Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_56.22530na 1ON55455424780.0
KLTH0C10450gna 1ON56652220860.0
SAKL0H26246gna 1ON55151417400.0
TDEL0G04770singletonON52632612011e-159
KLLA0E09901gna 1ON56032011811e-156
YNR029C6.337ON4293182452e-21
NDAI0K015506.337ON4312642415e-21
Ecym_24956.337ON4352622416e-21
CAGL0M10747g6.337ON4322632406e-21
Smik_14.3586.337ON4662692391e-20
KAFR0C045706.337ON4292192353e-20
TPHA0H022906.337ON4542612344e-20
SAKL0A01342g6.337ON4082702301e-19
AAR044W6.337ON4102572301e-19
Kwal_23.63166.337ON4082572291e-19
KNAG0D004106.337ON4252572292e-19
Suva_14.3836.337ON4333002247e-19
KLLA0C08613g6.337ON4222662239e-19
TBLA0F041006.337ON4662172222e-18
NCAS0A045206.337ON4422132203e-18
Skud_14.3606.337ON4292632193e-18
KLTH0A06688g6.337ON4102082166e-18
Kpol_325.26.337ON4392642177e-18
ZYRO0D08272g6.337ON4102132042e-16
TDEL0A075206.337ON4242611953e-15
TBLA0C028201.285ON73771732.6
CAGL0K07986g3.395ON532183732.7
KLLA0F02926g2.462ON33924722.8
ABR125C3.220ON148868724.3
Smik_16.3303.395ON548178689.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_56.22530
         (554 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_56.22530 s56 (171195..172859) [1665 bp, 554 aa] {ON} YNR029...   959   0.0  
KLTH0C10450g Chr3 complement(867872..869572) [1701 bp, 566 aa] {...   808   0.0  
SAKL0H26246g Chr8 complement(2311294..2312949) [1656 bp, 551 aa]...   674   0.0  
TDEL0G04770 Chr7 (871701..873281) [1581 bp, 526 aa] {ON}              467   e-159
KLLA0E09901g Chr5 complement(877366..879048) [1683 bp, 560 aa] {...   459   e-156
YNR029C Chr14 complement(677199..678488) [1290 bp, 429 aa] {ON} ...    99   2e-21
NDAI0K01550 Chr11 (351617..352912) [1296 bp, 431 aa] {ON} Anc_6....    97   5e-21
Ecym_2495 Chr2 complement(970589..971896) [1308 bp, 435 aa] {ON}...    97   6e-21
CAGL0M10747g Chr13 complement(1072542..1073840) [1299 bp, 432 aa...    97   6e-21
Smik_14.358 Chr14 complement(635188..636588) [1401 bp, 466 aa] {...    97   1e-20
KAFR0C04570 Chr3 complement(914620..915909) [1290 bp, 429 aa] {O...    95   3e-20
TPHA0H02290 Chr8 complement(545849..547213) [1365 bp, 454 aa] {O...    95   4e-20
SAKL0A01342g Chr1 (129065..130291) [1227 bp, 408 aa] {ON} simila...    93   1e-19
AAR044W Chr1 (420088..421320) [1233 bp, 410 aa] {ON} Syntenic ho...    93   1e-19
Kwal_23.6316 s23 complement(1527371..1528597) [1227 bp, 408 aa] ...    93   1e-19
KNAG0D00410 Chr4 (60526..61803) [1278 bp, 425 aa] {ON} Anc_6.337...    93   2e-19
Suva_14.383 Chr14 complement(658484..659785) [1302 bp, 433 aa] {...    91   7e-19
KLLA0C08613g Chr3 (754098..755366) [1269 bp, 422 aa] {ON} simila...    91   9e-19
TBLA0F04100 Chr6 complement(1016306..1017706) [1401 bp, 466 aa] ...    90   2e-18
NCAS0A04520 Chr1 (907999..909327) [1329 bp, 442 aa] {ON} Anc_6.337     89   3e-18
Skud_14.360 Chr14 complement(645289..646578) [1290 bp, 429 aa] {...    89   3e-18
KLTH0A06688g Chr1 complement(557036..558268) [1233 bp, 410 aa] {...    88   6e-18
Kpol_325.2 s325 complement(4458..5777) [1320 bp, 439 aa] {ON} co...    88   7e-18
ZYRO0D08272g Chr4 (716261..717493) [1233 bp, 410 aa] {ON} simila...    83   2e-16
TDEL0A07520 Chr1 complement(1310807..1312081) [1275 bp, 424 aa] ...    80   3e-15
TBLA0C02820 Chr3 complement(674701..676914) [2214 bp, 737 aa] {O...    33   2.6  
CAGL0K07986g Chr11 complement(792641..794239) [1599 bp, 532 aa] ...    33   2.7  
KLLA0F02926g Chr6 (273193..274212) [1020 bp, 339 aa] {ON} simila...    32   2.8  
ABR125C Chr2 complement(623888..628354) [4467 bp, 1488 aa] {ON} ...    32   4.3  
Smik_16.330 Chr16 complement(588603..590249) [1647 bp, 548 aa] {...    31   9.9  

>Kwal_56.22530 s56 (171195..172859) [1665 bp, 554 aa] {ON} YNR029C -
           Hypothetical ORF [contig 185] FULL
          Length = 554

 Score =  959 bits (2478), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 480/554 (86%), Positives = 480/554 (86%)

Query: 1   MTSDQNTKKAIPITLLSGFLGSGKTTLLEKILTTNHGYKVAVIINDMSELNIDSSLIQNH 60
           MTSDQNTKKAIPITLLSGFLGSGKTTLLEKILTTNHGYKVAVIINDMSELNIDSSLIQNH
Sbjct: 1   MTSDQNTKKAIPITLLSGFLGSGKTTLLEKILTTNHGYKVAVIINDMSELNIDSSLIQNH 60

Query: 61  NVCQKEEKLIELQNGCICCTLRGDLLEELVGIAEKGHFDYIVIESTGIAEPMQVAETFSV 120
           NVCQKEEKLIELQNGCICCTLRGDLLEELVGIAEKGHFDYIVIESTGIAEPMQVAETFSV
Sbjct: 61  NVCQKEEKLIELQNGCICCTLRGDLLEELVGIAEKGHFDYIVIESTGIAEPMQVAETFSV 120

Query: 121 EFSDMLLETPGGIPEDEEKLLRKVSNMGGLQSLAKIDTCVTVVDALNFFANINTTQFLAD 180
           EFSDMLLETPGGIPEDEEKLLRKVSNMGGLQSLAKIDTCVTVVDALNFFANINTTQFLAD
Sbjct: 121 EFSDMLLETPGGIPEDEEKLLRKVSNMGGLQSLAKIDTCVTVVDALNFFANINTTQFLAD 180

Query: 181 RWGENGQGESERTITDLMVDQIEFADVVIINKKNTVSXXXXXXXXXXXXALNPVAKTVAA 240
           RWGENGQGESERTITDLMVDQIEFADVVIINKKNTVS            ALNPVAKTVAA
Sbjct: 181 RWGENGQGESERTITDLMVDQIEFADVVIINKKNTVSKKKMQKIRKMIKALNPVAKTVAA 240

Query: 241 DYCNVPLSLILNTGLHDFEKASTSAGWLQSINEMTVREGFGEKGGSVLTPKPETEEYGVN 300
           DYCNVPLSLILNTGLHDFEKASTSAGWLQSINEMTVREGFGEKGGSVLTPKPETEEYGVN
Sbjct: 241 DYCNVPLSLILNTGLHDFEKASTSAGWLQSINEMTVREGFGEKGGSVLTPKPETEEYGVN 300

Query: 301 NFVYRRRRPFHPERLYELIRDKFFIIEQAGGVPTXXXXXXXXXXXXXXXXXXXXXXXXXX 360
           NFVYRRRRPFHPERLYELIRDKFFIIEQAGGVPT                          
Sbjct: 301 NFVYRRRRPFHPERLYELIRDKFFIIEQAGGVPTGEEGEDWQDEEGSESEEESEADSGSN 360

Query: 361 XXXXXXXXXXXXXXXXXXXXXXINTNRSKSPFGQLLRSKGFFWLATRYVVRGEWSSAGPM 420
                                 INTNRSKSPFGQLLRSKGFFWLATRYVVRGEWSSAGPM
Sbjct: 361 SADEEDEGGEDDDEAEEYTEEEINTNRSKSPFGQLLRSKGFFWLATRYVVRGEWSSAGPM 420

Query: 421 LTLNGGLPWFAVSGLDNVPEEALPLIKKDFDGEFGDRRNELVFIGLKINEKLLSEVLDSC 480
           LTLNGGLPWFAVSGLDNVPEEALPLIKKDFDGEFGDRRNELVFIGLKINEKLLSEVLDSC
Sbjct: 421 LTLNGGLPWFAVSGLDNVPEEALPLIKKDFDGEFGDRRNELVFIGLKINEKLLSEVLDSC 480

Query: 481 LLTDKEMAQFKRITDKHNELVADEKLAKIWDDGFEDWQIMXXXXXXXXXXXXXXKKVAQE 540
           LLTDKEMAQFKRITDKHNELVADEKLAKIWDDGFEDWQIM              KKVAQE
Sbjct: 481 LLTDKEMAQFKRITDKHNELVADEKLAKIWDDGFEDWQIMGAGDEDEEEDQGEAKKVAQE 540

Query: 541 KGVLGARHSHTIST 554
           KGVLGARHSHTIST
Sbjct: 541 KGVLGARHSHTIST 554

>KLTH0C10450g Chr3 complement(867872..869572) [1701 bp, 566 aa] {ON}
           conserved hypothetical protein
          Length = 566

 Score =  808 bits (2086), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/522 (75%), Positives = 430/522 (82%), Gaps = 2/522 (0%)

Query: 1   MTSDQNTKKAIPITLLSGFLGSGKTTLLEKILTTNHGYKVAVIINDMSELNIDSSLIQNH 60
           MTSD+   KAIPITLLSGFLGSGKTTLLEKILTTNHG+K+AVIINDMSELNIDSSL+Q H
Sbjct: 1   MTSDKKVSKAIPITLLSGFLGSGKTTLLEKILTTNHGFKIAVIINDMSELNIDSSLVQAH 60

Query: 61  NVCQKEEKLIELQNGCICCTLRGDLLEELVGIAEKGHFDYIVIESTGIAEPMQVAETFSV 120
           NVCQKEEKLIELQNGCICCTLRGDLLEELVGI E+G FDYIVIESTGIAEPMQVAETFSV
Sbjct: 61  NVCQKEEKLIELQNGCICCTLRGDLLEELVGIGERGEFDYIVIESTGIAEPMQVAETFSV 120

Query: 121 EFSDMLLETPGGIPEDEEKLLRKVSNMGGLQSLAKIDTCVTVVDALNFFANINTTQFLAD 180
           EFSD+LLETPGGIPE+EEKLLRKVS+MGGLQ++AK+DTCVTV+DALNF +NI TT+FLAD
Sbjct: 121 EFSDILLETPGGIPENEEKLLRKVSDMGGLQAIAKLDTCVTVIDALNFLSNIQTTEFLAD 180

Query: 181 RWGENGQGESERTITDLMVDQIEFADVVIINKKNTVSXXXXXXXXXXXXALNPVAKTVAA 240
           RWGENGQGE+ERTITDLMVDQIEF+DV+I+NKK+ VS             LNPVAK +A 
Sbjct: 181 RWGENGQGEAERTITDLMVDQIEFSDVIIVNKKSMVSKKKLKEIKKMVKILNPVAKVIAT 240

Query: 241 DYCNVPLSLILNTGLHDFEKASTSAGWLQSINEMTVREGFGEKGGSVLTPKPETEEYGVN 300
           DYCNVPLS IL+T LHDFEKAS SAGWLQSINEMTVR+GFG KG SVLTPKPETEEYGVN
Sbjct: 241 DYCNVPLSSILDTKLHDFEKASLSAGWLQSINEMTVRDGFGNKGSSVLTPKPETEEYGVN 300

Query: 301 NFVYRRRRPFHPERLYELIRDKFFIIEQAG--GVPTXXXXXXXXXXXXXXXXXXXXXXXX 358
           NFVYRRRRPFHPERLY+LIRDKFF+IEQAG  G+                          
Sbjct: 301 NFVYRRRRPFHPERLYDLIRDKFFVIEQAGAAGMDEEEEDDEEESEEQSSESEADSEMEA 360

Query: 359 XXXXXXXXXXXXXXXXXXXXXXXXINTNRSKSPFGQLLRSKGFFWLATRYVVRGEWSSAG 418
                                   IN NR+ SPFG+LLRSKGFFWLATR+VVRGEWSSAG
Sbjct: 361 EVDEGARDGEEKEEEEGEEYTEEEINKNRANSPFGKLLRSKGFFWLATRFVVRGEWSSAG 420

Query: 419 PMLTLNGGLPWFAVSGLDNVPEEALPLIKKDFDGEFGDRRNELVFIGLKINEKLLSEVLD 478
           PMLTLNGGLPWFAVSGL++VPEEAL L+KKD++GEFGDRRNELVFIGL INEKLLSE LD
Sbjct: 421 PMLTLNGGLPWFAVSGLEDVPEEALELVKKDYEGEFGDRRNELVFIGLDINEKLLSEALD 480

Query: 479 SCLLTDKEMAQFKRITDKHNELVADEKLAKIWDDGFEDWQIM 520
           SCLLTDKE  +FK IT KHN LVADEKL+K+WDDGFEDW IM
Sbjct: 481 SCLLTDKEYKRFKNITSKHNALVADEKLSKVWDDGFEDWIIM 522

>SAKL0H26246g Chr8 complement(2311294..2312949) [1656 bp, 551 aa]
           {ON} conserved hypothetical protein
          Length = 551

 Score =  674 bits (1740), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/514 (65%), Positives = 385/514 (74%), Gaps = 5/514 (0%)

Query: 8   KKAIPITLLSGFLGSGKTTLLEKILTTNHGYKVAVIINDMSELNIDSSLIQNHNVCQKEE 67
           K  IPIT+LSGFLGSGKTTLLEKILTTNHG KVAVIINDMSELNID++L+QNH+V +KEE
Sbjct: 9   KTPIPITMLSGFLGSGKTTLLEKILTTNHGLKVAVIINDMSELNIDATLVQNHSVTKKEE 68

Query: 68  KLIELQNGCICCTLRGDLLEELVGIAEKGHFDYIVIESTGIAEPMQVAETFSVEFSDMLL 127
           KLI+LQNGCICCTLRGDLLEEL G+AE G F YIVIESTGIAEPMQVAETFS+EFS+MLL
Sbjct: 69  KLIQLQNGCICCTLRGDLLEELFGLAENGEFQYIVIESTGIAEPMQVAETFSMEFSEMLL 128

Query: 128 ETPGGIPEDEEKLLRKVSNMGGLQSLAKIDTCVTVVDALNFFANINTTQFLADRWGENGQ 187
           ETPGGIPEDEEKLL+KV  MGGL  + KIDTCVTV+DALNF +NI TTQFLADRWG+NGQ
Sbjct: 129 ETPGGIPEDEEKLLKKVLEMGGLHKITKIDTCVTVIDALNFLSNIETTQFLADRWGDNGQ 188

Query: 188 GESERTITDLMVDQIEFADVVIINKKNTVSXXXXXXXXXXXXALNPVAKTVAADYCNVPL 247
           GE++RTITDLMVDQIEFADVVIINK + +              LNPVAK +  DYCNVP+
Sbjct: 189 GEADRTITDLMVDQIEFADVVIINKVSLIKKRKLRKIEKIIKGLNPVAKILKTDYCNVPM 248

Query: 248 SLILNTGLHDFEKASTSAGWLQSINEMTVREGFGEKGGSVLTPKPETEEYGVNNFVYRRR 307
             I+NT L DFEKASTSAGWLQSINEMTVR GF +K  S+LTPKPETEEYGVNNFVY  R
Sbjct: 249 EEIINTNLFDFEKASTSAGWLQSINEMTVRTGFDDKKKSILTPKPETEEYGVNNFVYTAR 308

Query: 308 RPFHPERLYELIRDKFFIIEQAGGVPTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 367
           RPFHPERLY +++DKFFIIEQ                                       
Sbjct: 309 RPFHPERLYSMLKDKFFIIEQT----EIDDQADGEEMDEDEDGEDKDGEDSSVSDQEEEI 364

Query: 368 XXXXXXXXXXXXXXXINTNRSKSPFGQLLRSKGFFWLATRYVVRGEWSSAGPMLTLNGGL 427
                          I  N+  S FG LLRSKGFFWLATR+++RGEWSSAGPMLTL GG 
Sbjct: 365 EEESEDGSAGLTEKQILKNKKISSFGPLLRSKGFFWLATRHIMRGEWSSAGPMLTLKGGT 424

Query: 428 PWFAVSGLDNVPEEALPLIKKDFDGEFGDRRNELVFIGLKINEKLLSEVLDSCLLTDKEM 487
           PWFAVSGL++VP++   LIK++F+GEFGDRRNE+VFIGL I ++ L++ LDSCLL D+E 
Sbjct: 425 PWFAVSGLESVPDDTAKLIKQEFEGEFGDRRNEIVFIGLDIEKRALTKDLDSCLLNDEEF 484

Query: 488 AQFKRITD-KHNELVADEKLAKIWDDGFEDWQIM 520
           A F   T  K N L  +++LA I++DGFEDW I 
Sbjct: 485 ATFVAATKGKKNILKVEKELATIFEDGFEDWFIF 518

>TDEL0G04770 Chr7 (871701..873281) [1581 bp, 526 aa] {ON} 
          Length = 526

 Score =  467 bits (1201), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 230/326 (70%), Positives = 277/326 (84%), Gaps = 2/326 (0%)

Query: 1   MTSDQNTKKAIPITLLSGFLGSGKTTLLEKILTTNHGYKVAVIINDMSELNIDSSLIQNH 60
           MT  Q  ++ IP+T+LSGFLGSGKTTLLE+ILT NHG K+AVIINDMS++N+D++L+Q H
Sbjct: 1   MTMTQ--RQPIPVTILSGFLGSGKTTLLERILTENHGLKIAVIINDMSQVNVDAALVQQH 58

Query: 61  NVCQKEEKLIELQNGCICCTLRGDLLEELVGIAEKGHFDYIVIESTGIAEPMQVAETFSV 120
            V  +EEKLI+LQNGCICCTLRGDLLEEL+G++E+G FDYIVIESTGIAEPMQVAETFS 
Sbjct: 59  KVSNQEEKLIQLQNGCICCTLRGDLLEELLGLSEQGAFDYIVIESTGIAEPMQVAETFST 118

Query: 121 EFSDMLLETPGGIPEDEEKLLRKVSNMGGLQSLAKIDTCVTVVDALNFFANINTTQFLAD 180
           +FS  LL+TPGGIPE+EE LL++V  +GGL+ +AKIDTCVTVVDA NF +NI TT+FLA 
Sbjct: 119 DFSQALLDTPGGIPENEELLLKRVVELGGLEKVAKIDTCVTVVDAANFLSNIETTEFLAQ 178

Query: 181 RWGENGQGESERTITDLMVDQIEFADVVIINKKNTVSXXXXXXXXXXXXALNPVAKTVAA 240
           R+GE+GQ ESERT+T+LMVDQIEFADV+IINK + V             +LNPVAK + +
Sbjct: 179 RFGESGQNESERTVTNLMVDQIEFADVIIINKVSRVKKNDLLKIGKMISSLNPVAKILRS 238

Query: 241 DYCNVPLSLILNTGLHDFEKASTSAGWLQSINEMTVREGFGEKGGSVLTPKPETEEYGVN 300
           DYC VP+  I+NTGL+DFEKAS+SAGWLQSI+EMT+REGFG+K  SVLTPKPETEEYGVN
Sbjct: 239 DYCKVPIKEIINTGLYDFEKASSSAGWLQSIHEMTLREGFGDKTKSVLTPKPETEEYGVN 298

Query: 301 NFVYRRRRPFHPERLYELIRDKFFII 326
           +FVY  RRPFHPERLY L++DKFFII
Sbjct: 299 SFVYNSRRPFHPERLYYLLKDKFFII 324

 Score =  176 bits (445), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 81/133 (60%), Positives = 105/133 (78%), Gaps = 1/133 (0%)

Query: 386 NRSKSPFGQLLRSKGFFWLATRYVVRGEWSSAGPMLTLNGGLPWFAVSGLDNVPEEALPL 445
           N+  SPFG LLRSKGFFWLATR+++RGEWSSAG MLTL GG+PWF VSGL+ +PE+   +
Sbjct: 376 NKKSSPFGPLLRSKGFFWLATRHIMRGEWSSAGLMLTLKGGIPWFDVSGLEGIPEDTAEI 435

Query: 446 IKKDFDGEFGDRRNELVFIGLKINEKLLSEVLDSCLLTDKEMAQF-KRITDKHNELVADE 504
           I+++F+   GDRRNE+VFIGL I+++ L++ LDSCLLTDKE  +F K I+ + N L  + 
Sbjct: 436 IRQEFEEPHGDRRNEIVFIGLGIDKEALAKTLDSCLLTDKEYEKFMKIISQEKNLLKVER 495

Query: 505 KLAKIWDDGFEDW 517
           KLA  +DDGFEDW
Sbjct: 496 KLANTFDDGFEDW 508

>KLLA0E09901g Chr5 complement(877366..879048) [1683 bp, 560 aa] {ON}
           some similarities with uniprot|P53729 Saccharomyces
           cerevisiae YNR029C Hypothetical ORF
          Length = 560

 Score =  459 bits (1181), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 212/320 (66%), Positives = 265/320 (82%)

Query: 11  IPITLLSGFLGSGKTTLLEKILTTNHGYKVAVIINDMSELNIDSSLIQNHNVCQKEEKLI 70
           IP+T+LSGFLGSGKTTLLE+ILT+NHG KVAVIINDMSELN+D++LI++H V  KEEKLI
Sbjct: 18  IPVTILSGFLGSGKTTLLERILTSNHGMKVAVIINDMSELNVDAALIKDHKVANKEEKLI 77

Query: 71  ELQNGCICCTLRGDLLEELVGIAEKGHFDYIVIESTGIAEPMQVAETFSVEFSDMLLETP 130
           +LQNGCICCTLRGDLLEEL+ + +   FDYI+IESTGIAEPMQVAETFS EFS  LL+TP
Sbjct: 78  QLQNGCICCTLRGDLLEELINLHQNNEFDYILIESTGIAEPMQVAETFSSEFSQTLLDTP 137

Query: 131 GGIPEDEEKLLRKVSNMGGLQSLAKIDTCVTVVDALNFFANINTTQFLADRWGENGQGES 190
             +  DE  LL+KV ++GGL+ L KIDT VTV+DA+NF ANI TT FLA+RWG++GQGE+
Sbjct: 138 DSVTSDERVLLQKVLDLGGLEKLTKIDTTVTVIDAMNFLANIETTDFLANRWGDSGQGEA 197

Query: 191 ERTITDLMVDQIEFADVVIINKKNTVSXXXXXXXXXXXXALNPVAKTVAADYCNVPLSLI 250
           +RT+TDLM+DQIEFADV+IINK + +             +LN VAK +   YC VP+S I
Sbjct: 198 DRTVTDLMIDQIEFADVIIINKTDRIKKKRLTKIQKIIKSLNLVAKIIKTSYCKVPMSEI 257

Query: 251 LNTGLHDFEKASTSAGWLQSINEMTVREGFGEKGGSVLTPKPETEEYGVNNFVYRRRRPF 310
           LNTGL++FEKA++SAGWL+SINEMT++EG+G+K  SVL+P PET EYGVN+FVY+ R+PF
Sbjct: 258 LNTGLYNFEKAASSAGWLKSINEMTLKEGYGDKTKSVLSPTPETVEYGVNSFVYKSRKPF 317

Query: 311 HPERLYELIRDKFFIIEQAG 330
           HP+RLY+ ++DKF+IIEQ  
Sbjct: 318 HPKRLYDALKDKFYIIEQQA 337

 Score =  180 bits (457), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 85/136 (62%), Positives = 104/136 (76%), Gaps = 4/136 (2%)

Query: 386 NRSKSPFGQLLRSKGFFWLATRYVVRGEWSSAGPMLTLNGGLPWFAVSGLD---NVPEEA 442
           N+  SPFG LLRSKGFFWLATRY++RGEWSSAGPMLTL GG+PWF V+GLD   ++P EA
Sbjct: 401 NKKNSPFGPLLRSKGFFWLATRYLLRGEWSSAGPMLTLKGGIPWFHVAGLDKQEDIPPEA 460

Query: 443 LPLIKKDFDGEFGDRRNELVFIGLKINEKLLSEVLDSCLLTDKEMAQFKRITDK-HNELV 501
           L LIK+DF G FGDRRNELVFIG  I+   L ++LD CLLT+ E  QF   + K HN L 
Sbjct: 461 LTLIKRDFQGPFGDRRNELVFIGTGIDSVKLKQILDDCLLTEDEYKQFVDCSLKEHNLLK 520

Query: 502 ADEKLAKIWDDGFEDW 517
            + +L++++ DGFEDW
Sbjct: 521 VERRLSELFQDGFEDW 536

>YNR029C Chr14 complement(677199..678488) [1290 bp, 429 aa] {ON}
           Putative protein of unknown function, deletion confers
           reduced fitness in saline
          Length = 429

 Score = 99.0 bits (245), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 86/318 (27%), Positives = 147/318 (46%), Gaps = 46/318 (14%)

Query: 2   TSDQNTKKAIPITLLSGFLGSGKTTLLEKILTTNHGYKVAVIINDMSELNIDSSLIQN-- 59
            +D + KK IP+++++G+LGSGK+TLLEKI       K+AVI+N+      DSS I+   
Sbjct: 62  ATDVHEKKRIPVSIITGYLGSGKSTLLEKIALKGADKKIAVILNEFG----DSSEIEKAM 117

Query: 60  --HNVCQKEEKLIELQNGCICCTLRGDLLEELVGIAEK--GHFDYIVIESTGIAEPMQVA 115
              N     ++ ++L NGC+CC+L+   ++ +  + E+  G  DYI++E++GIA+P  +A
Sbjct: 118 TIKNGSNSYQEWLDLGNGCLCCSLKNIGVKAIEDMVERSPGKIDYILLETSGIADPAPIA 177

Query: 116 ETFSVEFSDMLLETPGGIPEDEEKLLRKVSNMGGLQSLAKIDTCVTVVDALNFFANINTT 175
           + F                +DE           GL S   ID  +TV+D  +    ++  
Sbjct: 178 KMFW---------------QDE-----------GLNSSVYIDGIITVLDCEHILKCLDDI 211

Query: 176 QFLADRWGENGQGESERTITDLMVDQIEFADVVIINKKNTV--SXXXXXXXXXXXXALNP 233
              A   G+    E   TI      Q+  AD +I+NK +T+  S             +N 
Sbjct: 212 SIDAHWHGDKVGLEGNLTIAHF---QLAMADRIIMNKYDTIEHSPEMVKQLKERVREINS 268

Query: 234 VAKTVAADYCNVPLSLILNTGLHDFEKASTSAGWLQSINEMTVREGFGEKGGSVLTPKP- 292
           +A      Y + P+  +L+  +H ++    S          T+ +     G  +LT +P 
Sbjct: 269 IAPMFFTKYSDTPIQNLLD--IHAYDSVRISDILDSGSGNGTIHD--DRMGTIMLTFRPL 324

Query: 293 ETEEYGVNNFVYRRRRPF 310
           + EE   N F+ +  +P 
Sbjct: 325 KNEEEYNNKFIKQFLQPL 342

>NDAI0K01550 Chr11 (351617..352912) [1296 bp, 431 aa] {ON} Anc_6.337
          Length = 431

 Score = 97.4 bits (241), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 76/264 (28%), Positives = 128/264 (48%), Gaps = 45/264 (17%)

Query: 8   KKAIPITLLSGFLGSGKTTLLEKILTTNHGYKVAVIINDMSELNIDSSLIQNHNVCQKEE 67
           +K IP+T+++G+LGSGK+TLLEKI+      K+AVI+N+      DSS I+     + +E
Sbjct: 67  EKKIPVTIITGYLGSGKSTLLEKIVLKGSDMKIAVILNEFG----DSSEIEKAMTIRNQE 122

Query: 68  ----KLIELQNGCICCTLRG---DLLEELVGIAEKGHFDYIVIESTGIAEPMQVAETFSV 120
               + ++L NGC+CC+L+      +E+++     G  DYI++E++GIA+P  +A+ F  
Sbjct: 123 SSTQEWLDLGNGCLCCSLKNVGVKAIEDMIA-RSPGKIDYILLETSGIADPAPIAKMFWQ 181

Query: 121 EFSDMLLETPGGIPEDEEKLLRKVSNMGGLQSLAKIDTCVTVVDALNFFANINTTQFLAD 180
           +                           GL S   ID  VTV+D+ +    ++       
Sbjct: 182 D--------------------------DGLNSNVYIDGIVTVLDSEHILKCLDDISPETH 215

Query: 181 RWGENGQGESERTITDLMVDQIEFADVVIINKKNTV--SXXXXXXXXXXXXALNPVAKTV 238
             GEN   +   TI      QI  ADV+I+NK + +  +             +N  AK  
Sbjct: 216 WHGENVITKENLTIAHF---QIAMADVIILNKFDKIENNEKLINEVNVKIGQINSTAKIH 272

Query: 239 AADYCNVPLSLILNTGLHDFEKAS 262
              Y  +PL+ I++  LH +++ +
Sbjct: 273 FTKYGELPLNYIID--LHSYDRVN 294

>Ecym_2495 Chr2 complement(970589..971896) [1308 bp, 435 aa] {ON}
           similar to Ashbya gossypii AAR044W
          Length = 435

 Score = 97.4 bits (241), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 77/262 (29%), Positives = 131/262 (50%), Gaps = 37/262 (14%)

Query: 2   TSDQNTKKAIPITLLSGFLGSGKTTLLEKILTTNHGYKVAVIINDMSELN-IDSSLIQNH 60
           T ++ +++ IP+T+++G+LGSGK+TLLE+I+      K+AVI+N+  + + I+ S+   +
Sbjct: 77  TEEKESRQKIPVTVITGYLGSGKSTLLERIVLKGSELKIAVILNEFGDSSEIEKSMTIRN 136

Query: 61  NVCQKEEKLIELQNGCICCTLRGDLLEELVGIAEK--GHFDYIVIESTGIAEPMQVAETF 118
           N    EE L +L NGC+CC+L+   ++ +  +  +  G  DYI++E++GIA+P  +A  F
Sbjct: 137 NGKSYEEWL-DLGNGCLCCSLKDVGVKAIEAMVARSPGKIDYILLETSGIADPAPIARMF 195

Query: 119 SVEFSDMLLETPGGIPEDEEKLLRKVSNMGGLQSLAKIDTCVTVVDALNFFANINTTQFL 178
                           +DE           GL S   ID  VTV+D+ +  + ++     
Sbjct: 196 W---------------QDE-----------GLSSNIYIDGIVTVLDSEHILSCLDDVTGD 229

Query: 179 ADRWGENGQGESERTITDLMVDQIEFADVVIINKKNTV--SXXXXXXXXXXXXALNPVAK 236
           +   GE    +   T+  L   QI  AD +++NK + +  S             +N +A 
Sbjct: 230 SHWHGEKVVLDDGITVAHL---QIAMADTILLNKIDKLEKSEMAVAQVEDRVQGINALAP 286

Query: 237 TVAADYCNVPLSLILNTGLHDF 258
                Y N+ L  ILN  LH F
Sbjct: 287 IYHTKYGNISLDKILN--LHAF 306

>CAGL0M10747g Chr13 complement(1072542..1073840) [1299 bp, 432 aa]
           {ON} similar to uniprot|P53729 Saccharomyces cerevisiae
           YNR029c
          Length = 432

 Score = 97.1 bits (240), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 79/263 (30%), Positives = 126/263 (47%), Gaps = 43/263 (16%)

Query: 5   QNTKKAIPITLLSGFLGSGKTTLLEKILTTNHGYKVAVIINDMSELNIDSSLIQNHNVCQ 64
           Q  KK IP+T+++G+LGSGK+TLLEKI       K+AVI+N+      DSS I+     Q
Sbjct: 65  QTEKKRIPVTIITGYLGSGKSTLLEKIALKGSDRKIAVILNEFG----DSSEIEKAMTIQ 120

Query: 65  ----KEEKLIELQNGCICCTLRGDLLEELVGIAEK--GHFDYIVIESTGIAEPMQVAETF 118
               K ++ ++L NGC+CC+L+   ++ +  + E+  G  DYI++E++GIA+P  +A+ F
Sbjct: 121 NGDSKYQEWLDLGNGCLCCSLKNIGVKAIEDMIERSPGSIDYILLETSGIADPAPIAKMF 180

Query: 119 SVEFSDMLLETPGGIPEDEEKLLRKVSNMGGLQSLAKIDTCVTVVDALNFFANINTTQFL 178
                           +DE           GL S   ID  +TV+DA +    ++     
Sbjct: 181 W---------------QDE-----------GLNSSVYIDGIITVLDAEHIVKCLDDVSPD 214

Query: 179 ADRWGENGQGESERTITDLMVDQIEFADVVIINKKNTV--SXXXXXXXXXXXXALNPVAK 236
           A  + ++   E   TI      QI  AD +++NK + +                +N VA 
Sbjct: 215 AHWYNQSVVKEENLTIAYF---QIAMADRILLNKVDKIEGKRVSISDIEARIKDINGVAP 271

Query: 237 TVAADYCNVPLSLILNTGLHDFE 259
                Y  V L  +L+  LH +E
Sbjct: 272 IYHTQYGEVSLDKLLD--LHAYE 292

>Smik_14.358 Chr14 complement(635188..636588) [1401 bp, 466 aa] {ON}
           YNR029C (REAL)
          Length = 466

 Score = 96.7 bits (239), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 71/269 (26%), Positives = 126/269 (46%), Gaps = 33/269 (12%)

Query: 2   TSDQNTKKAIPITLLSGFLGSGKTTLLEKILTTNHGYKVAVIINDMSELNIDSSLIQNHN 61
            +D   +K IP+++++G+LGSGK+TLLEKI       K+AVI+N+  + +     +   N
Sbjct: 99  VTDLRKRKRIPVSIITGYLGSGKSTLLEKIALKGADKKIAVILNEFGDSSEIEKAMTIKN 158

Query: 62  VCQKEEKLIELQNGCICCTLRGDLLEELVGIAEK--GHFDYIVIESTGIAEPMQVAETFS 119
                ++ ++L NGC+CC+L+   ++ +  + E+  G  DYI++E++GIA+P  +A+ F 
Sbjct: 159 GSSSYQEWLDLGNGCLCCSLKNIGVKAIEDMVERSPGKIDYILLETSGIADPAPIAKMFW 218

Query: 120 VEFSDMLLETPGGIPEDEEKLLRKVSNMGGLQSLAKIDTCVTVVDALNFFANINTTQFLA 179
                          +DE           GL S   ID  +TV+D  +    ++     A
Sbjct: 219 ---------------QDE-----------GLNSSVYIDGIITVLDCEHILKCLDDVSVDA 252

Query: 180 DRWGENGQGESERTITDLMVDQIEFADVVIINKKNTV--SXXXXXXXXXXXXALNPVAKT 237
              G+    +   TI      Q+  AD +I+NK +T+  S             +N +A  
Sbjct: 253 HWHGDKVGLKGNLTIAHF---QLAMADRIIMNKYDTIEHSPAMVKHLKERVREVNSIAPM 309

Query: 238 VAADYCNVPLSLILNTGLHDFEKASTSAG 266
               Y + P+  +L+   +D  + S   G
Sbjct: 310 FFTKYSDTPIDNLLDIHAYDSIRISDMLG 338

>KAFR0C04570 Chr3 complement(914620..915909) [1290 bp, 429 aa] {ON}
           Anc_6.337 YNR029C
          Length = 429

 Score = 95.1 bits (235), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 70/219 (31%), Positives = 112/219 (51%), Gaps = 39/219 (17%)

Query: 4   DQNTKKAIPITLLSGFLGSGKTTLLEKILTTNHGYKVAVIINDMSELNIDSSLIQN---- 59
           D + KK IP+T+++G+LGSGK+TLLEKI       K+AVI+N+      DSS I+     
Sbjct: 66  DGSHKKRIPVTIITGYLGSGKSTLLEKIALQGSDKKIAVILNEFG----DSSEIEKAMTI 121

Query: 60  HNVCQKEEKLIELQNGCICCTLRGDLLEELVGIAEK--GHFDYIVIESTGIAEPMQVAET 117
            N     E+ ++L NGC+CC+L+   ++ +  + ++  G  DYI++E++GIA+P  +A+ 
Sbjct: 122 RNGDAAYEEWLDLGNGCLCCSLKNVGVKAIEDMVDRSPGKIDYILLETSGIADPAPIAKM 181

Query: 118 FSVEFSDMLLETPGGIPEDEEKLLRKVSNMGGLQSLAKIDTCVTVVDALNFFANINTTQF 177
           F                +DE           GL S   ID  +TV+D+ +    ++    
Sbjct: 182 FW---------------QDE-----------GLNSSVYIDGIITVLDSEHILKCLDDVSE 215

Query: 178 LADRWGENGQGESERTITDLMVDQIEFADVVIINKKNTV 216
                GEN   E+  TI      QI  AD +I+NK + +
Sbjct: 216 ETHWHGENVTVENNLTIAHF---QIAMADRIILNKIDKI 251

>TPHA0H02290 Chr8 complement(545849..547213) [1365 bp, 454 aa] {ON}
           Anc_6.337 YNR029C
          Length = 454

 Score = 94.7 bits (234), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 72/261 (27%), Positives = 122/261 (46%), Gaps = 38/261 (14%)

Query: 5   QNTKKAIPITLLSGFLGSGKTTLLEKILTTNHGYKVAVIINDMSELNIDSSLIQNHNVCQ 64
           ++  K IP+++++G+LGSGK+TLLE+I       K+AVI+N+  + +     ++  N   
Sbjct: 80  ESVTKKIPVSVITGYLGSGKSTLLEQIALKGSDKKIAVILNEFGDSSEIEKAMKIRNGSS 139

Query: 65  KEEKLIELQNGCICCTLRG---DLLEELVGIAEKGHFDYIVIESTGIAEPMQVAETFSVE 121
             E+ ++L NGC+CC+L+      +E++V +   G  DYI++E++GIA+P  +A+ F   
Sbjct: 140 AYEEWLDLGNGCLCCSLKNVGVKAIEDMV-LRSPGKIDYILLETSGIADPAPIAKMFW-- 196

Query: 122 FSDMLLETPGGIPEDEEKLLRKVSNMGGLQSLAKIDTCVTVVDALNFFANINTTQFLADR 181
                        +DE           GL S   +D  +TV+DA N    ++        
Sbjct: 197 -------------QDE-----------GLNSCVYLDGIITVLDAENILKCLDDVSPDTHW 232

Query: 182 WGENGQGESERTITDLMVDQIEFADVVIINKKNTV-----SXXXXXXXXXXXXALNPVAK 236
            GE    E+  TI      QI  AD +++NK + V     S             +N VA 
Sbjct: 233 HGEKVLMENNLTIAHF---QIAMADRILLNKMDRVEGSPDSSETVKVLEDRIRQINAVAP 289

Query: 237 TVAADYCNVPLSLILNTGLHD 257
                Y +  L  +L+   +D
Sbjct: 290 IYHTKYGDTALEYLLDIHAYD 310

>SAKL0A01342g Chr1 (129065..130291) [1227 bp, 408 aa] {ON} similar
           to uniprot|P53729 Saccharomyces cerevisiae YNR029C
           Hypothetical ORF
          Length = 408

 Score = 93.2 bits (230), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 78/270 (28%), Positives = 130/270 (48%), Gaps = 43/270 (15%)

Query: 3   SDQNTKKAIPITLLSGFLGSGKTTLLEKILTTNHGYKVAVIINDMSELNIDSSLIQN--- 59
           S  +T K IP+T+++G+LGSGK+TLLE+I       K+AVI+N+      DSS I+    
Sbjct: 60  STPSTSKKIPVTIITGYLGSGKSTLLEQIALKGSDRKIAVILNEFG----DSSEIEKSLT 115

Query: 60  -HNVCQKEEKLIELQNGCICCTLRGDLLEELVGIAEK--GHFDYIVIESTGIAEPMQVAE 116
             N     E+ ++L NGC+CC+L+   +  +  +  +  G  DYI++E++GIA+P  +A+
Sbjct: 116 IRNGSSSYEEWLDLGNGCLCCSLKDVGVRAIENMVSRCPGKIDYILLETSGIADPGPIAK 175

Query: 117 TFSVEFSDMLLETPGGIPEDEEKLLRKVSNMGGLQSLAKIDTCVTVVDALNFFANINTTQ 176
            F +               DE           GL S   ID  +TV+D+ +  + ++   
Sbjct: 176 MFWM---------------DE-----------GLNSNVYIDGIITVLDSEHILSCLDDFS 209

Query: 177 FLADRWGENGQGESERTITDLMVDQIEFADVVIINKKNTV--SXXXXXXXXXXXXALNPV 234
             +   GE    + + TI  L   QI  AD +++NK + +               ++N  
Sbjct: 210 PESHWHGEKVLLQDKTTIAHL---QIAMADRILLNKIDRLEGDVERVREVEGKVKSINSA 266

Query: 235 AKTVAADYCNVPLSLILNTGLHDFEKASTS 264
           A      Y ++ L  IL+  LH FE +S +
Sbjct: 267 AVIYHTKYGDLNLDKILD--LHAFESSSIA 294

>AAR044W Chr1 (420088..421320) [1233 bp, 410 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNR029C
          Length = 410

 Score = 93.2 bits (230), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 73/257 (28%), Positives = 129/257 (50%), Gaps = 37/257 (14%)

Query: 7   TKKAIPITLLSGFLGSGKTTLLEKILTTNHGYKVAVIINDMSELN-IDSSLIQNHNVCQK 65
           ++K IP+T+++G+LGSGK+TLLE+I       ++AVI+N+  + + I+ SL   +N    
Sbjct: 60  SQKKIPVTVITGYLGSGKSTLLEEITKRGSDMRIAVILNEFGDSSEIEKSLTIKNNGKAY 119

Query: 66  EEKLIELQNGCICCTLRGDLLEELVGIAEK--GHFDYIVIESTGIAEPMQVAETFSVEFS 123
           EE L +L NGC+CC+L+   ++ +  +  +  G  DYI++E++GIA+P+ + + F     
Sbjct: 120 EEWL-DLGNGCLCCSLKDVGVKAIEAMVSRSPGKIDYIILETSGIADPVPIVKMFW---- 174

Query: 124 DMLLETPGGIPEDEEKLLRKVSNMGGLQSLAKIDTCVTVVDALNFFANINTTQFLADRWG 183
                      +DE           GL S   ID  VTV+DA +    ++         G
Sbjct: 175 -----------QDE-----------GLNSCIYIDGIVTVLDAEHVMTWLDEVAPPRQWRG 212

Query: 184 ENGQGESERTITDLMVDQIEFADVVIINKKNTVS--XXXXXXXXXXXXALNPVAKTVAAD 241
           +    E++ T+  L   Q+  AD V++NK + +               ++N VA      
Sbjct: 213 DQVLMENQMTVAHL---QLAMADAVVLNKIDRLEGLDDEIAVVEEKVRSINAVAPIYRTK 269

Query: 242 YCNVPLSLILNTGLHDF 258
           + ++ ++ +LN  LH F
Sbjct: 270 FGDLEINKVLN--LHAF 284

>Kwal_23.6316 s23 complement(1527371..1528597) [1227 bp, 408 aa]
           {ON} YNR029C - 1:1 [contig 17] FULL
          Length = 408

 Score = 92.8 bits (229), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 78/257 (30%), Positives = 123/257 (47%), Gaps = 41/257 (15%)

Query: 11  IPITLLSGFLGSGKTTLLEKILTTNHGYKVAVIIN---DMSELNIDSSLIQNHNVCQKEE 67
           IP+T+++G+LGSGK+TLLEKI       K+AVI+N   D SE+    ++   +N     E
Sbjct: 67  IPVTIITGYLGSGKSTLLEKIALKGSDKKIAVILNEFGDSSEIEKSMTIRDGNN---SYE 123

Query: 68  KLIELQNGCICCTLRG---DLLEELVGIAEKGHFDYIVIESTGIAEPMQVAETFSVEFSD 124
           + ++L NGC+CC+L+      +E L+     G  DYI++E++GIA+P  +A+ F      
Sbjct: 124 EWLDLGNGCLCCSLQDVGVKAIENLIARC-PGKIDYILLETSGIADPRPIAKMFW----- 177

Query: 125 MLLETPGGIPEDEEKLLRKVSNMGGLQSLAKIDTCVTVVDALNFFANINTTQFLADRWGE 184
                     +D+           GL S   +D  VTV+DA N    ++         GE
Sbjct: 178 ----------QDD-----------GLYSNVYLDGIVTVLDAENVLTCLDDVSPATHWHGE 216

Query: 185 NGQGESERTITDLMVDQIEFADVVIINKKNTVSXXXXXXXXXXXXALNPVAKTVAADYCN 244
           +   E   TI  L   QI  AD ++INK + +             A      ++A+ +C+
Sbjct: 217 SVLTEDNITIAHL---QIAMADSILINKLDRIGEDESSAKVRKIEAKVRQINSIASIHCS 273

Query: 245 V--PLSLILNTGLHDFE 259
               +SL+    LH FE
Sbjct: 274 SFGEVSLVKVLDLHAFE 290

>KNAG0D00410 Chr4 (60526..61803) [1278 bp, 425 aa] {ON} Anc_6.337
           YNR029C
          Length = 425

 Score = 92.8 bits (229), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 71/257 (27%), Positives = 122/257 (47%), Gaps = 37/257 (14%)

Query: 8   KKAIPITLLSGFLGSGKTTLLEKILTTNHGYKVAVIINDMSELNIDSSLIQNHNVCQKEE 67
           +K IP+T+++G+LGSGK+TLLEKI       K+AVI+N+  + +     +   N     +
Sbjct: 65  QKRIPVTIITGYLGSGKSTLLEKIALKGSDRKIAVILNEFGDSSEIEKAMTIKNGSASYQ 124

Query: 68  KLIELQNGCICCTLRG---DLLEELVGIAEKGHFDYIVIESTGIAEPMQVAETFSVEFSD 124
           + ++L NGC+CC+L+      +E+++     G  DYI++E++GIA+P  +A+ F      
Sbjct: 125 EWLDLGNGCLCCSLKNVGVKAIEDMIA-RSPGAIDYILLETSGIADPAPIAKMFW----- 178

Query: 125 MLLETPGGIPEDEEKLLRKVSNMGGLQSLAKIDTCVTVVDALNFFANINTTQFLADRWGE 184
                     +DE           GL S   ID  +TV+DA +    ++         GE
Sbjct: 179 ----------QDE-----------GLNSSVYIDGVITVLDAEHILKCLDDVSPDTHWHGE 217

Query: 185 NGQGESERTITDLMVDQIEFADVVIINKKNTV--SXXXXXXXXXXXXALNPVAKTVAADY 242
               E   TI      Q+   D++++NK + V  +             +N VA    A Y
Sbjct: 218 KVIREDNLTIAHF---QLAMGDIIVLNKFDKVEGNHCAIEELQNRIRQVNEVAPIYCAKY 274

Query: 243 CNVPLSLILNTGLHDFE 259
            +V L  +++  +H +E
Sbjct: 275 GDVELDKLMD--IHAYE 289

>Suva_14.383 Chr14 complement(658484..659785) [1302 bp, 433 aa] {ON}
           YNR029C (REAL)
          Length = 433

 Score = 90.9 bits (224), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 81/300 (27%), Positives = 138/300 (46%), Gaps = 47/300 (15%)

Query: 8   KKAIPITLLSGFLGSGKTTLLEKILTTNHGYKVAVIINDMSELNIDSSLIQN----HNVC 63
           +K IP+++++G+LGSGK+TLLEKI       K+AVI+N+      DSS I+      N  
Sbjct: 68  RKRIPVSIITGYLGSGKSTLLEKIALKGADKKIAVILNEFG----DSSEIEKAMTIKNGS 123

Query: 64  QKEEKLIELQNGCICCTLRGDLLEELVGIAEK--GHFDYIVIESTGIAEPMQVAETFSVE 121
              ++ ++L NGC+CC+L+   ++ +  + E+  G  DYI++E++GIA+P  +A+ F   
Sbjct: 124 SSYQEWLDLGNGCLCCSLKNIGVKAIEDMVERSPGKIDYILLETSGIADPAPIAKMFW-- 181

Query: 122 FSDMLLETPGGIPEDEEKLLRKVSNMGGLQSLAKIDTCVTVVDALNFFANINTTQFLADR 181
                        +DE           GL S   ID  +TV+D  +    ++     A  
Sbjct: 182 -------------QDE-----------GLNSSVYIDGIITVLDCEHILKCLDDVSVDAHW 217

Query: 182 WGENGQGESERTITDLMVDQIEFADVVIINKKNTV--SXXXXXXXXXXXXALNPVAKTVA 239
            G+    E   TI      Q+  AD +I+NK + +  S             +N +A    
Sbjct: 218 HGDKVGLEGNLTIAHF---QLAMADRIIMNKYDKIEHSPNTIKQLQKRIREINCIAPMYF 274

Query: 240 ADYCNVPLSLILNTGLHDFEKASTSAGWLQSINEMTVREGFGEKGGSVLTPKP--ETEEY 297
             Y    +  +L+  +H ++    S     S+   T+ +     G  +LT +P  + EEY
Sbjct: 275 TKYSETSIDKLLD--IHAYDSIRVSDILDNSVGGGTIHD--HRMGTVMLTFRPLRDEEEY 330

>KLLA0C08613g Chr3 (754098..755366) [1269 bp, 422 aa] {ON} similar
           to uniprot|P53729 Saccharomyces cerevisiae YNR029C
           Hypothetical ORF
          Length = 422

 Score = 90.5 bits (223), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 72/266 (27%), Positives = 128/266 (48%), Gaps = 39/266 (14%)

Query: 1   MTSDQNTKKAIPITLLSGFLGSGKTTLLEKILTTNHGYKVAVIINDMSELNIDSSLIQNH 60
           +  D + ++ IP+T+++G+LG+GK+TLLE+I       ++AVI+N+  + +     I   
Sbjct: 56  LDEDFDRQQRIPVTIITGYLGAGKSTLLEQIALKGSNKRLAVILNEFGDSSEIEKSITIK 115

Query: 61  NVCQKEEKLIELQNGCICCTLRG---DLLEELVGIAEKGHFDYIVIESTGIAEPMQVAET 117
           N  +  E+ ++L NGC+CC+L+      +E++V     G  DYI++E++GIA+P  +A+ 
Sbjct: 116 NKGEVYEEWLDLGNGCLCCSLKDVGVKAIEDMVA-RSPGKIDYILLETSGIADPGPIAKM 174

Query: 118 FSVEFSDMLLETPGGIPEDEEKLLRKVSNMGGLQSLAKIDTCVTVVDALNFFANINTTQF 177
           F  +                           GL S   ID  +TV+D+ +    ++    
Sbjct: 175 FWQD--------------------------KGLNSNVYIDGIITVLDSEHIITCLDDISP 208

Query: 178 LADRWGE--NGQGESERTITDLMVDQIEFADVVIINKKNTV--SXXXXXXXXXXXXALNP 233
            A   GE      ES+ TI  L   QI  AD +++NK + +               ++N 
Sbjct: 209 TAHWHGEKVTVDDESKTTIAHL---QIAMADAILVNKSDKIEGDESKKYDLENVVRSINT 265

Query: 234 VAKTVAADYCNVPLSLILNTGLHDFE 259
           VA      + ++ L L+L+  L+ FE
Sbjct: 266 VAPIYYTKFGDINLDLVLD--LNAFE 289

>TBLA0F04100 Chr6 complement(1016306..1017706) [1401 bp, 466 aa]
           {ON} Anc_6.337 YNR029C
          Length = 466

 Score = 90.1 bits (222), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 68/217 (31%), Positives = 113/217 (52%), Gaps = 37/217 (17%)

Query: 1   MTSDQNTKKAIPITLLSGFLGSGKTTLLEKILTTNHGYKVAVIIN---DMSELNIDSSLI 57
           + + +N ++ IP+++++G+LGSGK+TLLE I       K+AVI+N   D SE+   S  I
Sbjct: 63  INNKKNIQQKIPVSIITGYLGSGKSTLLEAIAKKGSDRKIAVILNEFGDSSEIE-KSMTI 121

Query: 58  QNHNVCQKEEKLIELQNGCICCTLRGDLLEELVGIAEK--GHFDYIVIESTGIAEPMQVA 115
           +N N     ++ ++L NGC+CC+L+   ++ +  + ++  G  DYI++E++GIA+P  +A
Sbjct: 122 RNGN--NNYQEWLDLGNGCLCCSLKNIGVKAIEDMIDRSPGKIDYILLETSGIADPAPIA 179

Query: 116 ETFSVEFSDMLLETPGGIPEDEEKLLRKVSNMGGLQSLAKIDTCVTVVDALNFFANINTT 175
           + F                +DE           GL S   ID  +TV+D  N    ++  
Sbjct: 180 KMFW---------------QDE-----------GLNSSIYIDGIITVLDCENILKCLDDK 213

Query: 176 QFLADRWGENGQGESERTITDLMVDQIEFADVVIINK 212
              +   GEN   E+  TI      QI  AD +I+NK
Sbjct: 214 SPESHWHGENVIVENNLTIAHF---QIAMADRIIMNK 247

>NCAS0A04520 Chr1 (907999..909327) [1329 bp, 442 aa] {ON} Anc_6.337
          Length = 442

 Score = 89.4 bits (220), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 59/213 (27%), Positives = 104/213 (48%), Gaps = 28/213 (13%)

Query: 6   NTKKAIPITLLSGFLGSGKTTLLEKILTTNHGYKVAVIINDMSELNIDSSLIQNHNVCQK 65
           N  K IP+T+++G+LGSGK+TLLE I       K+AVI+N+  + +     +   N    
Sbjct: 67  NAGKKIPVTIITGYLGSGKSTLLEMIAKKGSDKKIAVILNEFGDSSEIEKAMTIRNGSDS 126

Query: 66  EEKLIELQNGCICCTLRGDLLEELVGIAEK--GHFDYIVIESTGIAEPMQVAETFSVEFS 123
            ++ ++L NGC+CC+L+   ++ +  + E+  G  DYI++E++GIA+P  +A+ F  +  
Sbjct: 127 YQEWLDLGNGCLCCSLKNIGVKAIEDMVERSPGKIDYILLETSGIADPAPIAKMFWQD-- 184

Query: 124 DMLLETPGGIPEDEEKLLRKVSNMGGLQSLAKIDTCVTVVDALNFFANINTTQFLADRWG 183
                                    GL S   +D  +TV+D  +    ++     A   G
Sbjct: 185 ------------------------DGLSSSVFVDGIITVLDCEHILTCLDDRSPDAHWHG 220

Query: 184 ENGQGESERTITDLMVDQIEFADVVIINKKNTV 216
           +    + E  I  +   QI  AD +I+NK + +
Sbjct: 221 DKVVSKDEDGILTIAHFQIAMADRIIMNKVDKI 253

>Skud_14.360 Chr14 complement(645289..646578) [1290 bp, 429 aa] {ON}
           YNR029C (REAL)
          Length = 429

 Score = 89.0 bits (219), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 71/263 (26%), Positives = 122/263 (46%), Gaps = 41/263 (15%)

Query: 8   KKAIPITLLSGFLGSGKTTLLEKILTTNHGYKVAVIINDMSELNIDSSLIQN----HNVC 63
           +K IP+++++G+LGSGK+TLLEKI       K+AVI+N+      DSS I+      N  
Sbjct: 68  RKRIPVSIITGYLGSGKSTLLEKIALKGADRKIAVILNEFG----DSSEIEKAMTIKNGS 123

Query: 64  QKEEKLIELQNGCICCTLRGDLLEELVGIAEK--GHFDYIVIESTGIAEPMQVAETFSVE 121
              ++ ++L NGC+CC+L+   ++ +  + E+  G  DYI++E++GIA+P  +A+ F   
Sbjct: 124 STYQEWLDLGNGCLCCSLKNVGVKAIEDMVERSPGKIDYILLETSGIADPAPIAKMFW-- 181

Query: 122 FSDMLLETPGGIPEDEEKLLRKVSNMGGLQSLAKIDTCVTVVDALNFFANINTTQFLADR 181
                        +DE           GL S   ID  +TV+D  +    ++     A  
Sbjct: 182 -------------QDE-----------GLNSSVYIDGIITVLDCEHILKCLDDVSIDAHW 217

Query: 182 WGENGQGESERTITDLMVDQIEFADVVIINKKNTV--SXXXXXXXXXXXXALNPVAKTVA 239
            G+    +   TI      Q+  AD +I+NK + +  S             +N +A    
Sbjct: 218 HGDKVGLKGNLTIAHF---QLAMADRIIMNKYDNIENSPEMIKHLKDRVREINSIAPMYF 274

Query: 240 ADYCNVPLSLILNTGLHDFEKAS 262
             Y    +  +L+   +D  + S
Sbjct: 275 TKYSETSIDNLLDIHAYDSMRIS 297

>KLTH0A06688g Chr1 complement(557036..558268) [1233 bp, 410 aa] {ON}
           similar to uniprot|P53729 Saccharomyces cerevisiae
           YNR029C Hypothetical ORF
          Length = 410

 Score = 87.8 bits (216), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 66/208 (31%), Positives = 103/208 (49%), Gaps = 39/208 (18%)

Query: 11  IPITLLSGFLGSGKTTLLEKILTTNHGYKVAVIIN---DMSELNIDSSLIQNHNVCQKEE 67
           +P+T+++G+LGSGK+TLLEKI       K+AVI+N   D SE+    ++    N     E
Sbjct: 67  VPVTIITGYLGSGKSTLLEKIALKGSDKKIAVILNEFGDSSEIEKSMTIRNGEN---SYE 123

Query: 68  KLIELQNGCICCTLRG---DLLEELVGIAEKGHFDYIVIESTGIAEPMQVAETFSVEFSD 124
           + ++L NGC+CC+L+      +E L+     G  DYI++E++GIA+P  +A+ F      
Sbjct: 124 EWLDLGNGCLCCSLQDVGVKAIESLIARC-PGKIDYIILETSGIADPRPIAKMFW----- 177

Query: 125 MLLETPGGIPEDEEKLLRKVSNMGGLQSLAKIDTCVTVVDALNFFANINTTQFLADRWGE 184
                     +D+           GL S   +D  VTV+DA N    ++         GE
Sbjct: 178 ----------QDD-----------GLYSNVYLDGIVTVLDAENILTCLDDVSPATHWHGE 216

Query: 185 NGQGESERTITDLMVDQIEFADVVIINK 212
               +   TI  L   Q+  AD ++INK
Sbjct: 217 KVVTDDNITIAHL---QVALADCILINK 241

>Kpol_325.2 s325 complement(4458..5777) [1320 bp, 439 aa] {ON}
           complement(4458..5777) [1320 nt, 440 aa]
          Length = 439

 Score = 88.2 bits (217), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 73/264 (27%), Positives = 121/264 (45%), Gaps = 43/264 (16%)

Query: 3   SDQNTKKAIPITLLSGFLGSGKTTLLEKILTTNHGYKVAVIINDMSELNIDSSLIQN--- 59
           S + +   IPI++++G+LGSGK+TLLE I       K+AVI+N+      DSS I+    
Sbjct: 67  SSKTSTSKIPISIITGYLGSGKSTLLEMIAMKGSDKKIAVILNEFG----DSSEIEKAMT 122

Query: 60  -HNVCQKEEKLIELQNGCICCTLRG---DLLEELVGIAEKGHFDYIVIESTGIAEPMQVA 115
             N     E+ ++L NGC+CC+L+      +E++V     G  DYI++E++GIA+P  +A
Sbjct: 123 IRNGSASYEEWLDLGNGCLCCSLKNIGVKAIEDMV-TRSPGKIDYILLETSGIADPAPIA 181

Query: 116 ETFSVEFSDMLLETPGGIPEDEEKLLRKVSNMGGLQSLAKIDTCVTVVDALNFFANINTT 175
           + F                +DE           GL S   ID  +TV+D+ N    ++  
Sbjct: 182 KMFW---------------QDE-----------GLNSCIYIDGIITVLDSENVLKCLDDI 215

Query: 176 QFLADRWGENGQGESERTITDLMVDQIEFADVVIINKKNTVSXXXX--XXXXXXXXALNP 233
                  GE    E+  T+      QI  AD +++NK + +                +N 
Sbjct: 216 SPETHWHGEKVIMENNLTVAHF---QIAMADRILLNKFDKIENDPNFITKIEDRVRQINS 272

Query: 234 VAKTVAADYCNVPLSLILNTGLHD 257
           +A      Y + P+  +L+   +D
Sbjct: 273 MAPMYNTKYGDTPIDTLLDLHAYD 296

>ZYRO0D08272g Chr4 (716261..717493) [1233 bp, 410 aa] {ON} similar
           to uniprot|P53729 Saccharomyces cerevisiae YNR029C
           Hypothetical ORF
          Length = 410

 Score = 83.2 bits (204), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 63/213 (29%), Positives = 108/213 (50%), Gaps = 37/213 (17%)

Query: 9   KAIPITLLSGFLGSGKTTLLEKILTTNHGYKVAVIIN---DMSELNIDSSLIQNHNVCQK 65
           + IP+++++G+LGSGK+TLLEK+       K+AVI+N   D SE+    ++    N  Q+
Sbjct: 67  RKIPVSIITGYLGSGKSTLLEKLAQKGSDKKIAVILNEFGDSSEIEKAMTIRNGENSYQE 126

Query: 66  EEKLIELQNGCICCTLRGDLLEELVGIAEK--GHFDYIVIESTGIAEPMQVAETFSVEFS 123
               ++L NGC+CC+L+   ++ +  + ++  G  DYI++E++GIA+P  +A+ F     
Sbjct: 127 ---WLDLGNGCLCCSLKNVGVKAIEDMIQRSPGKIDYILLETSGIADPAPIAKMFW---- 179

Query: 124 DMLLETPGGIPEDEEKLLRKVSNMGGLQSLAKIDTCVTVVDALNFFANINTTQFLADRWG 183
                      +DE           GL S   ID  +TV+D  +    ++         G
Sbjct: 180 -----------QDE-----------GLNSNVYIDGIITVLDCEHIVKCLDDVSEQTHWHG 217

Query: 184 ENGQGESERTITDLMVDQIEFADVVIINKKNTV 216
           +    E + TI  L   QI  AD +I+NK + +
Sbjct: 218 DQVVLEDKLTIAHL---QIAMADRLIMNKLDRI 247

>TDEL0A07520 Chr1 complement(1310807..1312081) [1275 bp, 424 aa]
           {ON} Anc_6.337 YNR029C
          Length = 424

 Score = 79.7 bits (195), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 67/261 (25%), Positives = 121/261 (46%), Gaps = 40/261 (15%)

Query: 8   KKAIPITLLSGFLGSGKTTLLEKILTTNHGYKVAVIINDMSELNIDSSLIQNHNVCQKEE 67
           +  IP+T+++G+LGSGK+TLLE I       K+AVI+N+  + +     +   N     E
Sbjct: 64  RPKIPVTIITGYLGSGKSTLLEMIALKGSDRKIAVILNEFGQSSEIEKAMTIRNGSASYE 123

Query: 68  KLIELQNGCICCTLRGDLLEELVGIAEKG--HFDYIVIESTGIAEPMQVAETFSVEFSDM 125
           + ++L NGC+CC+L+   ++ +  + E+     D I++E++GIA+P  +A+ F  + S  
Sbjct: 124 EWLDLGNGCLCCSLQNVGVKAIENMIERSPVKIDNILLETSGIADPAPIAKMFWQDDS-- 181

Query: 126 LLETPGGIPEDEEKLLRKVSNMGGLQSLAKIDTCVTVVDALNFFANINTTQFLADRWGEN 185
                                   L S   ID  +TV+D+ +        + L D+   +
Sbjct: 182 ------------------------LNSSVYIDGIITVLDSEHIL------KCLDDKPPTH 211

Query: 186 GQGESERTITDLMVD--QIEFADVVIINKKNTV--SXXXXXXXXXXXXALNPVAKTVAAD 241
             G+S     +L +   QI  AD +I+NK + +               ++N  A      
Sbjct: 212 WHGDSVLVGDNLTIAHFQIAMADRIILNKYDKIEGKSSDIAALEERIRSINAEAPLFYTK 271

Query: 242 YCNVPLSLILNTGLHDFEKAS 262
           Y  + LS +L+  +H F+ +S
Sbjct: 272 YGEIALSKLLD--IHAFDASS 290

>TBLA0C02820 Chr3 complement(674701..676914) [2214 bp, 737 aa] {ON}
           Anc_1.285 YJL082W
          Length = 737

 Score = 32.7 bits (73), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 33/71 (46%), Gaps = 13/71 (18%)

Query: 12  PITLLSGF------LGSGKTTLLEKILTTNHGYKVAVIINDMSELNIDSSLIQNHNVCQK 65
           P+  LS F      + SG   L + +LT  H   V        +LN+D  LI+N  +C  
Sbjct: 627 PVHELSYFYNGYNRMDSGNLKLAQNLLTNYHNPAV-------DKLNVDQELIRNFLICLT 679

Query: 66  EEKLIELQNGC 76
             +L E++ GC
Sbjct: 680 FRRLGEVEKGC 690

>CAGL0K07986g Chr11 complement(792641..794239) [1599 bp, 532 aa]
           {ON} highly similar to uniprot|P20424 Saccharomyces
           cerevisiae YPR088c
          Length = 532

 Score = 32.7 bits (73), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 46/183 (25%), Positives = 74/183 (40%), Gaps = 22/183 (12%)

Query: 5   QNTKKAIPITLLSGFLGSGKTTLLEK--ILTTNHGYKVAVIINDMSELNIDSSLIQNHNV 62
           Q  KKA  I +  G  GSGKTT   K  +  +  G+KV ++  D         L Q  N 
Sbjct: 101 QPKKKATNIIMFVGLQGSGKTTSCTKLAVYYSKRGFKVGLVCADTFRAGAFDQLKQ--NA 158

Query: 63  CQKEEKLIELQNGCICCTLRGDLLEELVGIA--EKGHFDYIVIESTG--------IAEPM 112
            +                + GD      GIA  +K  FD I+++++G          E +
Sbjct: 159 VKARIPFYGSYTETDPVKVAGD------GIAKFKKEKFDVIIVDTSGRHHQEEELFHEMV 212

Query: 113 QVAETFSVEFSDMLLETP-GGIPEDEEKLLRKVSNMGGLQSLAKIDTCVTVVDALNFFAN 171
           Q++       + M+L+   G   E + K  ++ S+ G +  L K+D       A++  A 
Sbjct: 213 QISNVIKPNQTIMVLDASIGQAAEQQSKAFKESSDFGAI-ILTKMDGHAKGGGAISAVAA 271

Query: 172 INT 174
            NT
Sbjct: 272 TNT 274

>KLLA0F02926g Chr6 (273193..274212) [1020 bp, 339 aa] {ON} similar
          to uniprot|P34253 Saccharomyces cerevisiae YKL110C
          KTI12 Protein associated with the RNA polymerase II
          Elongator complex involved in sensitivity to G1 arrest
          induced by Kluyveromyces lactis toxin zymocin
          Length = 339

 Score = 32.3 bits (72), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 13/24 (54%), Positives = 20/24 (83%)

Query: 10 AIPITLLSGFLGSGKTTLLEKILT 33
          A+P+ LL+GF  SGKTT+ +K++T
Sbjct: 27 AMPLVLLTGFPSSGKTTVAKKLVT 50

>ABR125C Chr2 complement(623888..628354) [4467 bp, 1488 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YDR011W
           (SNQ2), YNR070W and YPL058C (PDR12)
          Length = 1488

 Score = 32.3 bits (72), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 35/68 (51%), Gaps = 8/68 (11%)

Query: 4   DQNTKKAIP--ITLLSGFLGSGKTTLLEKILTTNHGYKVAVIINDM--SELNIDSSLIQN 59
           DQ T   IP  +T L G  G+GKTTLL  +   N    V VI  DM  + L ID+S  + 
Sbjct: 872 DQITGYCIPGTLTALMGESGAGKTTLLNTLAQRN----VGVITGDMLVNGLPIDASFERR 927

Query: 60  HNVCQKEE 67
               Q+++
Sbjct: 928 TGYVQQQD 935

>Smik_16.330 Chr16 complement(588603..590249) [1647 bp, 548 aa] {ON}
           YPR088C (REAL)
          Length = 548

 Score = 30.8 bits (68), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 42/178 (23%), Positives = 73/178 (41%), Gaps = 18/178 (10%)

Query: 8   KKAIPITLLSGFLGSGKTTLLEK--ILTTNHGYKVAVIINDMSELNIDSSLIQNHNVCQK 65
           K+   I +  G  GSGKTT   K  +  +  G+KV ++  D         L QN    + 
Sbjct: 106 KRKTNIIMFVGLQGSGKTTSCTKLAVYYSKRGFKVGLVCADTFRAGAFDQLKQNAIRAR- 164

Query: 66  EEKLIELQNGCICCTLRGDLLEELVGIAEKGHFDYIVIESTG--------IAEPMQVAET 117
               I    G    T    + EE +   +K  FD I+++++G          E ++++  
Sbjct: 165 ----IPFY-GSYTETDPAKVAEEGINKFKKEKFDIIIVDTSGRHHQEEELFQEMIEISNV 219

Query: 118 FSVEFSDMLLETP-GGIPEDEEKLLRKVSNMGGLQSLAKIDTCVTVVDALNFFANINT 174
                + M+L+   G   E + K  ++ S+ G +  L K+D       A++  A  NT
Sbjct: 220 IKPNQTIMVLDASIGQAAEQQSKAFKESSDFGAI-ILTKMDGHARGGGAISAVAATNT 276

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.136    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 51,069,196
Number of extensions: 2079143
Number of successful extensions: 6098
Number of sequences better than 10.0: 41
Number of HSP's gapped: 6233
Number of HSP's successfully gapped: 46
Length of query: 554
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 439
Effective length of database: 40,294,809
Effective search space: 17689421151
Effective search space used: 17689421151
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)