRIAKKMNSKWSSKEKEKDLMVTY                     RRNPEIFYRNV
Sbjct: 1   MIKFNRIAKKMNSKWSSKEKEKDLMVTYESSRSTLEELELIEGAIAARLRRNPEIFYRNV 60

Query: 61  DELKLITGDAKVDDYAEIEKNSNKIYSVRKTKRTRKQILAQEHEIQLFLEEYRKKSESLR 120
           DELKLITGDAKVDDYAEIEKNSNKIYSVRKTKRTRKQILAQEHEIQLFLEEYRKKSESLR
Sbjct: 61  DELKLITGDAKVDDYAEIEKNSNKIYSVRKTKRTRKQILAQEHEIQLFLEEYRKKSESLR 120

Query: 121 NVEFDLRRYQVTDGSVDGFLEHIETINSEVPDDIDDSMENYTMFSNSTAARRDILSKKAR 180
           NVEFDLRRYQVTDGSVDGFLEHIETINSEVPDDIDDSMENYTMFSNSTAARRDILSKKAR
Sbjct: 121 NVEFDLRRYQVTDGSVDGFLEHIETINSEVPDDIDDSMENYTMFSNSTAARRDILSKKAR 180

Query: 181 ALDINAKFTREEQYGEFLDLEPFHQQWLSVVKDGSVSLLQFLGEIEKFTTKRFLLTPAVN 240
           ALDINAKFTREEQYGEFLDLEPFHQQWLSVVKDGSVSLLQFLGEIEKFTTKRFLLTPAVN
Sbjct: 181 ALDINAKFTREEQYGEFLDLEPFHQQWLSVVKDGSVSLLQFLGEIEKFTTKRFLLTPAVN 240

Query: 241 RGSARYQDFVKALLCYLQDYLMRAYPLQDWDKIHAEIQATYCDYKSHPEEAGDSGLFCIP 300
           RGSARYQDFVKALLCYLQDYLMRAYPLQDWDKIHAEIQATYCDYKSHPEEAGDSGLFCIP
Sbjct: 241 RGSARYQDFVKALLCYLQDYLMRAYPLQDWDKIHAEIQATYCDYKSHPEEAGDSGLFCIP 300

Query: 301 CDKTFKAETVYLAHLTGKKHINNMNKKDEFLAQEYKLHMLCCYLVQELVRTREFVERKLA 360
           CDKTFKAETVYLAHLTGKKHINNMNKKDEFLAQEYKLHMLCCYLVQELVRTREFVERKLA
Sbjct: 301 CDKTFKAETVYLAHLTGKKHINNMNKKDEFLAQEYKLHMLCCYLVQELVRTREFVERKLA 360

Query: 361 FTPEERRQEMERLTTVYESPVYGXXXXXXXXXXXXKPTTNQEDSTPEPSFDLPLGPDGFP 420
           FTPEERRQEMERLTTVYESPVYG            KPTTNQEDSTPEPSFDLPLGPDGFP
Sbjct: 361 FTPEERRQEMERLTTVYESPVYGEQEQEDIAEADQKPTTNQEDSTPEPSFDLPLGPDGFP 420

Query: 421 IPYWLYKLQGLDIEYPCEVCGNLIYKGRRQFDKHFTEQRHIFGLKRLGVDPSPSFKGVTS 480
           IPYWLYKLQGLDIEYPCEVCGNLIYKGRRQFDKHFTEQRHIFGLKRLGVDPSPSFKGVTS
Sbjct: 421 IPYWLYKLQGLDIEYPCEVCGNLIYKGRRQFDKHFTEQRHIFGLKRLGVDPSPSFKGVTS 480

Query: 481 IDDVKQLWAHLRSSSKASNAAGPKFEEEIEDEEGNVMSKKVYEELKKQGLI 531
           IDDVKQLWAHLRSSSKASNAAGPKFEEEIEDEEGNVMSKKVYEELKKQGLI
Sbjct: 481 IDDVKQLWAHLRSSSKASNAAGPKFEEEIEDEEGNVMSKKVYEELKKQGLI 531

>KLTH0C08888g Chr3 (745663..747183) [1521 bp, 506 aa] {ON} similar
           to uniprot|P19736 Saccharomyces cerevisiae YDL030W PRP9
           Subunit of the SF3a splicing factor complex required for
           spliceosome assembly
          Length = 506

 Score =  630 bits (1626), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/482 (61%), Positives = 371/482 (76%), Gaps = 1/482 (0%)

Query: 50  RRNPEIFYRNVDELKLITGDAKVDDYAEIEKNSNKIYSVRKTKRTRKQILAQEHEIQLFL 109
           RRNPEIFYRN+DE+ L+    + D     +K++NK+Y+V+K++R+RKQILAQEHEI+ FL
Sbjct: 26  RRNPEIFYRNIDEVDLVEHSGRFDHIPSSQKSANKVYTVKKSRRSRKQILAQEHEIKSFL 85

Query: 110 EEYRKKSESLRNVEFDLRRYQVTDGSVDGFLEHIETINSEVPDDIDDSMENYTMFSNSTA 169
            +Y K  +SL  VEFD+  Y+V +GSV+  LEHIE I    P D D+  + Y MFS+ST 
Sbjct: 86  SQYLKDCQSLGRVEFDMSEYRVDNGSVNKLLEHIERIKEIHPKD-DEFGDQYAMFSSSTP 144

Query: 170 ARRDILSKKARALDINAKFTREEQYGEFLDLEPFHQQWLSVVKDGSVSLLQFLGEIEKFT 229
           + ++I+S+KA+ LDIN+ FTR+EQYGE+LDLEPFHQ+WLSVVK+G V+LLQFL E+EKFT
Sbjct: 145 SNKNIISRKAQNLDINSYFTRDEQYGEYLDLEPFHQKWLSVVKNGDVTLLQFLSEVEKFT 204

Query: 230 TKRFLLTPAVNRGSARYQDFVKALLCYLQDYLMRAYPLQDWDKIHAEIQATYCDYKSHPE 289
            +R+LL PAVNR S+RY++FV +L  YL DY  RAYPL  WD IHA+ Q  Y    + P 
Sbjct: 205 DQRYLLQPAVNRNSSRYREFVASLHHYLSDYAARAYPLLSWDLIHAKAQELYHTNVAKPI 264

Query: 290 EAGDSGLFCIPCDKTFKAETVYLAHLTGKKHINNMNKKDEFLAQEYKLHMLCCYLVQELV 349
            +G+SG+FCIPCDK FK +TVY AHL GK+H+ N++K   FL QE+ LH+ C YL +EL 
Sbjct: 265 PSGESGVFCIPCDKRFKTDTVYNAHLPGKRHVGNLHKNSSFLTQEHSLHIFCRYLSRELA 324

Query: 350 RTREFVERKLAFTPEERRQEMERLTTVYESPVYGXXXXXXXXXXXXKPTTNQEDSTPEPS 409
           RTREFVERKLAFT EER QE+ERLT +Y+SPVYG            K T ++EDS  + S
Sbjct: 325 RTREFVERKLAFTTEERTQELERLTDIYDSPVYGRQEQEDAQEDENKETEDKEDSVLDSS 384

Query: 410 FDLPLGPDGFPIPYWLYKLQGLDIEYPCEVCGNLIYKGRRQFDKHFTEQRHIFGLKRLGV 469
            +LPLGPDGFPIPYWLYKLQGLDIEYPCE+CGN +Y GRRQFDKHF EQRH+FGL+RLG+
Sbjct: 385 MNLPLGPDGFPIPYWLYKLQGLDIEYPCELCGNFVYNGRRQFDKHFGEQRHVFGLRRLGI 444

Query: 470 DPSPSFKGVTSIDDVKQLWAHLRSSSKASNAAGPKFEEEIEDEEGNVMSKKVYEELKKQG 529
           +PS SFKGVT IDD KQLW+HLRS+S    ++  K E E+EDE+GNVMSKKVY+ELKKQG
Sbjct: 445 EPSASFKGVTKIDDAKQLWSHLRSTSSGRVSSEGKLEVEVEDEDGNVMSKKVYDELKKQG 504

Query: 530 LI 531
           L+
Sbjct: 505 LL 506

>SAKL0C08800g Chr3 (807712..809517) [1806 bp, 601 aa] {ON} similar
           to uniprot|P19736 Saccharomyces cerevisiae YDL030W PRP9
           Subunit of the SF3a splicing factor complex required for
           spliceosome assembly
          Length = 601

 Score =  445 bits (1144), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 224/504 (44%), Positives = 312/504 (61%), Gaps = 23/504 (4%)

Query: 50  RRNPEIFYRNVDELKLITGD--AKVDDYAEIEKNSNKIYSVRKTKRTRKQILAQEHEIQL 107
           RRNPE++Y   +E +L+  +    +      + ++N+I+SV+K++R+RKQI+ Q+HEI  
Sbjct: 99  RRNPELYYSYYEEQRLVDKENHGLLPPVPASDISANRIHSVKKSRRSRKQIVLQQHEIDR 158

Query: 108 FLEEYRKKSESLRNVEFDLRRYQVTDGSVDGFLEHIETINSEVPDD------IDDSMENY 161
           FLEEY+++   L  ++ D    +      +   + ++   S   D+      +D     +
Sbjct: 159 FLEEYQREVARLHGIKLDKDDSESAAPDFEQLEKAVKDAKSRYADESRTLAGVDVESVEH 218

Query: 162 TMFSNSTAARRDILSKKARALDINAKFTREEQYGEFLDLEPFHQQWLSVVKDGSVSLLQF 221
           +MFS+ST+  +DILS + R LD+N  F R+E YGEFL LEPFH +WL++VKDGSV+ LQF
Sbjct: 219 SMFSSSTSTHKDILSTRGRDLDMNRLFARDEHYGEFLLLEPFHHEWLNIVKDGSVTALQF 278

Query: 222 LGEIEKFTTKRFLLTPAVNRGSARYQDFVKALLCYLQDYLMRAYPLQDWDKIHAEIQATY 281
           +  +E F +  +L+ PAVNRGS +YQDFV +LL Y+ ++  + YPL +   +   + A +
Sbjct: 279 MNVVEMFVSDAYLVAPAVNRGSKKYQDFVGSLLGYMSEFFRKTYPLVNHSTLGRRLAALF 338

Query: 282 CDYKSHPEEAGDSGLFCIPCDKTFKAETVYLAHLTGKKHINNMNKKDEFLAQEYKLHMLC 341
            +Y   P      GLFCIPC + FK ETVY +HL+GKKH  N+ K D  L  EYKLH  C
Sbjct: 339 DEYLRAPVADETKGLFCIPCGRWFKLETVYKSHLSGKKHSKNLAKGDGHLLAEYKLHKYC 398

Query: 342 CYLVQELVRTREFVERKLAFTPEERRQEMERLTTVYESPVYGXXXXXXXXXXXXKPTTNQ 401
             LVQ +  TR FVER  A T +ER QE+ERL   YE+P Y             +    +
Sbjct: 399 GLLVQTIANTRAFVERNRALTADERAQELERLAKEYEAPAYSQHETEDAAREKQQKREPE 458

Query: 402 EDSTPEPSFDLPLGPDGFPIPYWLYKLQGLDIEYPCEVCGNLIYKGRRQFDKHFTEQRHI 461
            D    P F+LPLGPDG+PIPYWLYKLQGLDIEY CE+C N  YKGRR F+KHF+E RHI
Sbjct: 459 TDEGGNP-FNLPLGPDGYPIPYWLYKLQGLDIEYSCEICSNHTYKGRRYFEKHFSEARHI 517

Query: 462 FGLKRLGVDPSPSFKGVTSIDDVKQLWAHLRSSSKAS--------------NAAGPKFEE 507
           FGL+ LG++PS +FKG+T I + K LWA +++S                    +  K E 
Sbjct: 518 FGLRCLGIEPSATFKGITKIQEAKDLWARIQTSVATGVGAGAIASAATAAATPSTAKLEI 577

Query: 508 EIEDEEGNVMSKKVYEELKKQGLI 531
           E+EDEEGNVMS+K+Y ELK+QGL+
Sbjct: 578 EVEDEEGNVMSEKLYHELKRQGLL 601

>Ecym_3549 Chr3 complement(1038111..1039709) [1599 bp, 532 aa] {ON}
           similar to Ashbya gossypii AEL085W
          Length = 532

 Score =  410 bits (1053), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 210/506 (41%), Positives = 311/506 (61%), Gaps = 25/506 (4%)

Query: 51  RNPEIFYRNVDELKLITGDAKV-DDYAEIEKNSNKIYSVRKTKRTRKQILAQEHEIQLFL 109
           RNPE+FY  + EL ++  D KV  +   ++  +N++Y ++K+KR+RKQIL Q+HEI  FL
Sbjct: 27  RNPEVFYSYIHELSIVNSDEKVLSNIPNVDITANRVYMIKKSKRSRKQILLQQHEISKFL 86

Query: 110 EEYRKKSESLRNVEFD-LRRYQVTDGSVDGFLEHIETINSEVPDD-----IDDSME---- 159
             Y K  + L   + D +  ++  + + + F + I+ I  +  ++      D S+E    
Sbjct: 87  SYYLKNVKKLNGYKNDNVDEFKDHNQNFELFRDQIQRIKEKYAEESNSEAFDASLEARKY 146

Query: 160 NYTMFSNSTAARRDILSKKARALDINAKFTREEQYGEFLDLEPFHQQWLSVVKDGSVSLL 219
            YTMFSNS   ++DILS + +++DIN KF+ EE YGE+L L+ +HQ++L++VK+ +VSLL
Sbjct: 147 QYTMFSNSNHQKKDILSLEGQSIDINKKFSWEEHYGEYLHLDQYHQEYLNIVKNANVSLL 206

Query: 220 QFLGEIEKFTTKRFLLTPAVNRGSARYQDFVKALLCYLQDYLMRAYPLQDWDKIHAEIQA 279
           QF+G ++ F     L  P V+R S  Y  F++ LL Y+  +   A+PL +  +    I+ 
Sbjct: 207 QFIGFLQTFCDHGHLKNPPVDRNSKIYHGFLERLLKYVNSFFESAFPLINHVQFQKRIKN 266

Query: 280 TYCDYKSHPEEAGDSGLFCIPCDKTFKAETVYLAHLTGKKHINNMNKKDEFLAQEYKLHM 339
           ++ +Y S P E    G  C+ C K FKA TVY +HL G+KH+NN+  +   L  EY L  
Sbjct: 267 SFVEYTSTPIEDSSRGCLCVACGKWFKAITVYTSHLQGRKHLNNLKCRRRSLMVEYTLQN 326

Query: 340 LCCYLVQELVRTREFVERKLAFTPEERRQEMERLTTVYESPVYGXXXXXXXXXXXXKPTT 399
           L   L +ELV T+ FVERK AFT EER QE+ +L   Y +  YG              ++
Sbjct: 327 LFTCLNKELVSTKSFVERKYAFTVEERIQELAKLRDAYNANAYGDHEREDSQEDLSVSSS 386

Query: 400 NQEDSTPEPSFDLPLGPDGFPIPYWLYKLQGLDIEYPCEVCGNLIYKGRRQFDKHFTEQR 459
            +         +LPLGPDG+PIPYWLYKLQGLDIEY CE+CGN +YKGRR F++HF EQR
Sbjct: 387 KETPPDDNNPLNLPLGPDGYPIPYWLYKLQGLDIEYTCEICGNHLYKGRRVFERHFHEQR 446

Query: 460 HIFGLKRLGVDPSPSFKGVTSIDDVKQLWAHLRSSSKASNAAGP--------------KF 505
           H +GL+ LG++P+ +FKG++ I D + LW+ L+++S  ++A+                K 
Sbjct: 447 HTYGLRCLGIEPTSTFKGISKISDAQILWSRLKNNSHLNSASATYPDATSSRAVVTNNKL 506

Query: 506 EEEIEDEEGNVMSKKVYEELKKQGLI 531
           E E+EDE+GNVMS +VYE+LKKQGL+
Sbjct: 507 EIEMEDEDGNVMSHRVYEDLKKQGLL 532

>ZYRO0B04950g Chr2 complement(399973..401493) [1521 bp, 506 aa] {ON}
           similar to uniprot|P19736 Saccharomyces cerevisiae
           YDL030W PRP9 Subunit of the SF3a splicing factor complex
           required for spliceosome assembly
          Length = 506

 Score =  382 bits (981), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 204/490 (41%), Positives = 299/490 (61%), Gaps = 19/490 (3%)

Query: 51  RNPEIFYRNVDELKLITGDAKVDDYAEIEKNSNKIYSVRKTKRTRKQILAQEHEIQLFLE 110
           RNPE++Y N+ +  LI G  ++     +    N+IY  ++TKR+RKQ++ Q+HEI LFL 
Sbjct: 27  RNPELYYSNITKQVLIDGGIELPSTTAMA--VNRIYKSKRTKRSRKQLVTQQHEINLFLS 84

Query: 111 EYRKKSESLRNVE--FDLRRYQVTDGSVDGFLEHIETINSEVPD------DIDDSMENYT 162
           +   K + L  V    D+  Y+  + + D F E ++ INS+  D      DI++++ N+ 
Sbjct: 85  QALDKQKELSGVNGTVDVEDYRDEEINFDKFREAVDQINSKYEDQEGLALDINENIVNHE 144

Query: 163 MFSNSTAARRDILSKKARALDINAKFTREEQYGEFLDLEPFHQQWLSVVKDGSVSLLQFL 222
           MFS +T ++  ILS+ AR LD+N  FTR+EQYG+ LDLE FH QWL+V+K    S LQF 
Sbjct: 145 MFS-ATFSKSTILSESARDLDLNQIFTRDEQYGDLLDLEKFHSQWLNVIKRADCSYLQFF 203

Query: 223 GEIEKFTT-KRFLLTPAVNRGSARYQDFVKALLCYLQDYLMRAYPLQDWDKIHAEIQATY 281
             ++KF     +LL+P ++R + RY  F+  L  Y++ +  + Y L +   +   +++ +
Sbjct: 204 DVLQKFLDPSEYLLSPPMDRKNERYGQFLIELFQYVEQFFAKVYVLVNSTILSQRMESDF 263

Query: 282 CDYKSHPEEAGDSGLFCIPCDKTFKAETVYLAHLTGKKHINNMNKKDEFLAQEYKLHMLC 341
            +Y   P    + GL+C+ C K FK  TV+ +HLTGK H NN +K+   L  EYKLH   
Sbjct: 264 EEYLRMPIYKSNHGLYCVACGKWFKTPTVFQSHLTGKHHRNNRDKRFTKLQAEYKLHRYL 323

Query: 342 CYLVQELVRTREFVERKLAFTPEERRQEMERLTTVYESPVYGXXXXXXXXXXXXKPTTNQ 401
             L  +L RTR FVERK+AFT EER +EM RL  +YE P Y               T ++
Sbjct: 324 KILQGQLERTRGFVERKMAFTTEERMEEMSRLARIYEGPDYAPDEKEIEEKEDSVDTPSE 383

Query: 402 EDSTPEPSFDLPLGPDGFPIPYWLYKLQGLDIEYPCEVCGNLIYKGRRQFDKHFTEQRHI 461
           +        +LPLG DG PIP WLYKLQGLD+ Y CE+CGN  Y+GRR F++HFTE  H+
Sbjct: 384 KKMN--GGIELPLGLDGLPIPLWLYKLQGLDVTYSCEICGNQTYRGRRMFERHFTEPTHL 441

Query: 462 FGLKRLGVDPSPSFKGVTSIDDVKQLWAHLRSSSKASNAAGPKFEEEIEDEEGNVMSKKV 521
           F LK LG++ S +F+ +TSI++ + LW  +  ++  S+      + E+EDEEGNVM+++V
Sbjct: 442 FHLKCLGIEASDAFRSITSIEEAQNLWKRISGNNTTSSR-----DIEVEDEEGNVMTQQV 496

Query: 522 YEELKKQGLI 531
           YEELKKQGL+
Sbjct: 497 YEELKKQGLV 506

>TDEL0D04620 Chr4 complement(847509..849059) [1551 bp, 516 aa] {ON}
           Anc_3.160 YDL030W
          Length = 516

 Score =  382 bits (980), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 205/494 (41%), Positives = 297/494 (60%), Gaps = 17/494 (3%)

Query: 51  RNPEIFYRNVDELKLITGDAKVDDYAEIEKNSNKIYSVRKTKRTRKQILAQEHEIQLFLE 110
           RNP ++Y  + +  LI  D  +        N+N+IY  +++KR RKQ + Q+HEI LFL+
Sbjct: 27  RNPGLYYGYLQKRALI-DDIPLSSSITNAYNANRIYKAKRSKRNRKQFVLQQHEIDLFLQ 85

Query: 111 EYRKKSESLRNVEFDLRRYQVTD--GSVDGFLEHIETINSEVPD--------DIDDSMEN 160
           E  +K   L +++  +  + + D   + + F +++E I  +  D        D+++ +  
Sbjct: 86  ESMRKLRDLGSLKGPVNTHSLRDEEATFEIFKQNLEEIKDKYKDLGSDSLFSDVNEEISK 145

Query: 161 YTMFSNSTAARR--DILSKKARALDINAKFTREEQYGEFLDLEPFHQQWLSVVKDGSVSL 218
           + MFS  T   +   ILS+ A+ L +N  F+REEQYGE+LDL+ FH  WL+V++    +L
Sbjct: 146 HAMFSALTTDSKPVTILSRSAKNLRLNDVFSREEQYGEYLDLDRFHSSWLNVIRSTECTL 205

Query: 219 LQFLGEIEKFTTKR-FLLTPAVNRGSARYQDFVKALLCYLQDYLMRAYPLQDWDKIHAEI 277
           LQF   +EKF   R ++L P ++R + RY +F+  +  YL+ +  +A  L +  K+   I
Sbjct: 206 LQFYSILEKFLDDRQYILAPPMDRKNGRYAEFLVEISNYLEKFFQKANVLLNHTKLERRI 265

Query: 278 QATYCDYKSHPEEAGDSGLFCIPCDKTFKAETVYLAHLTGKKHINNMNKKDEFLAQEYKL 337
           Q+ +    + P   G  G +CI C K FK  TV+ +HLTGK H NN++K+ + L  EYKL
Sbjct: 266 QSEFSRSLATPLHTGGKGFYCIACCKWFKVPTVFDSHLTGKHHKNNLSKRSKHLQAEYKL 325

Query: 338 HMLCCYLVQELVRTREFVERKLAFTPEERRQEMERLTTVYESPVYGXXXXXXXXXXXXKP 397
           H     L +E  RTREF ERK+AFT EER QEM RL   Y +P YG            K 
Sbjct: 326 HRYLTLLSEEFRRTREFTERKVAFTAEERMQEMARLNHDYHAPDYGPDEKEQEDPDSNKA 385

Query: 398 TTNQEDSTPEPSFDLPLGPDGFPIPYWLYKLQGLDIEYPCEVCGNLIYKGRRQFDKHFTE 457
             ++ +S    SFDLPLG DG PIPYWLYKLQGLD+EY CE+C N  YKGRR F+KHF E
Sbjct: 386 ELDK-NSALGGSFDLPLGADGLPIPYWLYKLQGLDVEYSCEICTNQTYKGRRAFEKHFLE 444

Query: 458 QRHIFGLKRLGVDPSPSFKGVTSIDDVKQLWAHLRSSSKASNAAGPKFEEEIEDEEGNVM 517
             H F LK LG++PS +FKG+T I + + LW   ++SS+       K + E+ED+EGNV+
Sbjct: 445 PTHTFHLKCLGIEPSITFKGITGIQEAQDLWR--QTSSRNRPQTQKKIDLEVEDQEGNVL 502

Query: 518 SKKVYEELKKQGLI 531
           ++KVY+ELKKQGL+
Sbjct: 503 TQKVYQELKKQGLV 516

>KAFR0C01050 Chr3 complement(214128..215648) [1521 bp, 506 aa] {ON}
           Anc_3.160 YDL030W
          Length = 506

 Score =  377 bits (969), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 200/487 (41%), Positives = 309/487 (63%), Gaps = 11/487 (2%)

Query: 50  RRNPEIFYRNVDELKLITGDAKVDDYAEIEKNSNKIYSVRKTKRTRKQILAQEHEIQLFL 109
           +RNPE++Y  +++L      + ++  + I+  +N++Y  +K KR++KQI+AQ+HEI+LF+
Sbjct: 26  QRNPELYYNYLEKLSSFEKHS-LEVPSSIDIKNNRVYKSKKAKRSKKQIVAQQHEIRLFI 84

Query: 110 EEYRKKSESLRNVEFDLRRYQVTDGSVD--GFLEHIETINSEVPDDIDDSMENYTMFSNS 167
           E+Y  K + L  +   ++R   T  S D   F+  I    S V   + D ++ Y+MFS S
Sbjct: 85  EDYTNKQKGLNML---MKRKDTTQISSDIGDFITSITENKSHVKSSLKDKIDYYSMFSAS 141

Query: 168 TAARRDILSKKARALDINAKFTREEQYGEFLDLEPFHQQWLSVVKDGSVSLLQFLGEIEK 227
           T  ++ ILSK+A  LDIN  FTR+EQ+GE +DLE FH  WLSVVKD S SLL F   IE 
Sbjct: 142 TT-QKSILSKRAADLDINQTFTRDEQFGECMDLERFHNVWLSVVKDDSYSLLDFFRVIES 200

Query: 228 FT-TKRFLLTPAVNRGSARYQDFVKALLCYLQDYLMRAYPLQDWDKIHAEIQATYCDYKS 286
           F  TK +L +P ++R + RYQ+F+K +  Y++ +  + + L D + ++A +Q  +  Y  
Sbjct: 201 FLDTKSYLKSPHMDRKNQRYQEFIKTISGYVESFFFKKFCLIDKEYVNARLQQDFILYLD 260

Query: 287 HPEEAGDSGLFCIPCDKTFKAETVYLAHLTGKKHINNMNKKDEFLAQEYKLHMLCCYLVQ 346
           +P     +G FC+ C+K+FK ++V+  HL GK+H  N++K+   L  EYKL+     L  
Sbjct: 261 NPLN-NQNGFFCVACNKSFKTKSVFDNHLPGKQHKRNVDKRRNSLISEYKLYRFLNLLRT 319

Query: 347 ELVRTREFVERKLAFTPEERRQEMERLTTVYESPVYGXXXXXXXXXXXXK-PTTNQEDST 405
           E   T+EF ERK++FT  ERR+E+ERL   Y +PVYG            +  + N   S 
Sbjct: 320 EFNNTKEFTERKISFTANERREELERLNNEYNAPVYGSEEQEEGDEEHDEYASKNGNRSI 379

Query: 406 PEPSFDLPLGPDGFPIPYWLYKLQGLDIEYPCEVCGNLIYKGRRQFDKHFTEQRHIFGLK 465
            +  F++PLGPDG P+P+WLYKLQGLD+ Y CE+C N  +KGRR F++HF E+ H + L+
Sbjct: 380 LDGLFNMPLGPDGVPMPFWLYKLQGLDVSYYCEICSNREFKGRRAFERHFNEKTHQYHLR 439

Query: 466 RLGVDPSPSFKGVTSIDDVKQLWAHLRSSSKASNAAGP-KFEEEIEDEEGNVMSKKVYEE 524
            LG+ PSP+F G+T+I + + LW H++S+ K    +G    + E+ED +GNV+++KVY++
Sbjct: 440 CLGITPSPTFVGITAITEAQTLWDHIQSTQKKKAPSGKIDMDIEVEDADGNVLTRKVYDD 499

Query: 525 LKKQGLI 531
           LK+QGL+
Sbjct: 500 LKRQGLL 506

>NCAS0C03540 Chr3 (707075..708631) [1557 bp, 518 aa] {ON} Anc_3.160
           YDL030W
          Length = 518

 Score =  372 bits (954), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 201/496 (40%), Positives = 300/496 (60%), Gaps = 20/496 (4%)

Query: 50  RRNPEIFYRNVDELKLITGDAKVDDYAEIEKNSNKIYSVRKTKRTRKQILAQEHEIQLFL 109
           +RNPE++Y N+ +L ++T +  +D  AE  K++NKIY  +K KR+RKQ + Q+ EI +FL
Sbjct: 27  QRNPELYYDNITKLSILT-NLSIDTPAESNKSNNKIYKRKKLKRSRKQFVLQQQEINIFL 85

Query: 110 EEYRKKSESLRNVEFDLRRYQVTDGSV--DGFLEHIETINSEVPDD----IDDSMENYTM 163
           +++ ++    R V  DL +  V D ++  + F   I+ IN++        I+  +  Y M
Sbjct: 86  KDFEER----RRVLLDLGKETVKDDNITLETFKTMIQDINAKKSSSEVLPINQKITRYAM 141

Query: 164 FSNSTAARR--DILSKKARALDINAKFTREEQYGEFLDLEPFHQQWLSVVKDGSVSLLQF 221
           FS S +  +  +ILS++   LDIN  F+REEQYG+++D E F+ +WL+VVK G V+LLQF
Sbjct: 142 FSASISESKPNNILSQRCAGLDINKYFSREEQYGQYMDFENFYLEWLNVVKTGDVTLLQF 201

Query: 222 LGEIEKFT-TKRFLLTPAVNRGSARYQDFVKALLCYLQDYLMRAYPLQDWDKIHAEIQAT 280
           L  +  F   +++L  P ++R + RY  F+++L  Y++ +  R Y L +   I ++I++ 
Sbjct: 202 LNLLRVFMDEEKYLTHPPMDRKNNRYMKFLESLCSYVESFFFRKYALINKSAITSQIESQ 261

Query: 281 YCDYKSHPEEAGDSGLFCIPCDKTFKAETVYLAHLTGKKHINNMNKKDEFLAQEYKLHML 340
           + +Y   P E    G +C  C K FK E+V++ H+ GK HI N  ++   L  EYKLH  
Sbjct: 262 FTEYIKEPTEHSVKGQYCKACAKWFKTESVFVNHIPGKNHIKNEKQRKNALLSEYKLHRF 321

Query: 341 CCYLVQELVRTREFVERKLAFTPEERRQEMERLTTVYESPVYGXXXXXXXXXXXXKPTTN 400
              L +E   T EF+E K+A T +ER +EM+RLT  YE P Y                  
Sbjct: 322 FFLLQEEFKETYEFIEMKMALTADERMEEMKRLTENYEKPAYSSDEKEGDENNADLEHDE 381

Query: 401 QEDSTP----EPSFDLPLGPDGFPIPYWLYKLQGLDIEYPCEVCGNLIYKGRRQFDKHFT 456
           Q         E SFD+PLGPDG P+P+WLYKLQGLD+EYPCE+C N I+KGRR F+KHFT
Sbjct: 382 QRSGKGQGLLEGSFDMPLGPDGLPMPFWLYKLQGLDVEYPCEICSNQIFKGRRAFEKHFT 441

Query: 457 EQRHIFGLKRLGVDPSPSFKGVTSIDDVKQLWAHLRSSSKASN--AAGPKFEEEIEDEEG 514
              H + L+ LG++PS  FKG+T I + ++LW  + S   +S    +  + + E+ED  G
Sbjct: 442 APTHQYHLRCLGIEPSSMFKGITKIKEAQKLWVDINSQKNSSKPMVSSIELQVEVEDSVG 501

Query: 515 NVMSKKVYEELKKQGL 530
           NVMSKK+Y+ELKKQGL
Sbjct: 502 NVMSKKLYDELKKQGL 517

>Kpol_479.26 s479 complement(50993..52546) [1554 bp, 517 aa] {ON}
           complement(50993..52546) [1554 nt, 518 aa]
          Length = 517

 Score =  371 bits (952), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 205/502 (40%), Positives = 306/502 (60%), Gaps = 30/502 (5%)

Query: 50  RRNPEIFYRNVDELKLITGDAKVDDYAEIEKNSNKIYSVRKTKRTRKQILAQEHEIQLFL 109
           +RNPE++Y    +L  I G  +        ++SN+IY  RK KR RKQ++ Q++E   F+
Sbjct: 26  QRNPEVYYYYSQQLNDINGGGEETKTVVSNRSSNRIYKSRKHKRDRKQVILQQYETNEFI 85

Query: 110 EEYRKKSESLRNVE-------FDLRRYQVTDGSVDGFLEHIETINSEVPDDIDDSMENYT 162
           ++ R K   +R +          L RY    GS+D   E   + N ++P  I+ ++  Y+
Sbjct: 86  KDIRSKLNEIREINVTKESNGIKLDRYVELMGSIDTKYEDSVSDNQQLP--INKTIFQYS 143

Query: 163 MFSNSTAARR--DILSKKARALDINAKFTREEQYGEFLDLEPFHQQWLSVVKDGSVSLLQ 220
           MF++S +  +  +ILS K + L+IN  FTR+EQYGE+L+LE F+  WL+V+K  + S+LQ
Sbjct: 144 MFTSSNSKNKPNNILSDKCKYLEINDYFTRDEQYGEYLELERFYNNWLNVIKSANCSILQ 203

Query: 221 FLGEIEKFT-TKRFLLTPAVNRGSARYQDFVKALLCYLQDYLMRAYPLQDWD------KI 273
           ++  IEKF  + +++L P ++R + RY  F++ +  YL  ++ + Y L DW+      K 
Sbjct: 204 YMSIIEKFLDSAQYILQPPMDRKNERYLKFLEIIETYLTSFIKKTYVLIDWEEEAEVLKY 263

Query: 274 HAEIQATYCDYKSHPEEAGDSGLFCIPCDKTFKAETVYLAHLTGKKHINNMNKK-DEFLA 332
             EI+ T    KS  ++    G FC  C K FK E+V+  HL GK H+ N  K  DE+  
Sbjct: 264 DYEIECT----KSLMKQG--KGNFCRLCGKWFKTESVFENHLPGKNHVKNYKKYYDEYFI 317

Query: 333 QEYKLHMLCCYLVQELVRTREFVERKLAFTPEERRQEMERLTTVYESPVY--GXXXXXXX 390
            E+K+H +  +L +E   T+ F+ERKLAFT +ER +E++R+T VYE P Y  G       
Sbjct: 318 -EFKIHRILNWLSKEFEETKLFLERKLAFTSDERIKEIDRMTEVYERPAYSVGEPEEGKP 376

Query: 391 XXXXXKPTTNQEDSTPEPSFDLPLGPDGFPIPYWLYKLQGLDIEYPCEVCGNLIYKGRRQ 450
                K ++N+ D     SFD+PLGPDG P+PYWLYKLQGLD+ Y CE+C N IYKGRR 
Sbjct: 377 NENSSKTSSNKND-IINGSFDMPLGPDGLPMPYWLYKLQGLDMTYKCEICANTIYKGRRT 435

Query: 451 FDKHFTEQRHIFGLKRLGVDPSPSFKGVTSIDDVKQLWAHLRSSSKAS-NAAGPKFEEEI 509
           F+KHF+E  H + L+ LG++PS +FKG+ SI +   LW  +    K+S +A    +E E+
Sbjct: 436 FEKHFSETTHNYHLRCLGIEPSSAFKGIVSIKEATDLWGTMNVKDKSSKHAESNNYEIEV 495

Query: 510 EDEEGNVMSKKVYEELKKQGLI 531
           ED+EGNV+SK++YEELKKQGL+
Sbjct: 496 EDKEGNVLSKEIYEELKKQGLL 517

>AEL085W Chr5 (467583..469166) [1584 bp, 527 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL030W (PRP9)
          Length = 527

 Score =  365 bits (937), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 203/505 (40%), Positives = 292/505 (57%), Gaps = 28/505 (5%)

Query: 51  RNPEIFYRNVDELKLITGDAKV-DDYAEIEKNSNKIYSVRKTKRTRKQILAQEHEIQLFL 109
           RNPEI+Y  + EL+L+  D KV D+ ++ + NSN+IY  +K +R+RKQ++ Q+HEI  FL
Sbjct: 27  RNPEIYYSYLKELQLVNPDEKVLDNISKDDINSNRIYVNKKARRSRKQLILQQHEIARFL 86

Query: 110 EEYRKKSESLRNVEFD----LRRYQVTDGSVDGFLEHIETINSEVPDD------IDDSME 159
           + Y K+ + L   + D    LR   +   + +  ++ ++   +E  D       ++    
Sbjct: 87  QRYWKQVKRLNAFKSDDIESLRDPNMNFETFEADIKELQERQAEGADSESAISSLERKRR 146

Query: 160 NYTMFSNSTAARRDILSKKARALDINAKFTREEQYGEFLDLEPFHQQWLSVVKDGSVSLL 219
            Y+MFS S+ A + ILS   + +D+N  F  EE YGE+L LE  HQ WL+VVKDGSV+LL
Sbjct: 147 EYSMFSASSGADQTILSNVGQFIDVNKLFMWEEHYGEYLFLERLHQDWLNVVKDGSVTLL 206

Query: 220 QFLGEIEKFTTKRFLLTPAVNRGSARYQDFVKALLCYLQDYLMRAYPLQDWDKIHAEIQA 279
           QF+  +E F    +L  P V+R S RYQ F++ L+ YL+      YPL +   +   I  
Sbjct: 207 QFIAFLESFAGTGYLTAPPVDRNSKRYQVFIQKLVTYLEGAFRNTYPLLNHRLLENRISQ 266

Query: 280 TYCDYKSHPEEAGDSGLFCIPCDKTFKAETVYLAHLTGKKHINNMNKKDEFLAQEYKLHM 339
           ++  Y ++P E    GL CI C K FK  TV+  HL GKKH  ++  K   L  E+ LH 
Sbjct: 267 SFESYIANPVEDPPRGLLCIACGKHFKVGTVFAGHLLGKKHAQSVTTKVATLRAEHTLHY 326

Query: 340 LCCYLVQELVRTREFVERKLAFTPEERRQEMERLTTVYESPVYGXXX-XXXXXXXXXKPT 398
           L  YL   +  TR  VERK AFT  ER +EM  +   Y++P Y              +  
Sbjct: 327 LVIYLATSIENTRALVERKYAFTSGERNREMATIRDAYDAPAYSSGEPEDVIETPQQQQN 386

Query: 399 TNQEDSTPEPSFDLPLGPDGFPIPYWLYKLQGLDIEYPCEVCGNLIYKGRRQFDKHFTEQ 458
            + +D  P    +LPLGP G+PIPYWLYKLQGLDIEY CE+C N +YKGRR  +  F   
Sbjct: 387 AHPDDVNP---LNLPLGPMGYPIPYWLYKLQGLDIEYACEICANHVYKGRRISNAIF-RT 442

Query: 459 RHIFGLKRLGVDPSPSFKGVTSIDDVKQLWAHLRSSSK------------ASNAAGPKFE 506
              +GL+ LG++PSP+FK + +I + +QL+  L+SS+             +S+A   K E
Sbjct: 443 APCYGLRCLGIEPSPAFKDIYNIAEAQQLFQSLQSSTGPAGLATRRAGAISSSANTRKLE 502

Query: 507 EEIEDEEGNVMSKKVYEELKKQGLI 531
            E+EDE+GNVM+ +VYE+LKKQGL+
Sbjct: 503 VEVEDEDGNVMTHQVYEDLKKQGLL 527

>Skud_4.221 Chr4 (392347..393942) [1596 bp, 531 aa] {ON} YDL030W
           (REAL)
          Length = 531

 Score =  363 bits (931), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 210/512 (41%), Positives = 303/512 (59%), Gaps = 36/512 (7%)

Query: 50  RRNPEIFYRNVDELKLITGDAKVDDYAEIEKNSNKIYSVRKTKRTRKQILAQEHEIQLFL 109
           +RNPE++Y  + E   +  D K+   + I +N  KIY ++K KR RKQ++ Q+HEI LFL
Sbjct: 26  QRNPELYYHYIQESCKVFPDVKLPKPSLIAEN--KIYKLKKVKRNRKQVILQQHEIDLFL 83

Query: 110 EEYRKKSESLRNVEFDLRRYQVTDGSVDGFLEHIETINSEVPD-------DIDDSMENYT 162
            +Y +K ++  N   +L   +  D  VD F ++++ +   + +       DI+ +   Y 
Sbjct: 84  RDYHEKQKAF-NESNNLEGVEEDDKEVDRFEQNLQELEERLKNEDDNFQLDINLTRSKYA 142

Query: 163 MFSNST--AARRDILSKKARALDINAKFTREEQYGEFLDLEPFHQQWLSVVKDGSVSLLQ 220
           +FS+S   + R +ILS++AR LD+N  FTR+EQYGE+++L+ FH  WL+V++    SLLQ
Sbjct: 143 LFSSSADPSKRTNILSERARDLDLNKIFTRDEQYGEYMELDQFHYLWLNVIRRSDCSLLQ 202

Query: 221 FLGEIEKFTT-KRFLLTPAVNRGSARYQDFVKALLCYLQDYLMRAYPLQDWDKIHAEIQA 279
           F   +E F   K+FLLTP ++R + RY DF+  L  YL+ +  ++Y L D + +   I++
Sbjct: 203 FFNILELFVDDKKFLLTPPMDRKNDRYMDFLMRLSKYLETFFFKSYVLFDKEMVENSIES 262

Query: 280 ----TYCDYKSHPEEAGDSGLFCIPCDKTFKAETVYLAHLTGKKHINNMNKKDEFLAQEY 335
               +YC      E     G++C  C K FK   V+  HL+GK H  N  K+   +  EY
Sbjct: 263 DFENSYCKGLVRSEA---KGIYCPFCSKWFKTFPVFENHLSGKNHKKNEAKRKNTVYSEY 319

Query: 336 KLHMLCCYLVQELVRTREFVERKLAFTPEERRQEMERLTTVYESPVYGXXXXXXXXX--X 393
           KLH    YL  E   TR F+ERKLAFT  ER  EM+ LT  YE+P Y             
Sbjct: 320 KLHRYLKYLKDEFFHTRSFIERKLAFTANERMAEMDSLTEKYEAPAYDHTEGEGDGQCDA 379

Query: 394 XXKPTTNQEDSTPEPSFDLPLGPDGFPIPYWLYKLQGLDIEYPCEVCGNLIYKGRRQFDK 453
             K    QE      SFD+PLGPDG P+PYWLYKL GLD EYPCE+C N +Y GRR F++
Sbjct: 380 GRKGDLLQEKQPFGKSFDMPLGPDGLPMPYWLYKLHGLDREYPCEICANRVYNGRRTFER 439

Query: 454 HFTEQRHIFGLKRLGVDPSPSFKGVTSIDDVKQLWAHLRSSSKASNAAG----------P 503
           HF E+ H++ L+ LG++PSP+FKG+T I +V++LW  +++  ++ ++            P
Sbjct: 440 HFNEEAHLYHLRCLGIEPSPAFKGITKIAEVQKLWKDIQNQHRSGSSTAVALTKKSPSQP 499

Query: 504 KF----EEEIEDEEGNVMSKKVYEELKKQGLI 531
           K     E E EDEEGNVMSKKVY+ELKKQGL+
Sbjct: 500 KLPTGLELEEEDEEGNVMSKKVYDELKKQGLV 531

>YDL030W Chr4 (397537..399129) [1593 bp, 530 aa] {ON}  PRP9Subunit
           of the SF3a splicing factor complex, required for
           spliceosome assembly; acts after the formation of the U1
           snRNP-pre-mRNA complex
          Length = 530

 Score =  353 bits (906), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 210/511 (41%), Positives = 303/511 (59%), Gaps = 35/511 (6%)

Query: 50  RRNPEIFYRNVDELKLITGDAKVDDYAEIEKNSNKIYSVRKTKRTRKQILAQEHEIQLFL 109
           +RNPE++Y  + E   +  D K+   + I +N  KIY  +K KR RKQI+ Q+HEI +FL
Sbjct: 26  QRNPELYYHYIQESSKVFPDTKLPRSSLIAEN--KIYKFKKVKRKRKQIILQQHEINIFL 83

Query: 110 EEYRKKSESLRNVEFDLRRYQVTDGSVDGFLEHIETINSEVPD-------DIDDSMENYT 162
            +Y++K ++   +       Q  D  +  F   ++ +  E+ +       DI+   + Y 
Sbjct: 84  RDYQEKQQTFNKINRP-EETQEDDKDLPNFERKLQQLEKELKNEDENFELDINSKKDKYA 142

Query: 163 MFSNST--AARRDILSKKARALDINAKFTREEQYGEFLDLEPFHQQWLSVVKDGSVSLLQ 220
           +FS+S+  + R +ILS +AR LD+N  FTR+EQYGE+++LE FH  WL+V+K G  SLLQ
Sbjct: 143 LFSSSSDPSRRTNILSDRARDLDLNEIFTRDEQYGEYMELEQFHSLWLNVIKRGDCSLLQ 202

Query: 221 FLGEIEKFTT-KRFLLTPAVNRGSARYQDFVKALLCYLQDYLMRAYPLQDW----DKIHA 275
           FL  +E F   +++LLTP ++R + RY  F+  L  Y++ +  ++Y L D     + I +
Sbjct: 203 FLDILELFLDDEKYLLTPPMDRKNDRYMAFLLKLSKYVETFFFKSYALLDAAAVENLIKS 262

Query: 276 EIQATYCDYKSHPEEAGDSGLFCIPCDKTFKAETVYLAHLTGKKHINNMNKKDEFLAQEY 335
           + + +YC      E     G++C  C + FK  +V+ +HL GK H  N +K+  F+  EY
Sbjct: 263 DFEHSYCRGSLRSEA---KGIYCPFCSRWFKTSSVFESHLVGKIHKKNESKRRNFVYSEY 319

Query: 336 KLHMLCCYLVQELVRTREFVERKLAFTPEERRQEMERLTTVYESPVYGXXXXXXXXXXXX 395
           KLH    YL  E  RTR FVERKLAFT  ER  EM+ LT  YE+P Y             
Sbjct: 320 KLHRYLKYLNDEFSRTRSFVERKLAFTANERMAEMDILTQKYEAPAYDSTEKEGAEQVDG 379

Query: 396 KPTTNQ--EDSTPEPSFDLPLGPDGFPIPYWLYKLQGLDIEYPCEVCGNLIYKGRRQFDK 453
           +    Q  E+     SFD+PLGPDG P+PYWLYKL GLD EY CE+C N +Y GRR F++
Sbjct: 380 EQRDGQLQEEHLSGKSFDMPLGPDGLPMPYWLYKLHGLDREYRCEICSNKVYNGRRTFER 439

Query: 454 HFTEQRHIFGLKRLGVDPSPSFKGVTSIDDVKQLWAHLRSSSKASNAAG--PK------- 504
           HF E+RHI+ L+ LG++PS  FKG+T I + ++LW +++  S+ ++ A   PK       
Sbjct: 440 HFNEERHIYHLRCLGIEPSSVFKGITKIKEAQELWKNMQGQSQLTSIAAVPPKPNPSQLK 499

Query: 505 ----FEEEIEDEEGNVMSKKVYEELKKQGLI 531
                E E EDEEGNVMSKKVY+ELKKQGL+
Sbjct: 500 VPTELELEEEDEEGNVMSKKVYDELKKQGLV 530

>NDAI0G02890 Chr7 (669498..671108) [1611 bp, 536 aa] {ON} Anc_3.160
           YDL030W
          Length = 536

 Score =  350 bits (898), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 197/511 (38%), Positives = 295/511 (57%), Gaps = 33/511 (6%)

Query: 50  RRNPEIFYRNVDELKLITGDAKVDDYAEIE-KNSNKIYSVRKTKRTRKQILAQEHEIQLF 108
           +RNPE++Y N+ ++  +    +V++        +NKIY  +K KR RKQI  Q+HEI LF
Sbjct: 28  QRNPELYYSNLKKVSELFPSKQVEELPTHSIMTNNKIYKTKKLKRNRKQIALQQHEISLF 87

Query: 109 LEEYRKKSESL----RNVEFDLRRYQVTDGSVDGFLEHIETINSEVPD------------ 152
           ++++  K + L    R   F  ++       +   +E  + I SE+ +            
Sbjct: 88  IKDFFSKQKELETLTREANFKAKK---NKEEILLPVEEFKDILSEINEADGNENGNRREL 144

Query: 153 DIDDSMENYTMFSNSTAARR--DILSKKARALDINAKFTREEQYGEFLDLEPFHQQWLSV 210
           +I+D +  Y+MFSNS        ILS +A  LDIN+ F+ EEQYGE+L L P++ +WL+V
Sbjct: 145 EINDKINKYSMFSNSLNKSHPSTILSSRASDLDINSIFSLEEQYGEYLALNPYYTEWLNV 204

Query: 211 VKDGSVSLLQFLGEIEKFTT-KRFLLTPAVNRGSARYQDFVKALLCYLQDYLMRAYPLQD 269
           VK   ++ LQFL  ++ F   KR+++ P ++R +  Y  +++    YL+ +  R YPL D
Sbjct: 205 VKKEDLTFLQFLNMLKIFQDDKRYIVQPPMDRKNEPYMKYLQRYCSYLESFFERKYPLID 264

Query: 270 WDKIHAEIQATYCDYKSHPEEAGDSGLFCIPCDKTFKAETVYLAHLTGKKHINNMNKKDE 329
                 E++  +      P E    G FC  C K FK  TV+ +HL G+KHI + NK+ +
Sbjct: 265 SRYTSRELKKEFNKSIIKPLENEKKGFFCKTCCKWFKTLTVFESHLNGQKHIKSYNKRVQ 324

Query: 330 FLAQEYKLHMLCCYLVQELVRTREFVERKLAFTPEERRQEMERLTTVYESPVYGXXXXX- 388
            L  EYK H     L +E   T EFVERK+AFT EER  EM+RL  + ++P Y       
Sbjct: 325 GLYAEYKTHRYSMLLKEEHQSTCEFVERKMAFTVEERITEMKRLAEICKAPAYDVNEKEG 384

Query: 389 --XXXXXXXKPTTNQEDSTP--EPSFDLPLGPDGFPIPYWLYKLQGLDIEYPCEVCGNLI 444
                    K     + ++     S ++PLGPDG P+P+WLYKLQGLD+ YPCE+C N I
Sbjct: 385 DENNTELNVKDNLKNDGASAMLSGSINMPLGPDGLPMPFWLYKLQGLDVSYPCEICSNQI 444

Query: 445 YKGRRQFDKHFTEQRHIFGLKRLGVDPSPSFKGVTSIDDVKQLWAHLRSSS-----KASN 499
           +KGRR FDKHFTE  HI+ L+ LG++P+P+FKGVT I++ ++LW ++++ +     K   
Sbjct: 445 FKGRRTFDKHFTEATHIYHLRCLGIEPTPAFKGVTKIEEAQRLWNNMKNDTIMGDKKFIE 504

Query: 500 AAGPKFEEEIEDEEGNVMSKKVYEELKKQGL 530
               K   E+ED+EGN+M++KVY+ELKKQGL
Sbjct: 505 TIPDKMAIEVEDKEGNIMTQKVYDELKKQGL 535

>Smik_4.205 Chr4 (377655..379250) [1596 bp, 531 aa] {ON} YDL030W
           (REAL)
          Length = 531

 Score =  346 bits (887), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 204/516 (39%), Positives = 296/516 (57%), Gaps = 44/516 (8%)

Query: 50  RRNPEIFYRNVDELKLITGDAKVDDYAEIEKNSNKIYSVRKTKRTRKQILAQEHEIQLFL 109
           RRNPE++Y  + E   +  D K+   + I +N  K++ ++K KR RKQ++ Q+HEI LFL
Sbjct: 26  RRNPELYYHYIQESSKVFPDVKLPKSSLIAEN--KLFKIKKVKRNRKQVILQQHEISLFL 83

Query: 110 EEYRKKSESLRNVEFDLRRY-QVTDGSVDGFLEHIETINSEVPD-------DIDDSMENY 161
            +Y +K +S  N+  + + Y Q  D  +  F E +  +  E+         DI+     Y
Sbjct: 84  RDYLEKQKSFNNI--NSQNYSQEDDKDLCSFDEELRQLEDELKSEEENFQLDINSKRNKY 141

Query: 162 TMFSNS--TAARRDILSKKARALDINAKFTREEQYGEFLDLEPFHQQWLSVVKDGSVSLL 219
            +FS+S  ++ R +ILS++AR LD+N  FTR+EQYGE+++LE FH  WL+V K    SLL
Sbjct: 142 ALFSSSIDSSKRTNILSERARDLDLNKIFTRDEQYGEYMELEQFHSLWLNVFKRSDCSLL 201

Query: 220 QFLGEIEKFTT-KRFLLTPAVNRGSARYQDFVKALLCYLQDYLMRAYPLQDWDKIHAEI- 277
           QF   +E F   K++LLTP ++R + RY  F+  L  YL+ +  ++Y L D + I + I 
Sbjct: 202 QFFDVVELFVDDKKYLLTPPMDRKNDRYMAFLIKLCKYLETFFFKSYALFDKEVIESSIR 261

Query: 278 ---QATYCDYKSHPEEAGDSGLFCIPCDKTFKAETVYLAHLTGKKHINNMNKKDEFLAQE 334
              + +YC      E     G+ C  C K FK   V+  HLTGK H  N  K+ + +  E
Sbjct: 262 FDFEQSYCKGSLRSEA---KGIHCPFCYKWFKTSPVFENHLTGKIHKKNEFKRKDTVYSE 318

Query: 335 YKLHMLCCYLVQELVRTREFVERKLAFTPEERRQEMERLTTVYESPVYGXXXXXXXXXXX 394
           YKLH    YL  E   T+ FVERKL FT  ER  EM+ LT  YE+P Y            
Sbjct: 319 YKLHRYLKYLKDEFSHTKSFVERKLVFTANERIAEMDALTQKYEAPAYDPTDKDGDQQ-- 376

Query: 395 XKPTTNQEDSTPEP-----SFDLPLGPDGFPIPYWLYKLQGLDIEYPCEVCGNLIYKGRR 449
            K +  ++D   E      SFD+PLGPDG P+P+WLYKL GLD EY CE+C N +Y GRR
Sbjct: 377 -KGSDQRDDQLQEKHFFGKSFDMPLGPDGLPMPHWLYKLHGLDREYHCEICANKVYNGRR 435

Query: 450 QFDKHFTEQRHIFGLKRLGVDPSPSFKGVTSIDDVKQLWAHLRSSSKASNAAGPKFEE-- 507
            F++HF E  H++ L+ LG++PS +FKG+T I + ++LW +++   +++ +      +  
Sbjct: 436 TFERHFNEGPHLYHLRCLGIEPSLAFKGITKITEAQKLWENMQKQPQSATSIASSLTKLK 495

Query: 508 ------------EIEDEEGNVMSKKVYEELKKQGLI 531
                       E EDEEGNVMSKKV++ELKKQGL+
Sbjct: 496 HSRSKLPTELELEEEDEEGNVMSKKVFDELKKQGLV 531

>TPHA0A00910 Chr1 (179145..180728) [1584 bp, 527 aa] {ON} Anc_3.160
           YDL030W
          Length = 527

 Score =  343 bits (879), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 201/507 (39%), Positives = 288/507 (56%), Gaps = 30/507 (5%)

Query: 50  RRNPEIFYRNVDELKLITGDAKVDDYAEIEKNSNKIYSVRKTKRTRKQILAQEHEIQLFL 109
           +RNPE++Y+  + LK +  D  +D  ++  +N+NKIY  RK KR RKQIL Q++EI  FL
Sbjct: 26  QRNPELYYKYQEGLKKVV-DPDIDLPSKTVRNTNKIYKTRKHKRKRKQILLQQYEINEFL 84

Query: 110 EEYRKKSESLRNVEFDLRRYQVTDGSVDGFLEHIETINSE-------VPDDID--DSMEN 160
           ++YR+K + L   + D+  ++        F E +E+IN+E        P ++   D  + 
Sbjct: 85  DDYRRKEKQLMKQKLDISEFRDKGADFVKFEELLESINNEYNNQNEETPTNLKLLDKKDK 144

Query: 161 YTMFSNSTAAR--RDILSKKARALDINAKFTREEQYGEFLDLEPFHQQWLSVVKDGSVSL 218
           Y MFS+S       +ILSK+++ LD+N  F++EEQYGE L+LE F+  WL+VVK    S+
Sbjct: 145 YAMFSSSININSPNNILSKRSQLLDLNNYFSKEEQYGEILNLEQFYSSWLNVVKTADCSI 204

Query: 219 LQFLGEIEKFTTK-RFLLTPAVNRGSARYQDFVKALLCYLQDYLMRAYPLQDWDKIHAEI 277
           L+++  +  F  K  F+L   ++R + RY DF++ L  Y + YL + Y L +W     E+
Sbjct: 205 LKYILMLNVFLDKDEFILNSPMDRKNLRYVDFIRILSKYFESYLEKRYILNNWINFKTEL 264

Query: 278 QATYCDYKSHPEEAGDSGLFCIPCDKTFKAETVYLAHLTGKKHINNMNKKDEFLAQEYKL 337
           + ++  Y   P      G  CI C K FK   VY  HL GK+H  + + +  FL  EYKL
Sbjct: 265 KKSFEKYSIKPIVKEKKGYLCISCGKWFKNSNVYDGHLKGKQHEKHYSNRKMFLYNEYKL 324

Query: 338 HMLCCYLVQELVRTREFVERKLAFTPEERRQEMERLTTVYESPVYGXXXXXXXXXXXXKP 397
           H +  YL  E   ++ ++ERKLAFT  ER  E++ LT  YE P Y               
Sbjct: 325 HRIINYLKYEFDESKAYMERKLAFTNTERNNELKLLTKKYEEPAYNKDEPENTDKYEEDD 384

Query: 398 TTNQEDSTP-EPSFDLPLGPDGFPIPYWLYKLQGLDIEYPCEVCGNLIYKGRRQFDKHFT 456
            +    +     SF++PLGPDG PIP WLYKLQGLDI+Y CE+CGN  Y+GR+ ++ HF+
Sbjct: 385 NSMSNAAEDRNKSFNMPLGPDGMPIPLWLYKLQGLDIKYNCEICGNKEYQGRKAYENHFS 444

Query: 457 EQRHIFGLKRLGVDPSPSFKGVTSIDDVKQLWAHLRSSSKASNAAGPKFEE--------- 507
           E  H   L  LG+  S +FKG+TSI + K LW    SS  ASN +   F           
Sbjct: 445 ELTHTSHLYFLGIQYSKAFKGITSIAEAKSLW----SSMHASNGSAASFSNQNNTKLAMT 500

Query: 508 ---EIEDEEGNVMSKKVYEELKKQGLI 531
              E+ED EGNVMSKK+Y+ELKKQ L+
Sbjct: 501 EDIEVEDSEGNVMSKKIYDELKKQNLV 527

>Suva_4.219 Chr4 (387976..389571) [1596 bp, 531 aa] {ON} YDL030W
           (REAL)
          Length = 531

 Score =  336 bits (862), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 204/511 (39%), Positives = 296/511 (57%), Gaps = 34/511 (6%)

Query: 50  RRNPEIFYRNVDELKLITGDAKVDDYAEIEKNSNKIYSVRKTKRTRKQILAQEHEIQLFL 109
           +RNPE++YR + E   +  D K    + +  + NKIY ++K KR RKQ++ Q+HEI LFL
Sbjct: 26  QRNPELYYRYILEAGKLFPDIKQPRPSLV--SENKIYKLKKNKRNRKQVILQQHEIDLFL 83

Query: 110 EEYRKKSESLRNV---------EFDLRRYQVTDGSVDGFLEHIETINSEVPDDIDDSMEN 160
            +Y++K   +  +         E DLR ++     ++   E ++        DI+     
Sbjct: 84  RDYKEKQRLINEINIPQDVQEDEKDLRSFEQKLQELE---EELKNEQENYQLDINLKRGR 140

Query: 161 YTMFSNST--AARRDILSKKARALDINAKFTREEQYGEFLDLEPFHQQWLSVVKDGSVSL 218
           Y +FS+S   + R +ILS++AR +D+N  FTR+EQYGE+++LE FH  WL+V+K G  SL
Sbjct: 141 YALFSSSAEPSKRTNILSERARDIDLNRLFTRDEQYGEYMELEQFHSLWLNVIKRGDCSL 200

Query: 219 LQFLGEIEKFTT-KRFLLTPAVNRGSARYQDFVKALLCYLQDYLMRAYPLQDWDKIHAEI 277
           LQF   +E F   K++LL P ++R + RY  F+  L  Y++ +  ++Y L + + +   I
Sbjct: 201 LQFFDTVELFVDDKKYLLAPPMDRKNDRYMSFLMKLSEYVESFFYKSYALFEKEVVEGLI 260

Query: 278 QATYCD-YKSHPEEAGDSGLFCIPCDKTFKAETVYLAHLTGKKHINNMNKKDEFLAQEYK 336
           ++ + + Y     ++   G++C  C K FK + V+  H+ GK H  N  K+   +  EYK
Sbjct: 261 KSDFDNSYCRGILKSESKGIYCPLCYKWFKTQAVFENHIPGKNHKKNEAKRKRIVYSEYK 320

Query: 337 LHMLCCYLVQELVRTREFVERKLAFTPEERRQEMERLTTVYESPVYGXXXXXXXXXX--X 394
           LH     L  EL  T+ FVERKLAFT  ER  EM+ LT  YE+P Y              
Sbjct: 321 LHRYLRLLKDELFHTKSFVERKLAFTANERMVEMDSLTQKYEAPAYDATEREDDGKGGGE 380

Query: 395 XKPTTNQEDSTPEPSFDLPLGPDGFPIPYWLYKLQGLDIEYPCEVCGNLIYKGRRQFDKH 454
            K    QE      SFD+PLGPDG P+PYWLYKL GLD EYPCE+C N IY GRR F++H
Sbjct: 381 QKDDKLQEKHLFGKSFDMPLGPDGLPMPYWLYKLHGLDREYPCEICANRIYNGRRTFERH 440

Query: 455 FTEQRHIFGLKRLGVDPSPSFKGVTSIDDVKQLWAHLRSSSK--ASNAAGPK-------- 504
           F E+ H++ L+ LG++PS  FKG+T I + ++LW + +S  +  +S AA P         
Sbjct: 441 FNEETHLYHLRCLGIEPSSVFKGITKIAEAQRLWKNTQSQPQFVSSIAAVPAEKKLSQTK 500

Query: 505 ----FEEEIEDEEGNVMSKKVYEELKKQGLI 531
                E E EDE+GNVMSKKVY+ELKKQGL+
Sbjct: 501 LPAGMELEEEDEQGNVMSKKVYDELKKQGLV 531

>CAGL0K01573g Chr11 (139809..141359) [1551 bp, 516 aa] {ON} similar
           to uniprot|P19736 Saccharomyces cerevisiae YDL030w
           Pre-mRNA splicing factor PRP9
          Length = 516

 Score =  302 bits (773), Expect = 8e-96,   Method: Compositional matrix adjust.
 Identities = 178/509 (34%), Positives = 287/509 (56%), Gaps = 44/509 (8%)

Query: 50  RRNPEIFYRNVDELKLITGDA---KVDDYAEIEKNSNKIYSVRKTKRTRKQILAQEHEIQ 106
           +RNPE++Y     L+ I  D     +DD    ++  NKIY  RK KRT KQ   Q++EI 
Sbjct: 25  QRNPELYYDYRIHLEGIRDDIPKLGLDD----DRMVNKIYKARKHKRTLKQKRTQQYEIN 80

Query: 107 LFLEEYRKKSESLRNVEFDLR----RYQVTDGSVDGF--------------LEHIETINS 148
            FL++  KK++ +  V   L+    +Y+ ++   +                 + I   NS
Sbjct: 81  TFLDDIFKKNKYILKVRNQLKSDGLKYKDSECKFELLKKLLGDEPTEDEDEDDSISKSNS 140

Query: 149 EVPDDIDDSMENYTMFSNSTAARRDILSKKARALDINAKFTREEQYGEFLDLEPFHQQWL 208
               DID+++  Y M          ++S++   LDIN  F ++EQ G  +D EP +++WL
Sbjct: 141 SRLLDIDETINRYNM----NLGNGKLVSERCSLLDINTIFQKDEQDGFIIDFEPLYRRWL 196

Query: 209 SVVKDGSVSLLQFLGEIEKFTT-KRFLLTPAVNRGSARYQDFVKALLCYLQDYLMRAYPL 267
           ++VKDG+++  +F+  +EKF   K++LL P ++R +  Y +FV     +++    +   L
Sbjct: 197 NIVKDGTLTYPKFISNLEKFIDDKKYLLDPVMDRKTKGYCEFVVEACDFVETQYFKRNIL 256

Query: 268 QDWDKIHAEIQATYCDYKSHPEEA--GDSGLF-CIPCDKTFKAETVYLAHLTGKKHINNM 324
            + ++I  ++     D+++H  +A   +SG++ C+ CDK F +  +Y +H TGK H  ++
Sbjct: 257 LNEEQIKGKLHR---DFENHVTKAIITESGIYYCLYCDKMFNSAHIYDSHRTGKAHSKSV 313

Query: 325 NKKDEFLAQEYKLHMLCCYLVQELVRTREFVERKLAFTPEERRQEMERLTTVYESPVYGX 384
           +   +    E+KLH+    + +E   T+E+V+RK+AFT +ER +EME+LT  Y  PVY  
Sbjct: 314 SNYHDSFRAEFKLHVYVSCMREEFENTKEYVDRKMAFTNKERLEEMEKLTQEYHRPVYDP 373

Query: 385 XXXXXXXXXXXKPTTNQEDSTPEPSF--DLPLGPDGFPIPYWLYKLQGLDIEYPCEVCGN 442
                        +  +++         D+PLGPDG PIPYWLYKLQGLD+   CE+CGN
Sbjct: 374 TEKEGDVEEDNSKSKTKDELKEMLGLGEDMPLGPDGLPIPYWLYKLQGLDVGQECEICGN 433

Query: 443 LIYKGRRQFDKHFTEQRHIFGLKRLGVDPSPSFKGVTSIDDVKQLWAHLRSSSKASNAAG 502
            +YKG + FDKHF+   H + LK LG++PS +F+G+T I + + LW  ++ ++    A  
Sbjct: 434 QVYKGHKNFDKHFSGPTHTYHLKCLGIEPSSAFQGITKIKEAQALWKQMQRNTTQELA-- 491

Query: 503 PKFEEEIEDEEGNVMSKKVYEELKKQGLI 531
               EE+ED+EGNVMSK +YEELKKQGL+
Sbjct: 492 ----EEVEDKEGNVMSKDIYEELKKQGLV 516

>KLLA0F24662g Chr6 complement(2292807..2294399) [1593 bp, 530 aa]
           {ON} similar to uniprot|P19736 Saccharomyces cerevisiae
           YDL030W PRP9 Subunit of the SF3a splicing factor complex
           required for spliceosome assembly
          Length = 530

 Score =  300 bits (767), Expect = 7e-95,   Method: Compositional matrix adjust.
 Identities = 191/508 (37%), Positives = 293/508 (57%), Gaps = 34/508 (6%)

Query: 50  RRNPEIFYRNVDELKLITGDAKVDDYAEIEKNSNKIYSVRKTKRTRKQILAQEHEIQLFL 109
           RRNPEIFYR  + L  +  +A      +++ ++N+IY  +K+KR+RKQI AQE+EI LFL
Sbjct: 31  RRNPEIFYRFNEALHNLGVEAWA--VPKLDVSANRIYRSKKSKRSRKQIKAQEYEIALFL 88

Query: 110 EEYRKKSESLRN---VEFDLRRYQVTDGSVDGFLEHIETINSEVPDDIDDSME------N 160
             YR+  +SL+     E  L  ++ T+ S + F    ET+ +EV +   +S        +
Sbjct: 89  GRYRRLLKSLQKHKLSEEHLEYFRDTNASFEQF----ETVTTEVLEGQVNSRSLVEVKSD 144

Query: 161 YTMFSNSTAARRDILSKKARALDINAKFTREEQYGEFLDLEPFHQQWLSVVKDGSVSLLQ 220
           Y MFS   AA ++I+S   + +D++  F R+E +G +LDL    ++WL+++K   +++L 
Sbjct: 145 YEMFSGPQAASKNIISPIGQIIDLSRNFARDENFGTYLDLSEQFKKWLNIIKRADLTILS 204

Query: 221 FLGEIEKFTTKRFLLTPAVNRGSARYQDFVKALLCYLQDYLMRAYPLQDWDKIHAEIQAT 280
           FL  +E F T  +LL P+++R +  Y   V  LL Y + Y  +AYPL D + +   I   
Sbjct: 205 FLKMLESFETYDYLLNPSLDRDTKEYNQLVTELLKYYKAYYSKAYPLVDKEILSKTIHNG 264

Query: 281 YCDY------KSHPEEAGDSGLFCIPCDKTFKAETVYLAHLTGKKHINNMNKKDEFLAQE 334
           +  Y      +S  +E+G   ++ +  ++ F +++ +  H+  ++    +++  + L +E
Sbjct: 265 FDKYVRTGITESPSKESGK--MYSVVFNRWFDSQSEFNTHVQTEQFNIALSRNRKRLMKE 322

Query: 335 YKLHMLCCYLVQELVRTREFVERKLAFTPEERRQEMERLTTVYESPVYGXXXXXXXXXX- 393
           Y  H    +L + L  T  F ERKLAFT EE  +E+E+L   YESP+Y            
Sbjct: 323 YTFHCFSKFLSKVLQNTISFTERKLAFTDEEFTEELEKLQEQYESPIYAKDESEDKPSYI 382

Query: 394 -XXKPTTNQEDSTPEPSFDLPLGPDGFPIPYWLYKLQGLDIEYPCEVCGNLIYKGRRQFD 452
              + T  +E   P   ++LPLGPDGFPIP WL K+QGLD++Y CE+CGN IY GRR+F+
Sbjct: 383 DNAEDTAQKESMDPTNPYNLPLGPDGFPIPRWLIKVQGLDVKYVCEICGNQIYHGRREFE 442

Query: 453 KHFTEQRHIFGLKRLGVDPSPSFKGVTSIDDVKQLWAHLRSS---------SKASNAAGP 503
           KHF  ++H  GLK LG+ PS +FK VT+I +V +LW  L++          SK S    P
Sbjct: 443 KHFPLKKHSEGLKSLGITPSLAFKDVTTIVEVTELWKALQAKSTLKSGEPFSKISTVKEP 502

Query: 504 KFEEEIEDEEGNVMSKKVYEELKKQGLI 531
           +   E ED EGNVMS +VYEELKKQGL+
Sbjct: 503 EMVLETEDNEGNVMSVQVYEELKKQGLL 530

>KNAG0K01120 Chr11 (218749..220332) [1584 bp, 527 aa] {ON} Anc_3.160
           YDL030W
          Length = 527

 Score =  298 bits (762), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 179/509 (35%), Positives = 283/509 (55%), Gaps = 33/509 (6%)

Query: 50  RRNPEIFYRNVDELKLITGDAKVDDYAEIEK-NSNKIYSVRKTKRTRKQILAQEHEIQLF 108
           +RNP ++Y +V  LK +T  A+       +    NK+Y V K+ R  KQ+  Q+HEI+LF
Sbjct: 25  QRNPALYYNSVPMLKKLTMQAEPKVCPPQDHVTKNKVYRVEKSARKVKQVATQQHEIKLF 84

Query: 109 LEEYRKKSESLRNVEFDLRRYQVTDG-----SVDGFLEHIETIN-SEVP--DDIDDSMEN 160
           L++   +++ L  +    R  +   G     ++D F   I  +  S +P    +    + 
Sbjct: 85  LQD---RTDILNKLS---RAQESGPGESQYKNLDEFKTAINGLTESNIPKRSGLQSEKDQ 138

Query: 161 YTMFSNST-AARRDILSKKARALDINAKFTREEQYGEFLDLEPFHQQWLSVVKDGSVSLL 219
           Y MFS+S      +ILS +A  LDINA F REEQYG ++ LE +H  WL ++K+ SV++L
Sbjct: 139 YAMFSSSIEKPPTNILSARALELDINAIFNREEQYGTYIQLENYHPMWLELMKEPSVTVL 198

Query: 220 QFLGEIEKF-----TTKRFLLTPAVNRGSARYQDFVKALLCYLQDYLMRAYPLQDWDKIH 274
           Q+L  +E+          +L +P ++R + +Y  F++ L  YL+ Y+ + +PL D   + 
Sbjct: 199 QYLESLERMFLNADDKTSYLTSPPIDRDNKQYLRFLERLGLYLKTYIAKKFPLIDQHLVE 258

Query: 275 AEIQATYCD-YKSHPEEAGDSGLFCIPCDKTFKAETVYLAHLTGKKHINNMNKKDEFLAQ 333
             +   + + Y + P     +  FC  CDK ++   ++  HL  K H     K+   L  
Sbjct: 259 DYLLDHFKNRYVNKPVSTDQNTQFCPVCDKRYEGMQLFNDHLLNKFHAQQRGKRLPLLQA 318

Query: 334 EYKLHMLCCYLVQELVRTREFVERKLAFTPEERRQEMERLTTVYESPVYGXX-------X 386
           E+++ +    L +E   ++ F+ERKLAFT  ER++E++RLTT YE+P Y           
Sbjct: 319 EFRVSVYLTALSKEFKDSKNFMERKLAFTYAERQEELQRLTTEYEAPNYNPALEHEDNPA 378

Query: 387 XXXXXXXXXKPTTNQEDSTPEPSF-DLPLGPDGFPIPYWLYKLQGLDIEYPCEVCGNLIY 445
                      + N++ +  E  F ++PLGPDG PIP WLYKLQGLD++Y CE+CGN  +
Sbjct: 379 ETDKNKNGKTHSENKQTAELESMFTNMPLGPDGMPIPLWLYKLQGLDVKYTCEICGNAEF 438

Query: 446 KGRRQFDKHFTEQRHIFGLKRLGVDPSPSFKGVTSIDDVKQLWAHLRSSSKASNAAGP-- 503
           KGRR + KHF E  H + LK LG+  S +F G+  I++ ++LWA +   S ++ A     
Sbjct: 439 KGRRAYQKHFHEPLHEYRLKCLGITRSKAFDGIALIEEAQELWAKISGKSTSARAGSDDS 498

Query: 504 -KFEEEIEDEEGNVMSKKVYEELKKQGLI 531
            K E E+EDE+GNVMS+ VY++LK+QGL+
Sbjct: 499 LKLEIEVEDEDGNVMSQTVYQDLKRQGLL 527

>TBLA0B01600 Chr2 (352382..353842) [1461 bp, 486 aa] {ON} Anc_3.160
           YDL030W
          Length = 486

 Score = 88.2 bits (217), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 88/354 (24%), Positives = 154/354 (43%), Gaps = 33/354 (9%)

Query: 156 DSMENYTMFSNSTAARRDILSKKARALDINAKFT-REEQYGEFLDLEPFHQQWLSVV--- 211
           +S+E  ++ S      ++I      ++DIN+ +   EE+YG  + L+ F+  W+  +   
Sbjct: 86  NSVEEVSVASLFATRIKEIAPLPIPSIDINSVYRDPEEEYGTSISLDRFYNLWIGHLTKR 145

Query: 212 --KDGSVSLLQFLGEIEKFTTKRFLLTPAVNRGSARYQDFVKALLCYLQDYLMRAYPLQD 269
              +   +L++F G++    TK+FL    ++  +A     +  +L YL  +  R   ++ 
Sbjct: 146 KTSESPPTLVEFYGQV----TKQFLHDRWIDE-TAFPPSLIAGMLEYLTGFQERVDIVKP 200

Query: 270 WD---------KIHAEIQATYCDYKSHPEEAGDS-GLFCIPCD-KTFKAETVYLAHLTGK 318
            D         + H  + ++ C   S    +     L CI C  K F  E V+  HL   
Sbjct: 201 QDSSAAITRRLRRHIALSSSSCSSSSSSASSPSPWPLTCIVCGPKKFATEQVFHHHLNSN 260

Query: 319 KHINNMNKKDEFLAQEYKLHMLCCYLVQELVRTREFVERKLAFTPEERRQE---MERLTT 375
           +H+     +   +     +      L  EL      VER+L  TP+ER  E    +R+ T
Sbjct: 261 RHLKREASRLPIMIPIQSVREKLQTLAAELASGAARVERQLNMTPQERFAEHAAQQRIRT 320

Query: 376 VYESPVYGXXXXXXXXXXXXKPTTNQEDSTPEPSFDLPLGPDGFPIPYWLYKLQGLDIEY 435
                V G             P+     +TP  +  + +  DG  +P WLY+LQGL   +
Sbjct: 321 A----VQGRGGGDTTATPSATPSATPAATTPASASTVEV--DGRHVPRWLYRLQGLSSIF 374

Query: 436 PCEVCGNLIYKGRRQFDKHFTEQRHIFGLKRLGV--DPSPSFKGVTSIDDVKQL 487
            CE+C    + GR ++++HFT  +H   L  LGV  +    F+G+  +D V +L
Sbjct: 375 TCELCDGREFHGRTRYERHFTSTQHRTRLVCLGVPAEQHVQFRGLGKLDAVLEL 428

>KLTH0H09922g Chr8 complement(852480..854204) [1725 bp, 574 aa] {ON}
           similar to uniprot|P05066 Saccharomyces cerevisiae
           YOR386W PHR1 DNA photolyase involved in
           photoreactivation repairs pyrimidine dimers in the
           presence of visible light induced by DNA damage
           regulated by transcriptional repressor Rph1p
          Length = 574

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 41/97 (42%), Gaps = 12/97 (12%)

Query: 272 KIHA-----EIQATYCDYKSHPEEAGDSGLFCIPCDK------TFKAETVYLAHLTGKKH 320
           KIHA     ++  +   ++S   E  D  L  +PCDK      T       L       +
Sbjct: 261 KIHAVDQESKVNESLAKFESEAYELSDEFLAYLPCDKLEVPPATEADAHELLQEFISSGN 320

Query: 321 INNMNKKDEFLAQEYKLHMLCCYLVQELVRTREFVER 357
            +  N+K + L+ +   H L CY+   L+ TRE V R
Sbjct: 321 AHKYNEKKDTLSLDSTSH-LSCYITSGLISTREVVNR 356

>KLLA0E01409g Chr5 (140505..141065) [561 bp, 186 aa] {ON} similar to
           uniprot|Q12368 Saccharomyces cerevisiae YDL098C SNU23 23
           kD U4/U6.U5 snRNP associated protein Putative RNA
           binding zinc finger protein
          Length = 186

 Score = 31.2 bits (69), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 34/76 (44%), Gaps = 7/76 (9%)

Query: 247 QDFVKALLCYLQDY-LMRAYPLQDWDKIHAEIQATYCDYKSHPEEAGDSGLFCIPCDKTF 305
           Q+ +KAL     DY  +  Y L+D +K       T     S  ++    G +C  CD TF
Sbjct: 32  QEQLKALKDRYTDYNALLEYNLRDINK------KTLSANLSQQKKGKQFGFYCDICDLTF 85

Query: 306 KAETVYLAHLTGKKHI 321
           K    ++ HL  K H+
Sbjct: 86  KDTLQFINHLNHKSHV 101

>TPHA0G01920 Chr7 complement(398453..398947) [495 bp, 164 aa] {ON}
           Anc_2.359 YDL098C
          Length = 164

 Score = 30.4 bits (67), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 20/40 (50%), Gaps = 4/40 (10%)

Query: 295 GLFCIPCDKTFKAETVYLAHLTGKKHINNMNKKDEFLAQE 334
           G +C  CD TFK    Y+ HL  K H    N K E L +E
Sbjct: 77  GFYCELCDLTFKDNLQYIDHLNHKTH----NIKFELLFEE 112

>KNAG0C01470 Chr3 (292959..294557) [1599 bp, 532 aa] {ON} Anc_1.259
           YKR023W
          Length = 532

 Score = 30.8 bits (68), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 50/102 (49%), Gaps = 8/102 (7%)

Query: 85  IYSVRKTKRTRKQILAQEHEIQLFLEEYRKKSESLRNVEFDLRRYQVTDGSVDGFLEHIE 144
           I   ++ +R R+++L ++ E Q+  E   +K ES +NV+ DLR  Q     +D  L H +
Sbjct: 290 IERQKERERKREEVLREKTEEQIMQEATERKEESEKNVDKDLRDAQ---ERLDNLL-HFQ 345

Query: 145 TINSEVPDDIDD----SMENYTMFSNSTAARRDILSKKARAL 182
             +++    ID+    SM N +        R  +L K+ R +
Sbjct: 346 DTSAQRTKIIDNASDFSMSNESGLWGDARERALMLKKQQRNM 387

>Kpol_499.15 s499 (44708..47899) [3192 bp, 1063 aa] {ON}
           (44708..47899) [3192 nt, 1064 aa]
          Length = 1063

 Score = 30.8 bits (68), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 50/218 (22%), Positives = 88/218 (40%), Gaps = 38/218 (17%)

Query: 72  VDDYAEIEKNSNKIYSVRKTKRTRKQILAQEHEIQLFLEEYRKKSESLRNVEFDLRRYQV 131
           +D  ++++ N  K   +  +    K+ L Q  +I  F E  +   + ++N+E   + + V
Sbjct: 695 LDTMSDLKNNRLKPSVLAPSNSQVKRNLQQNLKISAFSEPIQVSLDDIKNIETKGKWWLV 754

Query: 132 T---DGSVDGFLEHIE---------TINSEVPDDIDDSMENYTMFSN----STAARRDIL 175
                G+++   E  E         T N ++ DD+ D + ++T  S     +T  RR I 
Sbjct: 755 GASWKGNMESAFEEAESQNDGGLKNTSNLKIVDDLLDDIPDWTEVSKQQRMNTDVRRAIF 814

Query: 176 SKKARALDINAKFTREEQYGEFLDLEPFHQQWLSVVKDGSVSLLQFLGEIEKFTTKRFLL 235
                A D    FT+ E+    L+L+  ++Q L               EI K  T   LL
Sbjct: 815 ISIMSAQDFMDAFTKLEK----LNLK--NKQML---------------EIPKVLT-HCLL 852

Query: 236 TPAVNRGSARYQDFVKALLCYLQDYLMRAYPLQDWDKI 273
           T   N G   Y   V + +C     L++ +    WD +
Sbjct: 853 TDGANNGYNPYYAIVASKICEHHHQLLKTFQFLFWDVV 890

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.396 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 55,808,855
Number of extensions: 2436208
Number of successful extensions: 9113
Number of sequences better than 10.0: 86
Number of HSP's gapped: 9360
Number of HSP's successfully gapped: 86
Length of query: 531
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 417
Effective length of database: 40,409,475
Effective search space: 16850751075
Effective search space used: 16850751075
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)