Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_56.224726.30ON1221226436e-88
KLTH0C10934g6.30ON1221226324e-86
SAKL0E01562g6.30ON1221225752e-77
KLLA0C06160g6.30ON1211225594e-75
ZYRO0C07502g6.30ON1221225585e-75
TDEL0G043906.30ON1221225579e-75
ACL005C6.30ON1221225552e-74
Smik_15.1656.30ON1201205422e-72
YOL005C (RPB11)6.30ON1201205412e-72
Suva_15.1696.30ON1221225412e-72
Skud_15.1576.30ON1221225412e-72
NCAS0D021206.30ON1221225371e-71
KAFR0A051106.30ON1221225361e-71
CAGL0E02453g6.30ON1201205352e-71
KNAG0F029106.30ON1221215291e-70
Kpol_1037.216.30ON1201205265e-70
NDAI0C026706.30ON1221225231e-69
TBLA0E031506.30ON1181185143e-68
TPHA0J004106.30ON1201205032e-66
TPHA0B029202.163ON130921132e-07
TDEL0F011802.163ON129901071e-06
CAGL0L03872g2.163ON137921071e-06
Kpol_165.22.163ON128921026e-06
KNAG0I020602.163ON134751027e-06
KAFR0B045702.163ON131751027e-06
NCAS0G025502.163ON150741021e-05
ZYRO0B09878g2.163ON13090992e-05
TBLA0B012902.163ON10286972e-05
YNL113W (RPC19)2.163ON142102965e-05
SAKL0E10692g2.163ON131102956e-05
Smik_14.2142.163ON142102957e-05
Ecym_54232.163ON12762949e-05
Suva_14.2252.163ON142104922e-04
AFL220C2.163ON13590903e-04
Skud_14.2182.163ON156104914e-04
KLTH0D09350g2.163ON14643870.001
NDAI0F027502.163ON14962860.002
Kwal_26.84732.163ON15043850.002
KLLA0F23760g2.163ON12790830.003
NDAI0A031507.264ON93832700.38
CAGL0L09174g8.97ON42786652.1
CAGL0L04268g5.501ON44746642.7
NDAI0C012305.501ON51176624.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_56.22472
         (122 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_56.22472 s56 (144443..144811) [369 bp, 122 aa] {ON} YOL005C...   252   6e-88
KLTH0C10934g Chr3 complement(900683..901051) [369 bp, 122 aa] {O...   248   4e-86
SAKL0E01562g Chr5 (120177..120545) [369 bp, 122 aa] {ON} highly ...   226   2e-77
KLLA0C06160g Chr3 complement(543239..543604) [366 bp, 121 aa] {O...   219   4e-75
ZYRO0C07502g Chr3 complement(567967..568335) [369 bp, 122 aa] {O...   219   5e-75
TDEL0G04390 Chr7 complement(794577..794945) [369 bp, 122 aa] {ON...   219   9e-75
ACL005C Chr3 complement(346569..346937) [369 bp, 122 aa] {ON} Sy...   218   2e-74
Smik_15.165 Chr15 complement(283099..283461) [363 bp, 120 aa] {O...   213   2e-72
YOL005C Chr15 complement(315813..316175) [363 bp, 120 aa] {ON}  ...   213   2e-72
Suva_15.169 Chr15 complement(289702..290070) [369 bp, 122 aa] {O...   213   2e-72
Skud_15.157 Chr15 complement(275429..275797) [369 bp, 122 aa] {O...   213   2e-72
NCAS0D02120 Chr4 complement(393640..394008) [369 bp, 122 aa] {ON...   211   1e-71
KAFR0A05110 Chr1 complement(1014087..1014455) [369 bp, 122 aa] {...   211   1e-71
CAGL0E02453g Chr5 complement(233352..233714) [363 bp, 120 aa] {O...   210   2e-71
KNAG0F02910 Chr6 complement(551617..551985) [369 bp, 122 aa] {ON...   208   1e-70
Kpol_1037.21 s1037 complement(44216..44578) [363 bp, 120 aa] {ON...   207   5e-70
NDAI0C02670 Chr3 (621282..621650) [369 bp, 122 aa] {ON} Anc_6.30...   206   1e-69
TBLA0E03150 Chr5 complement(788457..788813) [357 bp, 118 aa] {ON...   202   3e-68
TPHA0J00410 Chr10 (95837..96199) [363 bp, 120 aa] {ON} Anc_6.30 ...   198   2e-66
TPHA0B02920 Chr2 (666060..666452) [393 bp, 130 aa] {ON} Anc_2.16...    48   2e-07
TDEL0F01180 Chr6 (211106..211495) [390 bp, 129 aa] {ON} Anc_2.16...    46   1e-06
CAGL0L03872g Chr12 complement(447274..447687) [414 bp, 137 aa] {...    46   1e-06
Kpol_165.2 s165 complement(2511..2897) [387 bp, 128 aa] {ON} com...    44   6e-06
KNAG0I02060 Chr9 complement(401412..401816) [405 bp, 134 aa] {ON...    44   7e-06
KAFR0B04570 Chr2 complement(949880..950275) [396 bp, 131 aa] {ON...    44   7e-06
NCAS0G02550 Chr7 (456827..457279) [453 bp, 150 aa] {ON} Anc_2.16...    44   1e-05
ZYRO0B09878g Chr2 complement(771644..772036) [393 bp, 130 aa] {O...    43   2e-05
TBLA0B01290 Chr2 (274238..274546) [309 bp, 102 aa] {ON} Anc_2.16...    42   2e-05
YNL113W Chr14 (412771..413199) [429 bp, 142 aa] {ON}  RPC19RNA p...    42   5e-05
SAKL0E10692g Chr5 complement(891637..892032) [396 bp, 131 aa] {O...    41   6e-05
Smik_14.214 Chr14 (392413..392841) [429 bp, 142 aa] {ON} YNL113W...    41   7e-05
Ecym_5423 Chr5 complement(871715..872098) [384 bp, 127 aa] {ON} ...    41   9e-05
Suva_14.225 Chr14 (409562..409990) [429 bp, 142 aa] {ON} YNL113W...    40   2e-04
AFL220C Chr6 complement(25281..25688) [408 bp, 135 aa] {ON} Synt...    39   3e-04
Skud_14.218 Chr14 (402879..403349) [471 bp, 156 aa] {ON} YNL113W...    40   4e-04
KLTH0D09350g Chr4 complement(776115..776555) [441 bp, 146 aa] {O...    38   0.001
NDAI0F02750 Chr6 complement(673843..674292) [450 bp, 149 aa] {ON...    38   0.002
Kwal_26.8473 s26 complement(800017..800469) [453 bp, 150 aa] {ON...    37   0.002
KLLA0F23760g Chr6 complement(2218555..2218938) [384 bp, 127 aa] ...    37   0.003
NDAI0A03150 Chr1 (709990..712806) [2817 bp, 938 aa] {ON} Anc_7.264     32   0.38 
CAGL0L09174g Chr12 complement(996457..997740) [1284 bp, 427 aa] ...    30   2.1  
CAGL0L04268g Chr12 complement(499667..501010) [1344 bp, 447 aa] ...    29   2.7  
NDAI0C01230 Chr3 complement(251556..253091) [1536 bp, 511 aa] {O...    28   4.9  

>Kwal_56.22472 s56 (144443..144811) [369 bp, 122 aa] {ON} YOL005C
           (RPB11) - RNA polymerase II subunit, homologous to S.
           pombe Rpb11p subunit [contig 185] FULL
          Length = 122

 Score =  252 bits (643), Expect = 6e-88,   Method: Compositional matrix adjust.
 Identities = 122/122 (100%), Positives = 122/122 (100%)

Query: 1   MNAPDRFELFLLPEGEAKLKIDPDTKAPNAVIVTFEKEDHTLANLIRAELLEDKGVLFAA 60
           MNAPDRFELFLLPEGEAKLKIDPDTKAPNAVIVTFEKEDHTLANLIRAELLEDKGVLFAA
Sbjct: 1   MNAPDRFELFLLPEGEAKLKIDPDTKAPNAVIVTFEKEDHTLANLIRAELLEDKGVLFAA 60

Query: 61  YKVEHPLFAQFKMRIQTAEGYDPKDALKNACNGIISKLGQLQSNFETEWNLQTLASEDNY 120
           YKVEHPLFAQFKMRIQTAEGYDPKDALKNACNGIISKLGQLQSNFETEWNLQTLASEDNY
Sbjct: 61  YKVEHPLFAQFKMRIQTAEGYDPKDALKNACNGIISKLGQLQSNFETEWNLQTLASEDNY 120

Query: 121 AM 122
           AM
Sbjct: 121 AM 122

>KLTH0C10934g Chr3 complement(900683..901051) [369 bp, 122 aa] {ON}
           highly similar to uniprot|P38902 Saccharomyces
           cerevisiae YOL005C
          Length = 122

 Score =  248 bits (632), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 119/122 (97%), Positives = 120/122 (98%)

Query: 1   MNAPDRFELFLLPEGEAKLKIDPDTKAPNAVIVTFEKEDHTLANLIRAELLEDKGVLFAA 60
           MNAPDRFELFLLPEGEAKLKIDPDTKAPNAVIVTFEKEDHTLANLIR ELLEDKGVLFAA
Sbjct: 1   MNAPDRFELFLLPEGEAKLKIDPDTKAPNAVIVTFEKEDHTLANLIRGELLEDKGVLFAA 60

Query: 61  YKVEHPLFAQFKMRIQTAEGYDPKDALKNACNGIISKLGQLQSNFETEWNLQTLASEDNY 120
           YKVEHPLFAQFK+RIQT EGYDPKDALKNACNGIISKLGQLQSNFETEWNLQTLASEDNY
Sbjct: 61  YKVEHPLFAQFKLRIQTVEGYDPKDALKNACNGIISKLGQLQSNFETEWNLQTLASEDNY 120

Query: 121 AM 122
           AM
Sbjct: 121 AM 122

>SAKL0E01562g Chr5 (120177..120545) [369 bp, 122 aa] {ON} highly
           similar to uniprot|P38902 Saccharomyces cerevisiae
           YOL005C
          Length = 122

 Score =  226 bits (575), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 106/122 (86%), Positives = 115/122 (94%)

Query: 1   MNAPDRFELFLLPEGEAKLKIDPDTKAPNAVIVTFEKEDHTLANLIRAELLEDKGVLFAA 60
           MNAPDRFELFLLPEGE+KL I+PDTKAPNAVI+TFEKEDHTL NLIRAELLED+ VLFAA
Sbjct: 1   MNAPDRFELFLLPEGESKLNIEPDTKAPNAVIITFEKEDHTLGNLIRAELLEDQRVLFAA 60

Query: 61  YKVEHPLFAQFKMRIQTAEGYDPKDALKNACNGIISKLGQLQSNFETEWNLQTLASEDNY 120
           YKVEHPLFA+FKMRIQT EGYDPKDALKNACN II+KL QLQSNFETEW+LQTLASE+NY
Sbjct: 61  YKVEHPLFARFKMRIQTVEGYDPKDALKNACNNIITKLAQLQSNFETEWSLQTLASEENY 120

Query: 121 AM 122
            +
Sbjct: 121 GL 122

>KLLA0C06160g Chr3 complement(543239..543604) [366 bp, 121 aa] {ON}
           highly similar to uniprot|P38902 Saccharomyces
           cerevisiae YOL005C
          Length = 121

 Score =  219 bits (559), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 105/122 (86%), Positives = 114/122 (93%), Gaps = 1/122 (0%)

Query: 1   MNAPDRFELFLLPEGEAKLKIDPDTKAPNAVIVTFEKEDHTLANLIRAELLEDKGVLFAA 60
           MNAPDRFELFLLPEGE+KLK++ DTKA +A+IVTFEKEDHTL NLIRAELLED+GVLFAA
Sbjct: 1   MNAPDRFELFLLPEGESKLKVEQDTKASSAIIVTFEKEDHTLGNLIRAELLEDEGVLFAA 60

Query: 61  YKVEHPLFAQFKMRIQTAEGYDPKDALKNACNGIISKLGQLQSNFETEWNLQTLASEDNY 120
           YKVEHPLFA+FKMRIQT EGYDPKDALKNACN II+KL QLQSNFETEWNLQTLA+ED Y
Sbjct: 61  YKVEHPLFAKFKMRIQTVEGYDPKDALKNACNSIINKLAQLQSNFETEWNLQTLATED-Y 119

Query: 121 AM 122
            M
Sbjct: 120 GM 121

>ZYRO0C07502g Chr3 complement(567967..568335) [369 bp, 122 aa] {ON}
           highly similar to uniprot|P38902 Saccharomyces
           cerevisiae YOL005C
          Length = 122

 Score =  219 bits (558), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 102/122 (83%), Positives = 114/122 (93%)

Query: 1   MNAPDRFELFLLPEGEAKLKIDPDTKAPNAVIVTFEKEDHTLANLIRAELLEDKGVLFAA 60
           MNAPDRFELFLL EGE+KL++DPDTKAPNA++VTFEKEDHTL NLIRAELL D  VLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLRVDPDTKAPNAIVVTFEKEDHTLGNLIRAELLNDPKVLFAA 60

Query: 61  YKVEHPLFAQFKMRIQTAEGYDPKDALKNACNGIISKLGQLQSNFETEWNLQTLASEDNY 120
           YKVEHPLFA+FKMRIQT EGYDPKDALKNACNGII+KLG L++NFETEWNLQTLAS+DN+
Sbjct: 61  YKVEHPLFARFKMRIQTMEGYDPKDALKNACNGIINKLGVLKTNFETEWNLQTLASDDNF 120

Query: 121 AM 122
            +
Sbjct: 121 GI 122

>TDEL0G04390 Chr7 complement(794577..794945) [369 bp, 122 aa] {ON}
           Anc_6.30 YOL005C
          Length = 122

 Score =  219 bits (557), Expect = 9e-75,   Method: Compositional matrix adjust.
 Identities = 102/122 (83%), Positives = 113/122 (92%)

Query: 1   MNAPDRFELFLLPEGEAKLKIDPDTKAPNAVIVTFEKEDHTLANLIRAELLEDKGVLFAA 60
           MNAPDRFELFLL EGE+KLKI+PDTKAPNAV++TFEKEDHTL NLIR+ELL D  VLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLKIEPDTKAPNAVVITFEKEDHTLGNLIRSELLNDTKVLFAA 60

Query: 61  YKVEHPLFAQFKMRIQTAEGYDPKDALKNACNGIISKLGQLQSNFETEWNLQTLASEDNY 120
           YKVEHPLFA+FKMRIQT EGYDPKDALKNACNGII+KL  L++NFETEWNLQTLAS+DNY
Sbjct: 61  YKVEHPLFARFKMRIQTVEGYDPKDALKNACNGIINKLAVLKTNFETEWNLQTLASDDNY 120

Query: 121 AM 122
            +
Sbjct: 121 GI 122

>ACL005C Chr3 complement(346569..346937) [369 bp, 122 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL005C
           (RPB11)
          Length = 122

 Score =  218 bits (555), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 102/122 (83%), Positives = 114/122 (93%)

Query: 1   MNAPDRFELFLLPEGEAKLKIDPDTKAPNAVIVTFEKEDHTLANLIRAELLEDKGVLFAA 60
           MNAPDRFELFLLPEGE+KLKI+PDTKA NAVI+TFEKEDHTL N+IRAELLED+ VLFAA
Sbjct: 1   MNAPDRFELFLLPEGESKLKIEPDTKAANAVIITFEKEDHTLGNIIRAELLEDERVLFAA 60

Query: 61  YKVEHPLFAQFKMRIQTAEGYDPKDALKNACNGIISKLGQLQSNFETEWNLQTLASEDNY 120
           YKVEHPLFA+F+MRIQTAEGYDPK+ALKNACN II+KL  L+SNFETEWNLQTLASED +
Sbjct: 61  YKVEHPLFARFRMRIQTAEGYDPKEALKNACNSIINKLATLKSNFETEWNLQTLASEDQF 120

Query: 121 AM 122
            +
Sbjct: 121 RL 122

>Smik_15.165 Chr15 complement(283099..283461) [363 bp, 120 aa] {ON}
           YOL005C (REAL)
          Length = 120

 Score =  213 bits (542), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 99/120 (82%), Positives = 111/120 (92%)

Query: 1   MNAPDRFELFLLPEGEAKLKIDPDTKAPNAVIVTFEKEDHTLANLIRAELLEDKGVLFAA 60
           MNAPDRFELFLL EGE+KLKIDPDTKAPNAV++TFEKEDHTL NLIRAELL D+ VLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAA 60

Query: 61  YKVEHPLFAQFKMRIQTAEGYDPKDALKNACNGIISKLGQLQSNFETEWNLQTLASEDNY 120
           YKVEHP FA+FK+RIQT EGYDPKDALKNACN II+KLG L++NFETEWNLQTLA++D +
Sbjct: 61  YKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLATDDAF 120

>YOL005C Chr15 complement(315813..316175) [363 bp, 120 aa] {ON}
           RPB11RNA polymerase II subunit B12.5; part of central
           core; similar to Rpc19p and bacterial alpha subunit
          Length = 120

 Score =  213 bits (541), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 99/120 (82%), Positives = 111/120 (92%)

Query: 1   MNAPDRFELFLLPEGEAKLKIDPDTKAPNAVIVTFEKEDHTLANLIRAELLEDKGVLFAA 60
           MNAPDRFELFLL EGE+KLKIDPDTKAPNAV++TFEKEDHTL NLIRAELL D+ VLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAA 60

Query: 61  YKVEHPLFAQFKMRIQTAEGYDPKDALKNACNGIISKLGQLQSNFETEWNLQTLASEDNY 120
           YKVEHP FA+FK+RIQT EGYDPKDALKNACN II+KLG L++NFETEWNLQTLA++D +
Sbjct: 61  YKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF 120

>Suva_15.169 Chr15 complement(289702..290070) [369 bp, 122 aa] {ON}
           YOL005C (REAL)
          Length = 122

 Score =  213 bits (541), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 99/122 (81%), Positives = 112/122 (91%)

Query: 1   MNAPDRFELFLLPEGEAKLKIDPDTKAPNAVIVTFEKEDHTLANLIRAELLEDKGVLFAA 60
           MNAPDRFELFLL EGE+KLKI+PDTKAPNAV++TFEKEDHTL NLIRAELL D+ VLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLKIEPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAA 60

Query: 61  YKVEHPLFAQFKMRIQTAEGYDPKDALKNACNGIISKLGQLQSNFETEWNLQTLASEDNY 120
           YKVEHP FA+FK+RIQT EGYDPKDALKNACN II+KLG L++NFETEWNLQTLA++D +
Sbjct: 61  YKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF 120

Query: 121 AM 122
            M
Sbjct: 121 NM 122

>Skud_15.157 Chr15 complement(275429..275797) [369 bp, 122 aa] {ON}
           YOL005C (REAL)
          Length = 122

 Score =  213 bits (541), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 99/122 (81%), Positives = 112/122 (91%)

Query: 1   MNAPDRFELFLLPEGEAKLKIDPDTKAPNAVIVTFEKEDHTLANLIRAELLEDKGVLFAA 60
           MNAPDRFELFLL EGE+KLKI+PDTKAPNAV++TFEKEDHTL NLIRAELL D+ VLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLKIEPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAA 60

Query: 61  YKVEHPLFAQFKMRIQTAEGYDPKDALKNACNGIISKLGQLQSNFETEWNLQTLASEDNY 120
           YKVEHP FA+FK+RIQT EGYDPKDALKNACN II+KLG L++NFETEWNLQTLA++D +
Sbjct: 61  YKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF 120

Query: 121 AM 122
            M
Sbjct: 121 NM 122

>NCAS0D02120 Chr4 complement(393640..394008) [369 bp, 122 aa] {ON}
           Anc_6.30 YOL005C
          Length = 122

 Score =  211 bits (537), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 110/122 (90%)

Query: 1   MNAPDRFELFLLPEGEAKLKIDPDTKAPNAVIVTFEKEDHTLANLIRAELLEDKGVLFAA 60
           MNAPDRFELFLL EGE+KL+IDPDTKAPNAV++TFEKEDHTL NLIR+ELL D  VLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLQIDPDTKAPNAVVITFEKEDHTLGNLIRSELLNDSRVLFAA 60

Query: 61  YKVEHPLFAQFKMRIQTAEGYDPKDALKNACNGIISKLGQLQSNFETEWNLQTLASEDNY 120
           YKVEHP FA+FK+RIQT EGYDPKDALKNACN IISKLG L+ NFETEWNLQTLA+++N 
Sbjct: 61  YKVEHPFFARFKLRIQTVEGYDPKDALKNACNSIISKLGVLKGNFETEWNLQTLAADENM 120

Query: 121 AM 122
            +
Sbjct: 121 GI 122

>KAFR0A05110 Chr1 complement(1014087..1014455) [369 bp, 122 aa] {ON}
           Anc_6.30 YOL005C
          Length = 122

 Score =  211 bits (536), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 97/122 (79%), Positives = 112/122 (91%)

Query: 1   MNAPDRFELFLLPEGEAKLKIDPDTKAPNAVIVTFEKEDHTLANLIRAELLEDKGVLFAA 60
           MNAPDRFELFLL EGE+KLKIDPDTK+PNAV++TFEKEDHTL NLIRAELL D  VLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLKIDPDTKSPNAVVITFEKEDHTLGNLIRAELLNDTKVLFAA 60

Query: 61  YKVEHPLFAQFKMRIQTAEGYDPKDALKNACNGIISKLGQLQSNFETEWNLQTLASEDNY 120
           YKVEHP FA+FK+R+QT EGYDPK+ALKNACN II+KLG L++NFETEWNLQTLAS++N+
Sbjct: 61  YKVEHPFFARFKLRVQTIEGYDPKEALKNACNSIINKLGILKTNFETEWNLQTLASDENF 120

Query: 121 AM 122
            +
Sbjct: 121 GI 122

>CAGL0E02453g Chr5 complement(233352..233714) [363 bp, 120 aa] {ON}
           highly similar to uniprot|P38902 Saccharomyces
           cerevisiae YOL005c RPB11 DNA-directed RNA polymerase II
          Length = 120

 Score =  210 bits (535), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 98/120 (81%), Positives = 110/120 (91%)

Query: 1   MNAPDRFELFLLPEGEAKLKIDPDTKAPNAVIVTFEKEDHTLANLIRAELLEDKGVLFAA 60
           MNAPDRFELFLL EGE+KLKIDPDTKAPNAV++TFEKEDHTL NLIRAELL D  VLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDNKVLFAA 60

Query: 61  YKVEHPLFAQFKMRIQTAEGYDPKDALKNACNGIISKLGQLQSNFETEWNLQTLASEDNY 120
           YKVEHP FA+FK+RIQT EGYDPKDAL+NAC+ II+KLG L+SNFETEWNLQTLA++D +
Sbjct: 61  YKVEHPFFARFKLRIQTVEGYDPKDALRNACSSIINKLGALKSNFETEWNLQTLAADDAF 120

>KNAG0F02910 Chr6 complement(551617..551985) [369 bp, 122 aa] {ON}
           Anc_6.30 YOL005C
          Length = 122

 Score =  208 bits (529), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 95/121 (78%), Positives = 109/121 (90%)

Query: 1   MNAPDRFELFLLPEGEAKLKIDPDTKAPNAVIVTFEKEDHTLANLIRAELLEDKGVLFAA 60
           MNAPDRFELFLL +GE+KL IDPDTK+PNA+++TF KEDHTL NLIRAELL D  VLFAA
Sbjct: 1   MNAPDRFELFLLGDGESKLVIDPDTKSPNAIVITFNKEDHTLGNLIRAELLNDSKVLFAA 60

Query: 61  YKVEHPLFAQFKMRIQTAEGYDPKDALKNACNGIISKLGQLQSNFETEWNLQTLASEDNY 120
           YKVEHP FA+FK+RIQT EGYDPKDALKNACNGII+KLG L++NFETEWNLQTLA++D +
Sbjct: 61  YKVEHPFFARFKLRIQTVEGYDPKDALKNACNGIINKLGILKTNFETEWNLQTLATDDTF 120

Query: 121 A 121
            
Sbjct: 121 V 121

>Kpol_1037.21 s1037 complement(44216..44578) [363 bp, 120 aa] {ON}
           complement(44216..44578) [363 nt, 121 aa]
          Length = 120

 Score =  207 bits (526), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 96/120 (80%), Positives = 110/120 (91%)

Query: 1   MNAPDRFELFLLPEGEAKLKIDPDTKAPNAVIVTFEKEDHTLANLIRAELLEDKGVLFAA 60
           MNAPD+FELFLL EGE+KL I+PDTKAPNAV++TFEKEDHTL NLIR+ELL D  VLFAA
Sbjct: 1   MNAPDKFELFLLGEGESKLNIEPDTKAPNAVVITFEKEDHTLGNLIRSELLNDSKVLFAA 60

Query: 61  YKVEHPLFAQFKMRIQTAEGYDPKDALKNACNGIISKLGQLQSNFETEWNLQTLASEDNY 120
           YKVEHPLFA+FK+RIQT E YDPKDALKNACN II+KLG L++NFETEWNLQTLAS++N+
Sbjct: 61  YKVEHPLFARFKLRIQTVENYDPKDALKNACNNIINKLGILKTNFETEWNLQTLASDENF 120

>NDAI0C02670 Chr3 (621282..621650) [369 bp, 122 aa] {ON} Anc_6.30
           YOL005C
          Length = 122

 Score =  206 bits (523), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 96/122 (78%), Positives = 109/122 (89%)

Query: 1   MNAPDRFELFLLPEGEAKLKIDPDTKAPNAVIVTFEKEDHTLANLIRAELLEDKGVLFAA 60
           MNAPDRFELFLL EGE+KL IDPDTKAPNAV++TF+KEDHTL NLIR+ELL D  VLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLTIDPDTKAPNAVVITFQKEDHTLGNLIRSELLNDGKVLFAA 60

Query: 61  YKVEHPLFAQFKMRIQTAEGYDPKDALKNACNGIISKLGQLQSNFETEWNLQTLASEDNY 120
           YKVEHP FA FK+RIQT EGYDPK ALKNACN II+KLG L++NFETEWNLQTLAS++N+
Sbjct: 61  YKVEHPFFANFKLRIQTVEGYDPKLALKNACNNIINKLGILKTNFETEWNLQTLASDENF 120

Query: 121 AM 122
            +
Sbjct: 121 GI 122

>TBLA0E03150 Chr5 complement(788457..788813) [357 bp, 118 aa] {ON}
           Anc_6.30 YOL005C
          Length = 118

 Score =  202 bits (514), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 94/118 (79%), Positives = 106/118 (89%)

Query: 1   MNAPDRFELFLLPEGEAKLKIDPDTKAPNAVIVTFEKEDHTLANLIRAELLEDKGVLFAA 60
           MNAPDRFE FLL EGE+KL+I+PDTKAPN V++TFEKEDHTL NLI++ELL D  VLFAA
Sbjct: 1   MNAPDRFESFLLGEGESKLQIEPDTKAPNTVVITFEKEDHTLGNLIKSELLHDPKVLFAA 60

Query: 61  YKVEHPLFAQFKMRIQTAEGYDPKDALKNACNGIISKLGQLQSNFETEWNLQTLASED 118
           YKVEHPLFA+FKMRIQT EGYDPKDAL+ ACN II KLG L++NFETEWNLQTLAS+D
Sbjct: 61  YKVEHPLFARFKMRIQTVEGYDPKDALRKACNSIIKKLGILKTNFETEWNLQTLASDD 118

>TPHA0J00410 Chr10 (95837..96199) [363 bp, 120 aa] {ON} Anc_6.30
           YOL005C
          Length = 120

 Score =  198 bits (503), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 93/120 (77%), Positives = 108/120 (90%)

Query: 1   MNAPDRFELFLLPEGEAKLKIDPDTKAPNAVIVTFEKEDHTLANLIRAELLEDKGVLFAA 60
           MNAPDRFELFLL EG++KL+I+ DTKA NAV++TFEKEDHTL NLIR ELL D+ VLFAA
Sbjct: 1   MNAPDRFELFLLDEGQSKLQIEQDTKAANAVVITFEKEDHTLGNLIRNELLNDEKVLFAA 60

Query: 61  YKVEHPLFAQFKMRIQTAEGYDPKDALKNACNGIISKLGQLQSNFETEWNLQTLASEDNY 120
           YKVEHPLFA+FK+RIQT E YDPKDALK ACN II+KLG L++NF+TEWNLQTLAS+DN+
Sbjct: 61  YKVEHPLFARFKLRIQTEENYDPKDALKMACNNIINKLGILKTNFDTEWNLQTLASDDNF 120

>TPHA0B02920 Chr2 (666060..666452) [393 bp, 130 aa] {ON} Anc_2.163
           YNL113W
          Length = 130

 Score = 48.1 bits (113), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 46/92 (50%), Gaps = 2/92 (2%)

Query: 16  EAKLKIDPDTKAPNAVIVTFE--KEDHTLANLIRAELLEDKGVLFAAYKVEHPLFAQFKM 73
           E K+KI P+  +P+    +F+  +EDHTL N +R  ++++  V F  Y + HP      +
Sbjct: 32  EDKIKILPNATSPDGTSASFQISEEDHTLGNALRHIIMKNPEVEFCGYSIPHPSETLLNL 91

Query: 74  RIQTAEGYDPKDALKNACNGIISKLGQLQSNF 105
           RIQT       +AL+     ++     ++  F
Sbjct: 92  RIQTYGNTTAVEALQKGLKDLMDMCDVVEEKF 123

>TDEL0F01180 Chr6 (211106..211495) [390 bp, 129 aa] {ON} Anc_2.163
           YNL113W
          Length = 129

 Score = 45.8 bits (107), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 43/90 (47%), Gaps = 2/90 (2%)

Query: 18  KLKIDPDTKAPNAVIVTFE--KEDHTLANLIRAELLEDKGVLFAAYKVEHPLFAQFKMRI 75
           K+K+ P   + +    +F+  +EDHTL N +R  ++++K V F  Y + HP      +RI
Sbjct: 33  KIKLLPQASSEDGTCASFQIAEEDHTLGNALRYVIMKNKDVEFCGYSIPHPSENLLNLRI 92

Query: 76  QTAEGYDPKDALKNACNGIISKLGQLQSNF 105
           QT       D L+     ++     ++  F
Sbjct: 93  QTYGATTAVDVLQKGLTDLMDLCDAVEDRF 122

>CAGL0L03872g Chr12 complement(447274..447687) [414 bp, 137 aa] {ON}
           similar to uniprot|P28000 Saccharomyces cerevisiae
           YNL113w RPC19 DNA-directed RNA polymerase I III
          Length = 137

 Score = 45.8 bits (107), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 45/92 (48%), Gaps = 2/92 (2%)

Query: 16  EAKLKIDPDTKAPNAVIVTFE--KEDHTLANLIRAELLEDKGVLFAAYKVEHPLFAQFKM 73
           + K+K+ P   + +    +F+  +EDHTL N +R  ++++  V F  Y + HP      +
Sbjct: 40  KTKIKLLPQATSEDGTCASFQIAQEDHTLGNALRYIIMKNPEVEFCGYSIPHPSEELLNL 99

Query: 74  RIQTAEGYDPKDALKNACNGIISKLGQLQSNF 105
           RIQT       DAL+   + +I     ++  F
Sbjct: 100 RIQTYGNITAVDALQKGLDDLIDLCDAVKDKF 131

>Kpol_165.2 s165 complement(2511..2897) [387 bp, 128 aa] {ON}
           complement(2511..2897) [387 nt, 129 aa]
          Length = 128

 Score = 43.9 bits (102), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 43/92 (46%), Gaps = 2/92 (2%)

Query: 16  EAKLKIDPDTKAPNAVIVTFE--KEDHTLANLIRAELLEDKGVLFAAYKVEHPLFAQFKM 73
           E K+KI P   + +    +F+   EDHTL N +R  ++++  V F  Y + HP      +
Sbjct: 30  EDKIKILPQATSEDGTCASFQIMDEDHTLGNALRYIIMKNPEVEFCGYSIPHPSENLLNL 89

Query: 74  RIQTAEGYDPKDALKNACNGIISKLGQLQSNF 105
           RIQT       +AL+     ++     ++  F
Sbjct: 90  RIQTYGSTTAVEALQKGLGDLMDMCDVVEEKF 121

>KNAG0I02060 Chr9 complement(401412..401816) [405 bp, 134 aa] {ON}
           Anc_2.163 YNL113W
          Length = 134

 Score = 43.9 bits (102), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 36/75 (48%), Gaps = 2/75 (2%)

Query: 18  KLKIDPDTKAPNAVIVTFE--KEDHTLANLIRAELLEDKGVLFAAYKVEHPLFAQFKMRI 75
           K+KI P+    +    +F+   EDHTL N +R  ++++  V F  Y + HP      +RI
Sbjct: 38  KVKILPEATTEDGTCASFQILNEDHTLGNALRYVIMKNPEVEFCGYSIPHPSENWLNVRI 97

Query: 76  QTAEGYDPKDALKNA 90
           QT       DA K  
Sbjct: 98  QTYGKITAVDAFKKG 112

>KAFR0B04570 Chr2 complement(949880..950275) [396 bp, 131 aa] {ON}
           Anc_2.163 YNL113W
          Length = 131

 Score = 43.9 bits (102), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 38/75 (50%), Gaps = 2/75 (2%)

Query: 18  KLKIDPDTKAPNAVIVTFE--KEDHTLANLIRAELLEDKGVLFAAYKVEHPLFAQFKMRI 75
           K+KI P   + +    +F+  +EDHTL N +R  ++++  V F  Y + HP      +RI
Sbjct: 35  KIKILPQATSEDGTSASFQIVEEDHTLGNALRYIIMKNPQVEFCGYSIPHPSENLLNIRI 94

Query: 76  QTAEGYDPKDALKNA 90
           QT       DALK  
Sbjct: 95  QTYGEITAVDALKKG 109

>NCAS0G02550 Chr7 (456827..457279) [453 bp, 150 aa] {ON} Anc_2.163
           YNL113W
          Length = 150

 Score = 43.9 bits (102), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 39/74 (52%), Gaps = 8/74 (10%)

Query: 4   PDRFELFLLPEGEAKLKIDPDTKAPNAVIVTFEKEDHTLANLIRAELLEDKGVLFAAYKV 63
           PDR ++ +LPEG ++     D    +  IV    EDHTL N +R  ++++  V F  Y +
Sbjct: 50  PDREKVKILPEGASE-----DGTCASFQIV---DEDHTLGNALRYIIMKNPNVEFCGYSI 101

Query: 64  EHPLFAQFKMRIQT 77
            HP      +RIQT
Sbjct: 102 PHPSENFLNVRIQT 115

>ZYRO0B09878g Chr2 complement(771644..772036) [393 bp, 130 aa] {ON}
           highly similar to uniprot|Q755Q7 Ashbya gossypii AFL220C
           AFL220Cp and similar to YNL113W uniprot|P28000
           Saccharomyces cerevisiae YNL113W RPC19 RNA polymerase
           subunit common to RNA polymerases I and III
          Length = 130

 Score = 42.7 bits (99), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 41/90 (45%), Gaps = 2/90 (2%)

Query: 18  KLKIDPDTKAPNAVIVTFE--KEDHTLANLIRAELLEDKGVLFAAYKVEHPLFAQFKMRI 75
           K+KI P   + +    +F+  +EDHTL N +R  ++++  V F  Y + HP      +R+
Sbjct: 34  KIKILPQATSEDGTCASFQIAEEDHTLGNALRYMIMKNPDVEFCGYSIPHPSENLLNIRV 93

Query: 76  QTAEGYDPKDALKNACNGIISKLGQLQSNF 105
           QT       D L      ++     ++  F
Sbjct: 94  QTYGNVTAVDVLHKGLQDLMDLCDAVEDKF 123

>TBLA0B01290 Chr2 (274238..274546) [309 bp, 102 aa] {ON} Anc_2.163
           YNL113W
          Length = 102

 Score = 42.0 bits (97), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 36/86 (41%)

Query: 20  KIDPDTKAPNAVIVTFEKEDHTLANLIRAELLEDKGVLFAAYKVEHPLFAQFKMRIQTAE 79
           ++ P T   +A       EDHTL N +R  L+ +  V F  Y + HP      +R+QT  
Sbjct: 10  QLPPVTPDGSAASFQIRDEDHTLGNALRYLLMRNPAVEFCGYSIPHPSEPFLNLRVQTYG 69

Query: 80  GYDPKDALKNACNGIISKLGQLQSNF 105
                DAL      ++     ++  F
Sbjct: 70  DITASDALAQGLQDLMDLCDVVEDTF 95

>YNL113W Chr14 (412771..413199) [429 bp, 142 aa] {ON}  RPC19RNA
           polymerase subunit AC19, common to RNA polymerases I and
           III
          Length = 142

 Score = 41.6 bits (96), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 49/102 (48%), Gaps = 8/102 (7%)

Query: 4   PDRFELFLLPEGEAKLKIDPDTKAPNAVIVTFEKEDHTLANLIRAELLEDKGVLFAAYKV 63
           PDR ++ LL +  ++     D  + +  IV   +EDHTL N +R  ++++  V F  Y +
Sbjct: 42  PDREKIKLLTQATSE-----DGTSASFQIV---EEDHTLGNALRYVIMKNPDVEFCGYSI 93

Query: 64  EHPLFAQFKMRIQTAEGYDPKDALKNACNGIISKLGQLQSNF 105
            HP      +RIQT       DAL+     ++     ++S F
Sbjct: 94  PHPSENLLNIRIQTYGETTAVDALQKGLKDLMDLCDVVESKF 135

>SAKL0E10692g Chr5 complement(891637..892032) [396 bp, 131 aa] {ON}
           highly similar to uniprot|P28000 Saccharomyces
           cerevisiae YNL113W RPC19 RNA polymerase subunit common
           to RNA polymerases I and III
          Length = 131

 Score = 41.2 bits (95), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 47/102 (46%), Gaps = 8/102 (7%)

Query: 4   PDRFELFLLPEGEAKLKIDPDTKAPNAVIVTFEKEDHTLANLIRAELLEDKGVLFAAYKV 63
           PDR ++ LLP+  +    D  T A   +     +EDHTL N +R  ++++  V F  Y +
Sbjct: 31  PDREKIKLLPQATS----DDGTSASFQI----SEEDHTLGNALRYIIMKNPEVEFCGYSI 82

Query: 64  EHPLFAQFKMRIQTAEGYDPKDALKNACNGIISKLGQLQSNF 105
            HP      +RIQT       +AL+     ++     ++  F
Sbjct: 83  PHPSENLLNVRIQTYGKITAVEALQKGLQDLMDMCDAVEDKF 124

>Smik_14.214 Chr14 (392413..392841) [429 bp, 142 aa] {ON} YNL113W
           (REAL)
          Length = 142

 Score = 41.2 bits (95), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 49/102 (48%), Gaps = 8/102 (7%)

Query: 4   PDRFELFLLPEGEAKLKIDPDTKAPNAVIVTFEKEDHTLANLIRAELLEDKGVLFAAYKV 63
           PDR ++ LL +  ++     D  + +  IV   +EDHTL N +R  ++++  V F  Y +
Sbjct: 42  PDREKIKLLTQATSE-----DGTSASFQIV---EEDHTLGNALRYIIMKNPDVEFCGYSI 93

Query: 64  EHPLFAQFKMRIQTAEGYDPKDALKNACNGIISKLGQLQSNF 105
            HP      +RIQT       DAL+     ++     ++S F
Sbjct: 94  PHPSENLLNIRIQTYGESTAVDALQKGLKDLMDLCDVVESKF 135

>Ecym_5423 Chr5 complement(871715..872098) [384 bp, 127 aa] {ON}
          similar to Ashbya gossypii AFL220C
          Length = 127

 Score = 40.8 bits (94), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 34/62 (54%), Gaps = 2/62 (3%)

Query: 18 KLKIDPDTKAPNAVIVTFE--KEDHTLANLIRAELLEDKGVLFAAYKVEHPLFAQFKMRI 75
          K+++ P+  + +    +F+   EDHTL N +R  ++++  V F  Y + HP      +RI
Sbjct: 31 KIRLLPEAASEDGTCASFQISDEDHTLGNALRYIIMKNPEVEFCGYSIPHPSETVLNLRI 90

Query: 76 QT 77
          QT
Sbjct: 91 QT 92

>Suva_14.225 Chr14 (409562..409990) [429 bp, 142 aa] {ON} YNL113W
           (REAL)
          Length = 142

 Score = 40.0 bits (92), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 50/104 (48%), Gaps = 8/104 (7%)

Query: 2   NAPDRFELFLLPEGEAKLKIDPDTKAPNAVIVTFEKEDHTLANLIRAELLEDKGVLFAAY 61
           + PDR ++ LL +  ++     D  + +  IV   +EDHTL N +R  ++++  V F  Y
Sbjct: 40  DEPDREKIKLLTQATSE-----DGTSASFQIV---EEDHTLGNALRYIIMKNPEVEFCGY 91

Query: 62  KVEHPLFAQFKMRIQTAEGYDPKDALKNACNGIISKLGQLQSNF 105
            + HP      +RIQT       +AL+     ++     ++S F
Sbjct: 92  SIPHPSENLLNVRIQTYGAITAVEALQKGLKDLMDLCDVVESKF 135

>AFL220C Chr6 complement(25281..25688) [408 bp, 135 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL113W
           (RPC19)
          Length = 135

 Score = 39.3 bits (90), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 40/90 (44%), Gaps = 2/90 (2%)

Query: 18  KLKIDPDTKAPNAVIVTFE--KEDHTLANLIRAELLEDKGVLFAAYKVEHPLFAQFKMRI 75
           K+++ P   + +     F+   EDHTL N +R  ++++  V F  Y + HP      +RI
Sbjct: 39  KIRLLPQATSEDGTCAFFQITDEDHTLGNALRYIIMKNPEVEFCGYSIPHPSENFLNIRI 98

Query: 76  QTAEGYDPKDALKNACNGIISKLGQLQSNF 105
           QT       DAL      ++     ++  F
Sbjct: 99  QTYGKVTAVDALHKGLQDLMDMCDVVEDKF 128

>Skud_14.218 Chr14 (402879..403349) [471 bp, 156 aa] {ON} YNL113W
           (REAL)
          Length = 156

 Score = 39.7 bits (91), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 47/104 (45%), Gaps = 8/104 (7%)

Query: 2   NAPDRFELFLLPEGEAKLKIDPDTKAPNAVIVTFEKEDHTLANLIRAELLEDKGVLFAAY 61
           + PDR ++ LL +  ++          NA     E EDHTL N +R  ++++  V F  Y
Sbjct: 54  DEPDREKIKLLTQATSE-------DGTNASFQIVE-EDHTLGNALRYIIMKNPDVEFCGY 105

Query: 62  KVEHPLFAQFKMRIQTAEGYDPKDALKNACNGIISKLGQLQSNF 105
            + HP      +RIQT       DAL+     ++     +++ F
Sbjct: 106 SIPHPSENLLNIRIQTYGEITAVDALQKGLKDLMDLCDVVEAKF 149

>KLTH0D09350g Chr4 complement(776115..776555) [441 bp, 146 aa] {ON}
           some similarities with uniprot|P28000 Saccharomyces
           cerevisiae YNL113W RPC19 RNA polymerase subunit common
           to RNA polymerases I and III
          Length = 146

 Score = 38.1 bits (87), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 24/43 (55%)

Query: 35  FEKEDHTLANLIRAELLEDKGVLFAAYKVEHPLFAQFKMRIQT 77
             +EDHTL N +R  ++++  V F  Y + HP      +RIQT
Sbjct: 69  ISEEDHTLGNALRYIIMKNPDVEFCGYSIPHPSETLLNLRIQT 111

>NDAI0F02750 Chr6 complement(673843..674292) [450 bp, 149 aa] {ON}
           Anc_2.163 YNL113W
          Length = 149

 Score = 37.7 bits (86), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 33/62 (53%), Gaps = 2/62 (3%)

Query: 18  KLKIDPDTKAPNAVIVTFE--KEDHTLANLIRAELLEDKGVLFAAYKVEHPLFAQFKMRI 75
           K+KI     + +    +F+  +EDHTL N +R  ++++  V F  Y + HP      +RI
Sbjct: 53  KIKILQQGASEDGCSASFQILQEDHTLGNALRYIIMKNPQVEFCGYSIPHPSEEFLNIRI 112

Query: 76  QT 77
           QT
Sbjct: 113 QT 114

>Kwal_26.8473 s26 complement(800017..800469) [453 bp, 150 aa] {ON}
           YNL113W (RPC19) - subunit common to RNA polymerases I
           (A) and III (C) [contig 61] FULL
          Length = 150

 Score = 37.4 bits (85), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 24/43 (55%)

Query: 35  FEKEDHTLANLIRAELLEDKGVLFAAYKVEHPLFAQFKMRIQT 77
             +EDHTL N +R  ++++  V F  Y + HP      +RIQT
Sbjct: 73  ISEEDHTLGNSLRYIIMKNPDVEFCGYSIPHPSENLLNLRIQT 115

>KLLA0F23760g Chr6 complement(2218555..2218938) [384 bp, 127 aa]
           {ON} similar to uniprot|P28000 Saccharomyces cerevisiae
           YNL113W RPC19 RNA polymerase subunit common to RNA
           polymerases I and III
          Length = 127

 Score = 36.6 bits (83), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/90 (24%), Positives = 40/90 (44%), Gaps = 2/90 (2%)

Query: 18  KLKIDPDTKAPNAVIVTFE--KEDHTLANLIRAELLEDKGVLFAAYKVEHPLFAQFKMRI 75
           K+K+  +  + +    +F    EDHTL N +R  ++++  V F  Y + HP      +RI
Sbjct: 31  KIKLLTEATSEDGTSASFRITDEDHTLGNTLRYMIMKNPEVEFCGYSIPHPSENFLHIRI 90

Query: 76  QTAEGYDPKDALKNACNGIISKLGQLQSNF 105
           QT       +AL      ++     ++  F
Sbjct: 91  QTYGKITAVEALHKGLGDLMDMCDAVEDRF 120

>NDAI0A03150 Chr1 (709990..712806) [2817 bp, 938 aa] {ON} Anc_7.264
          Length = 938

 Score = 31.6 bits (70), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 19/32 (59%)

Query: 85  DALKNACNGIISKLGQLQSNFETEWNLQTLAS 116
           D++  ACNGII KL   Q     ++N+  LAS
Sbjct: 193 DSISTACNGIIIKLSNYQEANNIKYNISILAS 224

>CAGL0L09174g Chr12 complement(996457..997740) [1284 bp, 427 aa]
           {ON} similar to uniprot|P43589 Saccharomyces cerevisiae
           YFR005c SAD1 SnRNP assembly defective
          Length = 427

 Score = 29.6 bits (65), Expect = 2.1,   Method: Composition-based stats.
 Identities = 23/86 (26%), Positives = 38/86 (44%), Gaps = 11/86 (12%)

Query: 21  IDPDTKAPNAVIVTFEKEDHTLANLIRAELLEDKGVLFAAYKVEHPLFAQFKMRIQTAEG 80
           +D D   P   +       H   NL+RA +L D+  L +   + +P         +  E 
Sbjct: 163 MDTDKFDPLVKLFGLILRKHWSKNLLRAHVLTDE--LLSYISINYP---------KLLEN 211

Query: 81  YDPKDALKNACNGIISKLGQLQSNFE 106
            DP+  L +  N +ISK  QL+ +F+
Sbjct: 212 KDPRVFLLSLLNALISKCPQLKQSFD 237

>CAGL0L04268g Chr12 complement(499667..501010) [1344 bp, 447 aa]
           {ON} highly similar to uniprot|Q99312 Saccharomyces
           cerevisiae YOR155c
          Length = 447

 Score = 29.3 bits (64), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 22/46 (47%)

Query: 75  IQTAEGYDPKDALKNACNGIISKLGQLQSNFETEWNLQTLASEDNY 120
           I TA GYD     ++  NG+I+ L      +  + NL  +  E NY
Sbjct: 206 IVTAAGYDEAKTYESRLNGLITALNGSDLPYAKKRNLCVMGGESNY 251

>NDAI0C01230 Chr3 complement(251556..253091) [1536 bp, 511 aa] {ON}
           Anc_5.501 YOR155C
          Length = 511

 Score = 28.5 bits (62), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 32/76 (42%), Gaps = 5/76 (6%)

Query: 50  LLEDKGVLFAAYKVEHPLFAQFKMRIQ----TAEGYDPKDALKNACNGIISKLGQLQS-N 104
           L ED G LF    V   +    K  I+    TA GYD     +    G+I+ L   +S  
Sbjct: 238 LYEDGGSLFDTNPVIPYILKLLKCDIRVGIVTAAGYDDASTYERRLKGLINALHNSESLT 297

Query: 105 FETEWNLQTLASEDNY 120
            + + NL  +  E NY
Sbjct: 298 VKQKSNLTIMGGESNY 313

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.134    0.383 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 12,857,576
Number of extensions: 471865
Number of successful extensions: 1127
Number of sequences better than 10.0: 50
Number of HSP's gapped: 1126
Number of HSP's successfully gapped: 50
Length of query: 122
Length of database: 53,481,399
Length adjustment: 91
Effective length of query: 31
Effective length of database: 43,046,793
Effective search space: 1334450583
Effective search space used: 1334450583
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 59 (27.3 bits)