Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_56.224626.29ON1541154173360.0
KLTH0C10956g6.29ON1433145049220.0
KNAG0F029206.29ON1492133832560.0
SAKL0E01540g6.29ON141599832350.0
ACL004W6.29ON137794731880.0
Ecym_30336.29ON147493931220.0
ZYRO0C07524g6.29ON1670106630390.0
TDEL0G044006.29ON1490101730130.0
KLLA0C06182g6.29ON151997329810.0
Kpol_1037.226.29ON1496102729550.0
NCAS0D021306.29ON143498128790.0
YOL004W (SIN3)6.29ON153692028480.0
Smik_15.1666.29ON156692628330.0
Skud_15.1586.29ON155590428270.0
TPHA0J004006.29ON151299528150.0
Suva_15.1716.29ON156190328020.0
KAFR0A051206.29ON147997327740.0
NDAI0C026606.29ON165785826860.0
TBLA0E031606.29ON173992926830.0
CAGL0E02475g6.29ON149394326800.0
CAGL0J11594g6.29ON9373836131e-64
KAFR0A04880na 1ON344145830.45
Kpol_1064.538.403ON48969782.4
CAGL0H09350g5.190ON1965118748.0
KLTH0C10758g6.38ON522138738.3
Suva_16.3358.116ON3171297210.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_56.22462
         (1541 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_56.22462 s56 complement(139779..144404) [4626 bp, 1541 aa] ...  2830   0.0  
KLTH0C10956g Chr3 (901384..905685) [4302 bp, 1433 aa] {ON} simil...  1900   0.0  
KNAG0F02920 Chr6 (552441..556919) [4479 bp, 1492 aa] {ON} Anc_6....  1258   0.0  
SAKL0E01540g Chr5 complement(114922..119169) [4248 bp, 1415 aa] ...  1250   0.0  
ACL004W Chr3 (347727..351860) [4134 bp, 1377 aa] {ON} Syntenic h...  1232   0.0  
Ecym_3033 Chr3 complement(64660..69084) [4425 bp, 1474 aa] {ON} ...  1207   0.0  
ZYRO0C07524g Chr3 (569197..574209) [5013 bp, 1670 aa] {ON} simil...  1175   0.0  
TDEL0G04400 Chr7 (795501..799973) [4473 bp, 1490 aa] {ON} Anc_6....  1165   0.0  
KLLA0C06182g Chr3 (544281..548840) [4560 bp, 1519 aa] {ON} simil...  1152   0.0  
Kpol_1037.22 s1037 (46639..51129) [4491 bp, 1496 aa] {ON} (46639...  1142   0.0  
NCAS0D02130 Chr4 (394326..398630) [4305 bp, 1434 aa] {ON} Anc_6....  1113   0.0  
YOL004W Chr15 (316938..321548) [4611 bp, 1536 aa] {ON}  SIN3Comp...  1101   0.0  
Smik_15.166 Chr15 (284165..288865) [4701 bp, 1566 aa] {ON} YOL00...  1095   0.0  
Skud_15.158 Chr15 (276509..281176) [4668 bp, 1555 aa] {ON} YOL00...  1093   0.0  
TPHA0J00400 Chr10 complement(89956..94494) [4539 bp, 1512 aa] {O...  1088   0.0  
Suva_15.171 Chr15 (291325..296010) [4686 bp, 1561 aa] {ON} YOL00...  1083   0.0  
KAFR0A05120 Chr1 (1015307..1019746) [4440 bp, 1479 aa] {ON} Anc_...  1073   0.0  
NDAI0C02660 Chr3 complement(615526..620499) [4974 bp, 1657 aa] {...  1039   0.0  
TBLA0E03160 Chr5 (789593..794812) [5220 bp, 1739 aa] {ON} Anc_6....  1038   0.0  
CAGL0E02475g Chr5 (236580..241061) [4482 bp, 1493 aa] {ON} simil...  1036   0.0  
CAGL0J11594g Chr10 complement(1126896..1129709) [2814 bp, 937 aa...   240   1e-64
KAFR0A04880 Chr1 complement(964742..965776) [1035 bp, 344 aa] {O...    37   0.45 
Kpol_1064.53 s1064 (95468..96937) [1470 bp, 489 aa] {ON} (95468....    35   2.4  
CAGL0H09350g Chr8 complement(912452..918349) [5898 bp, 1965 aa] ...    33   8.0  
KLTH0C10758g Chr3 complement(887737..889305) [1569 bp, 522 aa] {...    33   8.3  
Suva_16.335 Chr16 complement(588678..589631) [954 bp, 317 aa] {O...    32   10.0 

>Kwal_56.22462 s56 complement(139779..144404) [4626 bp, 1541 aa] {ON}
            YOL004W (SIN3) - DNA binding protein involved in
            transcriptional regulation [contig 185] FULL
          Length = 1541

 Score = 2830 bits (7336), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1394/1541 (90%), Positives = 1394/1541 (90%)

Query: 1    MWQLSLPNHFVKFVNFPSFFMEFVDVYLHDRRDCRSFMKTPFLVKMKKNLSLVTSSTHKQ 60
            MWQLSLPNHFVKFVNFPSFFMEFVDVYLHDRRDCRSFMKTPFLVKMKKNLSLVTSSTHKQ
Sbjct: 1    MWQLSLPNHFVKFVNFPSFFMEFVDVYLHDRRDCRSFMKTPFLVKMKKNLSLVTSSTHKQ 60

Query: 61   YFIXXXXXXXXXXIELSCDPLLQQSPESYVEERFAKRSVRMPQSWSNQATGQTGLKSSAE 120
            YFI          IELSCDPLLQQSPESYVEERFAKRSVRMPQSWSNQATGQTGLKSSAE
Sbjct: 61   YFIRSSRSSAYRSIELSCDPLLQQSPESYVEERFAKRSVRMPQSWSNQATGQTGLKSSAE 120

Query: 121  GHGMVEQQAGSGGSMEQLPGIASEAKGAVPNGMGXXXXXXXXXXXXXSLSGLETGGRAEY 180
            GHGMVEQQAGSGGSMEQLPGIASEAKGAVPNGMG             SLSGLETGGRAEY
Sbjct: 121  GHGMVEQQAGSGGSMEQLPGIASEAKGAVPNGMGQPPQLPQQHVVLPSLSGLETGGRAEY 180

Query: 181  GASAQRLPFMQXXXXXXXXXXXXXXFSVASLNNPLPMXXXXXXXXXXXXXXXXXXXGVLP 240
            GASAQRLPFMQ              FSVASLNNPLPM                   GVLP
Sbjct: 181  GASAQRLPFMQGAAPQSASSGGSKGFSVASLNNPLPMQQQQQQQQQQQQQQQLLQQGVLP 240

Query: 241  LEHVQDASYRPLNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERIS 300
            LEHVQDASYRPLNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERIS
Sbjct: 241  LEHVQDASYRPLNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERIS 300

Query: 301  TLFKGYPVLIQGLNTFLPQGYKIECTSNPHDPHSIKVTTPFDTTRELSLDHNTGGSAVGG 360
            TLFKGYPVLIQGLNTFLPQGYKIECTSNPHDPHSIKVTTPFDTTRELSLDHNTGGSAVGG
Sbjct: 301  TLFKGYPVLIQGLNTFLPQGYKIECTSNPHDPHSIKVTTPFDTTRELSLDHNTGGSAVGG 360

Query: 361  HLAGPATVSTSPSQIPRQETAVSETKQEETPVDLPASAAFAQDQVHHAESDTQREIXXXX 420
            HLAGPATVSTSPSQIPRQETAVSETKQEETPVDLPASAAFAQDQVHHAESDTQREI    
Sbjct: 361  HLAGPATVSTSPSQIPRQETAVSETKQEETPVDLPASAAFAQDQVHHAESDTQREIQKSA 420

Query: 421  XXXXXXXXXXYATNRPNGDVEFSHAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPI 480
                      YATNRPNGDVEFSHAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPI
Sbjct: 421  QLQQSQQDQQYATNRPNGDVEFSHAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPI 480

Query: 481  HEVYTQVTSLFQNXXXXXXXXXXXXXXXTAAHEXXXXXXXXXXXXXXXXXXXXXXXXXXX 540
            HEVYTQVTSLFQN               TAAHE                           
Sbjct: 481  HEVYTQVTSLFQNAPDLLDDFKKFLPDATAAHEQHQQLLQQQQQQQQLQHQIQLQQQQSQ 540

Query: 541  XXXXXXXXXXELDQRQQQSNSPFNHPASFYQHQQARAQNLPPLGNFSPPINGRDNEAQVN 600
                      ELDQRQQQSNSPFNHPASFYQHQQARAQNLPPLGNFSPPINGRDNEAQVN
Sbjct: 541  QYQSFQSSPQELDQRQQQSNSPFNHPASFYQHQQARAQNLPPLGNFSPPINGRDNEAQVN 600

Query: 601  LPAVQPPALDFPPQQQSQSHRHVVAQGMTNNSLPVSDMRGPVDGGFAPQPLYSQDVQYME 660
            LPAVQPPALDFPPQQQSQSHRHVVAQGMTNNSLPVSDMRGPVDGGFAPQPLYSQDVQYME
Sbjct: 601  LPAVQPPALDFPPQQQSQSHRHVVAQGMTNNSLPVSDMRGPVDGGFAPQPLYSQDVQYME 660

Query: 661  PTSRPEIDLDPSLVPVIPEPIRPLENDSTLIEETSFFDKAKKYMGNKQVYTEFLKILNLF 720
            PTSRPEIDLDPSLVPVIPEPIRPLENDSTLIEETSFFDKAKKYMGNKQVYTEFLKILNLF
Sbjct: 661  PTSRPEIDLDPSLVPVIPEPIRPLENDSTLIEETSFFDKAKKYMGNKQVYTEFLKILNLF 720

Query: 721  SQDLIDTDELVDKVEHYLGGNSELFDWFKSFVNYVERPKHIENVVHEKHRLDLDLCEACC 780
            SQDLIDTDELVDKVEHYLGGNSELFDWFKSFVNYVERPKHIENVVHEKHRLDLDLCEACC
Sbjct: 721  SQDLIDTDELVDKVEHYLGGNSELFDWFKSFVNYVERPKHIENVVHEKHRLDLDLCEACC 780

Query: 781  PSYKKLPKADTFMPCCGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEE 840
            PSYKKLPKADTFMPCCGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEE
Sbjct: 781  PSYKKLPKADTFMPCCGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEE 840

Query: 841  ERHEYDYYIEANLRTIQLLETIANKISNMTVEEKKTFKLPPGLGHTSTTIYKKVIRKVYD 900
            ERHEYDYYIEANLRTIQLLETIANKISNMTVEEKKTFKLPPGLGHTSTTIYKKVIRKVYD
Sbjct: 841  ERHEYDYYIEANLRTIQLLETIANKISNMTVEEKKTFKLPPGLGHTSTTIYKKVIRKVYD 900

Query: 901  KDRGFEIIDALHENPAVSVPIVLRRLKQKDEEWRRAQREWNKVWRELEQKVFYKSLDHLG 960
            KDRGFEIIDALHENPAVSVPIVLRRLKQKDEEWRRAQREWNKVWRELEQKVFYKSLDHLG
Sbjct: 901  KDRGFEIIDALHENPAVSVPIVLRRLKQKDEEWRRAQREWNKVWRELEQKVFYKSLDHLG 960

Query: 961  LTFKQADKKLLTAKQLISEISSIKIDQANKRIYPFTSKPKSQLDFDISDKGVLFDILNLV 1020
            LTFKQADKKLLTAKQLISEISSIKIDQANKRIYPFTSKPKSQLDFDISDKGVLFDILNLV
Sbjct: 961  LTFKQADKKLLTAKQLISEISSIKIDQANKRIYPFTSKPKSQLDFDISDKGVLFDILNLV 1020

Query: 1021 DTFIDHSTTYSNPDKEKLSAFFRGFLSIFFSIPLTDLDNPSEEHKVENGDSTRKRSRDDD 1080
            DTFIDHSTTYSNPDKEKLSAFFRGFLSIFFSIPLTDLDNPSEEHKVENGDSTRKRSRDDD
Sbjct: 1021 DTFIDHSTTYSNPDKEKLSAFFRGFLSIFFSIPLTDLDNPSEEHKVENGDSTRKRSRDDD 1080

Query: 1081 QFFRDLLXXXXXXXXXXXXXXXXXXXXXXXXXAAKTSPDLEYEEAVRLDAKKPWLLGNIL 1140
            QFFRDLL                         AAKTSPDLEYEEAVRLDAKKPWLLGNIL
Sbjct: 1081 QFFRDLLKSKHKQAKKKTSQQEDESTSDDQDTAAKTSPDLEYEEAVRLDAKKPWLLGNIL 1140

Query: 1141 DEANNHGFVSNRKTYNMFANTNIYVFFRHLTTMYQRLSEAKNINEEVTKEINSRKVVQFA 1200
            DEANNHGFVSNRKTYNMFANTNIYVFFRHLTTMYQRLSEAKNINEEVTKEINSRKVVQFA
Sbjct: 1141 DEANNHGFVSNRKTYNMFANTNIYVFFRHLTTMYQRLSEAKNINEEVTKEINSRKVVQFA 1200

Query: 1201 KDLNLASTQLSDMGLDFKGADAYEQLLALCKRLIQSDIEHQWFEESLRQAYKNKAFKIYT 1260
            KDLNLASTQLSDMGLDFKGADAYEQLLALCKRLIQSDIEHQWFEESLRQAYKNKAFKIYT
Sbjct: 1201 KDLNLASTQLSDMGLDFKGADAYEQLLALCKRLIQSDIEHQWFEESLRQAYKNKAFKIYT 1260

Query: 1261 VDKVIQSLVKHAHSIITDAKTAEIMILFEKDRKAPTTSTREQILYRLQVRSCMGLTENMF 1320
            VDKVIQSLVKHAHSIITDAKTAEIMILFEKDRKAPTTSTREQILYRLQVRSCMGLTENMF
Sbjct: 1261 VDKVIQSLVKHAHSIITDAKTAEIMILFEKDRKAPTTSTREQILYRLQVRSCMGLTENMF 1320

Query: 1321 RIELNSTSAHVSIQFVAVDDLTLNQPNSLKDQWQYYLTSYSLSHPTEGVPHEEIKAPFLE 1380
            RIELNSTSAHVSIQFVAVDDLTLNQPNSLKDQWQYYLTSYSLSHPTEGVPHEEIKAPFLE
Sbjct: 1321 RIELNSTSAHVSIQFVAVDDLTLNQPNSLKDQWQYYLTSYSLSHPTEGVPHEEIKAPFLE 1380

Query: 1381 KTLRDDGDSDEDSEWYSPGGQSVSQLRIQINPESYALQIEPNSKDLFTRSTVNKHPTKIG 1440
            KTLRDDGDSDEDSEWYSPGGQSVSQLRIQINPESYALQIEPNSKDLFTRSTVNKHPTKIG
Sbjct: 1381 KTLRDDGDSDEDSEWYSPGGQSVSQLRIQINPESYALQIEPNSKDLFTRSTVNKHPTKIG 1440

Query: 1441 EASGRDAKTMQKSLADMVNSEHGWKKGLQNESIGKAESIINFVKARGFLEKATTVSPDPK 1500
            EASGRDAKTMQKSLADMVNSEHGWKKGLQNESIGKAESIINFVKARGFLEKATTVSPDPK
Sbjct: 1441 EASGRDAKTMQKSLADMVNSEHGWKKGLQNESIGKAESIINFVKARGFLEKATTVSPDPK 1500

Query: 1501 VEKEHSASNGAIPEGATTEKPGDDTDLRADETTAEDIQGNE 1541
            VEKEHSASNGAIPEGATTEKPGDDTDLRADETTAEDIQGNE
Sbjct: 1501 VEKEHSASNGAIPEGATTEKPGDDTDLRADETTAEDIQGNE 1541

>KLTH0C10956g Chr3 (901384..905685) [4302 bp, 1433 aa] {ON} similar to
            uniprot|P22579 Saccharomyces cerevisiae YOL004W SIN3 DNA
            binding protein involved in transcriptional regulation
          Length = 1433

 Score = 1900 bits (4922), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 958/1450 (66%), Positives = 1080/1450 (74%), Gaps = 26/1450 (1%)

Query: 101  MPQSWSNQATGQTGLKSSAEGHGMVEQQAGSGGSMEQLPGIASEAKGAVPNGMGXXXXXX 160
            MP SW+NQ   QTG KSS E   + EQQ  SGG   Q      E+K   P          
Sbjct: 1    MPPSWTNQPASQTGTKSSVESPSLSEQQPVSGGMQGQAANSTGESKANAP----VDASQQ 56

Query: 161  XXXXXXXSLSGLETGGRAEYGASAQRLPFMQXXXXXXXXXXXXXXFSVASLNNPLPMXXX 220
                   SLSGL+ G RAEYG+  QRLP +Q              FSVASLNNPLP    
Sbjct: 57   PHQFVLPSLSGLDAGTRAEYGSEPQRLPSLQGAQPQSISSGGSKGFSVASLNNPLPAQQQ 116

Query: 221  XXXXXXXXXXXXXXXXGVLPLEHVQDASYRPLNFKDALSYLEQVKFQFNNRPDVYNHFLD 280
                             +   EHVQD SYRPLNFKDALSYLEQVKFQFNNRPDVYNHFLD
Sbjct: 117  MLHSQQQQQLLQQGVLPL---EHVQDPSYRPLNFKDALSYLEQVKFQFNNRPDVYNHFLD 173

Query: 281  IMKDYKSQAIDTLGVIERISTLFKGYPVLIQGLNTFLPQGYKIECTSNPHDPHSIKVTTP 340
            IMKDYKSQAIDTLGVIERISTLFKGYP+LIQGLNTFLPQGYKIECT NP+DPHSIKVTTP
Sbjct: 174  IMKDYKSQAIDTLGVIERISTLFKGYPILIQGLNTFLPQGYKIECTLNPNDPHSIKVTTP 233

Query: 341  FDTTRELSL-DHNTGGSAVGGHLAGPATVSTSPSQIPRQETAVSETKQEETPVDLPASAA 399
            FD  REL+L    TG   V GH +   +   SP ++   E A  + K E  P +LP    
Sbjct: 234  FDNARELNLATMATGNGIVEGHPSLMPSDDVSPPKLVGHEPAAVQPKLENAPTNLPVPTT 293

Query: 400  FAQDQVHHAESDTQREIXXXXXXXXXXXXXXYATNRPNGDVEFSHAISYVNKIKTRFADQ 459
            F Q+   H + + Q                 +  NRP+GDVEFSHAISYVNKIKTRFADQ
Sbjct: 294  FNQNLPQHEQQNQQHGSQSPAMPQQQRQDQQFMGNRPSGDVEFSHAISYVNKIKTRFADQ 353

Query: 460  PDIYKHFLEILQTYQREQKPIHEVYTQVTSLFQNXXXXXXXXXXXXXXXTAAHEXXXXXX 519
            P+IYKHFLEILQTYQREQKPIHEVY QVTSLFQN               TAAHE      
Sbjct: 354  PEIYKHFLEILQTYQREQKPIHEVYAQVTSLFQNAPDLLDDFKKFLPDATAAHEQQQLLL 413

Query: 520  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELDQRQQQSNSPFNHPASFYQHQQARAQN 579
                                           +LDQRQQ ++ PF +   FYQ QQ R QN
Sbjct: 414  QQQQQQQQQLQQQQIQQHQSHYQNASQ----DLDQRQQHTHQPFGNTVPFYQTQQGRPQN 469

Query: 580  LPPLGNFSPPINGRDNEAQVNLPAVQPPALDFPPQQQSQSHRHVVAQGMTNNSLPVSDMR 639
            LPPLG+FSPPINGR+N+ Q+NLPAVQPPA++F  QQ      HVV Q +   +LP+SD+R
Sbjct: 470  LPPLGSFSPPINGRENDPQLNLPAVQPPAMEFASQQVPHHPSHVVPQVIPGGTLPLSDLR 529

Query: 640  GPVDGGFAPQPLYSQDVQYMEPTSRPEIDLDPSLVPVIPEPIRPLENDSTLIEETSFFDK 699
            G +DG FAPQPL SQDVQ++EPTSRPEIDLDPSLVPVIPEPI+PLEND TLIEETSFFD+
Sbjct: 530  GAMDGNFAPQPLQSQDVQFIEPTSRPEIDLDPSLVPVIPEPIKPLENDLTLIEETSFFDR 589

Query: 700  AKKYMGNKQVYTEFLKILNLFSQDLIDTDELVDKVEHYLGGNSELFDWFKSFVNYVERPK 759
            AKKYMGNKQVYTEFLKILNLFSQDLI T+ELVDKVEHYLGG+ ELFDWFKSFVNYVE+PK
Sbjct: 590  AKKYMGNKQVYTEFLKILNLFSQDLIGTEELVDKVEHYLGGSPELFDWFKSFVNYVEKPK 649

Query: 760  HIENVVHEKHRLDLDLCEACCPSYKKLPKADTFMPCCGRDEMCWEVLNDEWVGHPVWASE 819
            HIENV+HEKHRLDLDLCEAC PSYKKLPKADTFMPC GRDEMCWEVLNDEWVGHPVWASE
Sbjct: 650  HIENVIHEKHRLDLDLCEACFPSYKKLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASE 709

Query: 820  DSGFIAHRKNQYEETLFKIEEERHEYDYYIEANLRTIQLLETIANKISNMTVEEKKTFKL 879
            DSGFIAHRKNQYEETLFKIEEERHEYDYYIEANLRTIQLLETIANKISNMT EEK+ FKL
Sbjct: 710  DSGFIAHRKNQYEETLFKIEEERHEYDYYIEANLRTIQLLETIANKISNMTPEEKQAFKL 769

Query: 880  PPGLGHTSTTIYKKVIRKVYDKDRGFEIIDALHENPAVSVPIVLRRLKQKDEEWRRAQRE 939
            PPGLGHTS TIYKKVIRKVYDKDRGFEIIDALHENPAVSVPI+L+RLKQKDEEWRRAQRE
Sbjct: 770  PPGLGHTSMTIYKKVIRKVYDKDRGFEIIDALHENPAVSVPIILKRLKQKDEEWRRAQRE 829

Query: 940  WNKVWRELEQKVFYKSLDHLGLTFKQADKKLLTAKQLISEISSIKIDQANKRIYPFTSKP 999
            WNKVWRELEQKVFYKSLDHLGLTFKQADKKLLTAKQLISEISSIK+DQ NKRIYPFT KP
Sbjct: 830  WNKVWRELEQKVFYKSLDHLGLTFKQADKKLLTAKQLISEISSIKVDQTNKRIYPFTPKP 889

Query: 1000 KSQLDFDISDKGVLFDILNLVDTFIDHSTTYSNPDKEKLSAFFRGFLSIFFSIPLTDLDN 1059
            KSQLD+D+ DKGVLFDIL LV+ FIDHS+TYSNPDKEKL+AFF+GFLS+FFSI   +++N
Sbjct: 890  KSQLDYDLKDKGVLFDILCLVNNFIDHSSTYSNPDKEKLAAFFKGFLSVFFSISYQEIEN 949

Query: 1060 --PSEEHKVENGDSTRKRSRDDDQFFRDLLXXXXXXXXXXXXXXXXXXXXXXXXXAAKTS 1117
              P++   V N +  RKR  + +Q  ++LL                           K+ 
Sbjct: 950  STPADSDAVSNSNP-RKRLWESEQPLKELLRSKHKHHKKRDTSAEDDSISDDQNSPEKSP 1008

Query: 1118 PDLEYEEAVRLDAKKPWLLGNILDEANNHGFVSNRKTYNMFANTNIYVFFRHLTTMYQRL 1177
             ++E EE +R +AKKPWLLGNILDEAN+HG+VSNRK +N+FANTN+YVFFRHLTTMYQRL
Sbjct: 1009 QEIEDEEVIRQEAKKPWLLGNILDEANDHGYVSNRKIFNLFANTNVYVFFRHLTTMYQRL 1068

Query: 1178 SEAKNINEEVTKEINSRKVVQFAKDLNLASTQLSDMGLDFKGADAYEQLLALCKRLIQSD 1237
            SE KN+NEEVT+EINSR VVQFAKDLNL STQLSDMGLDFKG DAY+QLL LCKRLI++D
Sbjct: 1069 SEVKNMNEEVTREINSRNVVQFAKDLNLVSTQLSDMGLDFKGKDAYDQLLTLCKRLIRND 1128

Query: 1238 IEHQWFEESLRQAYKNKAFKIYTVDKVIQSLVKHAHSIITDAKTAEIMILFEKDRKAPTT 1297
            ++HQWFEESLRQAYKNKAFKIYTVDKVIQSLVKHAHSIITDAK+AEIMILFEKDR+   T
Sbjct: 1129 MDHQWFEESLRQAYKNKAFKIYTVDKVIQSLVKHAHSIITDAKSAEIMILFEKDRRCTAT 1188

Query: 1298 STREQILYRLQVRSCMGLTENMFRIELNSTSAHVSIQFVAVDDLTLNQPNSLKDQWQYYL 1357
            ST+EQILYRLQVRS MGLTENMFR+E+N  S HV IQ+VA+DDLTL +P SLKD+W YYL
Sbjct: 1189 STKEQILYRLQVRSYMGLTENMFRVEINKDSCHVCIQYVAIDDLTLKEPESLKDRWHYYL 1248

Query: 1358 TSYSLSHPTEGVPHEEIKAPFLEKTLRDDGDSDEDSEWYSPGGQSVSQLRIQINPESYAL 1417
            TSY+LSHPTEG+PHEEIK PFLEKTL+DD ++DE SE  SP G S+S LRIQ+NPESY L
Sbjct: 1249 TSYALSHPTEGIPHEEIKVPFLEKTLQDDEEADEGSEERSPSGHSLSNLRIQVNPESYEL 1308

Query: 1418 QIEPNSKDLFTRSTVNKHPTKIGEASGRDAK-TMQKSLADMVNSEHGWKKGLQNESIGKA 1476
            QIEP SKD+FTR  VN+        S  D K   +K+L   ++   GWKKG+  E + K 
Sbjct: 1309 QIEPGSKDIFTRFAVNRFLNSSENNSNTDLKEEKRKTLMSQLDGSRGWKKGMSQELVDKT 1368

Query: 1477 ESIINFVKARGFLEKATTVSPDPKV-----EKEHSASNGAIPEGATTEKPGDDTDLRADE 1531
             + +N+V+  G   K  +++ +P +     +  H +S     E ++ E   DDT+L+A E
Sbjct: 1369 LTALNYVRLHG---KHESLNKNPALVQGTRDPRHESS--VAKEASSLESHADDTELKAGE 1423

Query: 1532 TTAEDIQGNE 1541
            TTAEDIQGNE
Sbjct: 1424 TTAEDIQGNE 1433

>KNAG0F02920 Chr6 (552441..556919) [4479 bp, 1492 aa] {ON} Anc_6.29
            YOL004W
          Length = 1492

 Score = 1258 bits (3256), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 680/1338 (50%), Positives = 852/1338 (63%), Gaps = 149/1338 (11%)

Query: 246  DASYRPLNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFKG 305
            D+ YRPLN KDALSYLEQVK QFN+RP +YN FLDIMKD+KSQ IDT GVIER+STLFKG
Sbjct: 215  DSPYRPLNVKDALSYLEQVKLQFNSRPYIYNQFLDIMKDFKSQNIDTPGVIERVSTLFKG 274

Query: 306  YPVLIQGLNTFLPQGYKIECTSNPHDPHSIKVTTPFDTTRELSLDHNTGGSAVGGHLAGP 365
            +P LIQG NTFLPQGY+IEC+SNP++P  IKVTTP      + +  N  GS +      P
Sbjct: 275  FPALIQGFNTFLPQGYRIECSSNPNEP--IKVTTP------MGVLENVRGSDITAD-QQP 325

Query: 366  ATVSTSPSQIPRQET-AVSETKQEETPVDLPASAAFAQDQVHHAESDTQREIXXXXXXXX 424
            A      +Q P Q +    ++     P  + A+    Q    HAE++ ++          
Sbjct: 326  AIGQLPTTQSPIQASLPPPQSAHLHLPSTVAAATTVQQSANVHAENEPKKA--------- 376

Query: 425  XXXXXXYATNRPNGDVEFSHAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPIHEVY 484
                          DVEFS AISYVNKIK RF+DQPDIYK+FLEILQTYQREQKPI+EVY
Sbjct: 377  -------------NDVEFSQAISYVNKIKNRFSDQPDIYKNFLEILQTYQREQKPINEVY 423

Query: 485  TQVTSLFQNXXXXXXXXXXXXXXXTAAHEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 544
             QVT LF N               +A++E                               
Sbjct: 424  AQVTVLFHNAPDLLDDFKKFLPDSSASNE---------------------QQPKQSPYSP 462

Query: 545  XXXXXXELDQRQQQSNSPFNHPASFYQHQQARAQNLPPLGNFSPPINGRDNEAQVNLP-A 603
                  ++ +    +N+   +P    Q Q     NLPP+G+FSPP NG        +P A
Sbjct: 463  QVYSGADMARGYMYNNTGVYYPPQVNQPQ----SNLPPIGSFSPPANGVAPTTGTAIPHA 518

Query: 604  VQPPALDFPPQQQSQSHRHVVAQGMTNN-SLPVSDMRGPVDGGFAP-------------- 648
             +   +   P       +H  A  M NN  + +S+MRG   GG  P              
Sbjct: 519  DEQHVVAGVPAMAPHEQQH--APSMINNDGIQISNMRG---GGTVPALNQYGMISPHDYT 573

Query: 649  -------------------------QPLYSQDVQYMEPTSRPEIDLDPSLVPVIPEPIRP 683
                                     +   S D+Q      RPEIDLDPS+VPV+PEP  P
Sbjct: 574  QQQAKQVQQFQEDQQQQQQQSMMMDEQYGSGDMQV-----RPEIDLDPSIVPVVPEPTEP 628

Query: 684  LENDSTLIEETSFFDKAKKYMGNKQVYTEFLKILNLFSQDLIDTDELVDKVEHYLGGNSE 743
            +EN+ +L EETSFF+K KK +GN+Q+Y EFLK+LNLFSQDLI  DELV KVE+YL G  E
Sbjct: 629  IENNLSLSEETSFFEKVKKNIGNRQIYIEFLKVLNLFSQDLIAVDELVTKVENYLAGQPE 688

Query: 744  LFDWFKSFVNYVERPKHIENVVHEKHRLDLDLCEACCPSYKKLPKADTFMPCCGRDEMCW 803
            LF+WFK+FV Y ++PK IENV+HEKHRLDLDLCEA  PSYKKLPK+DTFMPC GRD+MCW
Sbjct: 689  LFEWFKNFVGYQDKPKIIENVIHEKHRLDLDLCEAYGPSYKKLPKSDTFMPCSGRDDMCW 748

Query: 804  EVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDYYIEANLRTIQLLETIA 863
            EVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYD+YIE+NLRTIQ LETIA
Sbjct: 749  EVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQTLETIA 808

Query: 864  NKISNMTVEEKKTFKLPPGLGHTSTTIYKKVIRKVYDKDRGFEIIDALHENPAVSVPIVL 923
            +KI+NMT EEK  FKLPPGLGHTS TIYKK+IRKVYDK+RGFEIID LHE+PA++VPIVL
Sbjct: 809  SKIANMTEEEKNMFKLPPGLGHTSLTIYKKIIRKVYDKERGFEIIDELHEHPAITVPIVL 868

Query: 924  RRLKQKDEEWRRAQREWNKVWRELEQKVFYKSLDHLGLTFKQADKKLLTAKQLISEISSI 983
            +RLKQKDEEWRRAQREWNKVWRELEQKV++KSLDHLGLTFKQADKKLLT KQLISEISSI
Sbjct: 869  KRLKQKDEEWRRAQREWNKVWRELEQKVYFKSLDHLGLTFKQADKKLLTTKQLISEISSI 928

Query: 984  KIDQANKRIYPFTSKPKSQLDFDISDKGVLFDILNLVDTFIDHSTTYSNPDKEKLSAFFR 1043
            K+DQ NKR++  T KPK QLD+  +D  ++FDI+ L D F+DH +TYSNPDKE+L   FR
Sbjct: 929  KVDQNNKRMHWLTPKPKKQLDYQFNDMDIIFDIVGLTDVFVDHCSTYSNPDKERLKDLFR 988

Query: 1044 GFLSIFFSIPL----TDLDNPSEEH-----KVENGDSTRKRSRDDDQF-FRDLLXXXXXX 1093
             F+S+FF IP       LD  S+E      K E  D ++KR R D +    D+L      
Sbjct: 989  VFISLFFFIPRDLISAALDTKSDEGKSTDTKFEKADDSKKRPRPDVELSLSDILHRAKYQ 1048

Query: 1094 XXXXXXXXXXXXXXXXXXXAAKTSPDLEYEEAVRLDAKKPWLLGNILDEANNHGFVSNRK 1153
                               A +     E       +A KPWL+G+I++ AN+HG V++R 
Sbjct: 1049 KLKNGEGLGMSEDDDEEKLAKEAEEMSEK------NASKPWLVGDIVERANSHGLVTDRA 1102

Query: 1154 TYNMFANTNIYVFFRHLTTMYQRLSEAKNINEEVTKEINSRKVVQFAKDLNLASTQLSDM 1213
             YN+F NTN+Y+F RH +T+Y RL E K ++E VTKEIN+RKVVQFA+DLNL STQL DM
Sbjct: 1103 VYNLFGNTNVYIFIRHWSTLYGRLLELKQMDERVTKEINNRKVVQFAEDLNLLSTQLRDM 1162

Query: 1214 GLDFKGADAYEQLLALCKRLIQSDIEHQWFEESLRQAYKNKAFKIYTVDKVIQSLVKHAH 1273
            GLDF G +AY++ L L KRLI++++EHQWFEESLRQAY NKAFK+YTVDKV+ SLVKHAH
Sbjct: 1163 GLDFDGKNAYQETLKLSKRLIRNELEHQWFEESLRQAYNNKAFKLYTVDKVVHSLVKHAH 1222

Query: 1274 SIITDAKTAEIMILFEKDRKAPTTSTREQILYRLQVRSCMGLTENMFRIELNSTSAHVSI 1333
            +++TD K++E+M LFEKDR   +T  ++QILYRL  RS M  TENMFR++ N  + HVSI
Sbjct: 1223 TLMTDNKSSELMELFEKDRLQSSTCVKDQILYRLLTRSHMSSTENMFRVQYNKDTRHVSI 1282

Query: 1334 QFVAVDDLTLNQPNSLKDQWQYYLTSYSLSHPTEGVPHEEIKAPFLEKTLR---DDGDSD 1390
            Q++ +DD+TL       ++W YY+TSY+L HPTEG+  +++  PFLE+ L    D  D +
Sbjct: 1283 QYIGLDDVTLEDAKDDNERWNYYMTSYALPHPTEGIMQDKLVVPFLERILEFENDMLDVE 1342

Query: 1391 EDSEWYSPGGQSVSQLRIQINPESYALQIEPNSKDLFTRSTVNKHPTKIGEASGRDAKTM 1450
              S+ Y+P G S S+L+I I+P++Y L I+  S D+F+RS++N++P +            
Sbjct: 1343 AGSDRYNPVGTSYSKLKINIDPKTYKLIIQDGSYDIFSRSSINEYPIRPDSKGYVQMVEK 1402

Query: 1451 QKSLAD-MVNSEHGWKKGLQNESIGKAESIINFVKARGFLEKATTVSPDPKVE--KEHSA 1507
            +K  A   ++   GWKK L ++ I                    TV P  K+    E + 
Sbjct: 1403 RKETAQKFLDGRFGWKKDLSDDVI-------------------NTVEPTKKIALLSEETK 1443

Query: 1508 SNGAIPEGATTEKPGDDT 1525
              G +    TTEK  ++T
Sbjct: 1444 DVGTLSTPVTTEKGAENT 1461

>SAKL0E01540g Chr5 complement(114922..119169) [4248 bp, 1415 aa] {ON}
            similar to uniprot|Q75CF0 Ashbya gossypii ACL004W
            ACL004Wp and some similarites with YOL004W uniprot|P22579
            Saccharomyces cerevisiae YOL004W SIN3 DNA binding protein
            involved in transcriptional regulation
          Length = 1415

 Score = 1250 bits (3235), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 637/998 (63%), Positives = 765/998 (76%), Gaps = 33/998 (3%)

Query: 567  ASFYQHQQARAQNLPPLGNFSPPINGRDNEAQ-VNLPAVQPPALDFPPQQQSQSHRHVVA 625
             +FY  Q A  QNLPPLG+FSPP +G   E + V LPAVQPP++D   Q Q    +H++ 
Sbjct: 422  GTFYP-QAAPQQNLPPLGSFSPPSSGSAREGEHVGLPAVQPPSMDISGQPQ----QHIIT 476

Query: 626  QGMTNNSLPVSDMRGPVDGGFAPQPLYSQDVQYMEPTSRPEIDLDPSLVPVIPEPIRPLE 685
            QGM+N+ +P+S++R   DG +      S +VQYMEP +RPEIDLDPSLVPVIPEPI P+E
Sbjct: 477  QGMSNDDIPISEVRNTADGAYRSDLRNSGEVQYMEPVARPEIDLDPSLVPVIPEPIEPME 536

Query: 686  NDSTLIEETSFFDKAKKYMGNKQVYTEFLKILNLFSQDLIDTDELVDKVEHYLGGNSELF 745
            N+ +L+EETSFFDKAKK++GNKQ+YTEFLKILNL+SQDL+D DELV+KVE+YLGGN ELF
Sbjct: 537  NEVSLVEETSFFDKAKKFIGNKQIYTEFLKILNLYSQDLLDRDELVEKVEYYLGGNKELF 596

Query: 746  DWFKSFVNYVERPKHIENVVHEKHRLDLDLCEACCPSYKKLPKADTFMPCCGRDEMCWEV 805
            DWFK+FV Y ++PKHIEN+VHEKHRLDLDLCEAC PSYKKLPKADTFMPC GRDEMCWEV
Sbjct: 597  DWFKNFVGYEKKPKHIENIVHEKHRLDLDLCEACGPSYKKLPKADTFMPCSGRDEMCWEV 656

Query: 806  LNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDYYIEANLRTIQLLETIANK 865
            LNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYD+YIEANLRTIQ LETIANK
Sbjct: 657  LNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIEANLRTIQTLETIANK 716

Query: 866  ISNMTVEEKKTFKLPPGLGHTSTTIYKKVIRKVYDKDRGFEIIDALHENPAVSVPIVLRR 925
            I+NMT EEK TFKL PGLGHTS TIYKKVIRKVYDKDRGFEIIDALHE P+++VPIVL+R
Sbjct: 717  IANMTPEEKATFKLSPGLGHTSVTIYKKVIRKVYDKDRGFEIIDALHETPSIAVPIVLKR 776

Query: 926  LKQKDEEWRRAQREWNKVWRELEQKVFYKSLDHLGLTFKQADKKLLTAKQLISEISSIKI 985
            LKQKDEEWRRAQREWNKVWRELEQKV+YKSLDHLGLTFKQADKKLLT KQL+SEIS+IK+
Sbjct: 777  LKQKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQLVSEISTIKV 836

Query: 986  DQANKRIYPFTSKPKSQLDFDISDKGVLFDILNLVDTFIDHSTTYSNPDKEKLSAFFRGF 1045
            DQANKRI+P T KPKSQLD+   D+ VL+DILNL   FID +TTYSNPDKEK+  F + F
Sbjct: 837  DQANKRIHPLTPKPKSQLDYHFKDREVLYDILNLAKVFIDCNTTYSNPDKEKMFDFLKSF 896

Query: 1046 LSIFFSIPLTDLD-------------NPSEEHKVENGDSTRKRSRDDDQFFRDLLXXXXX 1092
            L +FFS P+ +++             +  E    EN D +RKR+R+++   +D+L     
Sbjct: 897  LVLFFSYPMYEVETAFARRRGDIGVQDGEENSGQENSDLSRKRTREEENLLKDVL--RRN 954

Query: 1093 XXXXXXXXXXXXXXXXXXXXAAKTSPDLEYEEAVRLDAKKPWLLGNILDEANNHGFVSNR 1152
                                A KT  + E EE +R +AKKPWLLG+I+DEAN HGFV NR
Sbjct: 955  KYQKGRNFAEEEPIPEESEFAEKTVEEKEEEEIIRQEAKKPWLLGSIVDEANEHGFVENR 1014

Query: 1153 KTYNMFANTNIYVFFRHLTTMYQRLSEAKNINEEVTKEINSRKVVQFAKDLNLASTQLSD 1212
            KT+NMFANTNIYVFFRHL T+Y RLSE K+INE VT+EI +RKVVQFAKDLNL STQLSD
Sbjct: 1015 KTFNMFANTNIYVFFRHLATLYTRLSEVKDINEAVTEEIKNRKVVQFAKDLNLISTQLSD 1074

Query: 1213 MGLDFKGADAYEQLLALCKRLIQSDIEHQWFEESLRQAYKNKAFKIYTVDKVIQSLVKHA 1272
            MGLDF+GADAY Q+L L KRLI+ DIEHQWFEESLRQAYKNKAFKIYT+DKV+QSLVKHA
Sbjct: 1075 MGLDFEGADAYGQVLTLSKRLIEGDIEHQWFEESLRQAYKNKAFKIYTIDKVVQSLVKHA 1134

Query: 1273 HSIITDAKTAEIMILFEKDRKAPTTSTREQILYRLQVRSCMGLTENMFRIELNSTSAHVS 1332
            H+IITD KT EIMILFEKDR    TS +EQILYRLQVRS M   ENMFRIE N  S H S
Sbjct: 1135 HTIITDPKTVEIMILFEKDRTCLNTSAKEQILYRLQVRSHMTTAENMFRIEYNRQSTHAS 1194

Query: 1333 IQFVAVDDLTLNQPNSLKDQWQYYLTSYSLSHPTEGVPHEEIKAPFLEKTLRDDGDSDED 1392
            IQFVAVDDLTL +P SL+D+W+YY+TSYSLSHPTEG+ HEE++ PFLEK L  + +   +
Sbjct: 1195 IQFVAVDDLTLEEPKSLEDRWKYYVTSYSLSHPTEGISHEELQPPFLEKILEKEEEFQCE 1254

Query: 1393 SEWYSPGGQSVSQLRIQINPESYALQIEPNSKDLFTRSTVNKHPTKIGEASGRDAKTMQ- 1451
            +  YSP G S S L+++INPE+Y+L ++P S D F+R ++NK P +I   + +  +  + 
Sbjct: 1255 NGEYSPEGVSSSNLKVKINPETYSLDVQPGSYDFFSRKSINKFPIEINNDTYKSKRGEKA 1314

Query: 1452 KSLADMVNSEHGWKKGLQNESIGKAESIINFVKARGFL------EKATTVSPDPKVE-KE 1504
            K L   +N   GWK+GL    + KA++ I +VK +G L      +K   V  D   E K 
Sbjct: 1315 KCLTSYLNGAKGWKRGLVASKVLKAQTEIEYVKTKGTLVGLESKDKNDIVKNDIDGENKS 1374

Query: 1505 HSASNGAIPEGATTEKP---GDDTDLRADETTAEDIQG 1539
            ++ S G + +    +KP    ++ + + ++TT E+ +G
Sbjct: 1375 YTFSTGQLHDHE-EDKPISHQEEPESKGNDTTTEEFEG 1411

 Score =  197 bits (502), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 99/145 (68%), Positives = 108/145 (74%), Gaps = 5/145 (3%)

Query: 206 FSVASLNNPLPMXXXXXXXXXXXXXXXXXXXGVLPLEHVQDASYRPLNFKDALSYLEQVK 265
           FSVASLNNPLP                         +  QD SYRPLN KDALSYLEQVK
Sbjct: 120 FSVASLNNPLPEQQQQQQQQQQQQQQQQQQQ-----QQPQDPSYRPLNVKDALSYLEQVK 174

Query: 266 FQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFKGYPVLIQGLNTFLPQGYKIEC 325
           FQFNNRPDVYNHFLDIMKD+KSQAIDT GVIER+S LF+GYP LIQG NTFLPQGYKIEC
Sbjct: 175 FQFNNRPDVYNHFLDIMKDFKSQAIDTPGVIERVSNLFQGYPNLIQGFNTFLPQGYKIEC 234

Query: 326 TSNPHDPHSIKVTTPFDTTRELSLD 350
           +SNP+DPH IKVTTPF TT  ++L+
Sbjct: 235 SSNPNDPHPIKVTTPFGTTGSVTLN 259

 Score = 55.1 bits (131), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 44/78 (56%)

Query: 252 LNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFKGYPVLIQ 311
           + F  A+SY+ ++K +F  +PD+Y HFL+I++ Y+ +      V  +++ LF+  P L+ 
Sbjct: 339 VEFSHAISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLD 398

Query: 312 GLNTFLPQGYKIECTSNP 329
               FLP     + T+ P
Sbjct: 399 DFKKFLPDASAPQSTTTP 416

 Score = 32.7 bits (73), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 33/72 (45%), Gaps = 5/72 (6%)

Query: 682 RPLENDSTLIEETSFFDKAKKYMGNK-QVYTEFLKILNLFSQDLIDTDELVDKVEHYLGG 740
           RPL     L    S+ ++ K    N+  VY  FL I+  F    IDT  ++++V +   G
Sbjct: 159 RPLNVKDAL----SYLEQVKFQFNNRPDVYNHFLDIMKDFKSQAIDTPGVIERVSNLFQG 214

Query: 741 NSELFDWFKSFV 752
              L   F +F+
Sbjct: 215 YPNLIQGFNTFL 226

>ACL004W Chr3 (347727..351860) [4134 bp, 1377 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YOL004W (SIN3)
          Length = 1377

 Score = 1232 bits (3188), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 606/947 (63%), Positives = 733/947 (77%), Gaps = 38/947 (4%)

Query: 578  QNLPPLGNFSPPINGRDNEAQVNLPAVQPPALDFPPQQQSQSHRHVVAQGMTNNSLPVSD 637
            QNLPPLGNFS P     +   ++LP+VQ P +      Q QS  H+V QG++N  +PVSD
Sbjct: 393  QNLPPLGNFSTP----GDHHPMSLPSVQGPNVGL---SQGQSG-HIVTQGVSNQHIPVSD 444

Query: 638  MRGPVDGGF-APQPLYSQDVQYMEPTSRPEIDLDPSLVPVIPEPIRPLENDSTLIEETSF 696
            +RG  D  F A +    QDVQYMEPT RPEIDLDPSLVPVIPEPI+PLE++  L+EE +F
Sbjct: 445  LRGAPDASFRASEYNQVQDVQYMEPTVRPEIDLDPSLVPVIPEPIKPLEDELNLVEEATF 504

Query: 697  FDKAKKYMGNKQVYTEFLKILNLFSQDLIDTDELVDKVEHYLGGNSELFDWFKSFVNYVE 756
            FDKAKK++GNKQ+YTEFLKILNL+SQDL++ ++LV+ V HYL G+ ELFDWFKSFV Y E
Sbjct: 505  FDKAKKFIGNKQIYTEFLKILNLYSQDLLEKEKLVEDVSHYLSGSPELFDWFKSFVGYQE 564

Query: 757  RPKHIENVVHEKHRLDLDLCEACCPSYKKLPKADTFMPCCGRDEMCWEVLNDEWVGHPVW 816
            RPKHIENV+HEKHRLDLDLCEAC PSYK+LPKADTFMPC GRDEMCWEVLNDEWVGHPVW
Sbjct: 565  RPKHIENVIHEKHRLDLDLCEACGPSYKRLPKADTFMPCSGRDEMCWEVLNDEWVGHPVW 624

Query: 817  ASEDSGFIAHRKNQYEETLFKIEEERHEYDYYIEANLRTIQLLETIANKISNMTVEEKKT 876
            ASEDSGFIAHRKNQYE+TLFKIEEERHEYD+YIEANLRTIQ LETIANKI+NMT EEK  
Sbjct: 625  ASEDSGFIAHRKNQYEDTLFKIEEERHEYDFYIEANLRTIQTLETIANKIANMTPEEKAA 684

Query: 877  FKLPPGLGHTSTTIYKKVIRKVYDKDRGFEIIDALHENPAVSVPIVLRRLKQKDEEWRRA 936
            FKLPPGLGHTS TIYKKVIRKVYDKDRGFEIIDALHE+PA++VP+VL+RLKQKDEEWRRA
Sbjct: 685  FKLPPGLGHTSVTIYKKVIRKVYDKDRGFEIIDALHEHPAITVPLVLKRLKQKDEEWRRA 744

Query: 937  QREWNKVWRELEQKVFYKSLDHLGLTFKQADKKLLTAKQLISEISSIKIDQANKRIYPFT 996
            QREWNKVWRELEQKVFYKSLDHLGLTFKQADKKLLTAKQLISEISSIK+DQ+NKRI+P T
Sbjct: 745  QREWNKVWRELEQKVFYKSLDHLGLTFKQADKKLLTAKQLISEISSIKVDQSNKRIHPLT 804

Query: 997  SKPKSQLDFDISDKGVLFDILNLVDTFIDHSTTYSNPDKEKLSAFFRGFLSIFFSIPLTD 1056
             K KSQL +D  +  V  DIL+LV  F+ ++ TYS  D E+L  FF+GF+S+FFS PL +
Sbjct: 805  PKAKSQLSYDFKEPEVFQDILSLVMVFLANNNTYSPSDNERLKDFFKGFISLFFSYPLHE 864

Query: 1057 -----LDNPSEEHKVENGDST--------------RKRSRDD-DQFFRDLLXXXXXXXXX 1096
                 L   S+   + +GD T              RKR RDD +   RD+L         
Sbjct: 865  IEEGLLKRSSQNGTISHGDDTRKSKEDPKTEKHSARKRVRDDTEHLLRDILYRNKQQKVN 924

Query: 1097 XXXXXXXXXXXXXXXXAAKTSPDLEYEEAVRLDAKKPWLLGNILDEANNHGFVSNRKTYN 1156
                              +   D+E +E VR +AKKPWLLG+I+DEA+NHG VS+R T+N
Sbjct: 925  KGPQNDQSSEEF------EKESDIEEKEIVRQEAKKPWLLGSIVDEADNHGHVSDRVTFN 978

Query: 1157 MFANTNIYVFFRHLTTMYQRLSEAKNINEEVTKEINSRKVVQFAKDLNLASTQLSDMGLD 1216
            MFANTNIYVFFRHLTTMY+RL E K IN EVTKEI++RKVVQFAKDLNL STQL+DMGLD
Sbjct: 979  MFANTNIYVFFRHLTTMYERLVEVKKINGEVTKEISNRKVVQFAKDLNLISTQLTDMGLD 1038

Query: 1217 FKGADAYEQLLALCKRLIQSDIEHQWFEESLRQAYKNKAFKIYTVDKVIQSLVKHAHSII 1276
            FKGADAYE+LL L + LI  ++EHQWFEESLRQAYKNKAFK+YT+DKVIQ+LVKHAH+I+
Sbjct: 1039 FKGADAYEELLRLSRSLISGELEHQWFEESLRQAYKNKAFKLYTIDKVIQALVKHAHTIL 1098

Query: 1277 TDAKTAEIMILFEKDRKAPTTSTREQILYRLQVRSCMGLTENMFRIELNSTSAHVSIQFV 1336
             D KT EIM+LF+ DR + +TST++QILYRLQVRS M   ENMFRIE N+T++H SIQFV
Sbjct: 1099 MDHKTVEIMLLFDNDRTSTSTSTKDQILYRLQVRSNMSNIENMFRIEYNTTTSHASIQFV 1158

Query: 1337 AVDDLTLNQPNSLKDQWQYYLTSYSLSHPTEGVPHEEIKAPFLEKTL-RDDGDSDEDSEW 1395
            AV+DLTL++P SL+D+WQYYLTSYSLSHPTEG+ H+ ++ PFLEK + RD+G  D+  E 
Sbjct: 1159 AVEDLTLDEPKSLRDKWQYYLTSYSLSHPTEGISHDNLRTPFLEKIIERDEGYIDDGDER 1218

Query: 1396 YSPGGQSVSQLRIQINPESYALQIEPNSKDLFTRSTVNKHPTKIGEASGRDAKTMQKSLA 1455
            YSP G + S ++++I+P +Y++++EP   D+F+R +VNK PT++ +   + +  ++  L 
Sbjct: 1219 YSPEGVASSNMKVKIDPLTYSMEVEPGCHDIFSRKSVNKFPTRV-DVKKKKSAELKLVLE 1277

Query: 1456 DMVNSEHGWKKGLQNESIGKAESIINFVKARGFLEK-ATTVSPDPKV 1501
              +N E GWK+GL  +   +AE  + +VK  G L+  A  +S D K 
Sbjct: 1278 GFLNGERGWKRGLTTKRTAEAERRLEYVKNNGTLDDYAEEISTDTKA 1324

 Score =  266 bits (679), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 151/252 (59%), Positives = 167/252 (66%), Gaps = 39/252 (15%)

Query: 244 VQDAS-YRPLNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTL 302
            QD S YRPLN KDALSYLEQVKFQF++RPDVYNHFLDIMKD+KSQAIDT GVIER+STL
Sbjct: 123 AQDGSAYRPLNVKDALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTL 182

Query: 303 FKGYPVLIQGLNTFLPQGYKIECTSNPHDPHSIKVTTPFDTTRELSLDHNTGGSAVGGHL 362
           F GYP LIQG NTFLP GY IEC S+P+DP  IKVTTPF T  E+ +   TG  A G H 
Sbjct: 183 FHGYPALIQGFNTFLPHGYNIECPSDPNDP--IKVTTPFGTIGEIPI---TG--AGGNHA 235

Query: 363 AGPATVSTSPSQIPRQETAVSETKQEETPVDLPASAAFAQDQVHHAESDTQREIXXXXXX 422
            G    +T P     Q         E +P  + A+ A  Q+Q                  
Sbjct: 236 HG---ANTEPRLQSTQNVPTVYRSAEGSPAAI-ATPATTQEQ------------------ 273

Query: 423 XXXXXXXXYATN-RPNGDVEFSHAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPIH 481
                   Y T  +  GDVEFSHAISYVNKIKTRFA+QPDIYKHFLEILQTYQREQKPI+
Sbjct: 274 --------YGTGPKKAGDVEFSHAISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPIN 325

Query: 482 EVYTQVTSLFQN 493
           EVY QVT LFQN
Sbjct: 326 EVYAQVTVLFQN 337

 Score = 52.4 bits (124), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 40/67 (59%)

Query: 252 LNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFKGYPVLIQ 311
           + F  A+SY+ ++K +F  +PD+Y HFL+I++ Y+ +      V  +++ LF+  P L+ 
Sbjct: 284 VEFSHAISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLD 343

Query: 312 GLNTFLP 318
               FLP
Sbjct: 344 DFKKFLP 350

>Ecym_3033 Chr3 complement(64660..69084) [4425 bp, 1474 aa] {ON}
            similar to Ashbya gossypii ACL004W
          Length = 1474

 Score = 1207 bits (3122), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 602/939 (64%), Positives = 721/939 (76%), Gaps = 43/939 (4%)

Query: 579  NLPPLGNFSPPINGRDNEAQVNLPAVQPPALDFPPQQQSQSH-RHVVAQGMTNNSLPVSD 637
            NLPPLG+FS P     +   +NLP VQ P ++      +Q H  H++ QGM+N  +P+SD
Sbjct: 488  NLPPLGSFSTP----GDHHPMNLPLVQAPNMNL-----NQGHPAHIITQGMSNQKIPISD 538

Query: 638  MRGPVDGGFAPQPLYSQ--DVQYMEPTSRPEIDLDPSLVPVIPEPIRPLENDSTLIEETS 695
            +R   D  + P   YSQ  D QYME  +RPEIDLDPSLVPVIPEPI+PLE++  L+EE S
Sbjct: 539  LRTTADTSYRPAE-YSQGQDTQYMETNARPEIDLDPSLVPVIPEPIKPLEDELNLVEEAS 597

Query: 696  FFDKAKKYMGNKQVYTEFLKILNLFSQDLIDTDELVDKVEHYLGGNSELFDWFKSFVNYV 755
            FFDKAKKY+GNKQ+YTEFLKILNL+SQDL+D + LV+KV HYL G  ELFDWFKSFV Y 
Sbjct: 598  FFDKAKKYIGNKQIYTEFLKILNLYSQDLLDKERLVEKVGHYLSGCPELFDWFKSFVGYQ 657

Query: 756  ERPKHIENVVHEKHRLDLDLCEACCPSYKKLPKADTFMPCCGRDEMCWEVLNDEWVGHPV 815
            E+PKHIEN+VHEKHRLDLDLCEAC PSYK+LPKADTFMPC GRDEMCWEVLNDEWVGHPV
Sbjct: 658  EKPKHIENIVHEKHRLDLDLCEACGPSYKRLPKADTFMPCSGRDEMCWEVLNDEWVGHPV 717

Query: 816  WASEDSGFIAHRKNQYEETLFKIEEERHEYDYYIEANLRTIQLLETIANKISNMTVEEKK 875
            WASEDSGFIAHRKNQYE+TLFKIEEERHEYD+YIEANLRTIQ LETIANKI+NMT EEK 
Sbjct: 718  WASEDSGFIAHRKNQYEDTLFKIEEERHEYDFYIEANLRTIQTLETIANKIANMTPEEKA 777

Query: 876  TFKLPPGLGHTSTTIYKKVIRKVYDKDRGFEIIDALHENPAVSVPIVLRRLKQKDEEWRR 935
            TFKLPPGLGHTS TIYKKVIRKVYDKDRG+EIIDALHE PA++VPIVL+RLKQKDEEWRR
Sbjct: 778  TFKLPPGLGHTSVTIYKKVIRKVYDKDRGYEIIDALHEYPAITVPIVLKRLKQKDEEWRR 837

Query: 936  AQREWNKVWRELEQKVFYKSLDHLGLTFKQADKKLLTAKQLISEISSIKIDQANKRIYPF 995
            AQREWNKVWRELEQKVF+KSLDHLGLTFKQADKKLLTAKQLISEISSIK+DQ NKRI+P 
Sbjct: 838  AQREWNKVWRELEQKVFFKSLDHLGLTFKQADKKLLTAKQLISEISSIKVDQNNKRIHPL 897

Query: 996  TSKPKSQLDFDISDKGVLFDILNLVDTFIDHSTTYSNPDKEKLSAFFRGFLSIFFSIPLT 1055
            T K KSQLD D +D  V +DILNL   F++++ TYS PDKE+L  FF+GF+S+F S P+ 
Sbjct: 898  TPKAKSQLDHDFTDPEVFYDILNLAIVFLENNNTYSAPDKERLKDFFKGFISLFCSYPVP 957

Query: 1056 DLDNP-------------------SEEHKVENGDST--RKRSRDD-DQFFRDLLXXXXXX 1093
             ++                       E + E+GD    +KR+R+D D+  RD+L      
Sbjct: 958  QIEKALAKRDAASSSQSSNSNTETYSEKQQEDGDMKLPKKRNREDSDRLLRDVL------ 1011

Query: 1094 XXXXXXXXXXXXXXXXXXXAAKTSPDLEYEEAVRLDAKKPWLLGNILDEANNHGFVSNRK 1153
                               +A+   D+E EE +R +AK PWLLG+I+DEA+NHG V NRK
Sbjct: 1012 FRNKQQKGGRNSPRGDSSISAEKESDMEEEEIIRQEAKNPWLLGSIVDEADNHGHVENRK 1071

Query: 1154 TYNMFANTNIYVFFRHLTTMYQRLSEAKNINEEVTKEINSRKVVQFAKDLNLASTQLSDM 1213
            T+N+FANTNIYVFFRHL T+Y+RL E K +N+EVTKEI +RKVVQFAKDLNL STQL+DM
Sbjct: 1072 TFNLFANTNIYVFFRHLATIYERLVEVKKMNDEVTKEIANRKVVQFAKDLNLISTQLTDM 1131

Query: 1214 GLDFKGADAYEQLLALCKRLIQSDIEHQWFEESLRQAYKNKAFKIYTVDKVIQSLVKHAH 1273
            GLDFKG DAYE+LL L + LI  D+EHQWFEESLRQAYKNKAFKIYTVDKVIQ+LVKHAH
Sbjct: 1132 GLDFKGEDAYEKLLQLSRSLIAGDLEHQWFEESLRQAYKNKAFKIYTVDKVIQALVKHAH 1191

Query: 1274 SIITDAKTAEIMILFEKDRKAPTTSTREQILYRLQVRSCMGLTENMFRIELNSTSAHVSI 1333
            +IITD KT EIM+LFEKDR + +TST++QILYRLQVRS M   ENMFRIE N  +AHV I
Sbjct: 1192 AIITDNKTVEIMMLFEKDRTSLSTSTKDQILYRLQVRSNMSNIENMFRIEYNRLTAHVCI 1251

Query: 1334 QFVAVDDLTLNQPNSLKDQWQYYLTSYSLSHPTEGVPHEEIKAPFLEK-TLRDDGDSDED 1392
            QFVAVDDLTL +P SLKD+WQYYLTSYSLSHPTEG+ H+ +++PFLEK    ++   ++ 
Sbjct: 1252 QFVAVDDLTLEEPKSLKDKWQYYLTSYSLSHPTEGISHDNLRSPFLEKIIESEEDIIEDK 1311

Query: 1393 SEWYSPGGQSVSQLRIQINPESYALQIEPNSKDLFTRSTVNKHPTKIGEASGRDAKTMQK 1452
             E YSP G + S L+++I+P +Y++++E  S D+F+R  VNK P ++ +   + +  ++ 
Sbjct: 1312 DEKYSPEGVATSNLKVKIDPITYSMEVEFGSHDIFSRKAVNKFPVRV-DIRKKKSSELKL 1370

Query: 1453 SLADMVNSEHGWKKGLQNESIGKAESIINFVKARGFLEK 1491
             L   +NS  GWKK L  + I + E  + FVK  G LE+
Sbjct: 1371 ELERFLNSNSGWKKDLSAKQIAEVEKRLEFVKLNGNLEE 1409

 Score =  183 bits (465), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 94/145 (64%), Positives = 108/145 (74%), Gaps = 3/145 (2%)

Query: 206 FSVASLNNPLPMXXXXXXXXXXXXXXXXXXXGVLPLEHVQD-ASYRPLNFKDALSYLEQV 264
           FS++SL+NPLP                      L     QD +SYRPLN KDALSYLEQV
Sbjct: 116 FSMSSLDNPLPQQEFQEQSQHQQQQHHHHQLDQLQSPAHQDGSSYRPLNVKDALSYLEQV 175

Query: 265 KFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFKGYPVLIQGLNTFLPQGYKIE 324
           KFQFN+RPDVYNHFLDIMKD+KSQAIDT GVIER+STLF+GYP LIQG NTFLPQGY IE
Sbjct: 176 KFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFQGYPTLIQGFNTFLPQGYNIE 235

Query: 325 CTSNPHDPHSIKVTTPFDTTRELSL 349
           C+S+P+DP  IKVTTPF TT E+++
Sbjct: 236 CSSDPNDP--IKVTTPFGTTGEVAI 258

 Score =  113 bits (283), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 53/59 (89%), Positives = 55/59 (93%)

Query: 435 RPNGDVEFSHAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPIHEVYTQVTSLFQN 493
           +  GDVEFSHAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPI+EVY QVT LFQN
Sbjct: 347 KKTGDVEFSHAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQN 405

 Score = 53.1 bits (126), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 41/67 (61%)

Query: 252 LNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFKGYPVLIQ 311
           + F  A+SY+ ++K +F ++PD+Y HFL+I++ Y+ +      V  +++ LF+  P L+ 
Sbjct: 352 VEFSHAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLD 411

Query: 312 GLNTFLP 318
               FLP
Sbjct: 412 DFKKFLP 418

 Score = 42.4 bits (98), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 33/48 (68%)

Query: 445 AISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPIHEVYTQVTSLFQ 492
           A+SY+ ++K +F  +PD+Y HFL+I++ ++ +      V  +V++LFQ
Sbjct: 168 ALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFQ 215

>ZYRO0C07524g Chr3 (569197..574209) [5013 bp, 1670 aa] {ON} similar to
            uniprot|P22579 Saccharomyces cerevisiae YOL004W SIN3 DNA
            binding protein involved in transcriptional regulation
          Length = 1670

 Score = 1175 bits (3039), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 607/1066 (56%), Positives = 747/1066 (70%), Gaps = 97/1066 (9%)

Query: 571  QHQQARA---------------QNLPPLGNFSPPING---RDNEAQVNLPAVQPPALDFP 612
            QHQQA A               QNLPPLG+FSPP NG   RD   + +     PP     
Sbjct: 605  QHQQAAAATGYGYYGENQPVARQNLPPLGSFSPPPNGTAPRDYYQEPSQGMALPPMTHLE 664

Query: 613  PQQQSQSHRH-VVAQGMTNNSLPVSDMRGPVDGG--------FAPQ-------------- 649
             Q    +  H V+ QGM+N+++P+S+MR P  G          APQ              
Sbjct: 665  TQAAKVTPSHYVMTQGMSNDAIPLSNMRSPTVGAPGAQTPVETAPQHPQQYSPQQAPQPQ 724

Query: 650  --------------------PLYS-------QDVQYMEPTSRPEIDLDPSLVPVIPEPIR 682
                                PL         Q+VQY++   RPEIDLDPS+VPV+PEP  
Sbjct: 725  LPQQQLPPQQQEQSLPPQTIPLTQPSQLGPQQEVQYVDIAVRPEIDLDPSIVPVVPEPTE 784

Query: 683  PLENDSTLIEETSFFDKAKKYMGNKQVYTEFLKILNLFSQDLIDTDELVDKVEHYLGGNS 742
            P+E+  +L+EETSFFDKAKK++GNKQ+YTEFLKILNL+SQDL+D D LV+KVEHYLGG+ 
Sbjct: 785  PIEDSLSLVEETSFFDKAKKFIGNKQLYTEFLKILNLYSQDLLDIDGLVEKVEHYLGGSK 844

Query: 743  ELFDWFKSFVNYVERPKHIENVVHEKHRLDLDLCEACCPSYKKLPKADTFMPCCGRDEMC 802
            ELF WFK+FV Y +RPK+IENV+HEKHRLDLD+CEA  PSYKKLPK+DTFMPC GRDEMC
Sbjct: 845  ELFTWFKNFVGYQDRPKNIENVIHEKHRLDLDMCEASGPSYKKLPKSDTFMPCSGRDEMC 904

Query: 803  WEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDYYIEANLRTIQLLETI 862
            WEVLNDEW+GHPVWASEDSGFIAHRKNQYEETLFK+EEERHEYD+YIE+NLRTIQ LETI
Sbjct: 905  WEVLNDEWIGHPVWASEDSGFIAHRKNQYEETLFKVEEERHEYDFYIESNLRTIQTLETI 964

Query: 863  ANKISNMTVEEKKTFKLPPGLGHTSTTIYKKVIRKVYDKDRGFEIIDALHENPAVSVPIV 922
            A+KI+NMT EEK  FKLPPGLGHTS TIYKKVIRKVYDK+RGFEIIDALHE+PAV+VP+V
Sbjct: 965  ASKIANMTEEEKANFKLPPGLGHTSLTIYKKVIRKVYDKERGFEIIDALHEHPAVAVPVV 1024

Query: 923  LRRLKQKDEEWRRAQREWNKVWRELEQKVFYKSLDHLGLTFKQADKKLLTAKQLISEISS 982
            L+RLKQKDEEWRRAQREWNKVWRELEQKV++KSLDHLGLTFKQADKKLLT KQLISEISS
Sbjct: 1025 LKRLKQKDEEWRRAQREWNKVWRELEQKVYFKSLDHLGLTFKQADKKLLTTKQLISEISS 1084

Query: 983  IKIDQANKRIYPFTSKPKSQLDFDISDKGVLFDILNLVDTFIDHSTTYSNPDKEKLSAFF 1042
            IK+DQ NKRI+  T KPKSQLD+D  D+ +  DIL+L + F++H+  YSN DKE+L  F 
Sbjct: 1085 IKVDQTNKRIHWLTPKPKSQLDYDFPDREIFCDILSLTEVFLNHTGNYSNSDKERLKDFL 1144

Query: 1043 RGFLSIFFSIPLTDLDN------PS--EEH---KVENGDSTR--KRSRDDDQFFRDLLXX 1089
            + FLS+FFSIP++++++      PS  EEH   K ENG +    KR R+ +   RD+L  
Sbjct: 1145 KSFLSLFFSIPVSEVNDGLRRRSPSNKEEHEANKKENGTALAHGKRPREIELPLRDILHR 1204

Query: 1090 XXXXXXXXXXXXXXXXXXXXXXXAAKTSPDLEYEEAVRLDAKKPWLLGNILDEANNHGFV 1149
                                     +     E EE ++ +AKKPWLLGNI++EAN  G +
Sbjct: 1205 NKYQKLKLRSDGEEGSIGQSEEGLDEQEEVDEEEEIIKQEAKKPWLLGNIVEEANAQGII 1264

Query: 1150 SNRKTYNMFANTNIYVFFRHLTTMYQRLSEAKNINEEVTKEINSRKVVQFAKDLNLASTQ 1209
            SNRK++N+FANT+IYVFFRHLTT+Y+RL E K+I++EVT+EINSRKV QFAKDLNL S Q
Sbjct: 1265 SNRKSFNLFANTSIYVFFRHLTTLYERLIEVKSIDQEVTQEINSRKVSQFAKDLNLISEQ 1324

Query: 1210 LSDMGLDFKGADAYEQLLALCKRLIQSDIEHQWFEESLRQAYKNKAFKIYTVDKVIQSLV 1269
            L +MGLDF G DAYEQLL L KRLI+ DIEHQWFEESLRQAY N+AFK YTVDKV+Q+LV
Sbjct: 1325 LKNMGLDFAGLDAYEQLLHLSKRLIEGDIEHQWFEESLRQAYNNRAFKFYTVDKVVQALV 1384

Query: 1270 KHAHSIITDAKTAEIMILFEKDRKAPTTSTREQILYRLQVRSCMGLTENMFRIELNSTSA 1329
            KHAH+I+TD K +EIM+LFEKDR   TTS ++QILYR+Q RS M  TENMFRIE N  S 
Sbjct: 1385 KHAHTILTDIKCSEIMVLFEKDRTLATTSAKDQILYRMQARSHMSNTENMFRIEFNRISK 1444

Query: 1330 HVSIQFVAVDDLTLNQPNSLKDQWQYYLTSYSLSHPTEGVPHEEIKAPFLEKTLRDDGDS 1389
            HV IQ++A+DDLTL +  SL+D+W+YY+TSYSLSHPTEG+ HE+++ PFLEK +  + + 
Sbjct: 1445 HVCIQYIAIDDLTLAEAKSLEDKWKYYVTSYSLSHPTEGISHEDLQVPFLEKIIESEQEY 1504

Query: 1390 DEDSEW---YSPGGQSVSQLRIQINPESYALQIEPNSKDLFTRSTVNKHPT-KIGEASGR 1445
            DED+     +SP G S S LRI+I+PE+Y L++EP S D+F+R  VNK P  K  E+   
Sbjct: 1505 DEDNGGDPKFSPEGVSKSSLRIKIDPETYFLEVEPGSCDVFSRKAVNKFPLEKNSESHKT 1564

Query: 1446 DAKTMQKSLADMVNSEHGWKKGLQNESIGKAESIINFVKARGFLE---------KATTVS 1496
                  + +   ++SE GWKK L  +SI   E  +NFVK  G L+         ++TT  
Sbjct: 1565 KVDKKNELIRGYLDSEKGWKKNLDAKSIQSVEEKLNFVKNYGTLQGYRAQENGLESTTKE 1624

Query: 1497 PDPKVEKEHSASNGAIPEGATTEKPGDDTDLR---ADETTAEDIQG 1539
                   E  A + A  +GA    P +   +     ++TTAED++ 
Sbjct: 1625 APFSDAVERKADSAAQADGAANGGPSNTAGVEERGGNDTTAEDVEA 1670

 Score =  168 bits (426), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 77/101 (76%), Positives = 88/101 (87%), Gaps = 2/101 (1%)

Query: 244 VQDASYRPLNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLF 303
           + D  YRPLN KDALSYLEQVKFQFN+RPDVYNHFLDIMKD+KSQAIDT GVIER+STLF
Sbjct: 272 LHDQYYRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLF 331

Query: 304 KGYPVLIQGLNTFLPQGYKIECTSNPHDPHSIKVTTPFDTT 344
           +GYP LIQG NTFLPQGY+I+C+ NP +P  IKVTTP  ++
Sbjct: 332 RGYPNLIQGFNTFLPQGYRIDCSQNPDEP--IKVTTPMGSS 370

 Score =  105 bits (262), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 49/56 (87%), Positives = 51/56 (91%)

Query: 438 GDVEFSHAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPIHEVYTQVTSLFQN 493
            DVEFS AISYVNKIK RF+DQPDIYKHFLEILQTYQREQKPI+EVY QVT LFQN
Sbjct: 518 ADVEFSQAISYVNKIKNRFSDQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQN 573

 Score = 54.3 bits (129), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 42/67 (62%)

Query: 252 LNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFKGYPVLIQ 311
           + F  A+SY+ ++K +F+++PD+Y HFL+I++ Y+ +      V  +++ LF+  P L+ 
Sbjct: 520 VEFSQAISYVNKIKNRFSDQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLD 579

Query: 312 GLNTFLP 318
               FLP
Sbjct: 580 DFKKFLP 586

 Score = 41.2 bits (95), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 33/48 (68%)

Query: 445 AISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPIHEVYTQVTSLFQ 492
           A+SY+ ++K +F  +PD+Y HFL+I++ ++ +      V  +V++LF+
Sbjct: 285 ALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFR 332

>TDEL0G04400 Chr7 (795501..799973) [4473 bp, 1490 aa] {ON} Anc_6.29
            YOL004W
          Length = 1490

 Score = 1165 bits (3013), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 599/1017 (58%), Positives = 728/1017 (71%), Gaps = 74/1017 (7%)

Query: 578  QNLPPLGNFSPPING-------RDNEAQVNLPAVQPPALDFPPQQQSQSH------RHVV 624
            QNLPPLG+FSPP NG       RD          QP  L  PP  Q ++H       H+ 
Sbjct: 485  QNLPPLGSFSPPPNGAVPHNYYRDQ---------QPQTLGLPPVAQVENHIDQRSPPHIA 535

Query: 625  AQGMTNNSLPVSDMRGPVDGG--------FAPQPLYSQ------DVQYMEPTSRPEIDLD 670
             QG+    +PVS++R  +              Q + SQ      D QY++   RPEIDLD
Sbjct: 536  TQGIAGEPMPVSNLRSQITAQSPSELAQLHQQQQIPSQPTANIPDGQYLDIAVRPEIDLD 595

Query: 671  PSLVPVIPEPIRPLENDSTLIEETSFFDKAKKYMGNKQVYTEFLKILNLFSQDLIDTDEL 730
            PS+VPV+PEP  P+E+  TL+EETSFFD+AKK++GNKQ+YTEFLKILNLFSQDL+D DEL
Sbjct: 596  PSIVPVVPEPTAPIEDSLTLVEETSFFDRAKKFIGNKQIYTEFLKILNLFSQDLLDVDEL 655

Query: 731  VDKVEHYLGGNSELFDWFKSFVNYVERPKHIENVVHEKHRLDLDLCEACCPSYKKLPKAD 790
            V +VEHYLGGN ELF WFK+FV + ++PKHIEN+VHEKHRLDLDLCEAC PSYKKLPK+D
Sbjct: 656  VGRVEHYLGGNKELFVWFKNFVGFQDKPKHIENIVHEKHRLDLDLCEACGPSYKKLPKSD 715

Query: 791  TFMPCCGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDYYIE 850
            TFMPC GRDEMCW VLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYD+YIE
Sbjct: 716  TFMPCSGRDEMCWAVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIE 775

Query: 851  ANLRTIQLLETIANKISNMTVEEKKTFKLPPGLGHTSTTIYKKVIRKVYDKDRGFEIIDA 910
            +NLRTIQ LETIA+KI+NM+ EEK TFKLPPGLGHTS TIYKKVIRKVYDK+RGFEIIDA
Sbjct: 776  SNLRTIQTLETIASKIANMSEEEKATFKLPPGLGHTSLTIYKKVIRKVYDKERGFEIIDA 835

Query: 911  LHENPAVSVPIVLRRLKQKDEEWRRAQREWNKVWRELEQKVFYKSLDHLGLTFKQADKKL 970
            LHE PA++VP+VL+RLKQKDEEWRRAQREWNKVWRELEQKV+YKSLDHLGLTFKQADKKL
Sbjct: 836  LHEYPAIAVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKKL 895

Query: 971  LTAKQLISEISSIKIDQANKRIYPFTSKPKSQLDFDISDKGVLFDILNLVDTFIDHSTTY 1030
            LT KQLISEI SIK DQ NKR++  T KPK QLD+ + DK V FDIL+L DTFI+H+++Y
Sbjct: 896  LTTKQLISEIGSIKTDQTNKRMHWLTPKPKDQLDYYVPDKSVFFDILSLTDTFINHNSSY 955

Query: 1031 SNPDKEKLSAFFRGFLSIFFSIPL----------TDLDNPSEE--HKVENGD-STRKRSR 1077
            SNPDK +L   F+ F+S+FFSIP+           +LD+  E+   K+E+ + +  KR R
Sbjct: 956  SNPDKIRLKDLFKIFVSLFFSIPMYEVNEAVSRRGNLDDDKEDSTQKMESDNLNNSKRPR 1015

Query: 1078 DDDQFFRDLLXXXXXXXXXXXXXXXXXXXXXXXXXAAKTSPDLEYEEAVRLDAKKPWLLG 1137
            +D+    ++L                                   EE +R +AKKPWLLG
Sbjct: 1016 EDEISLSEVLHRAKNQRFKSRAADETSEESAAEPEPELNE----EEETIRQEAKKPWLLG 1071

Query: 1138 NILDEANNHGFVSNRKTYNMFANTNIYVFFRHLTTMYQRLSEAKNINEEVTKEINSRKVV 1197
            N+++E N  G ++NRKT+NMFANTNIYVFFRHLTT+Y+RL E K +N+ VTKEINSRKVV
Sbjct: 1072 NLVEEVNAQGLINNRKTFNMFANTNIYVFFRHLTTLYERLEEVKKMNDAVTKEINSRKVV 1131

Query: 1198 QFAKDLNLASTQLSDMGLDFKGADAYEQLLALCKRLIQSDIEHQWFEESLRQAYKNKAFK 1257
            QFAKDLNL S QL +MGLDF+GADAYEQL  LCKRLI+ DIEHQWFEESLRQAY NKAFK
Sbjct: 1132 QFAKDLNLISQQLKEMGLDFEGADAYEQLRHLCKRLIEGDIEHQWFEESLRQAYNNKAFK 1191

Query: 1258 IYTVDKVIQSLVKHAHSIITDAKTAEIMILFEKDRKAPTTSTREQILYRLQVRSCMGLTE 1317
            +YTVDKVIQSLVKHAH+I+TD+KT+EIM  FEKDR    TS ++QILYRLQVRS M  TE
Sbjct: 1192 LYTVDKVIQSLVKHAHTILTDSKTSEIMTSFEKDRTQINTSAKDQILYRLQVRSYMSSTE 1251

Query: 1318 NMFRIELNSTSAHVSIQFVAVDDLTLNQPNSLKDQWQYYLTSYSLSHPTEGVPHEEIKAP 1377
            NMFRIE N  S +V IQF+AVDDLTL +P SL+++W+YY+TSYSLSHPTEG+  EE++ P
Sbjct: 1252 NMFRIEYNKQSKNVRIQFIAVDDLTLAEPRSLEEKWRYYVTSYSLSHPTEGISQEELQLP 1311

Query: 1378 FLEKTLRDDGD--SDEDS---EWYSPGGQSVSQLRIQINPESYALQIEPNSKDLFTRSTV 1432
            FLEK L  + D  SD D+   + +SP G S S L+I+I+PE+Y L IE  S D+F+R +V
Sbjct: 1312 FLEKVLETEEDYGSDVDNFSIDKFSPEGVSKSTLKIKIDPETYLLDIEAGSYDVFSRKSV 1371

Query: 1433 NKHPTKIGEASGRDAKTMQKSLA-DMVNSEHGWKKGLQNESIGKAESIINFVKARGFL-- 1489
            N+ P  +        K  +K++    + S+ GWKK L ++ +   +  +  VK  G L  
Sbjct: 1372 NRFPVIVDSNDYTTKKEKKKNMVIQFLESKKGWKKNLDDDQVKAIQEKLARVKENGSLDD 1431

Query: 1490 -------EKATTVSPDPKVEKEHSAS----NGAIPEGATTEKPGDDTDLRADETTAE 1535
                   ++A+ +    KVE+   ++    N    E    E  G+DT   ADE   E
Sbjct: 1432 FNEASQTQQASEIIAPSKVEQSKESTVADVNSLPKELVEAEDRGNDT--TADEVDPE 1486

 Score =  170 bits (431), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 95/120 (79%), Gaps = 6/120 (5%)

Query: 246 DASYRPLNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFKG 305
           DA YRPLN KDALSYLEQVK+QFN+RPDVYNHFLDIMKD+KSQAIDT GVI+R+STLFKG
Sbjct: 188 DAYYRPLNVKDALSYLEQVKYQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIDRVSTLFKG 247

Query: 306 YPVLIQGLNTFLPQGYKIECTSNPHDPHSIKVTTPFDTTRELSLDHNTGGSAVGGHLAGP 365
           YP LIQG NTFLPQGY+IEC++NP +P  I+VTTP  ++       N    AV G  A P
Sbjct: 248 YPGLIQGFNTFLPQGYRIECSANPDEP--IRVTTPMGSSSVAGTIEN----AVAGFPAQP 301

 Score =  103 bits (257), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 48/59 (81%), Positives = 52/59 (88%)

Query: 435 RPNGDVEFSHAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPIHEVYTQVTSLFQN 493
           +   DVEFS AI+YVNKIK RFA+QPDIYKHFLEILQTYQREQKPI+EVY QVT LFQN
Sbjct: 375 KKTADVEFSQAINYVNKIKNRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQN 433

 Score = 51.2 bits (121), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 40/67 (59%)

Query: 252 LNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFKGYPVLIQ 311
           + F  A++Y+ ++K +F  +PD+Y HFL+I++ Y+ +      V  +++ LF+  P L+ 
Sbjct: 380 VEFSQAINYVNKIKNRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLD 439

Query: 312 GLNTFLP 318
               FLP
Sbjct: 440 DFKKFLP 446

 Score = 40.8 bits (94), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 33/48 (68%)

Query: 445 AISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPIHEVYTQVTSLFQ 492
           A+SY+ ++K +F  +PD+Y HFL+I++ ++ +      V  +V++LF+
Sbjct: 199 ALSYLEQVKYQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIDRVSTLFK 246

>KLLA0C06182g Chr3 (544281..548840) [4560 bp, 1519 aa] {ON} similar to
            uniprot|Q75CF0 Ashbya gossypii ACL004W ACL004Wp and
            weakly similar to YOL004W uniprot|P22579 Saccharomyces
            cerevisiae YOL004W SIN3 DNA binding protein involved in
            transcriptional regulation
          Length = 1519

 Score = 1152 bits (2981), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 583/973 (59%), Positives = 711/973 (73%), Gaps = 59/973 (6%)

Query: 579  NLPPLGNFSPPINGRDNEAQVNLPAVQPPALDFPPQQQSQSH---RHVVAQGMTNNSLPV 635
            NLPPLGNFS        E    LP++         Q  +  H   +HVV QGM+N  +PV
Sbjct: 572  NLPPLGNFSASGQASPAENSHMLPSMH--------QHIAGGHVIPQHVVTQGMSNQDIPV 623

Query: 636  SDMRGPVDGGFA-----------PQPLYSQDVQYME-PTSRPEIDLDPSLVPVIPEPIRP 683
            S+MR  ++G +            PQPL  + VQYME P +RPEIDLDPSLVPV+PEPI+P
Sbjct: 624  SEMRSTMNGTYNQVEYIQGAPGYPQPL--EGVQYMEAPMARPEIDLDPSLVPVVPEPIQP 681

Query: 684  LENDSTLIEETSFFDKAKKYMGNKQVYTEFLKILNLFSQDLIDTDELVDKVEHYLGGNSE 743
             E+   L +E +FF++ K+++GNKQVY EFLKILNL+SQDL+ T ELV KVE YL  + E
Sbjct: 682  PEDAIALGDEVTFFERVKRFIGNKQVYAEFLKILNLYSQDLLTTSELVSKVEFYLHSSKE 741

Query: 744  LFDWFKSFVNYVERPKHIENVVHEKHRLDLDLCEACCPSYKKLPKADTFMPCCGRDEMCW 803
            LFDWFKSFV Y E+PKHIEN+VHEKHRLDLDLCEAC PSYKKLPK DTFMPC GRDEMCW
Sbjct: 742  LFDWFKSFVGYQEKPKHIENIVHEKHRLDLDLCEACGPSYKKLPKDDTFMPCSGRDEMCW 801

Query: 804  EVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDYYIEANLRTIQLLETIA 863
            EVLNDEWVGHPVWASEDSGFIAHRKNQYE+TLFK+EEERHEYD+YIE+NLRTIQ LETIA
Sbjct: 802  EVLNDEWVGHPVWASEDSGFIAHRKNQYEDTLFKVEEERHEYDFYIESNLRTIQTLETIA 861

Query: 864  NKISNMTVEEKKTFKLPPGLGHTSTTIYKKVIRKVYDKDRGFEIIDALHENPAVSVPIVL 923
            NKI+NMT EEK  FKLPPGLGHTS TIYKKV+RKVYDKDRGFEIIDALHE+PAV+VPIVL
Sbjct: 862  NKIANMTNEEKNNFKLPPGLGHTSLTIYKKVVRKVYDKDRGFEIIDALHEHPAVTVPIVL 921

Query: 924  RRLKQKDEEWRRAQREWNKVWRELEQKVFYKSLDHLGLTFKQADKKLLTAKQLISEISSI 983
            +RLKQKDEEWRRAQREWNKVWRELEQKV+YKSLDHLGLTFKQADKKLLT KQL+SEISSI
Sbjct: 922  KRLKQKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQLLSEISSI 981

Query: 984  KIDQANKRIYPFTSKPKSQLDFDISDKGVLFDILNLVDTFIDHSTTYSNPDKEKLSAFFR 1043
            K+DQ NKRI+P T KPKSQLDF+I+D+ VL+DIL+LV TF+  + +YSN DK KL  FF+
Sbjct: 982  KVDQTNKRIHPLTPKPKSQLDFEINDREVLYDILDLVFTFVKTNASYSNSDKIKLDHFFK 1041

Query: 1044 GFLSIFFSIP-------------LTDLDNPSEEHKVENGDSTRKR--SRDDDQFFRDLLX 1088
             F+S+FFS P             +TD +N  E+    + + + KR  S +D    +D+L 
Sbjct: 1042 AFISLFFSYPIKDVNEAVSERSSITDQENGEEDSNKSDSEKSNKRTLSDEDSYLMKDIL- 1100

Query: 1089 XXXXXXXXXXXXXXXXXXXXXXXXAAKTSPDLEYEEAVRLDAKKPWLLGNILDEANNHGF 1148
                                    + K++ + E E   + +A KPWLLG+++DEANN G 
Sbjct: 1101 ------RRTKNAKTSNSEENQNSSSVKSNEEDETELLAK-EAAKPWLLGSLIDEANNSGI 1153

Query: 1149 VSNRKTYNMFANTNIYVFFRHLTTMYQRLSEAKNINEEVTKEINSRKVVQFAKDLNLAST 1208
            VS+R  +N+F NT IYVFFRHL T+Y+RL E K I+ EVT EI +RK+VQFA DLNL ST
Sbjct: 1154 VSDRHIFNLFTNTTIYVFFRHLNTLYERLLEVKKIDAEVTDEIKNRKIVQFASDLNLIST 1213

Query: 1209 QLSDMGLDFKGADAYEQLLALCKRLIQSDIEHQWFEESLRQAYKNKAFKIYTVDKVIQSL 1268
            QL+DMGL FK   AY +LL L KRLI  D++HQWFEESLRQAYKNKAFKIYT+DKV+QSL
Sbjct: 1214 QLADMGLAFKDTKAYGELLRLSKRLITGDLDHQWFEESLRQAYKNKAFKIYTIDKVVQSL 1273

Query: 1269 VKHAHSIITDAKTAEIMILFEKDRKAPTTSTREQILYRLQVRSCMGLTENMFRIELNSTS 1328
            VKHAHSIITD K A +M+LFE+DR    T+ ++QILYRL+VR+ MG +ENMFRIE N+ S
Sbjct: 1274 VKHAHSIITDPKNAMVMVLFEQDRLKRDTTAKDQILYRLKVRNTMGESENMFRIEYNTDS 1333

Query: 1329 AHVSIQFVAVDDLTLNQPNSLKDQWQYYLTSYSLSHPTEGVPHEEIKAPFLEKTLRDDG- 1387
            +HVSIQ+VAVDDLTL +P ++K++W YY+TSYSLSHPTEG+  E+I  PFL K +  +  
Sbjct: 1334 SHVSIQYVAVDDLTLKEPQNMKEKWDYYVTSYSLSHPTEGITQEDISQPFLGKIIEKEAE 1393

Query: 1388 --DSDEDSEWYSPGGQSVSQLRIQINPESYALQIEPNSKDLFTRSTVNKHPTKIGEASGR 1445
              D +E ++ +SP G S S+L++ I+PE+Y L  E  S D+FTR +VNK P+     S +
Sbjct: 1394 YLDDEEQNDKFSPEGVSQSKLKVNIHPETYELTFECGSTDVFTRKSVNKFPSS---QSTQ 1450

Query: 1446 DAKTMQKSLADMVNSEHGWKKGLQNESIGKAESIINFVKARGFLEKATTVSPDPKVEKEH 1505
             A  M K L    NS  GWKK L  E IG+AES +  +K +G LE   T++   K+E+ +
Sbjct: 1451 PASKMDKFL----NSSKGWKKNLSTEIIGRAESKMKILKEQGKLEIDQTLTITAKIEEPN 1506

Query: 1506 S-ASNGAIPEGAT 1517
               S   +PE A 
Sbjct: 1507 EPISKEDVPEKAV 1519

 Score =  180 bits (456), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 84/112 (75%), Positives = 98/112 (87%), Gaps = 2/112 (1%)

Query: 237 GVLPLEHVQDASYRPLNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVI 296
           G  PL+  Q +SYRPLN KDALSYLEQVKFQF++RPDVYNHFLDIMKD+KSQAIDT GVI
Sbjct: 189 GQDPLQQAQYSSYRPLNVKDALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVI 248

Query: 297 ERISTLFKGYPVLIQGLNTFLPQGYKIECTSNPHDPHSIKVTTPFDTTRELS 348
           +R++TLF+G+P LIQG NTFLP GYKIEC++NP+DP  IKVTTPF TT E+S
Sbjct: 249 QRVTTLFQGFPNLIQGFNTFLPHGYKIECSTNPNDP--IKVTTPFGTTGEVS 298

 Score =  111 bits (278), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 52/56 (92%), Positives = 53/56 (94%)

Query: 438 GDVEFSHAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPIHEVYTQVTSLFQN 493
           G+VEFSHAISYVNKIKTRFADQPDIYK FLEILQTYQREQKPIHEVY QVT LFQN
Sbjct: 423 GEVEFSHAISYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQN 478

 Score = 49.7 bits (117), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 40/67 (59%)

Query: 252 LNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFKGYPVLIQ 311
           + F  A+SY+ ++K +F ++PD+Y  FL+I++ Y+ +      V  +++ LF+  P L+ 
Sbjct: 425 VEFSHAISYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQNNPDLLD 484

Query: 312 GLNTFLP 318
               FLP
Sbjct: 485 DFKKFLP 491

 Score = 46.6 bits (109), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 40/62 (64%), Gaps = 3/62 (4%)

Query: 431 YATNRPNGDVEFSHAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPIHEVYTQVTSL 490
           Y++ RP   +    A+SY+ ++K +F+ +PD+Y HFL+I++ ++ +      V  +VT+L
Sbjct: 198 YSSYRP---LNVKDALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIQRVTTL 254

Query: 491 FQ 492
           FQ
Sbjct: 255 FQ 256

>Kpol_1037.22 s1037 (46639..51129) [4491 bp, 1496 aa] {ON}
            (46639..51129) [4491 nt, 1497 aa]
          Length = 1496

 Score = 1142 bits (2955), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 566/1027 (55%), Positives = 734/1027 (71%), Gaps = 71/1027 (6%)

Query: 578  QNLPPLGNFSPPINGR--------DNEAQVNLPAVQPPALDFPPQQQSQSHRHVVAQGMT 629
            QNLPPLGNFSPP NG           EAQ ++ A+  P++   P + +Q H       MT
Sbjct: 471  QNLPPLGNFSPPSNGAVPGRPEEFSTEAQHHMMAL--PSMLQAPTEHAQLHAQQHIAPMT 528

Query: 630  NNSLPVSDMRGPVDGG-----FAPQPLYS----------------------QDVQYMEPT 662
            N ++P+SD+R  +        + P  L                        +     E  
Sbjct: 529  NEAIPISDLRSQIIDNNHVHNYTPIELAQLQQQQQQQQQQQQQQQQQQMQLEAAYATEGI 588

Query: 663  SRPEIDLDPSLVPVIPEPIRPLENDSTLIEETSFFDKAKKYMGNKQVYTEFLKILNLFSQ 722
             RPEIDLDPS+VPVIPEP  P+E   +L+EE +FFDKAKK++GNKQVY EFLKILNL+SQ
Sbjct: 589  VRPEIDLDPSIVPVIPEPTEPIEESLSLVEEANFFDKAKKFIGNKQVYVEFLKILNLYSQ 648

Query: 723  DLIDTDELVDKVEHYLGGNSELFDWFKSFVNYVERPKHIENVVHEKHRLDLDLCEACCPS 782
            D++  D+L++KV++YLG N ELFDWFK+FV + ++PKHIENVVHEKH+LDLDLCEAC PS
Sbjct: 649  DILSLDDLIEKVDYYLGSNKELFDWFKNFVGFQDKPKHIENVVHEKHKLDLDLCEACGPS 708

Query: 783  YKKLPKADTFMPCCGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEER 842
            YKKLPK DTFMPC GRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEER
Sbjct: 709  YKKLPKTDTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEER 768

Query: 843  HEYDYYIEANLRTIQLLETIANKISNMTVEEKKTFKLPPGLGHTSTTIYKKVIRKVYDKD 902
            HEYD+YIE+NLRTIQ LETIA+KI+NMT EEK+ FKLP GLGHTSTTIY+KVIRKVYDK+
Sbjct: 769  HEYDFYIESNLRTIQTLETIASKIANMTEEEKQAFKLPIGLGHTSTTIYQKVIRKVYDKE 828

Query: 903  RGFEIIDALHENPAVSVPIVLRRLKQKDEEWRRAQREWNKVWRELEQKVFYKSLDHLGLT 962
            RGFEIIDALHE P+V+VP+VL+RLKQKD+EWRRAQREWNKVWRELEQKVF+KSLDHLGLT
Sbjct: 829  RGFEIIDALHEYPSVAVPVVLKRLKQKDKEWRRAQREWNKVWRELEQKVFFKSLDHLGLT 888

Query: 963  FKQADKKLLTAKQLISEISSIKIDQANKRIYPFTSKPKSQLDFDISDKGVLFDILNLVDT 1022
            FKQ+DKKLLT KQL++EISSIK+DQ NKRI+  T KPKSQLD+++ DK VLFDIL L D 
Sbjct: 889  FKQSDKKLLTTKQLLAEISSIKVDQTNKRIHWLTPKPKSQLDYEVKDKRVLFDILRLADV 948

Query: 1023 FIDHSTTYSNPDKEKLSAFFRGFLSIFFSIPLTDLDNPSEEHKVENG------------D 1070
            FI+H+++YSNPDKE+L  F + ++ +FFSIP+ ++ + + E  ++NG             
Sbjct: 949  FINHTSSYSNPDKERLRDFLQSYIGLFFSIPIREIKD-AVEAAIDNGKQLDENEQNSSKK 1007

Query: 1071 STRKRSRDDDQFFRDLLXXXXXXXXXXXXXXXXXXXXXXXXXAAKTSPDLEYEEAVRLDA 1130
            ++ KR RD +    D+L                           +     + +E +R +A
Sbjct: 1008 NSNKRPRDVEICLSDILNRSRYQRLKHSLDSSEASLGAVSPGQNEQD---DMDEMIRQEA 1064

Query: 1131 KKPWLLGNILDEANNHGFVSNRKTYNMFANTNIYVFFRHLTTMYQRLSEAKNINEEVTKE 1190
            KKPWLLG++++EAN+ G + NRK YNMFAN N+YVF R+L T+Y RL E K+IN+ VTKE
Sbjct: 1065 KKPWLLGSLVEEANSQGLIQNRKIYNMFANVNMYVFMRNLITIYDRLHEVKDINDVVTKE 1124

Query: 1191 INSRKVVQFAKDLNLASTQLSDMGLDFKGADAYEQLLALCKRLIQSDIEHQWFEESLRQA 1250
            IN RKVVQFAKDLNL S QL +MGLDF G D+Y QLL L KRLI+ D+EHQWFEESLRQA
Sbjct: 1125 INGRKVVQFAKDLNLISAQLKNMGLDFSGGDSYTQLLLLSKRLIEGDLEHQWFEESLRQA 1184

Query: 1251 YKNKAFKIYTVDKVIQSLVKHAHSIITDAKTAEIMILFEKDRKAPTTSTREQILYRLQVR 1310
            Y+N+AFK+YT+DKVIQSLVKHAH+I+TD+K++++M LFEKDR + +T++++QILYRLQ R
Sbjct: 1185 YRNRAFKLYTIDKVIQSLVKHAHAIMTDSKSSDVMALFEKDRISSSTTSKDQILYRLQTR 1244

Query: 1311 SCMGLTENMFRIELNSTSAHVSIQFVAVDDLTLNQPNSLKDQWQYYLTSYSLSHPTEGVP 1370
            S M  TE+MFRIE N+  + +SIQ++A+DDLTL +P +L+D+W+YY+TSYSLSHPTEG+P
Sbjct: 1245 SHMSTTEHMFRIEYNTKKSSISIQYIALDDLTLEEPKTLEDKWKYYITSYSLSHPTEGIP 1304

Query: 1371 HEEIKAPFLEKTLRDDG---DSDEDSEWYSPGGQSVSQLRIQINPESYALQIEPNSKDLF 1427
             EEIK PFL+K +  +    + ++D+  YSP G S S L I+I+PE+Y L++EP S D+F
Sbjct: 1305 QEEIKIPFLDKVIESEQVHMEDEDDNPKYSPEGVSKSNLMIKIDPETYRLEVEPGSFDIF 1364

Query: 1428 TRSTVNKHPTKI-GEASGRDAKTMQKSLADMVNSEHGWKKGLQNESIGKAESIINFVKAR 1486
            +R +VNK P  +  E+     +T +    + +N +HGWK+ L +++I K E   N +K  
Sbjct: 1365 SRKSVNKFPVDVFSESYKVKKQTRRNRCKNFLNGKHGWKRQLSSDAISKIEQKFNDLKNG 1424

Query: 1487 GFLEKA------TTVSP----DPKVEKEHSASNGAIPEGATTEKPGD----DTDLRADET 1532
             F +++      TT  P    D   +++ S       + A  + P +    D + R ++T
Sbjct: 1425 TFQQRSRSATSETTSVPLNASDSTQKEQESTGTSETSQPALQKVPINSAEPDQEERGNDT 1484

Query: 1533 TAEDIQG 1539
            T E+++ 
Sbjct: 1485 TTEEVES 1491

 Score =  165 bits (418), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 94/136 (69%), Gaps = 10/136 (7%)

Query: 206 FSVASLNNPLPMXXXXXXXXXXXXXXXXXXXGVLPLEHVQDASYRPLNFKDALSYLEQVK 265
            SVAS +NPLP                         +    + YRPLN KDAL+YLEQVK
Sbjct: 86  LSVASFDNPLPPAPAAHLQQQQQQQQQQ--------QQADGSYYRPLNVKDALTYLEQVK 137

Query: 266 FQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFKGYPVLIQGLNTFLPQGYKIEC 325
            QFN+RPD+YNHFLDIMKD+KSQ+IDT GVIER+STLF+GYP LIQG NTFLPQGY IEC
Sbjct: 138 LQFNSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPNLIQGFNTFLPQGYTIEC 197

Query: 326 TSNPHDPHSIKVTTPF 341
           +SNP DP  IKVTTP 
Sbjct: 198 SSNPDDP--IKVTTPL 211

 Score =  105 bits (263), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 49/56 (87%), Positives = 50/56 (89%)

Query: 438 GDVEFSHAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPIHEVYTQVTSLFQN 493
            DVEFS A+SYVNKIK RFADQPDIYKHFLEILQTYQREQKPI EVY QVT LFQN
Sbjct: 359 ADVEFSQAVSYVNKIKNRFADQPDIYKHFLEILQTYQREQKPISEVYAQVTVLFQN 414

 Score = 53.1 bits (126), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 41/67 (61%)

Query: 252 LNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFKGYPVLIQ 311
           + F  A+SY+ ++K +F ++PD+Y HFL+I++ Y+ +      V  +++ LF+  P L+ 
Sbjct: 361 VEFSQAVSYVNKIKNRFADQPDIYKHFLEILQTYQREQKPISEVYAQVTVLFQNAPDLLD 420

Query: 312 GLNTFLP 318
               FLP
Sbjct: 421 DFKKFLP 427

 Score = 41.2 bits (95), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 33/48 (68%)

Query: 445 AISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPIHEVYTQVTSLFQ 492
           A++Y+ ++K +F  +PDIY HFL+I++ ++ +      V  +V++LF+
Sbjct: 129 ALTYLEQVKLQFNSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFR 176

>NCAS0D02130 Chr4 (394326..398630) [4305 bp, 1434 aa] {ON} Anc_6.29
            YOL004W
          Length = 1434

 Score = 1113 bits (2879), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 567/981 (57%), Positives = 699/981 (71%), Gaps = 57/981 (5%)

Query: 563  FNHPASFYQHQQARAQNLPPLGNFSPPINGRDNEAQVNLPAVQPPAL-DFPPQQQSQSHR 621
            + +P ++Y +     QNLPP+G+F+PP      E       V P  L    P  Q+   +
Sbjct: 457  YGYPNNYYPNGTGTQQNLPPIGSFAPPNGTASREYAPGNQFVGPGGLPSMIPNDQALQQQ 516

Query: 622  HV--VAQGMTNNSLPVSDMRGPVDGGFAPQPLYSQDV-----------------QYM-EP 661
                +  G TN ++PVS++R P+     P  L  Q+                  QY  E 
Sbjct: 517  QQPGLVHGYTNEAIPVSNLRSPLTDQQYPNLLNMQNQMTPGQMDINNATAPMAQQYTNEA 576

Query: 662  TSRPEIDLDPSLVPVIPEPIRPLENDSTLIEETSFFDKAKKYMGNKQVYTEFLKILNLFS 721
              RPEIDLDPS+VPVIPEP  PLE + +L+EET+FF+KAKK++G KQVYTEFLKILNL+S
Sbjct: 577  PIRPEIDLDPSIVPVIPEPTEPLEYNVSLVEETNFFEKAKKFIGTKQVYTEFLKILNLYS 636

Query: 722  QDLIDTDELVDKVEHYLGGNSELFDWFKSFVNYVERPKHIENVVHEKHRLDLDLCEACCP 781
            QDL+ TDEL  KVE+YLG N ELF WFK+FV + E+P  IEN+VHEKH+LDLDLCEAC P
Sbjct: 637  QDLLTTDELCVKVEYYLGSNEELFTWFKNFVGFQEKPLIIENIVHEKHKLDLDLCEACGP 696

Query: 782  SYKKLPKADTFMPCCGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEE 841
            SYKKLPK DTFMPC GRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEE+LFK EEE
Sbjct: 697  SYKKLPKTDTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEESLFKTEEE 756

Query: 842  RHEYDYYIEANLRTIQLLETIANKISNMTVEEKKTFKLPPGLGHTSTTIYKKVIRKVYDK 901
            RHEYD+ IE+NLRTIQ LETIANKI NMT EEKK FKLPPGLGHTS+TIYKKVIRKVYDK
Sbjct: 757  RHEYDFCIESNLRTIQTLETIANKIGNMTNEEKKNFKLPPGLGHTSSTIYKKVIRKVYDK 816

Query: 902  DRGFEIIDALHENPAVSVPIVLRRLKQKDEEWRRAQREWNKVWRELEQKVFYKSLDHLGL 961
            DRGFEIID LHE PA++VP+VL+RLKQKDEEWRRAQREWNKVWRELEQKV+YKSLDHLGL
Sbjct: 817  DRGFEIIDLLHEEPALTVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGL 876

Query: 962  TFKQADKKLLTAKQLISEISSIKIDQANKRIYPFTSKPKSQLDFDISDKGVLFDILNLVD 1021
            TFKQADKKLLT KQL+SEISSIK+DQ NKRI+  T KPKSQL+F   D  +  DIL L  
Sbjct: 877  TFKQADKKLLTTKQLLSEISSIKVDQTNKRIHWLTPKPKSQLEFQFDDNDIFVDILGLTS 936

Query: 1022 TFIDHSTTYSNPDKEKLSAFFRGFLSIFFSIP-------LTDLDNPSEEHKVENGDSTR- 1073
             FI+HS+TYSNP+KE++  F R F+S+FFSIP       L+D  +  +E + +  +S+R 
Sbjct: 937  VFINHSSTYSNPEKERMKDFLRVFVSLFFSIPLDKVNEALSDRSHWLQEKEKKTKESSRN 996

Query: 1074 ---------------KRSRDDDQFFRDLLXXXXXXXXXXXXXXXXXXXXXX---XXXAAK 1115
                           KR  + D    D+L                               
Sbjct: 997  IDSTTSSSSSGSNSKKRPLNIDIPLADILRKHKYQKIRKQAKESNEENAQEEDDENIVGD 1056

Query: 1116 TSPDLEYE---EAVRLDAKKPWLLGNILDEANNHGFVSNRKTYNMFANTNIYVFFRHLTT 1172
            ++ +L  +   E +  + K+PWLLGNI++ A+NHG +SNRK +NMFANTNIYVFFR  T 
Sbjct: 1057 SNEELNEQDENEIILEEIKRPWLLGNIIETASNHGTISNRKVFNMFANTNIYVFFRLWTV 1116

Query: 1173 MYQRLSEAKNINEEVTKEINSRKVVQFAKDLNLASTQLSDMGLDFKGADAYEQLLALCKR 1232
            +Y+RL E K INE+VTKE+NSR++ QFAKDLNL STQL DMGLDF G ++Y++LL L KR
Sbjct: 1117 IYERLYEMKQINEKVTKEVNSRRISQFAKDLNLISTQLKDMGLDFVGVNSYQELLVLSKR 1176

Query: 1233 LIQSDIEHQWFEESLRQAYKNKAFKIYTVDKVIQSLVKHAHSIITDAKTAEIMILFEKDR 1292
            LIQ+DIEHQWFEESLRQA+ NKAFK+YTVDKVIQSLVKHAH+I+ D KT+EIM+LFEKDR
Sbjct: 1177 LIQNDIEHQWFEESLRQAFNNKAFKLYTVDKVIQSLVKHAHTILGDVKTSEIMVLFEKDR 1236

Query: 1293 KAPTTSTREQILYRLQVRSCMGLTENMFRIELNSTSAHVSIQFVAVDDLTLNQPNSLKDQ 1352
               +TS +EQILYRLQ R+ M  TENMFRIE N    HV IQ++A++DLT+ QP S++  
Sbjct: 1237 LCSSTSAKEQILYRLQTRAHMTNTENMFRIEFNEEKNHVCIQYIALEDLTIKQPKSMEKN 1296

Query: 1353 WQYYLTSYSLSHPTEGVPHEEIKAPFLEKTLRDDGDSDEDSEWYSPGGQSVSQLRIQINP 1412
            W+YY+TSYSL HPTEGVP +E+K PFLEKTL  + D + D++  SP G S S+L+I+I+P
Sbjct: 1297 WEYYVTSYSLPHPTEGVPQDELKIPFLEKTLELEVDEEGDNK-SSPEGVSSSKLKIKIDP 1355

Query: 1413 ESYALQIEPNSKDLFTRSTVNKHPTKIGEASGRDAKTMQKSLADMVNSEHGWKKGLQNES 1472
            +SYAL+IEP S DLF+R ++N +PT   E   R  K++ + +   ++ ++GWKK L   +
Sbjct: 1356 KSYALEIEPGSFDLFSRKSMNVYPTYSDETKKR--KSIDQ-MTKFLDGKNGWKKNL---T 1409

Query: 1473 IGKAESIINFVKARGFLEKAT 1493
               + +I + VK    L KAT
Sbjct: 1410 TADSTNIEDLVKKSRELSKAT 1430

 Score =  243 bits (620), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 134/248 (54%), Positives = 164/248 (66%), Gaps = 40/248 (16%)

Query: 245 QDASYRPLNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFK 304
           QD +YRPLN KDALSYLEQVK+QF+ RPD+YN FLDIMKD+KSQ+IDT GVIER+S LF+
Sbjct: 203 QDLAYRPLNVKDALSYLEQVKYQFSQRPDIYNQFLDIMKDFKSQSIDTPGVIERVSALFR 262

Query: 305 GYPVLIQGLNTFLPQGYKIECTSNPHDPHSIKVTTPFDTTRELSLDHNTGGSAVGGHLAG 364
           GYP+L+QG NTFLPQGY+IECT++P  P  I+VTTP             G S + G   G
Sbjct: 263 GYPMLVQGFNTFLPQGYRIECTTDPDGP--IRVTTPM------------GTSTLSG---G 305

Query: 365 PATVSTSPSQIPRQETAVSETKQEETPVDLPASAAFAQDQVHHAESDTQREIXXXXXXXX 424
           PA  + S S     E+ + + +  ++P  +P+ AA         ES+ Q+          
Sbjct: 306 PAMEAPSSS-----ESNLQQQQHHQSPT-IPSLAAST-----FQESNFQQTPQPEDQSAK 354

Query: 425 XXXXXXYATNRPNGDVEFSHAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPIHEVY 484
                       N +VEFS AI+YVNKIK RFADQPDIYK FLEILQTYQREQKPI+EVY
Sbjct: 355 ------------NAEVEFSQAINYVNKIKNRFADQPDIYKRFLEILQTYQREQKPINEVY 402

Query: 485 TQVTSLFQ 492
           +QVT LFQ
Sbjct: 403 SQVTVLFQ 410

 Score = 51.2 bits (121), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 45/83 (54%)

Query: 245 QDASYRPLNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFK 304
           Q A    + F  A++Y+ ++K +F ++PD+Y  FL+I++ Y+ +      V  +++ LF+
Sbjct: 351 QSAKNAEVEFSQAINYVNKIKNRFADQPDIYKRFLEILQTYQREQKPINEVYSQVTVLFQ 410

Query: 305 GYPVLIQGLNTFLPQGYKIECTS 327
             P L+     FLP+      TS
Sbjct: 411 HAPDLLDDFKKFLPESSGTTSTS 433

>YOL004W Chr15 (316938..321548) [4611 bp, 1536 aa] {ON}  SIN3Component
            of the Sin3p-Rpd3p histone deacetylase complex, involved
            in transcriptional repression and activation of diverse
            processes, including mating-type switching and meiosis;
            involved in the maintenance of chromosomal integrity
          Length = 1536

 Score = 1101 bits (2848), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 550/920 (59%), Positives = 675/920 (73%), Gaps = 30/920 (3%)

Query: 563  FNHPAS-FYQHQQARA---QNLPPLGNFSPPINGRD-NEAQVNLPAVQPPALDFPPQQQS 617
            F +PAS +Y H   R    QNLPP+G+FSPP NG   +EA  +   +QPP    P     
Sbjct: 520  FLYPASGYYGHPSNRGIPQQNLPPIGSFSPPTNGSTVHEAYQDQQHMQPPHF-MPLPSIV 578

Query: 618  QSHRHVVAQGMTNNSLPVSDMRGPVDGGFAPQPLYSQ-----------DVQYMEPTSRPE 666
            Q   ++V QG+ N + P+SD+R  +   +AP  +  Q           + QY +   RPE
Sbjct: 579  QHGPNMVHQGIANENPPLSDLRTSLTEQYAPSSIQHQQQHPQSISPIANTQYGDIPVRPE 638

Query: 667  IDLDPSLVPVIPEPIRPLENDSTLIEETSFFDKAKKYMGNKQVYTEFLKILNLFSQDLID 726
            IDLDPS+VPV+PEP  P+EN+ +L EE +FF+KAK+Y+GNK +YTEFLKILNL+SQD++D
Sbjct: 639  IDLDPSIVPVVPEPTEPIENNISLNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILD 698

Query: 727  TDELVDKVEHYLGGNSELFDWFKSFVNYVERPKHIENVVHEKHRLDLDLCEACCPSYKKL 786
             D+LV+KV+ YLG N ELF WFK+FV Y E+ K IEN+VHEKHRLDLDLCEA  PSYK+L
Sbjct: 699  LDDLVEKVDFYLGSNKELFTWFKNFVGYQEKTKCIENIVHEKHRLDLDLCEAFGPSYKRL 758

Query: 787  PKADTFMPCCGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYD 846
            PK+DTFMPC GRD+MCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYD
Sbjct: 759  PKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYD 818

Query: 847  YYIEANLRTIQLLETIANKISNMTVEEKKTFKLPPGLGHTSTTIYKKVIRKVYDKDRGFE 906
            +YIE+NLRTIQ LETI NKI NMT  EK  FKLPPGLGHTS TIYKKVIRKVYDK+RGFE
Sbjct: 819  FYIESNLRTIQCLETIVNKIENMTENEKANFKLPPGLGHTSMTIYKKVIRKVYDKERGFE 878

Query: 907  IIDALHENPAVSVPIVLRRLKQKDEEWRRAQREWNKVWRELEQKVFYKSLDHLGLTFKQA 966
            IIDALHE+PAV+ P+VL+RLKQKDEEWRRAQREWNKVWRELEQKVF+KSLDHLGLTFKQA
Sbjct: 879  IIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQA 938

Query: 967  DKKLLTAKQLISEISSIKIDQANKRIYPFTSKPKSQLDFDISDKGVLFDILNLVDTFIDH 1026
            DKKLLT KQLISEISSIK+DQ NK+I+  T KPKSQLDFD  DK + +DIL L DTFI H
Sbjct: 939  DKKLLTTKQLISEISSIKVDQTNKKIHWLTPKPKSQLDFDFPDKNIFYDILCLADTFITH 998

Query: 1027 STTYSNPDKEKLSAFFRGFLSIFFSIPLTDLDNPSEEHK----------VENGDSTRKRS 1076
            +T YSNPDKE+L    + F+S+FFSI    ++     HK            +  ++RKR 
Sbjct: 999  TTAYSNPDKERLKDLLKYFISLFFSISFEKIEESLYSHKQNVSESSGSDDGSSIASRKRP 1058

Query: 1077 RDDDQFFRDLLXXXXXXXXXXXXXXXXXXXXXXXXXAAKTSPDLEYEEAVRLDAKKPWLL 1136
               +    D+L                           + +  +E EE +  +AK PWL 
Sbjct: 1059 YQQEMSLLDILHRSRYQKLKRSNDEDGKVPQLSEPPEEEPN-TIEEEELIDEEAKNPWLT 1117

Query: 1137 GNILDEANNHGFVSNRKTYNMFANTNIYVFFRHLTTMYQRLSEAKNINEEVTKEINSRKV 1196
            GN+++EAN+ G + NR  +N+FANTNIY+FFRH TT+Y+RL E K +NE VTKEIN+R  
Sbjct: 1118 GNLVEEANSQGIIQNRSIFNLFANTNIYIFFRHWTTIYERLLEIKQMNERVTKEINTRST 1177

Query: 1197 VQFAKDLNLASTQLSDMGLDFKGADAYEQLLALCKRLIQSDIEHQWFEESLRQAYKNKAF 1256
            V FAKDL+L S+QLS+MGLDF G DAY+Q+L L +RLI  D+EHQWFEESLRQAY NKAF
Sbjct: 1178 VTFAKDLDLLSSQLSEMGLDFVGEDAYKQVLRLSRRLINGDLEHQWFEESLRQAYNNKAF 1237

Query: 1257 KIYTVDKVIQSLVKHAHSIITDAKTAEIMILFEKDRKAPTTSTREQILYRLQVRSCMGLT 1316
            K+YT+DKV QSLVKHAH+++TDAKTAEIM LF KDR A TTS ++QI+YRLQVRS M  T
Sbjct: 1238 KLYTIDKVTQSLVKHAHTLMTDAKTAEIMALFVKDRNASTTSAKDQIIYRLQVRSHMSNT 1297

Query: 1317 ENMFRIELNSTSAHVSIQFVAVDDLTLNQPNSLKDQWQYYLTSYSLSHPTEGVPHEEIKA 1376
            ENMFRIE +  + HVSIQ++A+DDLTL +P + +D+W+YY+TSY+L HPTEG+PHE++K 
Sbjct: 1298 ENMFRIEFDKRTLHVSIQYIALDDLTLKEPKADEDKWKYYVTSYALPHPTEGIPHEKLKI 1357

Query: 1377 PFLEKTLR--DDGDSDEDSEWYSPGGQSVSQLRIQINPESYALQIEPNSKDLFTRSTVNK 1434
            PFLE+ +    D D  E  E +SP G SVS L+I+I P +Y L IE  S D+FTR   NK
Sbjct: 1358 PFLERLIEFGQDIDGTEVDEEFSPEGISVSTLKIKIQPITYQLHIENGSYDVFTRKATNK 1417

Query: 1435 HPTKIGEASGRDAKTMQKSL 1454
            +PT   + + +   + +K L
Sbjct: 1418 YPTIANDNTQKGMVSQKKEL 1437

 Score =  260 bits (664), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 144/258 (55%), Positives = 170/258 (65%), Gaps = 21/258 (8%)

Query: 246 DASYRPLNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFKG 305
           DA YRPLN KDALSYLEQVKFQF++RPD+YN FLDIMKD+KSQAIDT GVIER+STLF+G
Sbjct: 213 DADYRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRG 272

Query: 306 YPVLIQGLNTFLPQGYKIECTSNPHDPHSIKVTTPFDTTRELSLDHN--------TGGSA 357
           YP+LIQG NTFLPQGY+IEC+SNP DP  I+VTTP  TT   ++++N        T    
Sbjct: 273 YPILIQGFNTFLPQGYRIECSSNPDDP--IRVTTPMGTT---TVNNNISPSGRGTTDAQE 327

Query: 358 VGGHLAGPATVSTSPSQIPRQETAV-SETKQEETPVDLPASA-AFAQDQVHHAESDTQRE 415
           +G            PS +P   ++V    + ++    LP  A +     +   E    R+
Sbjct: 328 LGSFPESDGNGVQQPSNVPMVPSSVYQSEQNQDQQQSLPLLATSSGLPSIQQPEMPAHRQ 387

Query: 416 IXXXXXXXXXXXXXXYATNRPNGDVEFSHAISYVNKIKTRFADQPDIYKHFLEILQTYQR 475
           I                  + N DVEFS AISYVNKIKTRFADQPDIYKHFLEILQTYQR
Sbjct: 388 IPQSQSLVPQEDA------KKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQR 441

Query: 476 EQKPIHEVYTQVTSLFQN 493
           EQKPI+EVY QVT LFQN
Sbjct: 442 EQKPINEVYAQVTHLFQN 459

 Score = 53.5 bits (127), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 42/67 (62%)

Query: 252 LNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFKGYPVLIQ 311
           + F  A+SY+ ++K +F ++PD+Y HFL+I++ Y+ +      V  +++ LF+  P L++
Sbjct: 406 VEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLE 465

Query: 312 GLNTFLP 318
               FLP
Sbjct: 466 DFKKFLP 472

>Smik_15.166 Chr15 (284165..288865) [4701 bp, 1566 aa] {ON} YOL004W
            (REAL)
          Length = 1566

 Score = 1095 bits (2833), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 550/926 (59%), Positives = 676/926 (73%), Gaps = 41/926 (4%)

Query: 563  FNHPAS-FYQHQQARA---QNLPPLGNFSPPINGRD-NEAQVNLPAVQPPALDFPPQQQS 617
            F +PAS +Y H   R    QNLPP+G+FSPP NG   +E   +   +QPP L  P     
Sbjct: 551  FLYPASSYYGHSNNRGIPQQNLPPIGSFSPPTNGSTVHENYQDQQHMQPPHL-MPLPSMV 609

Query: 618  QSHRHVVAQGMTNNSLPVSDMRGPVDGGFAPQPL------YSQDV------QYMEPTSRP 665
            Q   ++V QG+ N +LP+SD+R  +   +AP  +      + Q +      QY +   RP
Sbjct: 610  QHGANIVHQGIANENLPLSDLRTSLTEQYAPSNIQQQQQQHPQSISPIANSQYGDVPVRP 669

Query: 666  EIDLDPSLVPVIPEPIRPLENDSTLIEETSFFDKAKKYMGNKQVYTEFLKILNLFSQDLI 725
            EIDLDPS+VPV+PEP  P+E++ +L EE +FF+KAK+Y+GNK +YTEFLKILNL+SQD++
Sbjct: 670  EIDLDPSIVPVVPEPTEPIEDNISLNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDIL 729

Query: 726  DTDELVDKVEHYLGGNSELFDWFKSFVNYVERPKHIENVVHEKHRLDLDLCEACCPSYKK 785
            D D+LV+KV+ YLG N ELF WFK+FV Y ER K IEN+VHEKHRLDLDLCEA  PSYK+
Sbjct: 730  DLDDLVEKVDFYLGSNKELFSWFKNFVGYQERTKFIENIVHEKHRLDLDLCEAFGPSYKR 789

Query: 786  LPKADTFMPCCGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEY 845
            LPK+DTFMPC GRD+MCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEY
Sbjct: 790  LPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEY 849

Query: 846  DYYIEANLRTIQLLETIANKISNMTVEEKKTFKLPPGLGHTSTTIYKKVIRKVYDKDRGF 905
            D+YIE+NLRTIQ LETI NKI NMT  EK  FKLPPGLGHTS TIYKKVIRKVYDK+RGF
Sbjct: 850  DFYIESNLRTIQCLETIVNKIENMTENEKVNFKLPPGLGHTSMTIYKKVIRKVYDKERGF 909

Query: 906  EIIDALHENPAVSVPIVLRRLKQKDEEWRRAQREWNKVWRELEQKVFYKSLDHLGLTFKQ 965
            EIIDALHE+PAV+ P+VL+RLKQKDEEWRRAQREWNKVWRELEQKVF+KSLDHLGLTFKQ
Sbjct: 910  EIIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQ 969

Query: 966  ADKKLLTAKQLISEISSIKIDQANKRIYPFTSKPKSQLDFDISDKGVLFDILNLVDTFID 1025
            ADKKLLT KQLISEISSIK+DQ NK+I+  T KPKSQLDFD  DK +  DIL L D+FI 
Sbjct: 970  ADKKLLTTKQLISEISSIKVDQTNKKIHWLTPKPKSQLDFDFPDKNIFCDILYLADSFIS 1029

Query: 1026 HSTTYSNPDKEKLSAFFRGFLSIFFSIPLTDLDNPSEEHK----------VENGDSTRKR 1075
            H+T YSNPDKE+L    + F+S+FFSI L +++   + +K                +RKR
Sbjct: 1030 HTTAYSNPDKERLKDLLKYFISLFFSISLEEIEESLQAYKQSVSESSGSDDGGSSVSRKR 1089

Query: 1076 SRDDDQFFRDLLXXXXXXXXXXXXXXXXXXXXXXXXXAAKTSPD-----LEYEEAVRLDA 1130
            S   +    D+L                             +PD     +E EE +  +A
Sbjct: 1090 SYQQEMTLLDILHRSRYQKLKRSKDEDGKVPQLSE------APDEESNIIEEEELINEEA 1143

Query: 1131 KKPWLLGNILDEANNHGFVSNRKTYNMFANTNIYVFFRHLTTMYQRLSEAKNINEEVTKE 1190
            K PWL GN+++EAN+ G + NR  +N+FANTNIY+FFRH TT+Y+RL E K +NE+VTKE
Sbjct: 1144 KNPWLTGNLVEEANSQGMIQNRGIFNLFANTNIYIFFRHWTTIYERLLEIKQMNEKVTKE 1203

Query: 1191 INSRKVVQFAKDLNLASTQLSDMGLDFKGADAYEQLLALCKRLIQSDIEHQWFEESLRQA 1250
            IN+R  V FAKDL+L S QLS+MGLDF G DAY+Q+L L +RLI  D+EHQWFEESLRQA
Sbjct: 1204 INTRSTVTFAKDLDLLSNQLSEMGLDFIGEDAYKQVLKLSRRLINGDLEHQWFEESLRQA 1263

Query: 1251 YKNKAFKIYTVDKVIQSLVKHAHSIITDAKTAEIMILFEKDRKAPTTSTREQILYRLQVR 1310
            Y N+AFK+YT+DKV QSLVKHAH+++TDAKTAEIM LF KDR   TTS + QI+YRLQVR
Sbjct: 1264 YNNRAFKLYTIDKVTQSLVKHAHTLMTDAKTAEIMALFVKDRNVTTTSAKGQIIYRLQVR 1323

Query: 1311 SCMGLTENMFRIELNSTSAHVSIQFVAVDDLTLNQPNSLKDQWQYYLTSYSLSHPTEGVP 1370
            S M  TENMFRIE +  + HVSIQ++A+DDLTL +P   +D+W+YY+TSY+L HPTEGV 
Sbjct: 1324 SHMSNTENMFRIEFDKRTLHVSIQYIALDDLTLKEPKEDEDKWKYYVTSYALPHPTEGVL 1383

Query: 1371 HEEIKAPFLEKTLR--DDGDSDEDSEWYSPGGQSVSQLRIQINPESYALQIEPNSKDLFT 1428
            HE++K PFLE+ +    D D  +  E +SP G SVS L+I+I P +Y L IE  S D+FT
Sbjct: 1384 HEKLKIPFLERLIEFGQDIDGKDVDEKFSPEGISVSTLKIKIQPTTYKLDIENGSYDVFT 1443

Query: 1429 RSTVNKHPTKIGEASGRDAKTMQKSL 1454
            R + NK+PT   + + ++    +K L
Sbjct: 1444 RKSANKYPTVANDDTHKEVVVQKKEL 1469

 Score =  253 bits (647), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 146/255 (57%), Positives = 171/255 (67%), Gaps = 21/255 (8%)

Query: 249 YRPLNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFKGYPV 308
           YRPLN KDALSYLEQVKFQF++RPD+YN FLDIMKD+KSQAIDT GVIER+STLF+GYP+
Sbjct: 229 YRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPI 288

Query: 309 LIQGLNTFLPQGYKIECTSNPHDPHSIKVTTPFDTTRELSLDHNTGGSAVGGHLAG-PAT 367
           LIQG NTFLPQGY+IEC++NP DP  I+VTTP  TT   ++++N      G   A  P++
Sbjct: 289 LIQGFNTFLPQGYRIECSTNPDDP--IRVTTPMGTT---TVNNNISPPERGTIDAQEPSS 343

Query: 368 V-------STSPSQIPRQETAV--SETKQEETPVDLPASAAFAQDQVHHAESDTQREIXX 418
           +       +     +P   + V  SE  Q++  V LP SA           S  Q EI  
Sbjct: 344 LPEADGNGTQRSHNVPMVPSNVYHSEQNQDQQQV-LPLSATSTG-----LPSIQQSEIPV 397

Query: 419 XXXXXXXXXXXXYATNRPNGDVEFSHAISYVNKIKTRFADQPDIYKHFLEILQTYQREQK 478
                           + N DVEFS AISYVNKIKTRFADQPDIYKHFLEILQTYQREQK
Sbjct: 398 HHQIPQIQPLAVQEDVKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQK 457

Query: 479 PIHEVYTQVTSLFQN 493
           PI+EVY QVT LFQN
Sbjct: 458 PINEVYAQVTHLFQN 472

 Score = 53.5 bits (127), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 42/67 (62%)

Query: 252 LNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFKGYPVLIQ 311
           + F  A+SY+ ++K +F ++PD+Y HFL+I++ Y+ +      V  +++ LF+  P L++
Sbjct: 419 VEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLE 478

Query: 312 GLNTFLP 318
               FLP
Sbjct: 479 DFKKFLP 485

>Skud_15.158 Chr15 (276509..281176) [4668 bp, 1555 aa] {ON} YOL004W
            (REAL)
          Length = 1555

 Score = 1093 bits (2827), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 543/904 (60%), Positives = 669/904 (74%), Gaps = 32/904 (3%)

Query: 563  FNHPAS-FYQHQQARA---QNLPPLGNFSPPINGRD-NEAQVNLPAVQPPALDFPPQQQS 617
            F +PAS +Y H   R    QNLPP+G+FSPP NG   ++   +   +QPP L  P     
Sbjct: 538  FLYPASSYYNHSTNRGVPQQNLPPIGSFSPPTNGSTVHDNYQDQQHMQPPHL-VPLPSMV 596

Query: 618  QSHRHVVAQGMTNNSLPVSDMRGPVDGGFAPQPLYSQ-----------DVQYMEPTSRPE 666
            Q   ++V QG+ N +LP+SD+R  +   +AP     Q           D+QY +   RPE
Sbjct: 597  QHGPNMVHQGIANENLPISDLRTSLTDQYAPSTFQQQQQNPPSISPITDLQYGDVPVRPE 656

Query: 667  IDLDPSLVPVIPEPIRPLENDSTLIEETSFFDKAKKYMGNKQVYTEFLKILNLFSQDLID 726
            IDLDPS+VPV+PEP  P+E++ +L EE +FF+KAK+Y+GNK +YTEFLKILNL+SQD++D
Sbjct: 657  IDLDPSIVPVVPEPTEPIEDNISLNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILD 716

Query: 727  TDELVDKVEHYLGGNSELFDWFKSFVNYVERPKHIENVVHEKHRLDLDLCEACCPSYKKL 786
             D+LV+KV+ YLG N ELF WFK+FV Y E+ K IEN+VHEKHRLDLDLCEA  PSYK+L
Sbjct: 717  LDDLVEKVDFYLGSNKELFSWFKNFVGYQEKTKCIENIVHEKHRLDLDLCEAFGPSYKRL 776

Query: 787  PKADTFMPCCGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYD 846
            PK+DTFMPC GRD+MCWE+LNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYD
Sbjct: 777  PKSDTFMPCSGRDDMCWEILNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYD 836

Query: 847  YYIEANLRTIQLLETIANKISNMTVEEKKTFKLPPGLGHTSTTIYKKVIRKVYDKDRGFE 906
            +YIE+NLRTIQ LETI NKI NMT  EK  FKLPPGLGHTS TIYKKVIRKVYDK+RGFE
Sbjct: 837  FYIESNLRTIQCLETIVNKIENMTESEKSDFKLPPGLGHTSMTIYKKVIRKVYDKERGFE 896

Query: 907  IIDALHENPAVSVPIVLRRLKQKDEEWRRAQREWNKVWRELEQKVFYKSLDHLGLTFKQA 966
            IIDALHE+PAV+ P+VL+RLKQKDEEWRRAQREWNKVWRELEQKVF+KSLDHLGLTFKQA
Sbjct: 897  IIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQA 956

Query: 967  DKKLLTAKQLISEISSIKIDQANKRIYPFTSKPKSQLDFDISDKGVLFDILNLVDTFIDH 1026
            DKKLLT KQLISEI+SIK+DQ NK+I+  T KPKSQLDFD  DK + +DIL L D+FI H
Sbjct: 957  DKKLLTTKQLISEINSIKVDQTNKKIHWLTPKPKSQLDFDFPDKDIFYDILYLADSFISH 1016

Query: 1027 STTYSNPDKEKLSAFFRGFLSIFFSIPLTDLDNPSEEHKVEN-----------GDSTRKR 1075
            +T YSNPDKE+L    + F+S+FFSIPL  ++   + HK EN             ++RKR
Sbjct: 1017 TTAYSNPDKERLKDLLKYFISLFFSIPLEKIEKALQFHK-ENVSESSGSDDGGSSTSRKR 1075

Query: 1076 SRDDDQFFRDLLXXXXXXXXXXXXXXXXXXXXXXXXXAAKTSPDLEYEEAVRLDAKKPWL 1135
                +    D+L                           +++  +E EE +  +A+ PWL
Sbjct: 1076 PYQQEMSLLDILHRNRYQKLKRSNDEEGKIPQLSEPLDEESN-TIEEEELISEEARNPWL 1134

Query: 1136 LGNILDEANNHGFVSNRKTYNMFANTNIYVFFRHLTTMYQRLSEAKNINEEVTKEINSRK 1195
             GN+++EAN+ G + NR  +N+FANTNIY+FFRH TT+Y+RL E K +N ++TKE+N+R 
Sbjct: 1135 TGNLVEEANSQGIIQNRSIFNLFANTNIYIFFRHWTTIYERLLEIKQMNGKITKEVNTRS 1194

Query: 1196 VVQFAKDLNLASTQLSDMGLDFKGADAYEQLLALCKRLIQSDIEHQWFEESLRQAYKNKA 1255
             V FAKDL+L S QL +MGLDF G DAY+Q+L L +RLI  D+EHQWFEESLRQAY NKA
Sbjct: 1195 TVTFAKDLDLLSNQLPEMGLDFIGEDAYKQVLRLSRRLINGDLEHQWFEESLRQAYNNKA 1254

Query: 1256 FKIYTVDKVIQSLVKHAHSIITDAKTAEIMILFEKDRKAPTTSTREQILYRLQVRSCMGL 1315
            FK+YT+DKV QSLVKHAH+++ D KTAEIM LF KDR A TTS ++QI+YRLQVRS M  
Sbjct: 1255 FKLYTIDKVTQSLVKHAHTLMADVKTAEIMALFVKDRNAFTTSAKDQIIYRLQVRSYMSN 1314

Query: 1316 TENMFRIELNSTSAHVSIQFVAVDDLTLNQPNSLKDQWQYYLTSYSLSHPTEGVPHEEIK 1375
             ENMFRIELN  S HVS+Q++A+DDLTL +P + +D+W+YY+TSY L HPTEG+ HE++K
Sbjct: 1315 IENMFRIELNKRSLHVSVQYIALDDLTLKEPKADEDKWKYYVTSYGLPHPTEGISHEKLK 1374

Query: 1376 APFLEKTLR--DDGDSDEDSEWYSPGGQSVSQLRIQINPESYALQIEPNSKDLFTRSTVN 1433
             PFLE+ +    D D  E  E +SP G S+S LRI+I P +Y L IE  S D+FTR  VN
Sbjct: 1375 IPFLERLIEFGQDTDGREVDEEFSPEGISLSTLRIKIQPITYKLHIENGSYDVFTRKAVN 1434

Query: 1434 KHPT 1437
            K+PT
Sbjct: 1435 KYPT 1438

 Score =  261 bits (667), Expect = 9e-70,   Method: Compositional matrix adjust.
 Identities = 145/256 (56%), Positives = 172/256 (67%), Gaps = 15/256 (5%)

Query: 245 QDASYRPLNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFK 304
           +D  YRPLN KDALSYLEQVKFQF++RPD+YN FLDIMKD+KSQAIDT GVIER+STLF+
Sbjct: 220 EDPDYRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFR 279

Query: 305 GYPVLIQGLNTFLPQGYKIECTSNPHDPHSIKVTTPFDTTRELSLDHNTGGSAVGGH--- 361
           GYP+LIQG NTFLPQGY+IEC++NP DP  I+VTTP  TT   +    +G   V G    
Sbjct: 280 GYPILIQGFNTFLPQGYRIECSTNPDDP--IRVTTPMGTTTVNNNVSPSGRGTVDGQEPS 337

Query: 362 -LAGPATVSTSP-SQIPRQETAVSETKQ-EETPVDLPASA-AFAQDQVHHAESDTQREIX 417
            L+ P   +  P   +P   + V  ++Q ++    LP SA +     +H  E     +I 
Sbjct: 338 SLSEPDGNAIQPFHNLPMVPSNVYRSEQSQDQKQSLPLSANSVGLSSIHPPEIPPHHQIL 397

Query: 418 XXXXXXXXXXXXXYATNRPNGDVEFSHAISYVNKIKTRFADQPDIYKHFLEILQTYQREQ 477
                            + N DVEFS AISYVNKIKTRFADQPDIYKHFLEILQTYQREQ
Sbjct: 398 QGQSLPVQEDA------KKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQ 451

Query: 478 KPIHEVYTQVTSLFQN 493
           KPI+EVY QVT LFQN
Sbjct: 452 KPINEVYAQVTHLFQN 467

 Score = 53.1 bits (126), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 42/67 (62%)

Query: 252 LNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFKGYPVLIQ 311
           + F  A+SY+ ++K +F ++PD+Y HFL+I++ Y+ +      V  +++ LF+  P L++
Sbjct: 414 VEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLE 473

Query: 312 GLNTFLP 318
               FLP
Sbjct: 474 DFKKFLP 480

>TPHA0J00400 Chr10 complement(89956..94494) [4539 bp, 1512 aa] {ON}
            Anc_6.29 YOL004W
          Length = 1512

 Score = 1088 bits (2815), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 549/995 (55%), Positives = 706/995 (70%), Gaps = 95/995 (9%)

Query: 578  QNLPPLGNFSPPINGRDNEAQ-----VNLPAVQPPALDFPPQQQ---SQSHRHVVAQG-- 627
            Q+LPPLGNF PP N  +N        + + ++  P +D    QQ    Q   +  AQ   
Sbjct: 482  QSLPPLGNFLPPSNKNNNTTAVNNNLMGISSIMHPKVDHIQSQQYIADQKQAYTPAQQQS 541

Query: 628  ---MTNNSLPVSDMRGP--VDG---------GFAPQPL---------------------- 651
               +TN ++ +S++RG   +DG          ++P  L                      
Sbjct: 542  TTQLTNEAMQISELRGSPMMDGQTARNLANVNYSPAELNQLQAQQHISIQQQQQQQQQQQ 601

Query: 652  --------------YSQDVQYMEPTSRPEIDLDPSLVPVIPEPIRPLENDSTLIEETSFF 697
                          Y QD+     + RPEIDLDPS+VPVIPEP+ P+E+  +L+EET+FF
Sbjct: 602  QQLQMQMQMQMDGGYPQDI-----SVRPEIDLDPSIVPVIPEPVEPIEDSLSLVEETNFF 656

Query: 698  DKAKKYMGNKQVYTEFLKILNLFSQDLIDTDELVDKVEHYLGGNSELFDWFKSFVNYVER 757
            DKAKK++ NKQ+Y EFLKILNL+SQ++++ +ELV+KV++YLG N ELFDWFK FV Y ++
Sbjct: 657  DKAKKFINNKQIYMEFLKILNLYSQNILNVNELVEKVQYYLGSNKELFDWFKGFVGYQDK 716

Query: 758  PKHIENVVHEKHRLDLDLCEACCPSYKKLPKADTFMPCCGRDEMCWEVLNDEWVGHPVWA 817
            PKHIEN+VHEKH+LDLDLCEA  PSYKKLPK DTFMPC GRDEMCWEVLND+WVGHPVWA
Sbjct: 717  PKHIENIVHEKHKLDLDLCEAYGPSYKKLPKTDTFMPCSGRDEMCWEVLNDDWVGHPVWA 776

Query: 818  SEDSGFIAHRKNQYEETLFKIEEERHEYDYYIEANLRTIQLLETIANKISNMTVEEKKTF 877
            SEDSGFIAHRKNQYEETLFKIEEERHEYD+YIE+NLRTIQ LETIA+KI+NMT EE+  F
Sbjct: 777  SEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQTLETIASKIANMTEEERANF 836

Query: 878  KLPPGLGHTSTTIYKKVIRKVYDKDRGFEIIDALHENPAVSVPIVLRRLKQKDEEWRRAQ 937
            KLP GLGHTS TIY+KVIRKVY K+RGFE+IDALHE PAV+VPI+L+RLKQKDEEWRRAQ
Sbjct: 837  KLPIGLGHTSVTIYQKVIRKVYGKERGFELIDALHEYPAVAVPIILKRLKQKDEEWRRAQ 896

Query: 938  REWNKVWRELEQKVFYKSLDHLGLTFKQADKKLLTAKQLISEISSIKIDQANKRIYPFTS 997
            REWNKVWREL+QKV+YKSLDHLGLTFKQADKKLLT KQLISEISSIK+DQ NK+++  T 
Sbjct: 897  REWNKVWRELQQKVYYKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTNKKLHWLTP 956

Query: 998  KPKSQLDFDISDKGVLFDILNLVDTFIDHSTTYSNPDKEKLSAFFRGFLSIFFSIPLTD- 1056
            KPKSQLD+ ++D+ +L+DIL L D FI+H++ YSNPDKE+L  F + F+S+FF IPL D 
Sbjct: 957  KPKSQLDYKVADRQILYDILKLTDVFINHTSNYSNPDKERLRDFLQSFISLFFFIPLADI 1016

Query: 1057 ---------LDNPSEEHKVENGDST---RKRS-RDDDQFFRDLLXXXXXXXXXXXXXXXX 1103
                     LD+   + +  +GDS    +KRS  DDD  F D+L                
Sbjct: 1017 KAAIKIRSPLDDTKTDSEESSGDSDKFPKKRSIEDDDISFHDILDKVKYQKVKQGLDKNE 1076

Query: 1104 XXXXXXXXXAAKTSPDLEYEEAVRLDAKKPWLLGNILDEANNHGFVSNRKTYNMFANTNI 1163
                      +     ++ +E +R +A+KPWLLG+I+D+AN+ G + NR  YN+F NTNI
Sbjct: 1077 TFSNDISSATS-----VDDDELIRQEAQKPWLLGSIVDDANSLGIIQNRSKYNIFGNTNI 1131

Query: 1164 YVFFRHLTTMYQRLSEAKNINEEVTKEINSRKVVQFAKDLNLASTQLSDMGLDFKGADAY 1223
            YVF RHL T+Y+RL+EAK +N EVT+EI +R +V FAKDLNL STQL +MGLDF+G D+Y
Sbjct: 1132 YVFIRHLITLYERLNEAKQMNAEVTEEIKNRSIVPFAKDLNLVSTQLKNMGLDFEGTDSY 1191

Query: 1224 EQLLALCKRLIQSDIEHQWFEESLRQAYKNKAFKIYTVDKVIQSLVKHAHSIITDAKTAE 1283
            +QLL L  RLI+ ++EH WFEESLRQA++NKAFK+YT+DKV QS+VKHAH+I++D KTAE
Sbjct: 1192 KQLLDLSTRLIEGNLEHHWFEESLRQAFRNKAFKLYTIDKVTQSIVKHAHTIMSDTKTAE 1251

Query: 1284 IMILFEKDRKAPTTSTREQILYRLQVRSCMGLTENMFRIELNSTSAHVSIQFVAVDDLTL 1343
            IM+L EKDR   TTS+++QILYRLQ RS M  T+NMFRIE N +S ++SIQ++ +DDLTL
Sbjct: 1252 IMMLMEKDRSCATTSSKDQILYRLQARSHMSTTDNMFRIEFNKSSDNISIQYIGMDDLTL 1311

Query: 1344 NQPNSLKDQWQYYLTSYSLSHPTEGVPHEEIKAPFLEKTLRDDGDSDED----SEWYSPG 1399
             +P + +++W+YY+TSY+LSHPTEGVP EEI+ PFLEK L  +    E+    ++ YSP 
Sbjct: 1312 GEPKTAEEKWKYYITSYALSHPTEGVPQEEIQIPFLEKILETEEAYAEEEEVINDKYSPK 1371

Query: 1400 GQSVSQLRIQINPESYALQIEPNSKDLFTRSTVNKHPTKIGEASGRDAKTMQKSLADMVN 1459
            G S S L+I+I+PE+YAL+IEP S D F+R ++NK+P  +   +  D K  +K   D VN
Sbjct: 1372 GVSQSDLKIKISPENYALEIEPGSFDTFSRLSMNKYPIDV---TSDDYKNKKKLSIDRVN 1428

Query: 1460 S----EHGWKKGLQNESIGKAESIINFVKARGFLE 1490
            +    + GWK+ L  + I       + +K  G L+
Sbjct: 1429 AFLNGKFGWKQSLSEDEINNINLKYSHIKKYGSLK 1463

 Score =  239 bits (611), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 135/268 (50%), Positives = 164/268 (61%), Gaps = 27/268 (10%)

Query: 249 YRPLNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFKGYPV 308
           YRPLN KDAL+YLEQVK QF++RPD+YNHFLDIMKD+KSQ+IDT GVIER+STLF+GYP 
Sbjct: 142 YRPLNVKDALTYLEQVKLQFSSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPS 201

Query: 309 LIQGLNTFLPQGYKIECTSNPHDPHSIKVTTPFDTTRELSLDHNTGGSAVGGHLAG---- 364
           LIQG NTFLPQGY IECT+NP+DP  IKVTTP   +  +        +A   ++ G    
Sbjct: 202 LIQGFNTFLPQGYTIECTNNPNDP--IKVTTPIG-SETIPYAKPIPSAATNTNVPGPTTS 258

Query: 365 ------------PATVSTSPSQIP-----RQETAVSETKQEETPVDLPASAAFAQDQVHH 407
                          V+ + + IP     ++  A+        P  LP     +  +V  
Sbjct: 259 TSPPTAATTTGTTTPVAANTTAIPNITRNKETNAIENVATAAQPSLLPNLGTPSHTEVTK 318

Query: 408 AESDTQREIXX--XXXXXXXXXXXXYATNRPNGDVEFSHAISYVNKIKTRFADQPDIYKH 465
           +ES  Q                     T +P  DVEFS A+SYVNKIK RF D+PDIYK 
Sbjct: 319 SESVIQSSANAPIQPNMHNMTQDTMKITEKP-ADVEFSQAVSYVNKIKNRFVDEPDIYKT 377

Query: 466 FLEILQTYQREQKPIHEVYTQVTSLFQN 493
           FLEILQTYQ+EQKPIHEVY+QVT LFQN
Sbjct: 378 FLEILQTYQKEQKPIHEVYSQVTILFQN 405

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 39/67 (58%)

Query: 252 LNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFKGYPVLIQ 311
           + F  A+SY+ ++K +F + PD+Y  FL+I++ Y+ +      V  +++ LF+  P L+ 
Sbjct: 352 VEFSQAVSYVNKIKNRFVDEPDIYKTFLEILQTYQKEQKPIHEVYSQVTILFQNAPDLLD 411

Query: 312 GLNTFLP 318
               FLP
Sbjct: 412 DFKKFLP 418

>Suva_15.171 Chr15 (291325..296010) [4686 bp, 1561 aa] {ON} YOL004W
            (REAL)
          Length = 1561

 Score = 1083 bits (2802), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 539/903 (59%), Positives = 667/903 (73%), Gaps = 30/903 (3%)

Query: 563  FNHPAS-FYQHQQARA---QNLPPLGNFSPPINGRD-NEAQVNLPAVQPPALDFPPQQQS 617
            F +PAS +Y H        QNLPP+G+FSPP NG   +E   +   +QPP L  P     
Sbjct: 544  FLYPASNYYSHSTNGGIPQQNLPPIGSFSPPTNGSTTHEGFQDQQHMQPPHL-MPLPSMV 602

Query: 618  QSHRHVVAQGMTNNSLPVSDMRGPVDGGFAPQPLYSQ-----------DVQYMEPTSRPE 666
            Q   ++V QG+ N ++P+SD+R  +   +AP     Q           D QY +   RPE
Sbjct: 603  QQGPNMVHQGIVNENIPLSDLRTSLTDQYAPSNFQQQQQQQPSISPIIDSQYGDVPVRPE 662

Query: 667  IDLDPSLVPVIPEPIRPLENDSTLIEETSFFDKAKKYMGNKQVYTEFLKILNLFSQDLID 726
            IDLDPS+VPV+PEP  P+E++ +L EE +FF+KAK+Y+GNK +YTEFLKILNL+SQD++D
Sbjct: 663  IDLDPSIVPVVPEPTEPIEDNISLNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILD 722

Query: 727  TDELVDKVEHYLGGNSELFDWFKSFVNYVERPKHIENVVHEKHRLDLDLCEACCPSYKKL 786
             D+LV+KV+ YLG N ELF WFK+FV Y E+ K IENVVHEKHRLDLDLCEA  PSYK+L
Sbjct: 723  LDDLVEKVDFYLGSNKELFSWFKNFVGYQEKIKSIENVVHEKHRLDLDLCEAFGPSYKRL 782

Query: 787  PKADTFMPCCGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYD 846
            PK+DTFMPC GRD+MCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYD
Sbjct: 783  PKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYD 842

Query: 847  YYIEANLRTIQLLETIANKISNMTVEEKKTFKLPPGLGHTSTTIYKKVIRKVYDKDRGFE 906
            +YIE+NLRTIQ LETI NKI NMT  EK  FKLPPGLGHTS TIYKKVIRKVYDK+RGFE
Sbjct: 843  FYIESNLRTIQCLETIVNKIENMTENEKANFKLPPGLGHTSMTIYKKVIRKVYDKERGFE 902

Query: 907  IIDALHENPAVSVPIVLRRLKQKDEEWRRAQREWNKVWRELEQKVFYKSLDHLGLTFKQA 966
            IIDALHE+PAV+ P+VL+RLKQKDEEWRRAQREWNKVWRELEQKV++KSLDHLGLTFKQA
Sbjct: 903  IIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVYFKSLDHLGLTFKQA 962

Query: 967  DKKLLTAKQLISEISSIKIDQANKRIYPFTSKPKSQLDFDISDKGVLFDILNLVDTFIDH 1026
            DKKLLT KQLISEISSIK+DQ NK+I+  T KPKSQLDFD  DK + +DIL L D+FI H
Sbjct: 963  DKKLLTTKQLISEISSIKVDQTNKKIHWLTPKPKSQLDFDFPDKDIFYDILYLADSFIAH 1022

Query: 1027 STTYSNPDKEKLSAFFRGFLSIFFSIPLTDLDNPSEEHK----------VENGDSTRKRS 1076
            +T YSNPDKE+L      F+S+FFSIPL  ++   + +K            +  + RKR 
Sbjct: 1023 TTAYSNPDKERLKDLLNYFISLFFSIPLEKIEEALQSYKQNLSDSSGSDDGDSSTPRKRP 1082

Query: 1077 RDDDQFFRDLLXXXXXXXXXXXXXXXXXXXXXXXXXAAKTSPDLEYEEAVRLDAKKPWLL 1136
               +    D+L                           +++  +E EE +  +AK PWL 
Sbjct: 1083 YQQEMSLLDILHRSKYQKLKRSNDEDGKVPQLSEPLDEESN-AIEEEELINEEAKNPWLT 1141

Query: 1137 GNILDEANNHGFVSNRKTYNMFANTNIYVFFRHLTTMYQRLSEAKNINEEVTKEINSRKV 1196
            GN+++EAN+ G + NR  +N+FAN+NIY+FFRH TT+Y+RL E K +NE+VTKEI+ R +
Sbjct: 1142 GNLVEEANSQGIIQNRNIFNLFANSNIYIFFRHWTTIYERLLEIKQMNEKVTKEISKRSM 1201

Query: 1197 VQFAKDLNLASTQLSDMGLDFKGADAYEQLLALCKRLIQSDIEHQWFEESLRQAYKNKAF 1256
            V FAKDL+L S+QLS+MGLDF G DAY+Q+L L +RLI  ++EHQWFEE LRQAY NKAF
Sbjct: 1202 VTFAKDLDLLSSQLSEMGLDFNGEDAYKQVLKLSRRLINGELEHQWFEEGLRQAYNNKAF 1261

Query: 1257 KIYTVDKVIQSLVKHAHSIITDAKTAEIMILFEKDRKAPTTSTREQILYRLQVRSCMGLT 1316
            K+YT+DKVIQ LVKHAH+++TDAKTAEIM LF KDR A TTS ++QI+YRLQ RS M  T
Sbjct: 1262 KLYTIDKVIQLLVKHAHTLMTDAKTAEIMALFVKDRNASTTSAKDQIIYRLQARSYMSNT 1321

Query: 1317 ENMFRIELNSTSAHVSIQFVAVDDLTLNQPNSLKDQWQYYLTSYSLSHPTEGVPHEEIKA 1376
            ENMFR+E +  + HVS+Q++A+DDLTL +P + +D+W+YY+TSY+L HPTEG+ HE++K 
Sbjct: 1322 ENMFRMEFDRRNLHVSVQYIALDDLTLKEPRADEDKWKYYVTSYALPHPTEGISHEKLKI 1381

Query: 1377 PFLEKTLR--DDGDSDEDSEWYSPGGQSVSQLRIQINPESYALQIEPNSKDLFTRSTVNK 1434
            PFLE+ +    D D  E  E +SP G SVS L+I+I P +Y L IE  S D+FTR   NK
Sbjct: 1382 PFLERLIEYGQDTDGREVDEKFSPEGLSVSTLKIKIQPVTYKLHIESGSYDVFTRKAANK 1441

Query: 1435 HPT 1437
            +PT
Sbjct: 1442 YPT 1444

 Score =  254 bits (650), Expect = 9e-68,   Method: Compositional matrix adjust.
 Identities = 145/272 (53%), Positives = 170/272 (62%), Gaps = 50/272 (18%)

Query: 245 QDASYRPLNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFK 304
           +D  YRPLN KDALSYLEQVKFQFN+RPD+YN FLDIMKD+KSQAIDT GVIER+STLF+
Sbjct: 63  EDPDYRPLNVKDALSYLEQVKFQFNSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFR 122

Query: 305 GYPVLIQGLNTFLPQGYKIECTSNPHDPHSIKVTTPFDTTRELSLDHNTGGSAV------ 358
           GYP+LIQG NTFLPQGY+IEC++NP DP  I+VTTP  TT   ++++N    A       
Sbjct: 123 GYPILIQGFNTFLPQGYRIECSTNPDDP--IRVTTPMGTT---TVNNNVSPPARSALEPQ 177

Query: 359 ---------GGHLAGPATVSTSPSQIPRQETAVSETKQE----ETPVDLPA----SAAFA 401
                    G  +     V   PS +   E +  + +Q       P  LP+         
Sbjct: 178 EPSSLPEADGSTIPQSHNVPMVPSNVYHSEQSQDQQQQPLPLLANPSGLPSIHQPELPIP 237

Query: 402 QDQVHHAESDTQREIXXXXXXXXXXXXXXYATNRPNGDVEFSHAISYVNKIKTRFADQPD 461
           Q Q   A+ D ++                      N DVEFS AISYVNKIKTRFADQPD
Sbjct: 238 QSQPLTAQEDVKK----------------------NVDVEFSQAISYVNKIKTRFADQPD 275

Query: 462 IYKHFLEILQTYQREQKPIHEVYTQVTSLFQN 493
           IYKHFLEILQTYQREQKPI+EVY QVT LFQN
Sbjct: 276 IYKHFLEILQTYQREQKPINEVYAQVTHLFQN 307

 Score = 53.1 bits (126), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 42/67 (62%)

Query: 252 LNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFKGYPVLIQ 311
           + F  A+SY+ ++K +F ++PD+Y HFL+I++ Y+ +      V  +++ LF+  P L++
Sbjct: 254 VEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLE 313

Query: 312 GLNTFLP 318
               FLP
Sbjct: 314 DFKKFLP 320

>KAFR0A05120 Chr1 (1015307..1019746) [4440 bp, 1479 aa] {ON} Anc_6.29
            YOL004W
          Length = 1479

 Score = 1073 bits (2774), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 546/973 (56%), Positives = 688/973 (70%), Gaps = 72/973 (7%)

Query: 578  QNLPPLGNFSPPIN-GRDNEAQVNLPAVQPPALDFPPQQQSQSHRH----VVAQGMTNNS 632
            Q+LPP+G+FSPP N G     Q   P +         +Q    + H    V  QG++N+ 
Sbjct: 477  QSLPPIGSFSPPANTGISMHDQSQRPHMMALPSMLQHEQIIDMNNHPKPAVSTQGISNDE 536

Query: 633  LPVSDMRG--------PVDGGFAPQPLYSQDV---------------------------- 656
            +PVSD+R         P  G +   P    D+                            
Sbjct: 537  IPVSDVRMAQYPNGAVPDYGQYPTHPQMKPDLATQRHILQQQEIQQQQLMLQQQQEQELL 596

Query: 657  -----QYMEPTSRPEIDLDPSLVPVIPEPIRPLENDSTLIEETSFFDKAKKYMGNKQVYT 711
                 QY+E   RPEIDLDPS+VPV+PEP  P+E++ TLIEETSFFDKAKK++ NKQ+YT
Sbjct: 597  EQQQQQYVEAPVRPEIDLDPSIVPVVPEPTEPIESNFTLIEETSFFDKAKKFINNKQIYT 656

Query: 712  EFLKILNLFSQDLIDTDELVDKVEHYLGGNSELFDWFKSFVNYVERPKHIENVVHEKHRL 771
            EFLK+LNLFSQDLI  D+LV+KVE+Y+G + ELF+WF++FV Y   PK IEN+VHEKHRL
Sbjct: 657  EFLKVLNLFSQDLISVDDLVNKVEYYIGSSKELFEWFRNFVGYQGNPKIIENIVHEKHRL 716

Query: 772  DLDLCEACCPSYKKLPKADTFMPCCGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQY 831
            DLDLCEAC PSYK+LPK+DTFMPC GRD+MCWEVLNDEWVGHPVWASEDSGFIAHRKNQY
Sbjct: 717  DLDLCEACGPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQY 776

Query: 832  EETLFKIEEERHEYDYYIEANLRTIQLLETIANKISNMTVEEKKTFKLPPGLGHTSTTIY 891
            EETLFKIEEERHEYDYYIE+NLRTIQ LE I NKISNM+ EEKK FKL PGLGHTS TIY
Sbjct: 777  EETLFKIEEERHEYDYYIESNLRTIQTLEAIVNKISNMSEEEKKNFKLEPGLGHTSLTIY 836

Query: 892  KKVIRKVYDKDRGFEIIDALHENPAVSVPIVLRRLKQKDEEWRRAQREWNKVWRELEQKV 951
            KKVIRKVYDK+RGFEIIDALHE+PA++ PIVL+RLKQKDEEWRRAQREWNKVWRELEQKV
Sbjct: 837  KKVIRKVYDKERGFEIIDALHEHPAIAAPIVLKRLKQKDEEWRRAQREWNKVWRELEQKV 896

Query: 952  FYKSLDHLGLTFKQADKKLLTAKQLISEISSIKIDQANKRIYPFTSKPKSQLDFDISDKG 1011
            ++KSLDHLGLTFKQADKKLLT KQLISEISSIK+DQ NKRI+  T KPKSQL+FDI D  
Sbjct: 897  YFKSLDHLGLTFKQADKKLLTIKQLISEISSIKVDQNNKRIHWLTPKPKSQLNFDIKDFE 956

Query: 1012 VLFDILNLVDTFIDHSTTYSNPDKEKLSAFFRGFLSIFFSIPLTDLDNPSEEH------- 1064
            +LFDIL+L + FI+HS+TYS  DKE+L+ F + F+S+FFS+PL +++N  ++        
Sbjct: 957  ILFDILSLSENFINHSSTYSTSDKERLNDFLKSFISLFFSVPLNEINNALDKRNNQKNSE 1016

Query: 1065 KVENG------DSTRKRSRDDDQF-FRDLLXXXXXXXXXXXXXXXXXXXXXXXXXAAKTS 1117
            KV +       ++ +KRS  D +    D+L                              
Sbjct: 1017 KVTDSALPDGTENQKKRSIHDIELSMSDILHRTKYQKMKLSNRGSDSQEENNIDTIIDEE 1076

Query: 1118 PD---LEYEEAVRLDAKKPWLLGNILDEANNHGFVSNRKTYNMFANTNIYVFFRHLTTMY 1174
             D    E  + +R DAK+PWLLG+I+D+ N  G +++RK +N+FANTNIYVF RH TT+Y
Sbjct: 1077 SDERLAEEADLIRQDAKRPWLLGDIIDKTNTQGIITDRKKFNLFANTNIYVFLRHWTTLY 1136

Query: 1175 QRLSEAKNINEEVTKEINSRKVVQFAKDLNLASTQLSDMGLDFKGADAYEQLLALCKRLI 1234
            +RL E K +N EVTKEIN+RK V+FA+DL L STQL +MGLDF   D+YE+LL L KRLI
Sbjct: 1137 ERLLELKEMNGEVTKEINNRKSVKFAEDLGLVSTQLKNMGLDFVDKDSYEELLRLSKRLI 1196

Query: 1235 QSDIEHQWFEESLRQAYKNKAFKIYTVDKVIQSLVKHAHSIITDAKTAEIMILFEKDRKA 1294
            ++DIEHQWFEESLRQAY N+AFK+YTVDKV+Q+LVKH H+++TD KT E+M LFEKDR +
Sbjct: 1197 ENDIEHQWFEESLRQAYNNRAFKLYTVDKVVQALVKHGHTLMTDYKTTEVMKLFEKDRLS 1256

Query: 1295 PTTSTREQILYRLQVRSCMGLTENMFRIELNSTSAHVSIQFVAVDDLTLNQPNSLKDQWQ 1354
              TS ++QILYRLQ RS M  TE MFRIE N    ++ IQ++A+DDLTL + N+ +++W+
Sbjct: 1257 SATSAKDQILYRLQARSHMSNTEYMFRIEYNKDDRNICIQYIALDDLTLKEGNTEEEKWK 1316

Query: 1355 YYLTSYSLSHPTEGVPHEEIKAPFLEKTLRDD-------GDSDEDSEWYSPGGQSVSQLR 1407
            YY+TSYSL HPTEG+ HE ++ PFL+K L  D        + ++ +  YSP G S S  +
Sbjct: 1317 YYVTSYSLPHPTEGIDHESLQIPFLQKILEFDQEELENNDEENKSNGKYSPEGVSNSMYK 1376

Query: 1408 IQINPESYALQIEPNSKDLFTRSTVNKHPTKIGEASGRDAKTMQKSLAD-MVNSEHGWKK 1466
            I+I+P +YAL I+  S D+F+R ++NK+P K+ E         +K++ +  + S +GWKK
Sbjct: 1377 IKIHPGNYALDIQTGSFDIFSRKSLNKYPVKVNEDHESLKLNKKKNILNTFLESNNGWKK 1436

Query: 1467 GLQNE-SIGKAES 1478
             L+ + S+ K ES
Sbjct: 1437 HLKKQLSLKKNES 1449

 Score =  246 bits (628), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 137/250 (54%), Positives = 157/250 (62%), Gaps = 37/250 (14%)

Query: 246 DASYRPLNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFKG 305
           DASYRPLN KDALSYLEQVK QFN+RPD+YN FLDIMKD+KSQ IDT GVIER+STLF+G
Sbjct: 207 DASYRPLNVKDALSYLEQVKQQFNSRPDIYNQFLDIMKDFKSQTIDTPGVIERVSTLFRG 266

Query: 306 YPVLIQGLNTFLPQGYKIECTSNPHDPHSIKVTTPF--DTTRELSLDHNTGGSAVGGHLA 363
           YP LIQG NTFLP GY+I+C SNP+DP  IKVTTP    T  E++       S +    A
Sbjct: 267 YPSLIQGFNTFLPTGYRIDCPSNPNDP--IKVTTPIGSSTLHEMTRSVQRANSNLQQQQA 324

Query: 364 GPATVSTSPSQIPRQETAVSETKQEETPVDLPASAAFAQDQVHHAESDTQREIXXXXXXX 423
                    +QIP    + +         +L A+     DQ   A               
Sbjct: 325 LSQNNMMQQAQIPIGSISNN--------ANLNAAVQSVDDQAKQA--------------- 361

Query: 424 XXXXXXXYATNRPNGDVEFSHAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPIHEV 483
                     N+   DVEFS AI+YVNKIK RFADQPDIYK+FLEILQTYQREQKPI+EV
Sbjct: 362 ----------NKKPADVEFSQAINYVNKIKNRFADQPDIYKNFLEILQTYQREQKPINEV 411

Query: 484 YTQVTSLFQN 493
           Y QVT LFQN
Sbjct: 412 YAQVTILFQN 421

 Score = 49.7 bits (117), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 48/83 (57%), Gaps = 2/83 (2%)

Query: 242 EHVQDASYRP--LNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERI 299
           +  + A+ +P  + F  A++Y+ ++K +F ++PD+Y +FL+I++ Y+ +      V  ++
Sbjct: 356 DQAKQANKKPADVEFSQAINYVNKIKNRFADQPDIYKNFLEILQTYQREQKPINEVYAQV 415

Query: 300 STLFKGYPVLIQGLNTFLPQGYK 322
           + LF+  P L+     FLP   K
Sbjct: 416 TILFQNAPDLLDDFKKFLPDSSK 438

>NDAI0C02660 Chr3 complement(615526..620499) [4974 bp, 1657 aa] {ON}
            Anc_6.29 YOL004W
          Length = 1657

 Score = 1039 bits (2686), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 511/858 (59%), Positives = 635/858 (74%), Gaps = 48/858 (5%)

Query: 660  EPTSRPEIDLDPSLVPVIPEPIRPLENDSTLIEETSFFDKAKKYMGNKQVYTEFLKILNL 719
            E  +RPEIDLDPS+VP+IPEP  P+EN+ TL+EETSFF+K KK++ +K +Y EFLK+LNL
Sbjct: 713  EAPTRPEIDLDPSIVPIIPEPTEPIENNITLVEETSFFEKVKKFISSKPIYMEFLKVLNL 772

Query: 720  FSQDLIDTDELVDKVEHYLGGNSELFDWFKSFVNYVERPKHIENVVHEKHRLDLDLCEAC 779
            +SQDL+ T+ELV +V++Y+G N ELFDWFK+FV Y E P  IEN++HEKH+LDLDLCEA 
Sbjct: 773  YSQDLLSTNELVTRVDYYIGSNKELFDWFKTFVGYSEIPSTIENIIHEKHKLDLDLCEAY 832

Query: 780  CPSYKKLPKADTFMPCCGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIE 839
             PSYKKLPK DTFMPC GRD MCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIE
Sbjct: 833  GPSYKKLPKTDTFMPCSGRDAMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIE 892

Query: 840  EERHEYDYYIEANLRTIQLLETIANKISNMTVEEKKTFKLPPGLGHTSTTIYKKVIRKVY 899
            EERHEYD++IE+NLRTIQ LETIANKI+NMT EEKK FKLP GLGHTS+TIYKKVIRKVY
Sbjct: 893  EERHEYDFHIESNLRTIQTLETIANKINNMTAEEKKNFKLPVGLGHTSSTIYKKVIRKVY 952

Query: 900  DKDRGFEIIDALHENPAVSVPIVLRRLKQKDEEWRRAQREWNKVWRELEQKVFYKSLDHL 959
            DK+RGFEIIDALHE+PA +VPI+LRRLK+KDEEWRRAQREWNKVWRELEQKV+YKSLDHL
Sbjct: 953  DKERGFEIIDALHEHPAFAVPIILRRLKEKDEEWRRAQREWNKVWRELEQKVYYKSLDHL 1012

Query: 960  GLTFKQADKKLLTAKQLISEISSIKIDQANKRIYPFTSKPKSQLDFDISDKGVLFDILNL 1019
            GLTFKQADKKLLT KQLISEISSI++DQ NKRI+  T KPKSQLDF  +D  +L DIL+L
Sbjct: 1013 GLTFKQADKKLLTTKQLISEISSIQVDQNNKRIHWLTPKPKSQLDFTFNDHDILVDILDL 1072

Query: 1020 VDTFIDHSTTYSNPDKEKLSAFFRGFLSIFFSIPLTDLD---NPSEEHKVENG------- 1069
             + FIDH++TYSN +KE+L  F R F+ +FFSIP +++D   +   + K E G       
Sbjct: 1073 ANVFIDHTSTYSNSEKERLKDFLRVFIGLFFSIPSSEIDKKLSGKNDEKFEKGSSSSSST 1132

Query: 1070 ----DSTRKRSRDDDQFFRDLLXXXXXXXXXXXXXXXXXXXXXXXXXAA---------KT 1116
                 S +KRS + D    D+L                                    + 
Sbjct: 1133 SNSTPSAKKRSLELDIPLADVLRKYKYQKIKEKVINELENNSNEYDERDEEFDEELKRQQ 1192

Query: 1117 SPDLEYEEAVRLDAKKPWLLGNILDEANNHGFVSNRKTYNMFANTNIYVFFRHLTTMYQR 1176
                E +  +  + KKPWLLG+++D+ + HG + NR  +N+FANTNIYVFFRH TT+Y+R
Sbjct: 1193 QEQEEEDHMIDEEMKKPWLLGSVIDKTSEHGLIENRHIFNLFANTNIYVFFRHWTTIYER 1252

Query: 1177 LSEAKNINEEVTKEINSRKVVQFAKDLNLASTQLSDMGLDFKGADAYEQLLALCKRLIQS 1236
            L E K IN++VT+EINSRKV  FAKDL L STQL+ MGLDFK +D+Y++LL L KRLI++
Sbjct: 1253 LLELKQINDKVTREINSRKVTPFAKDLGLISTQLTMMGLDFKTSDSYKELLNLTKRLIKN 1312

Query: 1237 DIEHQWFEESLRQAYKNKAFKIYTVDKVIQSLVKHAHSIITDAKTAEIMILFEKDRKAPT 1296
            DIEHQWFEESLRQAY NKAFK+YT DKVIQ+LVKHA+SI+TD+K +EIM LFEKDR   +
Sbjct: 1313 DIEHQWFEESLRQAYNNKAFKLYTADKVIQALVKHANSILTDSKASEIMALFEKDRLRSS 1372

Query: 1297 TSTREQILYRLQVRSCMGLTENMFRIELNSTSAHVSIQFVAVDDLTLNQPNSLKDQWQYY 1356
            T+TR+QI+YRLQ R+ M  TENMFRIE N  + HV IQ++AV+DLTL    + K+ W+YY
Sbjct: 1373 TTTRDQIIYRLQTRTHMTNTENMFRIEFNENTNHVCIQYIAVEDLTLKPSPTTKETWEYY 1432

Query: 1357 LTSYSLSHPTEGVPHEEIKAPFLEKTLR----------DDGDSDEDSEWYSPGGQSVSQL 1406
            +TSY+L HPTEGVP E +K PFLEK L           ++ + +E  E  SP G S S+L
Sbjct: 1433 VTSYALPHPTEGVPQEGLKVPFLEKNLNLELENAQDLDNETEKNEFIEKISPEGISTSKL 1492

Query: 1407 RIQINPESYALQIEPNSKDLFTRSTVNKHPTKIGEASGRDAKTMQKSLAD-------MVN 1459
            +I+I+ E+Y L +EP S D+F+R ++NK PT        DAK ++ S+ +        ++
Sbjct: 1493 KIKIDQETYNLDVEPGSFDVFSRKSLNKFPT--------DAKKIESSIKEKSEAFNKFLS 1544

Query: 1460 SEHGWKKGLQNESIGKAE 1477
            S+ GW    + + +   E
Sbjct: 1545 SKRGWNNQFKPDQVAGIE 1562

 Score =  224 bits (571), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 132/267 (49%), Positives = 156/267 (58%), Gaps = 32/267 (11%)

Query: 245 QDASYRPLNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFK 304
           +D  YRPLN KDALSYLEQVK QFN++P +YN FLDIMKD+KSQ IDT GVIER+STLFK
Sbjct: 266 EDPEYRPLNVKDALSYLEQVKVQFNSQPVIYNQFLDIMKDFKSQTIDTPGVIERVSTLFK 325

Query: 305 GYPVLIQGLNTFLPQGYKIECTSNPHDPHSIKVTTPFDTTRELSLDHNTGGSAVGGHLAG 364
           GYPVLIQG NTFLPQGY I C+ NP DP  ++VTTP  T+   +L  N   + V   L  
Sbjct: 326 GYPVLIQGFNTFLPQGYTIHCSDNPDDP--VRVTTPMGTSTYTNLP-NVDNTNVSPTLPT 382

Query: 365 PATVSTSPSQIPRQETAVSETKQEETPVDLPASAAFAQDQVH---HAESDTQREI----- 416
              +   P      +T            ++  +AA    QVH   H +  TQ +      
Sbjct: 383 VQPLLQQPQPQGNNDTT-----------NVINNAANQPQQVHAQTHLQEQTQAQTPADAD 431

Query: 417 ----------XXXXXXXXXXXXXXYATNRPNGDVEFSHAISYVNKIKTRFADQPDIYKHF 466
                                         N +VEFS AI+YVNKIKTR+ADQP IYKHF
Sbjct: 432 AQAQAEVQAQVQAHAQAQAQAQAQMQAQNQNPEVEFSQAINYVNKIKTRYADQPFIYKHF 491

Query: 467 LEILQTYQREQKPIHEVYTQVTSLFQN 493
           LEILQTYQRE+KPI EVY QVT LF +
Sbjct: 492 LEILQTYQREEKPISEVYEQVTVLFND 518

 Score = 50.1 bits (118), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 42/68 (61%)

Query: 252 LNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFKGYPVLIQ 311
           + F  A++Y+ ++K ++ ++P +Y HFL+I++ Y+ +      V E+++ LF   P L++
Sbjct: 465 VEFSQAINYVNKIKTRYADQPFIYKHFLEILQTYQREEKPISEVYEQVTVLFNDAPDLLE 524

Query: 312 GLNTFLPQ 319
               FLP+
Sbjct: 525 DFKKFLPE 532

>TBLA0E03160 Chr5 (789593..794812) [5220 bp, 1739 aa] {ON} Anc_6.29
            YOL004W
          Length = 1739

 Score = 1038 bits (2683), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 518/929 (55%), Positives = 671/929 (72%), Gaps = 51/929 (5%)

Query: 652  YSQDVQYMEPTSRPEIDLDPSLVPVIPEPIRPLENDSTLIEETSFFDKAKKYMGNKQVYT 711
            + Q V Y E   RPEIDLDPSLVP++PEP +P+E+   L+EET+FFDK KKY+GNK +Y 
Sbjct: 819  HQQQVMYEENAVRPEIDLDPSLVPIVPEPTQPIEDTLPLVEETNFFDKVKKYIGNKTIYA 878

Query: 712  EFLKILNLFSQDLIDTDELVDKVEHYLGGNSELFDWFKSFVNYVERPKHIENVVHEKHRL 771
            EFLK+LNL+S DL++ DELV+K+++YL  N ELF WFK+FV YVE+PKHIEN+VHEKH+L
Sbjct: 879  EFLKVLNLYSVDLLEVDELVEKIKYYLNDNEELFSWFKNFVGYVEKPKHIENIVHEKHKL 938

Query: 772  DLDLCEACCPSYKKLPKADTFMPCCGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQY 831
            DLDLCEAC PSYKKLPK DT MPC GRDEMCWE+LNDEWVGHPVWASEDSGFIAHRK   
Sbjct: 939  DLDLCEACGPSYKKLPKTDTLMPCSGRDEMCWEILNDEWVGHPVWASEDSGFIAHRKINT 998

Query: 832  EETLFKIEEERHEYDYYIEANLRTIQLLETIANKISNMTVEEKKTFKLPPGLGHTSTTIY 891
            ++   +++++ HEYD+YIE+NLRTIQ LETIA+KI+NMT  EK  FKLP GLGHT++TIY
Sbjct: 999  KKPYLRLKKKVHEYDFYIESNLRTIQTLETIASKIANMTENEKCNFKLPDGLGHTTSTIY 1058

Query: 892  KKVIRKVYDKDRGFEIIDALHENPAVSVPIVLRRLKQKDEEWRRAQREWNKVWRELEQKV 951
            KKVIRKVYDK+RGFEIIDALHE PA++VP+VL+RLKQKDEEWRRAQREWNKVWRELEQKV
Sbjct: 1059 KKVIRKVYDKERGFEIIDALHEYPAIAVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKV 1118

Query: 952  FYKSLDHLGLTFKQADKKLLTAKQLISEISSIKIDQANKRIYPFTSKPKSQLDFDISDKG 1011
            F+KSLDHLGLTFKQADKKLLT KQLISEISSIK+DQ +KR++  T KPKSQLDF++ DK 
Sbjct: 1119 FFKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTHKRMHWLTPKPKSQLDFNLPDKD 1178

Query: 1012 VLFDILNLVDTFIDHSTTYSNPDKEKLSAFFRGFLSIFFSIPL------------TDLDN 1059
            ++FDIL+ V+ F++H++TYSNP+KE+L  F + F S+FFSIPL            T+ ++
Sbjct: 1179 IIFDILSFVEIFVEHTSTYSNPEKERLIDFMKYFTSLFFSIPLEEIKEAISKRDITEKND 1238

Query: 1060 PSEEHKVENG--DSTRKRSRDDDQFFRDLLXXXXXXXXXXXXXXXXXXXXXXXXXAAKTS 1117
               E K +NG  +S ++ SRD      D+L                           K  
Sbjct: 1239 EKLEDKQKNGEENSKKRTSRDITLSLEDILQRTKYQRLKYGDDSDEVDGHGNRHDDQKLL 1298

Query: 1118 PDLEYEEAVRLDAKKPWLLGNILDEANNHGFVSNRKTYNMFANTNIYVFFRHLTTMYQRL 1177
               E EE +R +AKKPWLLG +++EAN  G + +R  +NMF+NTN+Y+F RHLTTMY+RL
Sbjct: 1299 ---EEEELLRQEAKKPWLLGTLVEEANAQGEIMHRNIFNMFSNTNMYIFIRHLTTMYERL 1355

Query: 1178 SEAKNINEEVTKEINSRKVVQFAKDLNLASTQLSDMGLDFKGADAYEQLLALCKRLIQSD 1237
             E K +N++V++EI+ RK+ +FAKDLNL STQL++MGLDF   D Y+QLL LCKRLI  D
Sbjct: 1356 HEIKQMNDKVSREISGRKISKFAKDLNLISTQLTEMGLDFSEGDVYQQLLVLCKRLILGD 1415

Query: 1238 IEHQWFEESLRQAYKNKAFKIYTVDKVIQSLVKHAHSIITDAKTAEIMILFEKDRKAPTT 1297
            +EHQWFEESLRQA+ NKAFK+YT+DKV Q+LVKHAH+II+D KT EIM LFEKDR   +T
Sbjct: 1416 LEHQWFEESLRQAFNNKAFKLYTLDKVTQALVKHAHTIISDLKTTEIMALFEKDRTKNST 1475

Query: 1298 STREQILYRLQVRSCMGLTENMFRIELNSTSAHVSIQFVAVDDLTLNQPNSLKDQWQYYL 1357
            S+++QILYRLQ R+ M   ENMFRIE N+T+ H+ IQ++A+DDLT+    +L+++W+YY+
Sbjct: 1476 SSKDQILYRLQTRARMTHNENMFRIEYNNTTKHICIQYIALDDLTVKDAKTLEEKWKYYI 1535

Query: 1358 TSYSLSHPTEGVPHEEIKAPFLEKTLR----------DDGDSDEDSEWYSPGGQSVSQLR 1407
            TSY+LSHPTEG+  E I+ PFLE+ +           DD    +    YSP G S S L+
Sbjct: 1536 TSYALSHPTEGIFQENIQIPFLERIIEEEQLYEDEETDDQKQTKSLMKYSPEGISGSTLK 1595

Query: 1408 IQINPESYALQIEPNSKDLFTRSTVNKHPTKIGEASGRDAK-TMQKSLADMVNSEHGWKK 1466
            I+I+P++Y L IE  S D+F+R ++N+ P K+ + S       ++ ++   +NS+ GWK+
Sbjct: 1596 IKIDPQNYCLNIEEGSFDIFSRKSLNQFPVKLTQDSKYGTMPKLKNTVEKFLNSKMGWKR 1655

Query: 1467 GL---QNESI-GKAESIINFVKARGFLEKA----------TTVSPDPKVEKEHSASNGAI 1512
             +   Q ESI  K + + N     G+ EK+          + +SP        SA NG  
Sbjct: 1656 AISKDQMESIESKWDHLSNNGNLEGYQEKSILKDVNGTDISKISPMKTFTVTESA-NGVP 1714

Query: 1513 PEGATTEKPGDDTDLRADETTAEDIQGNE 1541
             + A  E+ G+D       TTAE++ GNE
Sbjct: 1715 NDKADGEERGND-------TTAEEV-GNE 1735

 Score =  162 bits (410), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 76/100 (76%), Positives = 84/100 (84%), Gaps = 2/100 (2%)

Query: 245 QDASYRPLNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFK 304
           +D  YRPLN KDALSYLEQVKFQFN+RPDVYNHFLDIMKD+KSQAIDT GVI R+S+LF 
Sbjct: 295 EDNQYRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIARVSSLFH 354

Query: 305 GYPVLIQGLNTFLPQGYKIECTSNPHDPHSIKVTTPFDTT 344
            YP LIQG NTFLPQGY+IEC+SNP+ P  I V TP  TT
Sbjct: 355 DYPSLIQGFNTFLPQGYRIECSSNPNLP--ITVITPMGTT 392

 Score =  100 bits (249), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 48/58 (82%), Positives = 51/58 (87%)

Query: 435 RPNGDVEFSHAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPIHEVYTQVTSLFQ 492
           R   DVEFS AISYVNKIK RFA+QP IYKHFLEILQTYQREQKPI+EVY+QVT LFQ
Sbjct: 538 RRTQDVEFSQAISYVNKIKNRFANQPYIYKHFLEILQTYQREQKPINEVYSQVTVLFQ 595

 Score = 51.6 bits (122), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 40/65 (61%)

Query: 254 FKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFKGYPVLIQGL 313
           F  A+SY+ ++K +F N+P +Y HFL+I++ Y+ +      V  +++ LF+  P L++  
Sbjct: 545 FSQAISYVNKIKNRFANQPYIYKHFLEILQTYQREQKPINEVYSQVTVLFQEAPDLLEDF 604

Query: 314 NTFLP 318
             FLP
Sbjct: 605 KKFLP 609

 Score = 42.4 bits (98), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 33/49 (67%)

Query: 445 AISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPIHEVYTQVTSLFQN 493
           A+SY+ ++K +F  +PD+Y HFL+I++ ++ +      V  +V+SLF +
Sbjct: 307 ALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIARVSSLFHD 355

>CAGL0E02475g Chr5 (236580..241061) [4482 bp, 1493 aa] {ON} similar to
            uniprot|P22579 Saccharomyces cerevisiae YOL004w SIN3
            transcription regulatory protein
          Length = 1493

 Score = 1036 bits (2680), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 523/943 (55%), Positives = 651/943 (69%), Gaps = 71/943 (7%)

Query: 580  LPPLGNFSPPING--RDNEAQVNLPAVQPPALDFPPQQQ------------------SQS 619
            LPP+G+FSPP NG   D   Q   P  Q   +  P                      S S
Sbjct: 470  LPPIGSFSPPTNGPFVDQTQQSANPETQKGVMSLPSMMNNAEAVKEQAIKQAHSRLISDS 529

Query: 620  HRH-----VVAQGM-TNNSLPVSDMRGPV-DGGFAPQPLYSQ---------DVQYM---- 659
            H H     V++Q + +N+ +PVS++R  V +  + P+ +Y Q         D  Y+    
Sbjct: 530  HDHNSQQQVLSQNIHSNDDIPVSNLRTTVVEQNYHPETIYQQQGNAQQHMVDGGYVGTPS 589

Query: 660  EPTSRPEIDLDPSLVPVIPEPIRPLENDSTLIEETSFFDKAKKYMGNKQVYTEFLKILNL 719
            E   RPEIDLDPSLVPV+PEP  P+EN   L+EET+FF++ KK +GNKQ+Y EFLKILNL
Sbjct: 590  ELVVRPEIDLDPSLVPVVPEPTEPIENSLNLMEETNFFERVKKSIGNKQIYNEFLKILNL 649

Query: 720  FSQDLIDTDELVDKVEHYLGGNSELFDWFKSFVNYVERPKHIENVVHEKHRLDLDLCEAC 779
            FS DL+  DELVDKVE+Y+G N ELFDWFK FV Y ++PK IEN+VHEKH+LDLDLCEA 
Sbjct: 650  FSLDLLTVDELVDKVEYYIGANKELFDWFKVFVGYQDKPKRIENIVHEKHKLDLDLCEAY 709

Query: 780  CPSYKKLPKADTFMPCCGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIE 839
             PSYKKLPK DTFMPC GRD+MCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIE
Sbjct: 710  GPSYKKLPKTDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIE 769

Query: 840  EERHEYDYYIEANLRTIQLLETIANKISNMTVEEKKTFKLPPGLGHTSTTIYKKVIRKVY 899
            EERHEYDYYIE+NLRTIQ LETIANKI+NMT  EK  F+LPPGLGHTS TIYKKVIRKVY
Sbjct: 770  EERHEYDYYIESNLRTIQTLETIANKIANMTDAEKAQFRLPPGLGHTSMTIYKKVIRKVY 829

Query: 900  DKDRGFEIIDALHENPAVSVPIVLRRLKQKDEEWRRAQREWNKVWRELEQKVFYKSLDHL 959
            DK+RGFEIIDALH  PA+SVPI+LRRLKQKDEEWRRAQREWNK+WR+LEQKV++KSLDHL
Sbjct: 830  DKERGFEIIDALHNYPAISVPIILRRLKQKDEEWRRAQREWNKIWRDLEQKVYFKSLDHL 889

Query: 960  GLTFKQADKKLLTAKQLISEISSIKIDQANKRIYPFTSKPKSQLDFDISDKGVLFDILNL 1019
            GLTFKQADKKLLT KQLISEI+ IK+DQ +KRI+  T KPK+QLD+D  D  +LFDI+ L
Sbjct: 890  GLTFKQADKKLLTTKQLISEINGIKVDQNSKRIHWLTPKPKNQLDYDFPDYDILFDIIAL 949

Query: 1020 VDTFIDHSTTYSNPDKEKLSAFFRGFLSIFFSIPLTDL-----------DNPSEEHKV-- 1066
               F  ++  YSNPDKE++    R F+S FFSIPL ++           DN ++  K   
Sbjct: 950  GFVFTINTNLYSNPDKERIKDMLRVFVSQFFSIPLKEVSDALERRGFSDDNNNDSDKGSG 1009

Query: 1067 -------------ENGDSTRKRSRDDDQFFRDLLXXXXXXXXXXXXXXXXXXXXXXXXXA 1113
                         ++  S++KR  D+D    D+L                          
Sbjct: 1010 KMDQIAEEIGETEQDTSSSKKRPFDNDLNMSDILHKTKQQKTKMNKEMDGSKSPSEDLGT 1069

Query: 1114 AKTSPDLEYEEAVRLDAKKPWLLGNILDEANNHGFVSNRKTYNMFANTNIYVFFRHLTTM 1173
             +    +E   ++  + +K WL+G+++D AN    + NR  YN+FANTNIY+FFRHL T+
Sbjct: 1070 DRNVGTIEDSGSLS-EHRKQWLVGDVVDSANKETPMDNRNIYNLFANTNIYIFFRHLVTL 1128

Query: 1174 YQRLSEAKNINEEVTKEINSRKVVQFAKDLNLASTQLSDMGLDFKGADAYEQLLALCKRL 1233
            Y+RLSE K IN+E+ KEI SR+V  FAKDL L STQLS++GLDF  +DAY+QLL L KRL
Sbjct: 1129 YERLSEVKQINDEINKEIKSRRVTTFAKDLGLISTQLSELGLDFNSSDAYQQLLTLSKRL 1188

Query: 1234 IQSDIEHQWFEESLRQAYKNKAFKIYTVDKVIQSLVKHAHSIITDAKTAEIMILFEKDRK 1293
            I+ DIEHQWFEES+RQAY N+AFK+YT+DKV+QS VKHAH++I+D+KT+EIM+LFE  R 
Sbjct: 1189 IEGDIEHQWFEESIRQAYNNRAFKLYTIDKVVQSFVKHAHTLISDSKTSEIMLLFENQRN 1248

Query: 1294 APTTSTREQILYRLQVRSCMGLTENMFRIELNSTSAHVSIQFVAVDDLTLNQPNSLKDQW 1353
               T+T++QILYR+Q RS M  TENMFRIE      H SIQ++A+DDLTL    S ++ W
Sbjct: 1249 NTLTTTKDQILYRIQCRSHMSSTENMFRIEYKREKRHASIQYIALDDLTLKTAKSPEEAW 1308

Query: 1354 QYYLTSYSLSHPTEGVPHEEIKAPFLEKTLRDDGDSDED---SEWYSPGGQSVSQLRIQI 1410
             YY+TSYSLS+PTEGVPHE ++ PFLEK +  D +  +D   +  YS  G S S L I I
Sbjct: 1309 NYYVTSYSLSNPTEGVPHENLEVPFLEKVIEFDQEYSKDNGNNSTYSLAGISKSNLHIDI 1368

Query: 1411 NPESYALQIEPNSKDLFTRSTVNKHPTKIGEASGRDAKTMQKS 1453
            + E Y L ++  S D+++R+T+ K+P  +     R A   +K+
Sbjct: 1369 DREKYNLILQGGSSDVYSRATIQKYPI-VASDESRAANISEKT 1410

 Score =  251 bits (642), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 138/246 (56%), Positives = 161/246 (65%), Gaps = 39/246 (15%)

Query: 248 SYRPLNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFKGYP 307
           SYRPLN KDALSYLEQVKFQF+ RPD+YN FLDIMKD+KSQ IDT GVIER+S+LFKGYP
Sbjct: 184 SYRPLNVKDALSYLEQVKFQFHTRPDIYNLFLDIMKDFKSQTIDTPGVIERVSSLFKGYP 243

Query: 308 VLIQGLNTFLPQGYKIECTSNPHDPHSIKVTTPFDTTRELSLDHNTGGSAVGGHLAGPAT 367
            LIQG NTFLPQGY+IEC++NP+DP  IKVTTP              GS+          
Sbjct: 244 NLIQGFNTFLPQGYRIECSNNPNDP--IKVTTPM-------------GSST-------TV 281

Query: 368 VSTSPSQIPRQETAVSETKQEETPVDLPASAAFAQDQVHHAESDTQREIXXXXXXXXXXX 427
           ++T+P + P      +  +Q +      A A  AQ Q       TQ ++           
Sbjct: 282 LNTAPQKSPSPSDIQTNNQQTQ------AIAQEAQLQSQATPIPTQHDV----------- 324

Query: 428 XXXYATNRPNGDVEFSHAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPIHEVYTQV 487
              + + +   DVEFS AI+YVNKIKTRFADQPDIYK FLEILQTYQREQKPIHEVY QV
Sbjct: 325 GQNFGSAKKPADVEFSQAITYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQV 384

Query: 488 TSLFQN 493
           T LFQN
Sbjct: 385 TILFQN 390

 Score = 48.9 bits (115), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 40/67 (59%)

Query: 252 LNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFKGYPVLIQ 311
           + F  A++Y+ ++K +F ++PD+Y  FL+I++ Y+ +      V  +++ LF+  P L+ 
Sbjct: 337 VEFSQAITYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQNAPDLLD 396

Query: 312 GLNTFLP 318
               FLP
Sbjct: 397 DFKKFLP 403

>CAGL0J11594g Chr10 complement(1126896..1129709) [2814 bp, 937 aa]
            {ON} weakly similar to uniprot|P22579 Saccharomyces
            cerevisiae YOL004w SIN3 transcription regulatory protein
          Length = 937

 Score =  240 bits (613), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 140/383 (36%), Positives = 214/383 (55%), Gaps = 34/383 (8%)

Query: 683  PLENDSTLIEETSFFDKAKKYMGNKQVYTEFLKILNLFSQDLIDTDELVDKVEHYLGGNS 742
            P++  + + E   +F   +  + ++ +Y EFLK++NLF+Q LID +    +   + G ++
Sbjct: 196  PIDRPTNMAEFLIYF---RNLVYDESIYPEFLKLMNLFAQSLIDLNTFTKRAYIFFGSHN 252

Query: 743  ELFDWFKSFVN-YVERPKHIENVVHEKHRLDL-DLCEACCPSYKKLPKADTFMPCCGRDE 800
             L   F + ++ Y +  + ++  +      D+ D      PSYK+L   +T   C GRD 
Sbjct: 253  GLKTAFGNIMSEYKDIHQRMKPTLKSNDFDDIEDFSTESGPSYKRLSGFETRASCHGRDR 312

Query: 801  MCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDYYIEANLRTIQLLE 860
            +C EVLNDEWVGHPVWASE+ GFIAH+KNQYEETLFK+EEERHEYD++          L 
Sbjct: 313  LCHEVLNDEWVGHPVWASEEVGFIAHKKNQYEETLFKVEEERHEYDFF----------LL 362

Query: 861  TIANKISNMTVEEKKTFKLPPGLGH-------------TSTTIYKKVIRKVYDKDRGFEI 907
            ++ + I   T E +K+ +L    G              +  +I +KVIR++Y  + G  +
Sbjct: 363  SVEHLIVKFT-EYEKSLQLSKDDGRRRNRVSSPKEPMISLNSITEKVIRRLYGIEHGNIL 421

Query: 908  IDALHENPAVSVPIVLRRLKQKDEEWRRAQREWNKVWRELEQKVFYKSLDHLGLTFKQAD 967
            IDA+  NP   VP +L+  K+K ++W  A+ EWNK WRE+EQK +YKSLDHLGL FK A+
Sbjct: 422  IDAIKTNPEKVVPTILKTAKEKYQQWNSAKNEWNKAWREVEQKAYYKSLDHLGLPFKNAE 481

Query: 968  KKLLTAKQLISEISSIKIDQANKRIYPFTSKPKSQLDFDISDKGVLFDILNLVDTFIDHS 1027
            K+ L  KQL+ E  S K D+  K  Y        +  ++  DK VL+D+ +++   +  +
Sbjct: 482  KRFLNDKQLLLEYKSEKQDKLLKEHY-----DNYEYKYEFFDKSVLYDVKDIILCGLRSN 536

Query: 1028 TTYSNPDKEKLSAFFRGFLSIFF 1050
            ++ S   K      F  F  + F
Sbjct: 537  SSTSESQKNLYCQIFEAFFDLLF 559

 Score =  138 bits (347), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 93/311 (29%), Positives = 157/311 (50%), Gaps = 9/311 (2%)

Query: 1150 SNRKTYNMFANTNIYVFFRHLTTMYQRLSEAKNINEEVTKEINS--RKVVQFAKDLNLAS 1207
            SNR+  N+F + NI   F ++ T+Y+R ++ K     + K++ +  R+    AK L L  
Sbjct: 618  SNRQNINIFCDINIMSLFHYIQTLYERYNDVKIAETTILKDLRTKKRRPSLLAKSLKLLP 677

Query: 1208 TQLSDMGLDFKGADAYEQLLALCKRLIQSDIEHQWFEESLRQAYKNKAFKIYTVDKVIQS 1267
             QLSD GL+    D YE +    K+ +  +++HQWFEESLR  ++NKA+K+YT+D+VI++
Sbjct: 678  MQLSDNGLELGQDDGYEWIKTTSKKFLSGNLDHQWFEESLRINFENKAYKLYTIDRVIRN 737

Query: 1268 LVKHAHSIITDAKTAEIMILFEKDRKAPTTSTREQILYRLQVRSCMGLTENMFRIELNST 1327
            ++    +I       +I+ L   + K  TT+  +Q+ YR +VR  M    +MFR+E+   
Sbjct: 738  ILGVITTISQTPSLLQILDLLVDNMKKLTTTKLQQLTYRTKVRMLMDGVGDMFRLEIVRD 797

Query: 1328 SAHVSIQFVAVDDLTLNQPNSLKDQWQYYLTSYSLSHPTEGVPHEEIKAPFLEKTLRDDG 1387
            S  +  Q++ VDDL   Q +  K +   Y   Y  +  T+ +  + +  P+    L    
Sbjct: 798  SNAIYGQYIGVDDLLHAQLDKNKLEHSLYCQEYLSADATKYLDTDGLNTPYYSLNLL--- 854

Query: 1388 DSDEDSEWYSPGGQSVSQLRIQINPESYALQIEPNSKDLFTRSTVNKHPTKIGEASGRDA 1447
              +E +  +  G      L + INP  Y + I P S D+ + +    H TK+  +     
Sbjct: 855  KREEQNIPFMNGNIYKPHLSVNINPLDYVVDIAPGSIDICSST----HITKLKSSLKSSR 910

Query: 1448 KTMQKSLADMV 1458
            KT   SL   +
Sbjct: 911  KTQMASLISKI 921

>KAFR0A04880 Chr1 complement(964742..965776) [1035 bp, 344 aa] {ON} 
          Length = 344

 Score = 36.6 bits (83), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 39/145 (26%), Positives = 61/145 (42%), Gaps = 27/145 (18%)

Query: 1128 LDAKKPWLLGNILDEANNHGFVSNRKTYNMFANTNIYVFFRHLTTMYQRLSEA----KNI 1183
            LD    WL  NI           N   Y +   T    F  +L T+Y++L+E     K +
Sbjct: 182  LDTFNSWLQENI-----------NMGVYKIGLATKQSEFESNLATLYRKLNECEDHLKGV 230

Query: 1184 NEEVTKEINSRKVVQFAKDLNLASTQLSDMGLDF-----KGADAYEQLLALCKRLIQSDI 1238
             +++ KE+     V+  K   L   Q++D  + F     +   ++ Q L    R+I+ D 
Sbjct: 231  YKDIEKEVGKNNKVEILKKFYLFGNQITDTDIRFYTTAIRFDSSHAQHLKCNWRIIRDDY 290

Query: 1239 E--HQWFEESLRQAYKN-KAFKIYT 1260
               H W    LR  Y N KAF++ T
Sbjct: 291  PYIHLW----LRNLYWNHKAFRLTT 311

>Kpol_1064.53 s1064 (95468..96937) [1470 bp, 489 aa] {ON}
           (95468..96937) [1470 nt, 490 aa]
          Length = 489

 Score = 34.7 bits (78), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 37/69 (53%), Gaps = 3/69 (4%)

Query: 703 YMGNKQVYTEFLKILNLFSQDLIDTDELVDKVEHYLGGNSELFDWFKSFVNY---VERPK 759
           Y G K +Y ++LK+LN   QD     + V+  +     +S++ ++  + + Y    ER K
Sbjct: 80  YTGLKNMYQDYLKVLNQLKQDKAAVRDEVEASDDKPEESSDVLEYIVNELPYQQPTERKK 139

Query: 760 HIENVVHEK 768
           +I+N +H K
Sbjct: 140 YIDNFIHSK 148

>CAGL0H09350g Chr8 complement(912452..918349) [5898 bp, 1965 aa] {ON}
            similar to uniprot|P19812 Saccharomyces cerevisiae
            YGR184c UBR1
          Length = 1965

 Score = 33.1 bits (74), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 53/118 (44%), Gaps = 20/118 (16%)

Query: 675  PVIPEPIRPLENDSTLIEETSFFDKAKKYMGNKQVYTEFLKILNLFSQDLIDT------D 728
            P+I + +  +E+D ++ +  SF + A   +      TEF    ++F Q L+D+      D
Sbjct: 1622 PLIIDDVN-IESDISIEDYVSFANSATPLL------TEFTDFDDMFVQALLDSKFTEGND 1674

Query: 729  ELVDKVEHYLGGNSELFDWFKSFVNYVERPKH-------IENVVHEKHRLDLDLCEAC 779
              +  + H   G  +L +  K    YV   K        + NV++ K+RLD  +C  C
Sbjct: 1675 TYLKDIPHEYPGVVKLINLKKYLNTYVTDSKQFKLLEEALTNVINPKNRLDFRICLTC 1732

>KLTH0C10758g Chr3 complement(887737..889305) [1569 bp, 522 aa] {ON}
            similar to uniprot|P40959 Saccharomyces cerevisiae
            YMR004W MVP1 Protein required for sorting proteins to the
            vacuole overproduction of Mvp1p suppresses several
            dominant VPS1 mutations Mvp1p and Vps1p act in concert to
            promote membrane traffic to the vacuole
          Length = 522

 Score = 32.7 bits (73), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 35/138 (25%), Positives = 60/138 (43%), Gaps = 32/138 (23%)

Query: 934  RRAQREWNKVWRELEQKVFYKSLDHLGLTFKQADKKLLTAKQLISEISSIKIDQANKRIY 993
            R+ +  + K+WR+            +   + QAD  +  A +L ++I+ + +D+  KR+ 
Sbjct: 277  RKIEASFIKMWRK-----------DMAERWNQADASIDGALELWAKIT-VLVDRCEKRLR 324

Query: 994  PFTSKPKSQLDFDI------------SDKGVLFDILNLVDTFIDHSTTYSNPDKE----- 1036
             F ++ +S L   +            SD G L DI N +     H TT +N  KE     
Sbjct: 325  -FIAQDRSMLASMLDSFSDSAPQIFASDDGTLLDIKNHLGIVSKHLTTCNNLVKEENMQA 383

Query: 1037 --KLSAFFRGFLSIFFSI 1052
              +LS  FR F  +  S+
Sbjct: 384  SSELSPRFRTFTDVLLSL 401

>Suva_16.335 Chr16 complement(588678..589631) [954 bp, 317 aa] {ON}
           YPR013C (REAL)
          Length = 317

 Score = 32.3 bits (72), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 36/129 (27%), Positives = 55/129 (42%), Gaps = 28/129 (21%)

Query: 579 NLPPLGNFSPPI-NGRDNEAQVNLPAVQPPALDFPPQQQSQSHRHVVAQGMTNNSLP-VS 636
           NLPP+ +  P   +G+ N A   L         +PPQQ        V  GM  N +P V+
Sbjct: 73  NLPPISSLLPNFESGQRNNADTRL--------QYPPQQ--------VYHGM--NIVPMVN 114

Query: 637 DMRGPVDGGFAPQ--PLYSQDVQYMEPTSRPE------IDLDPSLVPVIPEPIRPLENDS 688
           ++  P+     P   P+Y  D Q   P S+P         + P +VP + +P+ P E + 
Sbjct: 115 EVYTPISMNVTPDQYPIYFSDNQQQIPHSQPAHITSSAPLMMPVIVPTLYKPMGPYEKEP 174

Query: 689 TLIEETSFF 697
             +   S F
Sbjct: 175 ITVAPESNF 183

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.132    0.385 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 155,846,373
Number of extensions: 6998362
Number of successful extensions: 24247
Number of sequences better than 10.0: 66
Number of HSP's gapped: 24880
Number of HSP's successfully gapped: 142
Length of query: 1541
Length of database: 53,481,399
Length adjustment: 123
Effective length of query: 1418
Effective length of database: 39,377,481
Effective search space: 55837268058
Effective search space used: 55837268058
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 73 (32.7 bits)