Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_56.224596.28ON38338320530.0
KLTH0C10978g6.28ON37737713160.0
Ecym_30326.28ON37737811531e-157
SAKL0E01518g6.28ON37937911451e-156
TDEL0G044106.28ON38137910791e-146
Kpol_1037.236.28ON37838110661e-144
YOL003C (PFA4)6.28ON37837910611e-143
Suva_15.1726.28ON39838110491e-141
NDAI0C026506.28ON38939110191e-137
KLLA0C06204g6.28ON37737910141e-136
CAGL0E02497g6.28ON37637910091e-135
ZYRO0C07546g6.28ON3773799961e-133
Skud_15.1596.28ON3793809961e-133
NCAS0D021406.28ON3763809941e-133
TPHA0J003906.28ON3803809911e-132
Smik_15.1676.28ON3783799911e-132
ACL003C6.28ON3753789531e-127
KNAG0F029306.28ON3863898831e-116
KAFR0A051306.28ON3964008211e-106
TBLA0B004806.28ON3774054562e-52
KLLA0E02069g3.12ON3251712081e-17
KAFR0A085903.12ON3311342072e-17
KLTH0F19580g3.12ON3421402044e-17
KNAG0K025703.12ON3281362035e-17
NDAI0G013403.12ON3351632011e-16
Kpol_1014.293.12ON3261062001e-16
NCAS0E013003.12ON3271621992e-16
Kwal_55.221263.12ON3601381993e-16
TBLA0H001503.12ON3451361974e-16
ZYRO0C03410g3.12ON3272051949e-16
NCAS0B035908.286ON3291391921e-15
SAKL0C13596g3.12ON3331391903e-15
CAGL0D02508g3.12ON332541894e-15
TPHA0C010708.286ON3331971885e-15
TDEL0F041308.286ON3282221886e-15
TPHA0P015603.12ON3311111861e-14
Suva_14.153.12ON3302341832e-14
KLLA0F19690g8.286ON3242331823e-14
KAFR0B053708.286ON3291491805e-14
TDEL0A003103.12ON329551798e-14
Skud_14.153.12ON336631781e-13
Smik_14.63.12ON334631781e-13
YNL326C (PFA3)3.12ON336541762e-13
SAKL0H16434g8.286ON5551391773e-13
Skud_12.3218.389ON356581753e-13
TBLA0D040408.286ON329621743e-13
NDAI0J010008.286ON3391951743e-13
YDR126W (SWF1)8.286ON3361411743e-13
ADL197C3.12ON390721754e-13
SAKL0H13860g8.389ON352721735e-13
KLTH0G13112g8.286ON3491641735e-13
Skud_4.3878.286ON3361411727e-13
Ecym_20143.12ON339501727e-13
ZYRO0D06600g8.286ON3301391701e-12
Suva_2.2898.286ON3351541701e-12
Smik_12.3068.389ON359551692e-12
ZYRO0C04092g8.389ON366581683e-12
KLLA0D18370g8.389ON355981673e-12
Smik_4.3728.286ON3351441663e-12
TDEL0F051308.389ON359731674e-12
TPHA0C023608.389ON404581674e-12
NCAS0C029208.389ON374581647e-12
CAGL0B01991g8.286ON3301391639e-12
KLTH0F08668g8.389ON358561622e-11
YLR246W (ERF2)8.389ON359581612e-11
KAFR0H019808.389ON361581602e-11
KNAG0A027108.389ON3541261593e-11
Suva_10.3428.389ON356581585e-11
NDAI0G022508.389ON3891791585e-11
Ecym_41788.389ON368541569e-11
TBLA0H009208.389ON360791551e-10
CAGL0G08217g8.389ON326581541e-10
AGL125C8.389ON367581513e-10
Kwal_23.33028.389ON353491505e-10
Kpol_1033.168.286ON321481495e-10
KNAG0H031108.286ON3311021486e-10
Ecym_42828.286ON340501487e-10
Skud_4.7345.579ON380841443e-09
TBLA0E028305.579ON386901425e-09
Kwal_56.236978.286ON338601415e-09
YDR459C (PFA5)5.579ON374871417e-09
AGR065W8.286ON326441371e-08
Smik_4.7375.579ON3782271372e-08
Kwal_47.183665.579ON356781353e-08
Suva_2.6345.579ON3881211345e-08
KNAG0C028305.579ON354741336e-08
NDAI0H018905.579ON406661329e-08
Ecym_41145.579ON3721181301e-07
TDEL0A044405.579ON365731292e-07
NCAS0F013905.579ON3742501283e-07
KLTH0G04972g5.579ON367781273e-07
SAKL0G06160g5.579ON364651247e-07
Kpol_1004.575.579ON362651169e-06
ZYRO0D13860g5.579ON3651991151e-05
KAFR0I011105.579ON3701681141e-05
CAGL0K06347g5.579ON352761122e-05
NDAI0H008505.626ON786781071e-04
KLLA0D06149g5.579ON349791024e-04
Kpol_526.325.626ON7771101018e-04
ABR203W5.579ON35964999e-04
Skud_4.5275.626ON76452950.004
Smik_4.5155.626ON76452930.007
ZYRO0C11132g5.626ON759105920.010
KAFR0H005705.626ON75772900.016
KNAG0C062305.626ON752104900.017
TPHA0C003705.626ON75955890.019
CAGL0M08712g5.626ON76352890.020
Suva_2.4325.626ON76352890.023
YOR034C (AKR2)5.626ON74954880.025
KLTH0E02420g5.626ON73459880.027
YDR264C (AKR1)5.626ON76452880.029
NCAS0C052805.626ON75752860.044
KNAG0B031405.626ON682114850.058
TBLA0J008305.626ON73957790.32
TDEL0A049205.626ON75060780.39
Suva_8.875.626ON730184770.60
Smik_15.2135.626ON744160770.62
AER388C5.626ON72450760.73
Smik_7.2674.97ON66751750.90
Ecym_13305.626ON739138741.2
SAKL0G07326g5.626ON73752732.0
Skud_15.1995.626ON741164722.3
KNAG0A059702.402ON100568703.7
NDAI0G039503.46ON45865694.3
YGL023C (PIB2)4.97ON63550695.0
KLLA0E16721g5.626ON75258695.3
KLLA0E23783g8.558ON55376686.1
Suva_7.2564.97ON68850678.5
Skud_5.3078.233ON546114678.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_56.22459
         (383 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_56.22459 s56 (138563..139714) [1152 bp, 383 aa] {ON} YOL003...   795   0.0  
KLTH0C10978g Chr3 complement(905760..906893) [1134 bp, 377 aa] {...   511   0.0  
Ecym_3032 Chr3 (63354..64487) [1134 bp, 377 aa] {ON} similar to ...   448   e-157
SAKL0E01518g Chr5 (113669..114808) [1140 bp, 379 aa] {ON} simila...   445   e-156
TDEL0G04410 Chr7 complement(800085..801230) [1146 bp, 381 aa] {O...   420   e-146
Kpol_1037.23 s1037 complement(51397..52533) [1137 bp, 378 aa] {O...   415   e-144
YOL003C Chr15 complement(321858..322994) [1137 bp, 378 aa] {ON} ...   413   e-143
Suva_15.172 Chr15 complement(296325..297521) [1197 bp, 398 aa] {...   408   e-141
NDAI0C02650 Chr3 (614101..615270) [1170 bp, 389 aa] {ON} Anc_6.28     397   e-137
KLLA0C06204g Chr3 complement(548912..550045) [1134 bp, 377 aa] {...   395   e-136
CAGL0E02497g Chr5 complement(241355..242485) [1131 bp, 376 aa] {...   393   e-135
ZYRO0C07546g Chr3 complement(574411..575544) [1134 bp, 377 aa] {...   388   e-133
Skud_15.159 Chr15 complement(281485..282624) [1140 bp, 379 aa] {...   388   e-133
NCAS0D02140 Chr4 complement(398924..400054) [1131 bp, 376 aa] {O...   387   e-133
TPHA0J00390 Chr10 (88587..89729) [1143 bp, 380 aa] {ON} Anc_6.28...   386   e-132
Smik_15.167 Chr15 complement(289180..290316) [1137 bp, 378 aa] {...   386   e-132
ACL003C Chr3 complement(352024..353151) [1128 bp, 375 aa] {ON} S...   371   e-127
KNAG0F02930 Chr6 complement(557052..558212) [1161 bp, 386 aa] {O...   344   e-116
KAFR0A05130 Chr1 complement(1019919..1021109) [1191 bp, 396 aa] ...   320   e-106
TBLA0B00480 Chr2 (93291..94424) [1134 bp, 377 aa] {ON} Anc_6.28 ...   180   2e-52
KLLA0E02069g Chr5 complement(195185..196162) [978 bp, 325 aa] {O...    85   1e-17
KAFR0A08590 Chr1 (1722408..1723403) [996 bp, 331 aa] {ON} Anc_3....    84   2e-17
KLTH0F19580g Chr6 (1586776..1587804) [1029 bp, 342 aa] {ON} simi...    83   4e-17
KNAG0K02570 Chr11 (511867..512853) [987 bp, 328 aa] {ON} Anc_3.1...    83   5e-17
NDAI0G01340 Chr7 (301254..302261) [1008 bp, 335 aa] {ON} Anc_3.12      82   1e-16
Kpol_1014.29 s1014 (48992..49972) [981 bp, 326 aa] {ON} (48992.....    82   1e-16
NCAS0E01300 Chr5 complement(250120..251103) [984 bp, 327 aa] {ON...    81   2e-16
Kwal_55.22126 s55 (1121936..1123018) [1083 bp, 360 aa] {ON} YNL3...    81   3e-16
TBLA0H00150 Chr8 complement(13169..14206) [1038 bp, 345 aa] {ON}...    80   4e-16
ZYRO0C03410g Chr3 (265684..266667) [984 bp, 327 aa] {ON} similar...    79   9e-16
NCAS0B03590 Chr2 complement(636400..637389) [990 bp, 329 aa] {ON}      79   1e-15
SAKL0C13596g Chr3 (1198957..1199958) [1002 bp, 333 aa] {ON} simi...    78   3e-15
CAGL0D02508g Chr4 (256760..257758) [999 bp, 332 aa] {ON} similar...    77   4e-15
TPHA0C01070 Chr3 complement(244556..245557) [1002 bp, 333 aa] {O...    77   5e-15
TDEL0F04130 Chr6 (759451..760437) [987 bp, 328 aa] {ON} Anc_8.28...    77   6e-15
TPHA0P01560 Chr16 (318550..319545) [996 bp, 331 aa] {ON} Anc_3.1...    76   1e-14
Suva_14.15 Chr14 complement(23560..24552) [993 bp, 330 aa] {ON} ...    75   2e-14
KLLA0F19690g Chr6 (1820355..1821329) [975 bp, 324 aa] {ON} simil...    75   3e-14
KAFR0B05370 Chr2 complement(1105534..1106523) [990 bp, 329 aa] {...    74   5e-14
TDEL0A00310 Chr1 complement(54006..54995) [990 bp, 329 aa] {ON} ...    74   8e-14
Skud_14.15 Chr14 complement(20841..21851) [1011 bp, 336 aa] {ON}...    73   1e-13
Smik_14.6 Chr14 complement(11864..12868) [1005 bp, 334 aa] {ON} ...    73   1e-13
YNL326C Chr14 complement(27337..28347) [1011 bp, 336 aa] {ON}  P...    72   2e-13
SAKL0H16434g Chr8 complement(1447419..1449086) [1668 bp, 555 aa]...    73   3e-13
Skud_12.321 Chr12 (571368..572438) [1071 bp, 356 aa] {ON} YLR246...    72   3e-13
TBLA0D04040 Chr4 complement(1006179..1007168) [990 bp, 329 aa] {...    72   3e-13
NDAI0J01000 Chr10 (229188..230207) [1020 bp, 339 aa] {ON} Anc_8....    72   3e-13
YDR126W Chr4 (703234..704244) [1011 bp, 336 aa] {ON}  SWF1Palmit...    72   3e-13
ADL197C Chr4 complement(350991..352163) [1173 bp, 390 aa] {ON} S...    72   4e-13
SAKL0H13860g Chr8 (1185970..1187028) [1059 bp, 352 aa] {ON} simi...    71   5e-13
KLTH0G13112g Chr7 complement(1129318..1130367) [1050 bp, 349 aa]...    71   5e-13
Skud_4.387 Chr4 (675002..676012) [1011 bp, 336 aa] {ON} YDR126W ...    71   7e-13
Ecym_2014 Chr2 complement(19723..20742) [1020 bp, 339 aa] {ON} s...    71   7e-13
ZYRO0D06600g Chr4 complement(573724..574716) [993 bp, 330 aa] {O...    70   1e-12
Suva_2.289 Chr2 (498420..499427) [1008 bp, 335 aa] {ON} YDR126W ...    70   1e-12
Smik_12.306 Chr12 (568353..569432) [1080 bp, 359 aa] {ON} YLR246...    70   2e-12
ZYRO0C04092g Chr3 complement(320634..321734) [1101 bp, 366 aa] {...    69   3e-12
KLLA0D18370g Chr4 complement(1549382..1550449) [1068 bp, 355 aa]...    69   3e-12
Smik_4.372 Chr4 (664437..665444) [1008 bp, 335 aa] {ON} YDR126W ...    69   3e-12
TDEL0F05130 Chr6 complement(961887..962966) [1080 bp, 359 aa] {O...    69   4e-12
TPHA0C02360 Chr3 (531446..532660) [1215 bp, 404 aa] {ON} Anc_8.3...    69   4e-12
NCAS0C02920 Chr3 (549815..550939) [1125 bp, 374 aa] {ON} Anc_8.389     68   7e-12
CAGL0B01991g Chr2 (182894..183886) [993 bp, 330 aa] {ON} similar...    67   9e-12
KLTH0F08668g Chr6 (750644..751720) [1077 bp, 358 aa] {ON} simila...    67   2e-11
YLR246W Chr12 (627118..628197) [1080 bp, 359 aa] {ON}  ERF2Subun...    67   2e-11
KAFR0H01980 Chr8 (367846..368931) [1086 bp, 361 aa] {ON} Anc_8.3...    66   2e-11
KNAG0A02710 Chr1 (294783..295847) [1065 bp, 354 aa] {ON} Anc_8.3...    66   3e-11
Suva_10.342 Chr10 (593959..595029) [1071 bp, 356 aa] {ON} YLR246...    65   5e-11
NDAI0G02250 Chr7 (503564..504733) [1170 bp, 389 aa] {ON} Anc_8.389     65   5e-11
Ecym_4178 Chr4 (375346..376452) [1107 bp, 368 aa] {ON} similar t...    65   9e-11
TBLA0H00920 Chr8 (203681..204763) [1083 bp, 360 aa] {ON} Anc_8.3...    64   1e-10
CAGL0G08217g Chr7 complement(778823..779803) [981 bp, 326 aa] {O...    64   1e-10
AGL125C Chr7 complement(473496..474599) [1104 bp, 367 aa] {ON} S...    63   3e-10
Kwal_23.3302 s23 (234749..235810) [1062 bp, 353 aa] {ON} YLR246W...    62   5e-10
Kpol_1033.16 s1033 (35544..36509) [966 bp, 321 aa] {ON} (35544.....    62   5e-10
KNAG0H03110 Chr8 complement(584877..585872) [996 bp, 331 aa] {ON...    62   6e-10
Ecym_4282 Chr4 complement(608898..609920) [1023 bp, 340 aa] {ON}...    62   7e-10
Skud_4.734 Chr4 complement(1302386..1303528) [1143 bp, 380 aa] {...    60   3e-09
TBLA0E02830 Chr5 (700364..701524) [1161 bp, 386 aa] {ON} Anc_5.5...    59   5e-09
Kwal_56.23697 s56 complement(665965..666981) [1017 bp, 338 aa] {...    59   5e-09
YDR459C Chr4 complement(1382319..1383443) [1125 bp, 374 aa] {ON}...    59   7e-09
AGR065W Chr7 (835871..836851) [981 bp, 326 aa] {ON} Syntenic hom...    57   1e-08
Smik_4.737 Chr4 complement(1303557..1304693) [1137 bp, 378 aa] {...    57   2e-08
Kwal_47.18366 s47 (796220..797290) [1071 bp, 356 aa] {ON} YDR459...    57   3e-08
Suva_2.634 Chr2 complement(1134492..1135658) [1167 bp, 388 aa] {...    56   5e-08
KNAG0C02830 Chr3 complement(563740..564804) [1065 bp, 354 aa] {O...    56   6e-08
NDAI0H01890 Chr8 complement(458111..459331) [1221 bp, 406 aa] {O...    55   9e-08
Ecym_4114 Chr4 complement(238112..239230) [1119 bp, 372 aa] {ON}...    55   1e-07
TDEL0A04440 Chr1 complement(795121..796218) [1098 bp, 365 aa] {O...    54   2e-07
NCAS0F01390 Chr6 complement(275879..277003) [1125 bp, 374 aa] {O...    54   3e-07
KLTH0G04972g Chr7 complement(404787..405890) [1104 bp, 367 aa] {...    54   3e-07
SAKL0G06160g Chr7 complement(514850..515944) [1095 bp, 364 aa] {...    52   7e-07
Kpol_1004.57 s1004 complement(123368..124456) [1089 bp, 362 aa] ...    49   9e-06
ZYRO0D13860g Chr4 complement(1171732..1172829) [1098 bp, 365 aa]...    49   1e-05
KAFR0I01110 Chr9 (214426..215538) [1113 bp, 370 aa] {ON} Anc_5.5...    49   1e-05
CAGL0K06347g Chr11 complement(624046..625104) [1059 bp, 352 aa] ...    48   2e-05
NDAI0H00850 Chr8 (190934..193294) [2361 bp, 786 aa] {ON} Anc_5.6...    46   1e-04
KLLA0D06149g Chr4 (527705..528754) [1050 bp, 349 aa] {ON} simila...    44   4e-04
Kpol_526.32 s526 complement(77926..80259) [2334 bp, 777 aa] {ON}...    44   8e-04
ABR203W Chr2 (782704..783783) [1080 bp, 359 aa] {ON} Syntenic ho...    43   9e-04
Skud_4.527 Chr4 complement(938779..941073) [2295 bp, 764 aa] {ON...    41   0.004
Smik_4.515 Chr4 complement(928882..931176) [2295 bp, 764 aa] {ON...    40   0.007
ZYRO0C11132g Chr3 complement(861388..863667) [2280 bp, 759 aa] {...    40   0.010
KAFR0H00570 Chr8 (100639..102912) [2274 bp, 757 aa] {ON} Anc_5.6...    39   0.016
KNAG0C06230 Chr3 complement(1208896..1211154) [2259 bp, 752 aa] ...    39   0.017
TPHA0C00370 Chr3 (62796..65075) [2280 bp, 759 aa] {ON} Anc_5.626...    39   0.019
CAGL0M08712g Chr13 (866454..868745) [2292 bp, 763 aa] {ON} simil...    39   0.020
Suva_2.432 Chr2 complement(762658..764949) [2292 bp, 763 aa] {ON...    39   0.023
YOR034C Chr15 complement(394837..397086) [2250 bp, 749 aa] {ON} ...    39   0.025
KLTH0E02420g Chr5 complement(211548..213752) [2205 bp, 734 aa] {...    39   0.027
YDR264C Chr4 complement(996029..998323) [2295 bp, 764 aa] {ON}  ...    39   0.029
NCAS0C05280 Chr3 complement(1073710..1075983) [2274 bp, 757 aa] ...    38   0.044
KNAG0B03140 Chr2 (604028..606076) [2049 bp, 682 aa] {ON} Anc_5.6...    37   0.058
TBLA0J00830 Chr10 complement(187815..190034) [2220 bp, 739 aa] {...    35   0.32 
TDEL0A04920 Chr1 complement(867970..870222) [2253 bp, 750 aa] {O...    35   0.39 
Suva_8.87 Chr8 complement(157531..159723) [2193 bp, 730 aa] {ON}...    34   0.60 
Smik_15.213 Chr15 complement(360836..363070) [2235 bp, 744 aa] {...    34   0.62 
AER388C Chr5 complement(1365604..1367778) [2175 bp, 724 aa] {ON}...    34   0.73 
Smik_7.267 Chr7 complement(442158..444161) [2004 bp, 667 aa] {ON...    33   0.90 
Ecym_1330 Chr1 (684758..686977) [2220 bp, 739 aa] {ON} similar t...    33   1.2  
SAKL0G07326g Chr7 complement(599477..601690) [2214 bp, 737 aa] {...    33   2.0  
Skud_15.199 Chr15 complement(354702..356927) [2226 bp, 741 aa] {...    32   2.3  
KNAG0A05970 Chr1 (893640..896657) [3018 bp, 1005 aa] {ON} Anc_2....    32   3.7  
NDAI0G03950 Chr7 (941809..943185) [1377 bp, 458 aa] {ON} Anc_3.4...    31   4.3  
YGL023C Chr7 complement(450197..452104) [1908 bp, 635 aa] {ON}  ...    31   5.0  
KLLA0E16721g Chr5 (1484752..1487010) [2259 bp, 752 aa] {ON} simi...    31   5.3  
KLLA0E23783g Chr5 complement(2115721..2115885,2115988..2117484) ...    31   6.1  
Suva_7.256 Chr7 complement(440959..443025) [2067 bp, 688 aa] {ON...    30   8.5  
Skud_5.307 Chr5 complement(506123..507763) [1641 bp, 546 aa] {ON...    30   8.7  

>Kwal_56.22459 s56 (138563..139714) [1152 bp, 383 aa] {ON} YOL003C -
           Hypothetical ORF [contig 185] FULL
          Length = 383

 Score =  795 bits (2053), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/383 (100%), Positives = 383/383 (100%)

Query: 1   MPVKLKWPWLGIAIPSSLIAFIGYGSHYFILGNFLSLGQQVWFQICLSMIWISYALAIFT 60
           MPVKLKWPWLGIAIPSSLIAFIGYGSHYFILGNFLSLGQQVWFQICLSMIWISYALAIFT
Sbjct: 1   MPVKLKWPWLGIAIPSSLIAFIGYGSHYFILGNFLSLGQQVWFQICLSMIWISYALAIFT 60

Query: 61  NPGKPPTGFQPLPHQWKNICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNF 120
           NPGKPPTGFQPLPHQWKNICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNF
Sbjct: 61  NPGKPPTGFQPLPHQWKNICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNF 120

Query: 121 PHFVRFLVWVIITTSYLGFMLWKRIFMHWQLRHTRIYVQKIELVFIFINTPLNAFVWLTI 180
           PHFVRFLVWVIITTSYLGFMLWKRIFMHWQLRHTRIYVQKIELVFIFINTPLNAFVWLTI
Sbjct: 121 PHFVRFLVWVIITTSYLGFMLWKRIFMHWQLRHTRIYVQKIELVFIFINTPLNAFVWLTI 180

Query: 181 ILLLLRCSKNQFLCGMTQIERWEWERIENQFNNGRLIPQLLENLAEIYGDDILNSPNAKK 240
           ILLLLRCSKNQFLCGMTQIERWEWERIENQFNNGRLIPQLLENLAEIYGDDILNSPNAKK
Sbjct: 181 ILLLLRCSKNQFLCGMTQIERWEWERIENQFNNGRLIPQLLENLAEIYGDDILNSPNAKK 240

Query: 241 LINARDLQLEEIVNFPYDLNIVANTRHAIGNLLTCILPWSSPVGNGLKFTKNDLSSYDTC 300
           LINARDLQLEEIVNFPYDLNIVANTRHAIGNLLTCILPWSSPVGNGLKFTKNDLSSYDTC
Sbjct: 241 LINARDLQLEEIVNFPYDLNIVANTRHAIGNLLTCILPWSSPVGNGLKFTKNDLSSYDTC 300

Query: 301 HTIEDKLLSLPWPPDGGRQQPTGDSQVSSRIEMHSSRGEPVLRKRLRDPRINMQRTEWYN 360
           HTIEDKLLSLPWPPDGGRQQPTGDSQVSSRIEMHSSRGEPVLRKRLRDPRINMQRTEWYN
Sbjct: 301 HTIEDKLLSLPWPPDGGRQQPTGDSQVSSRIEMHSSRGEPVLRKRLRDPRINMQRTEWYN 360

Query: 361 DWGENLSDFGVDVESETVPDANK 383
           DWGENLSDFGVDVESETVPDANK
Sbjct: 361 DWGENLSDFGVDVESETVPDANK 383

>KLTH0C10978g Chr3 complement(905760..906893) [1134 bp, 377 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003C DHHC-CRD protein
          Length = 377

 Score =  511 bits (1316), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 233/377 (61%), Positives = 291/377 (77%)

Query: 1   MPVKLKWPWLGIAIPSSLIAFIGYGSHYFILGNFLSLGQQVWFQICLSMIWISYALAIFT 60
           MPV+LKWPWLGIA+PS LIA+IGY SHYFIL NF S  QQ+WF+  L++IW+SYA AIF 
Sbjct: 1   MPVELKWPWLGIAVPSFLIAYIGYSSHYFILQNFASTYQQLWFEFSLTLIWVSYAFAIFK 60

Query: 61  NPGKPPTGFQPLPHQWKNICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNF 120
           NPG+PP  F+P  HQWKN C+KC  YKPERTHHCKTC QCVL MDHHCPWTMNCVGHNNF
Sbjct: 61  NPGRPPPNFEPPIHQWKNYCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNF 120

Query: 121 PHFVRFLVWVIITTSYLGFMLWKRIFMHWQLRHTRIYVQKIELVFIFINTPLNAFVWLTI 180
           PHFVRFL WV++TTSYLG +L +R F HW  R+TR +V   EL F+F+N PLNAF+ LT+
Sbjct: 121 PHFVRFLTWVVLTTSYLGLLLTQRAFDHWASRNTRKFVHTSELCFLFVNAPLNAFILLTV 180

Query: 181 ILLLLRCSKNQFLCGMTQIERWEWERIENQFNNGRLIPQLLENLAEIYGDDILNSPNAKK 240
            LL+ RC KNQFL GMTQIE WE +RIEN F N RL+PQL++NL E++ +D  +   A+K
Sbjct: 181 SLLVFRCVKNQFLNGMTQIESWEKDRIENLFFNERLVPQLIDNLKELFPEDTFDEGAAQK 240

Query: 241 LINARDLQLEEIVNFPYDLNIVANTRHAIGNLLTCILPWSSPVGNGLKFTKNDLSSYDTC 300
           L++++ L+LE+I+NFPYD++I+ N + ++G + +  LP   P   G +F  NDLS YD  
Sbjct: 241 LLSSKQLELEDIINFPYDVDILENMKSSMGPIYSWCLPCGRPRDEGTRFVTNDLSDYDIK 300

Query: 301 HTIEDKLLSLPWPPDGGRQQPTGDSQVSSRIEMHSSRGEPVLRKRLRDPRINMQRTEWYN 360
            +IEDKLLSLPWPPDGGRQ+    + ++S +E  SS GE  LR R  D RI++ RTEW+N
Sbjct: 301 ASIEDKLLSLPWPPDGGRQKSQRSADIASTLETFSSGGEATLRNRSFDSRISVPRTEWHN 360

Query: 361 DWGENLSDFGVDVESET 377
           DWGENLSDFGVDV++ET
Sbjct: 361 DWGENLSDFGVDVDAET 377

>Ecym_3032 Chr3 (63354..64487) [1134 bp, 377 aa] {ON} similar to
           Ashbya gossypii ACL003C
          Length = 377

 Score =  448 bits (1153), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 215/378 (56%), Positives = 277/378 (73%), Gaps = 4/378 (1%)

Query: 1   MPVKLKWPWLGIAIPSSLIAFIGYGSHYFILGNFLSLGQQVWFQICLSMIWISYALAIFT 60
           MPVKLKWPWLGIAIP  LIAFIGY +  F+L  FLS+ QQ+WFQ  L+MIW+SY  AI+T
Sbjct: 1   MPVKLKWPWLGIAIPCFLIAFIGYSAQLFVLQGFLSVKQQIWFQFSLTMIWLSYYKAIYT 60

Query: 61  NPGKPPTGFQPLPHQWKNICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNF 120
           NPG P  GFQPL H+WKN C+KC+ +KPERTHHCKTC QCVLVMDHHCP+TMNCVG+NNF
Sbjct: 61  NPGSPVPGFQPLKHEWKNYCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNF 120

Query: 121 PHFVRFLVWVIITTSYLGFMLWKRIFMHWQLRH-TRIYVQKIELVFIFINTPLNAFVWLT 179
           PHF+RFL W+I TT+YL    +KR +  W +RH T   V K E++F+ I TP NAFV LT
Sbjct: 121 PHFMRFLFWIITTTTYLSIQFFKRTWFVWNIRHSTAQLVTKKEIIFLTILTPANAFVLLT 180

Query: 180 IILLLLRCSKNQFLCGMTQIERWEWERIENQFNNGRLIPQLLENLAEIYGDDILNSPNA- 238
           I +L  RC KNQ L GMTQIE WE +RIE+ F N RL+PQLL NL E+Y + +       
Sbjct: 181 ISILFGRCIKNQVLNGMTQIEAWEMDRIESMFYNRRLVPQLLSNLEELYPNSLDGHKGEI 240

Query: 239 KKLINARDLQLEEIVNFPYDLNIVANTRHAIGNLLTCILPWSSPVGNGLKFTKNDLSSYD 298
            +++N R +  E++VNFPYD +   N  + +G +LT + P+  P GNG+ F KN+LS+Y+
Sbjct: 241 DRILNNRKISFEDLVNFPYDSDPWRNLINCMGPMLTWLNPFGKPNGNGMVFEKNELSAYE 300

Query: 299 TCHTIEDKLLSLPWPPDGGRQQPTGDSQVSSRIEMHSSRGEPVLRKRLRDPRINMQRTEW 358
              T+ DKLLSLPWPPDG R   + +S++  ++E  +  GE ++RKR  +PR+N+ RTEW
Sbjct: 301 HGSTLTDKLLSLPWPPDGERAPNSSNSRL--KVESSTRNGEHIIRKRSPEPRLNLSRTEW 358

Query: 359 YNDWGENLSDFGVDVESE 376
           YNDWGENL+ FGVDV+++
Sbjct: 359 YNDWGENLAHFGVDVDAD 376

>SAKL0E01518g Chr5 (113669..114808) [1140 bp, 379 aa] {ON} similar
           to uniprot|Q12006 Saccharomyces cerevisiae YOL003C
           DHHC-CRD protein
          Length = 379

 Score =  445 bits (1145), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 226/379 (59%), Positives = 277/379 (73%), Gaps = 3/379 (0%)

Query: 1   MPVKLKWPWLGIAIPSSLIAFIGYGSHYFILGNFLSLGQQVWFQICLSMIWISYALAIFT 60
           M VKLKWPWLGIAIP  LI+FIGY +HYFIL NFL   +Q+WF+  L MIWISY LAI+T
Sbjct: 1   MAVKLKWPWLGIAIPLFLISFIGYCAHYFILSNFLPTKKQLWFEFSLGMIWISYYLAIYT 60

Query: 61  NPGKPPTGFQPLPHQWKNICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNF 120
           NPGKP  GF+P   +W+N C KC  YKPER HHCK C+QCVL MDHHCPWTMNCVGH NF
Sbjct: 61  NPGKPTPGFRPSKFEWENFCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNF 120

Query: 121 PHFVRFLVWVIITTSYLGFMLWKRIFMHWQLRHT-RIYVQKIELVFIFINTPLNAFVWLT 179
            HF+RFL WVI TTS+L   L KRI   W  RH    +V + EL+F+ I TP++AFV LT
Sbjct: 121 AHFIRFLFWVIETTSFLLTYLVKRILFLWNRRHMPNYFVHRSELIFLTILTPMDAFVLLT 180

Query: 180 IILLLLRCSKNQFLCGMTQIERWEWERIENQFNNGRLIPQLLENLAEIYGDDILN-SPNA 238
           I LLLLRC+KNQ L GMTQIE WE +RIEN F++G+LIP++LENL EI    + N   + 
Sbjct: 181 ISLLLLRCAKNQILKGMTQIESWEMDRIENMFHSGQLIPRMLENLKEIRPGSLSNQDDDI 240

Query: 239 KKLINARDLQLEEIVNFPYDLNIVANTRHAIGNLLTCILPWSSPVGNGLKFTKNDLSSYD 298
           +KL++   L L+EIVNFPYDLN  AN  +++G++ + ILPW +  GNG+ F KN+LS Y+
Sbjct: 241 RKLLSQNRLSLDEIVNFPYDLNPWANAVNSLGDMYSWILPWGTAKGNGMIFEKNELSVYE 300

Query: 299 TCHTIEDKLLSLPWPPDGGRQQ-PTGDSQVSSRIEMHSSRGEPVLRKRLRDPRINMQRTE 357
               IEDKLLSLPWPPDGGR + P G +   + +E  +  GE V+RKR  DPR  M R +
Sbjct: 301 PEIPIEDKLLSLPWPPDGGRHKVPGGGANDVNIVESSTRDGERVVRKRWVDPRTTMPRKK 360

Query: 358 WYNDWGENLSDFGVDVESE 376
           WYNDWGENL+DFGVD++ E
Sbjct: 361 WYNDWGENLADFGVDLDEE 379

>TDEL0G04410 Chr7 complement(800085..801230) [1146 bp, 381 aa] {ON}
           Anc_6.28 YOL003C
          Length = 381

 Score =  420 bits (1079), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 203/379 (53%), Positives = 272/379 (71%), Gaps = 4/379 (1%)

Query: 1   MPVKLKWPWLGIAIPSSLIAFIGYGSHYFILGNFLSLGQQVWFQICLSMIWISYALAIFT 60
           MPVKLKWPWLGIAIP  L++FIGY  H+FIL NFLS  +Q+WFQ  L++IW+SY  AI+T
Sbjct: 1   MPVKLKWPWLGIAIPCVLVSFIGYCGHFFILSNFLSPSKQLWFQCNLALIWLSYYYAIYT 60

Query: 61  NPGKPPTGFQPLPHQWKNICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNF 120
           NPG+P   F+   ++WKN C+KC+ YKPER HHCKTC+QCVL+MDHHCPWTMNCVGHNNF
Sbjct: 61  NPGRPRPNFEVPKYEWKNYCKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNF 120

Query: 121 PHFVRFLVWVIITTSYLGFMLWKRIFMHWQLRHTRIYV-QKIELVFIFINTPLNAFVWLT 179
           PHF+RFLVWVI+ T++L + L  RI + W+ R+   Y+  + ELVF+ I TPL+AFV LT
Sbjct: 121 PHFLRFLVWVIVATAFLLYQLVSRIIVLWRDRNLPDYMFHRSELVFLTILTPLDAFVLLT 180

Query: 180 IILLLLRCSKNQFLCGMTQIERWEWERIENQFNNGRLIPQLLENLAEIY--GDDILNSPN 237
           I +LL RC  NQ   GM+QIE WE ER++  F++ RL+P L+E   +I+    + +N   
Sbjct: 181 ITILLCRCLANQIFNGMSQIETWELERLQALFDSKRLVPLLIEAAWDIFPGTREQINEST 240

Query: 238 AKKLINARDLQLEEIVNFPYDLNIVANTRHAIGNLLTCILPWSSPVGNGLKFTKNDLSSY 297
           A +L   ++L+LE++VNFPYDL+  +N    +GN L  + P+  P G+G+ F KN++S Y
Sbjct: 241 AAELSMNKELRLEDVVNFPYDLDPWSNAEQLLGNPLLWLWPFGRPKGDGMSFVKNEISEY 300

Query: 298 DTCHTIEDKLLSLPWPPDGGRQQPTGDSQVSSRIEMHSSRGEPVLRKRLRDPRINMQRTE 357
            +  + ED LLSLPWPPDGGR +  G   +SS IE  + +GE ++R+R  D    + R +
Sbjct: 301 SSRASYEDLLLSLPWPPDGGRTR-AGPGSLSSSIESITKQGEQLIRRRPNDTSDLIGRRQ 359

Query: 358 WYNDWGENLSDFGVDVESE 376
           W NDWGENL DFGVDV++E
Sbjct: 360 WQNDWGENLEDFGVDVDTE 378

>Kpol_1037.23 s1037 complement(51397..52533) [1137 bp, 378 aa] {ON}
           complement(51397..52533) [1137 nt, 379 aa]
          Length = 378

 Score =  415 bits (1066), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 200/381 (52%), Positives = 274/381 (71%), Gaps = 8/381 (2%)

Query: 1   MPVKLKWPWLGIAIPSSLIAFIGYGSHYFILGNFLSLGQQVWFQICLSMIWISYALAIFT 60
           MPVKLK+PW+GIAIP  LI+FI Y +HYFIL NFLS+G+Q+WF+I ++MIWISY LAI+T
Sbjct: 1   MPVKLKYPWMGIAIPCFLISFIAYTAHYFILLNFLSIGKQIWFEISVTMIWISYYLAIYT 60

Query: 61  NPGKPPTGFQPLPHQWKNICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNF 120
           NPGKP + + P  +QWKN C+KC  YKPERTHHCKTC QCVL+MDHHCPWTMNCVG+ NF
Sbjct: 61  NPGKPGSNYIPPSNQWKNYCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNF 120

Query: 121 PHFVRFLVWVIITTSYLGFMLWKRIFMHWQLRHTRIYV-QKIELVFIFINTPLNAFVWLT 179
           PHF+RFL WVI+TT+YL + L  RI   W+ R+   Y+  K E++F+ I TP++ FV LT
Sbjct: 121 PHFLRFLFWVIVTTTYLLYFLISRIVFLWKSRNLPSYLFNKSEIIFLTITTPMDGFVLLT 180

Query: 180 IILLLLRCSKNQFLCGMTQIERWEWERIENQFNNGRLIPQLLENLAEIYGDDILNSPN-- 237
           I LL +RC+ NQ L G TQIE WE ER+E+ F   RL PQL+ NL E + +  L +P+  
Sbjct: 181 ISLLFIRCTVNQLLSGRTQIETWENERLESLFYLRRLKPQLISNLWEFHPE--LKTPDNE 238

Query: 238 --AKKLINARDLQLEEIVNFPYDLNIVANTRHAIGNLLTCILPWSSPVGNGLKFTKNDLS 295
             A+K+++ R ++ + +V+FPYDL ++ N    +G+ +T +  +  P G+G+ F KN+ S
Sbjct: 239 AKAEKIVSKR-IRFDLLVSFPYDLGLINNITTVLGSPVTWLWFYGEPSGDGMLFKKNEYS 297

Query: 296 SYDTCHTIEDKLLSLPWPPDGGRQQPTGDSQVSSRIEMHSSRGEPVLRKRLRDPRINMQR 355
            ++    +ED++LSLPWPPDGG+     ++  ++ IE  +  GE V+RKR    ++   R
Sbjct: 298 LFEEDSILEDQILSLPWPPDGGKHGFNIENSSTNSIETSTKDGEHVIRKRSPVSKLLESR 357

Query: 356 TEWYNDWGENLSDFGVDVESE 376
           T+WYNDWGENL DFGVD++ E
Sbjct: 358 TQWYNDWGENLEDFGVDIDVE 378

>YOL003C Chr15 complement(321858..322994) [1137 bp, 378 aa] {ON}
           PFA4Palmitoyltransferase with autoacylation activity,
           required for palmitoylation of amino acid permeases
           containing a C-terminal Phe-Trp-Cys site; required for
           modification of Chs3p; member of the DHHC family of
           putative palmitoyltransferases
          Length = 378

 Score =  413 bits (1061), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 199/379 (52%), Positives = 270/379 (71%), Gaps = 4/379 (1%)

Query: 1   MPVKLKWPWLGIAIPSSLIAFIGYGSHYFILGNFLSLGQQVWFQICLSMIWISYALAIFT 60
           MPVKL+WPWLGIAIP+ LI+FIGYG+HYFIL NFLS+ +Q+ F+ CLSMIW+SY LAI T
Sbjct: 1   MPVKLRWPWLGIAIPTFLISFIGYGAHYFILSNFLSVPKQITFEFCLSMIWLSYYLAICT 60

Query: 61  NPGKPPTGFQPLPHQWKNICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNF 120
           NPG+P   ++P P  W+N C+KC++YKPER+HHCKTC+QCVL+MDHHCPWTMNCVG  N+
Sbjct: 61  NPGRPLPNYKPPPDIWRNFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANY 120

Query: 121 PHFVRFLVWVIITTSYLGFMLWKRIFMHWQLRHTRIY-VQKIELVFIFINTPLNAFVWLT 179
           PHF+RFL W+I+TTS L  +  KRI+  WQ RH   Y  +K EL+F+ I++PLN+FV LT
Sbjct: 121 PHFLRFLFWIIVTTSVLFCIQAKRIYFIWQQRHLPGYFFKKSELIFLTISSPLNSFVLLT 180

Query: 180 IILLLLRCSKNQFLCGMTQIERWEWERIENQFNNGRLIPQLLENLAEIYGD--DILNSPN 237
           I +L LRC  NQ L G +QIE W+ +R+E+ FN+GRL  +L++N   IY +     N  +
Sbjct: 181 ITILFLRCLFNQILNGRSQIESWDMDRLESLFNSGRLTQKLIDNTWRIYPESRSFQNKKD 240

Query: 238 AKKLINARDLQLEEIVNFPYDLNIVANTRHAIGNLLTCILPWSSPVGNGLKFTKNDLSSY 297
           A++ +  +  + +E+VNFPYD ++  N    +G +   + P+  P G+G  F KN +S Y
Sbjct: 241 AEEHLTKKRPRFDELVNFPYDFDLYTNALLYLGPIHLWLWPYGVPTGDGNNFPKNGISKY 300

Query: 298 DTCHTIEDKLLSLPWPPDGGRQQPTGDSQVSSRIEMHSSRGEPVLRKRLRDPRINMQRTE 357
           +   ++ED +LSLPWPPDGG+   T  +  SS IEM +  GE ++R RL     +  R +
Sbjct: 301 EANSSLEDHILSLPWPPDGGKTN-TVFNHGSSTIEMRNESGEQLIRTRLPQNGRHASREK 359

Query: 358 WYNDWGENLSDFGVDVESE 376
           WYNDWGE+L DFGVDV+ E
Sbjct: 360 WYNDWGESLDDFGVDVDME 378

>Suva_15.172 Chr15 complement(296325..297521) [1197 bp, 398 aa] {ON}
           YOL003C (REAL)
          Length = 398

 Score =  408 bits (1049), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 200/381 (52%), Positives = 268/381 (70%), Gaps = 8/381 (2%)

Query: 1   MPVKLKWPWLGIAIPSSLIAFIGYGSHYFILGNFLSLGQQVWFQICLSMIWISYALAIFT 60
           M VKLKWPWLGIAIP+ LI+FIGYG+HYFIL NFLS+ +Q+ F+  LSMIW+SY LAI+T
Sbjct: 21  MAVKLKWPWLGIAIPTFLISFIGYGAHYFILSNFLSVSKQIAFESSLSMIWVSYYLAIYT 80

Query: 61  NPGKPPTGFQPLPHQWKNICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNF 120
           NPGKP   +QP P+ W N C+KC+ YKPER+HHCK C+QCVL+MDHHCPWTMNCVG  N+
Sbjct: 81  NPGKPSPTYQPNPNTWPNYCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNY 140

Query: 121 PHFVRFLVWVIITTSYLGFMLWKRIFMHWQLRHTRIYV-QKIELVFIFINTPLNAFVWLT 179
           PHF+RF+ WVI TT +L  +  KR+   WQ RH   Y+ +K ELVF+ I TPLN FV LT
Sbjct: 141 PHFLRFIFWVIATTGFLFCIQLKRVSFIWQQRHLPGYLFKKSELVFLTILTPLNFFVLLT 200

Query: 180 IILLLLRCSKNQFLCGMTQIERWEWERIENQFNNGRLIPQLLENLAEIYGDDILNSP--- 236
           I++L LRC  NQ + G +QIE W+ +R+E+ F++ RLI +L+EN   IY +    SP   
Sbjct: 201 IVILFLRCLFNQIINGRSQIESWDMDRLESLFDSQRLIKKLIENTWRIYPEA--RSPQLE 258

Query: 237 -NAKKLINARDLQLEEIVNFPYDLNIVANTRHAIGNLLTCILPWSSPVGNGLKFTKNDLS 295
            +A+KL+    ++ EE+VNFPY++++  N    +G L   + P  +P G+G  F KND+S
Sbjct: 259 RDAEKLLTQHKIRFEEVVNFPYNIDLFTNATIYLGPLHLWLWPCGAPAGDGNSFQKNDIS 318

Query: 296 SYDTCHTIEDKLLSLPWPPDGGRQQPTGDSQVSSRIEMHSSRGEPVLRKRLRDPRINMQR 355
            Y+   ++ED +LSLPWPPDGG+ + T  +  +  IE  +  GE V+R R+     +  R
Sbjct: 319 KYEVNSSLEDIMLSLPWPPDGGKIK-TASNHSNLAIETCNEGGEQVVRSRIAQHGRSATR 377

Query: 356 TEWYNDWGENLSDFGVDVESE 376
            +WYNDWGE+L DFGVDV+ E
Sbjct: 378 EKWYNDWGESLDDFGVDVDME 398

>NDAI0C02650 Chr3 (614101..615270) [1170 bp, 389 aa] {ON} Anc_6.28
          Length = 389

 Score =  397 bits (1019), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 201/391 (51%), Positives = 263/391 (67%), Gaps = 17/391 (4%)

Query: 1   MPVKLKWPWLGIAIPSSLIAFIGYGSHYFILGNFLSLGQQVWFQICLSMIWISYALAIFT 60
           M +KLK+PWLG+AIPS +I+FIGY SHYFIL NFLS+ +Q+WFQ  LSMIW+SY LAIFT
Sbjct: 1   MAIKLKYPWLGVAIPSFIISFIGYNSHYFILSNFLSIKKQIWFQFSLSMIWVSYLLAIFT 60

Query: 61  NPGKPPTGFQPLP----HQWKNICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVG 116
           NPGKPP   +P+      +W   C+KC  YKPER+HHCKTC+QCVL+MDHHCPWTMNCVG
Sbjct: 61  NPGKPPKNCKPIDFNDQRKWNTHCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVG 120

Query: 117 HNNFPHFVRFLVWVIITTSYLGFMLWKRIFMHWQLRHTRIYV-QKIELVFIFINTPLNAF 175
           + NFPHF+RFL+W+IITT +L   L KR    W LRH   Y+  + E++F+ I  P++AF
Sbjct: 121 YKNFPHFIRFLMWIIITTGFLLVHLLKRTMTMWNLRHLPSYIFDRNEIIFLTILIPMDAF 180

Query: 176 VWLTIILLLLRCSKNQFLCGMTQIERWEWERIENQFNNGRLIPQLLENLAEIYGDDILNS 235
           + LTI LL +RC  NQ + GMTQIE WE ER+EN F N +L+P ++  L E+Y ++    
Sbjct: 181 ILLTISLLFIRCFNNQIVRGMTQIEFWELERLENLFYNKKLLPMIIATLWEVYPNERTKV 240

Query: 236 PN--AKKLINAR-DLQLEEIVNFPYDLNIVANTRHAIGNLLTCILPWSSPVGNGLKFTKN 292
            +  A  L++ R  ++ E IVNFPYD++I  N    +G+    I  +  P  NGLKF KN
Sbjct: 241 ADNYADDLLSRRKKVRFENIVNFPYDIDIWTNMNTVMGSAFNWIWIFGVPDRNGLKFEKN 300

Query: 293 DLSSYDTCHTIEDKLLSLPWPPDGGRQQPTGDSQVSSRIEMHSSRGEPVLRKRL-RDPRI 351
           ++S Y+   ++ED LLSLPWPPD GR      S   + +E     GE V+R R   D  I
Sbjct: 301 EISLYEPGSSVEDLLLSLPWPPDKGRN---FISNKDTSVESLVYDGEQVVRNRASNDTNI 357

Query: 352 -----NMQRTEWYNDWGENLSDFGVDVESET 377
                ++ R EW NDWGE+L DFGVD+E+E 
Sbjct: 358 STINKDISREEWNNDWGESLVDFGVDIEAEV 388

>KLLA0C06204g Chr3 complement(548912..550045) [1134 bp, 377 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003C DHHC- CRD protein
          Length = 377

 Score =  395 bits (1014), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 199/379 (52%), Positives = 256/379 (67%), Gaps = 5/379 (1%)

Query: 1   MPVKLKWPWLGIAIPSSLIAFIGYGSHYFILGNFLSLGQQVWFQICLSMIWISYALAIFT 60
           M +KLK  WLG+AIP+ L+A IGYGSHYFIL NFLS  +Q+++Q C +MIW+SY LAI+T
Sbjct: 1   MAIKLKNRWLGVAIPAFLVALIGYGSHYFILSNFLSWNEQIFYQTCQTMIWVSYYLAIYT 60

Query: 61  NPGKPPTGFQPLPHQWKNICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNF 120
           NPG PP  F+P   +W N C+KC+ YKPER HHCKTC+QCVL MDHHCPWT+NCVGH+NF
Sbjct: 61  NPGIPPKDFKPSAEEWHNYCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNF 120

Query: 121 PHFVRFLVWVIITTSYLGFMLWKRIFMHWQLRHTRIYVQKI-ELVFIFINTPLNAFVWLT 179
           PHF+RFL WVI +T+YL F+L  RI++ W +RHT  + +   E++FI I TP++AFV LT
Sbjct: 121 PHFMRFLFWVIFSTAYLLFLLIGRIYLLWSIRHTAFHHRSTSEIIFICIMTPMDAFVLLT 180

Query: 180 IILLLLRCSKNQFLCGMTQIERWEWERIENQFNNGRLIPQLLENLAEIYGDDILNSPNAK 239
           +  LL RC  NQ L GMTQIE WE +RI++     RL+ Q+++ L E    +IL +   +
Sbjct: 181 VSSLLGRCIYNQCLHGMTQIESWEMDRIQSLHYKNRLLAQVIDRLVE-RRPEILPAKQHE 239

Query: 240 --KLINARDLQLEEIVNFPYDLNIVANTRHAIGNLLTCILPWSSPVGNGLKFTKNDLSSY 297
             KL++ R +  E+  NFPYD+N   N  +A+G     + PWS P   G  F KN+L  Y
Sbjct: 240 INKLLSKRYVNQEDFTNFPYDVNPWTNINNAMGPWYLWLWPWSKPPTIGTSFAKNELFFY 299

Query: 298 DTCHTIEDKLLSLPWPPDGGRQQPTGDSQVSSRIEMHSSRGEPVLRKRLRDPRINMQRTE 357
           D   +IED L+SLPWPPDG           SS IE   S GE V+R +  D R  + R  
Sbjct: 300 DPNSSIEDMLMSLPWPPDGLTHHSRALGSGSS-IETIVSGGEQVIRDKSVDLRDRLGRNS 358

Query: 358 WYNDWGENLSDFGVDVESE 376
           WYNDWGE+LSDFGVD E E
Sbjct: 359 WYNDWGEDLSDFGVDTELE 377

>CAGL0E02497g Chr5 complement(241355..242485) [1131 bp, 376 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003c
          Length = 376

 Score =  393 bits (1009), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 197/379 (51%), Positives = 260/379 (68%), Gaps = 6/379 (1%)

Query: 1   MPVKLKWPWLGIAIPSSLIAFIGYGSHYFILGNFLSLGQQVWFQICLSMIWISYALAIFT 60
           MPVKLKWPWLGIAIPS LIA IGY +HYFIL NFLSL +Q+W+Q C +MIW+SY LAI+T
Sbjct: 1   MPVKLKWPWLGIAIPSFLIASIGYCAHYFILLNFLSLRKQLWYQFCQTMIWLSYYLAIYT 60

Query: 61  NPGKPPTGFQPLPHQWKNICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNF 120
            PGKPPT F+P  ++WK  C+KCK YKPER+HHCKTC+QCVL+MDHHCPWTMNCVG+NNF
Sbjct: 61  PPGKPPTNFKPSKNEWKVYCKKCKCYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNF 120

Query: 121 PHFVRFLVWVIITTSYLGFMLWKRIFMHWQLRHTRIYV-QKIELVFIFINTPLNAFVWLT 179
           PHF+RFL WVI+ T+ L   L  RI   W  R +  Y+  K EL+F+ I TPLNAF+ LT
Sbjct: 121 PHFIRFLFWVIVGTTSLAIFLTTRIHSIWVHRSSPSYLYYKSELIFLTILTPLNAFILLT 180

Query: 180 IILLLLRCSKNQFLCGMTQIERWEWERIENQFNNGRLIPQLLENLAEIYGD--DILNSPN 237
           I +L++RC  NQ   G +QIE WE +R+E      +L+P L+EN+  I+ +  +      
Sbjct: 181 ISILMIRCLFNQIFNGRSQIESWEMDRLETLARMSKLLPILIENVWYIFPNLRNEHVESQ 240

Query: 238 AKKLINARDLQLEEIVNFPYDLNIVANTRHAIGNLLTCILPWSSPVGNGLKFTKNDLSSY 297
           A+ L+N + L L+E+VNFPYDL    N    +G     + P+S P  +GL F KN+ S  
Sbjct: 241 AEALLNKKRLSLDELVNFPYDLGPFRNAIQLLGTPPLWLYPFSGPQDDGLHFQKNEESMI 300

Query: 298 DTCHTIEDKLLSLPWPPDGGRQQPTGDSQVSSRIEMHSSRGEPVLRKRLRDPRINMQRTE 357
           +  +++ D +L LPWPPD  +      S+ +S +++ S  GE V+  R+R P   + R+E
Sbjct: 301 EDPNSLNDIILCLPWPPDSTKHL-NSTSEHTSNVQIISEEGEQVI--RIRTPEKKLSRSE 357

Query: 358 WYNDWGENLSDFGVDVESE 376
           W NDWGE+L DFGVDV+ E
Sbjct: 358 WLNDWGESLEDFGVDVDVE 376

>ZYRO0C07546g Chr3 complement(574411..575544) [1134 bp, 377 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003C DHHC-CRD protein
          Length = 377

 Score =  388 bits (996), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 192/379 (50%), Positives = 256/379 (67%), Gaps = 5/379 (1%)

Query: 1   MPVKLKWPWLGIAIPSSLIAFIGYGSHYFILGNFLSLGQQVWFQICLSMIWISYALAIFT 60
           MPV+LKWP+LGIAIP  LI+FIGY +HYFIL NFLS  +Q+WF+  L+MIW SY LAI+T
Sbjct: 1   MPVQLKWPFLGIAIPCFLISFIGYNAHYFILSNFLSTQKQIWFEFSLTMIWFSYYLAIYT 60

Query: 61  NPGKPPTGFQPLPHQWKNICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNF 120
            PG+P   FQP  + WK+ C+KC+ YKPER HHCKTC+QCVL MDHHCPWT NCVG+ NF
Sbjct: 61  LPGQPLPNFQPSKNSWKSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNF 120

Query: 121 PHFVRFLVWVIITTSYLGFMLWKRIFMHWQLRHTRIYV-QKIELVFIFINTPLNAFVWLT 179
           PHF+RFL WVI TT YL + L  R +      ++  Y+  K EL+F+ I  P++ F+ LT
Sbjct: 121 PHFMRFLFWVIATTGYLLYELCLRAYFILSNHNSPTYLWNKSELIFLTILIPMDGFILLT 180

Query: 180 IILLLLRCSKNQFLCGMTQIERWEWERIENQFNNGRLIPQLLENLAEIYGDDILN--SPN 237
           I +L +RC  NQ  CG TQIE WE+ER+E  + + RL+P LL N  E+Y +         
Sbjct: 181 ISILFIRCLSNQIFCGRTQIETWEYERLEGLYYSKRLLPHLLANFWELYPELRTRELEDE 240

Query: 238 AKKLINARDLQLEEIVNFPYDLNIVANTRHAIGNLLTCILPWSSPVGNGLKFTKNDLSSY 297
           A +L   R + L+ +VNFPYD++  +NT   +G+ L  + P+  P G+G+ F KND+S +
Sbjct: 241 ASRLSTRRRIGLDHLVNFPYDIDPWSNTIEFLGSPLFWLWPFGKPKGDGMFFPKNDISEF 300

Query: 298 DTCHTIEDKLLSLPWPPDGGRQQPTGDSQVSSRIEMHSSRGEPVLRKRLRDPRINMQRTE 357
           +  + + D LL+LPWPPDGG+ +       ++ +E     GE V+RKRL DPR    RT+
Sbjct: 301 EETN-LTDMLLALPWPPDGGKDKVISIDGPNA-VETTVRDGEQVIRKRLVDPRDPSSRTQ 358

Query: 358 WYNDWGENLSDFGVDVESE 376
           W N WGENL DFGVDV++E
Sbjct: 359 WQNTWGENLEDFGVDVDAE 377

>Skud_15.159 Chr15 complement(281485..282624) [1140 bp, 379 aa] {ON}
           YOL003C (REAL)
          Length = 379

 Score =  388 bits (996), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 191/380 (50%), Positives = 263/380 (69%), Gaps = 5/380 (1%)

Query: 1   MPVKLKWPWLGIAIPSSLIAFIGYGSHYFILGNFLSLGQQVWFQICLSMIWISYALAIFT 60
           M VKLKWPWLGIAIP+ LI+FIGYG+HYFIL NFLS+ +Q+ F++ LSMIW+SY LAI+T
Sbjct: 1   MAVKLKWPWLGIAIPTFLISFIGYGAHYFILSNFLSISKQLLFELSLSMIWVSYYLAIYT 60

Query: 61  NPGKPPTGFQPLPHQWKNICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNF 120
           N G+P   ++P P  W N C+KC++YKPER+HHCK C+QCVL+MDHHCPWTMNCVG  N+
Sbjct: 61  NAGRPLPNYRPSPLIWPNFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNY 120

Query: 121 PHFVRFLVWVIITTSYLGFMLWKRIFMHWQLRHTRIYV-QKIELVFIFINTPLNAFVWLT 179
           PHF+RFL WVI+TTS L  M  KRI   WQ R    Y+ +K EL+F+ I +PL+ FV LT
Sbjct: 121 PHFLRFLFWVIVTTSILFCMQVKRICFIWQQRSLPGYLFEKSELIFLTILSPLDFFVLLT 180

Query: 180 IILLLLRCSKNQFLCGMTQIERWEWERIENQFNNGRLIPQLLENLAEIYGD--DILNSPN 237
           I +L LRC  NQ + G +QIE W+ +R+E+  ++G+LIP+L++N   IY +     +  +
Sbjct: 181 IAILFLRCLSNQIINGRSQIESWDMDRLESLCDSGKLIPKLIDNTWRIYPEARSSQHERD 240

Query: 238 AKKLINARD-LQLEEIVNFPYDLNIVANTRHAIGNLLTCILPWSSPVGNGLKFTKNDLSS 296
           A KL+  R   + +E+V+FPY+ N   N    +G +   + P+ +P G+G  F KND+S 
Sbjct: 241 ADKLLTQRGRARFDELVSFPYNFNPCTNAILYLGPIRLWLWPYGTPAGDGNSFPKNDISQ 300

Query: 297 YDTCHTIEDKLLSLPWPPDGGRQQPTGDSQVSSRIEMHSSRGEPVLRKRLRDPRINMQRT 356
           Y+    +ED +LSLPWPPDG + +   +   +S IE ++  GE ++R R      +  R 
Sbjct: 301 YEVNSPLEDIILSLPWPPDGNKTKAVSNHN-NSTIETYNEGGEQIVRSRNAQHGSDAIRE 359

Query: 357 EWYNDWGENLSDFGVDVESE 376
           +WYNDWGE+L DFGVDV+ E
Sbjct: 360 KWYNDWGESLDDFGVDVDME 379

>NCAS0D02140 Chr4 complement(398924..400054) [1131 bp, 376 aa] {ON}
           Anc_6.28
          Length = 376

 Score =  387 bits (994), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 192/380 (50%), Positives = 255/380 (67%), Gaps = 8/380 (2%)

Query: 1   MPVKLKWPWLGIAIPSSLIAFIGYGSHYFILGNFLSLGQQVWFQICLSMIWISYALAIFT 60
           MPVKLK+PW+G+ IP  L +FIGY +H F+L NF+S   Q+WFQ  L+M+WISYALAIFT
Sbjct: 1   MPVKLKYPWMGVVIPCLLTSFIGYSAHIFVLANFMSWKLQLWFQSSLTMLWISYALAIFT 60

Query: 61  NPGKPPTGFQPLPHQWKNICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNF 120
           NPG+P   F+PL  +W + C+KC+ +KPER HHCKTC+QCVL+MDHHCPWTMNCVG  NF
Sbjct: 61  NPGRPAKSFKPLKKEWTHFCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNF 120

Query: 121 PHFVRFLVWVIITTSYLGFMLWKRIFMHWQLRHTRIYV-QKIELVFIFINTPLNAFVWLT 179
           PHF+RFL WV++TT +L + L KR    W ++    Y+ +K E+ F+ I  P++ FV +T
Sbjct: 121 PHFLRFLFWVVVTTGFLLYQLLKRTIYLWGVKDLPSYLFEKTEITFLIILIPMDGFVLIT 180

Query: 180 IILLLLRCSKNQFLCGMTQIERWEWERIENQFNNGRLIPQLLENLAEIYGDDIL--NSPN 237
           + LL +RC  NQ + G TQIE WE ER+EN +   +L+PQLL NL EIY ++    N   
Sbjct: 181 VALLFIRCLSNQIIGGKTQIESWELERLENLYYRKKLLPQLLVNLWEIYPNEKTPENKVL 240

Query: 238 AKKLIN-ARDLQLEEIVNFPYDLNIVANTRHAIGNLLTCILPWSSPVGNGLKFTKNDLSS 296
           AKKL    R ++ E IV FPYDL+I +N    +G+ +  +  +  P  +G+ F KN+L+ 
Sbjct: 241 AKKLQERGRKVRFENIVTFPYDLDIWSNALTVLGSPVQWLWLFGGPDSDGMHFKKNELAL 300

Query: 297 YDTCHTIEDKLLSLPWPPDGGRQQPTGDSQVSSRIEMHSSRGEPVLRKRLRDPRINMQRT 356
           Y+    IED LLSLPWPPDGGR       Q  + +E  +  GE V+R+R  +   N  R 
Sbjct: 301 YEEGAAIEDLLLSLPWPPDGGR---NFIQQKGTNVESITENGEQVIRQRNFE-NDNSYRK 356

Query: 357 EWYNDWGENLSDFGVDVESE 376
            W NDWGENL DFGVDV+ E
Sbjct: 357 TWNNDWGENLEDFGVDVDVE 376

>TPHA0J00390 Chr10 (88587..89729) [1143 bp, 380 aa] {ON} Anc_6.28
           YOL003C
          Length = 380

 Score =  386 bits (991), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 191/380 (50%), Positives = 257/380 (67%), Gaps = 3/380 (0%)

Query: 1   MPVKLKWPWLGIAIPSSLIAFIGYGSHYFILGNFLSLGQQVWFQICLSMIWISYALAIFT 60
           MPVK KWPW+GIAIP  LI+FIGY SHY+IL   LSL +Q +F+  L+MIW+SY +AI  
Sbjct: 1   MPVKFKWPWMGIAIPCVLISFIGYLSHYYILRQHLSLIKQCYFEFSLTMIWVSYYMAIII 60

Query: 61  NPGKPPTGFQPLPHQWKNICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNF 120
           NPGKP   F+PLPH+W+N C+KC  YKPER+HHCKTC+QCVL+MDHHCPWTMNC+G NNF
Sbjct: 61  NPGKPGKNFKPLPHEWRNFCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNF 120

Query: 121 PHFVRFLVWVIITTSYLGFMLWKRIFMHWQLRHTRIYV-QKIELVFIFINTPLNAFVWLT 179
           PHF+RFL+W++ TT +L F   KRI   W  R+   Y+ ++ E++ +F+ TPLN F+ LT
Sbjct: 121 PHFMRFLLWIMATTGFLLFYQIKRIIYMWNNRNLPSYLFERSEVIALFVCTPLNLFILLT 180

Query: 180 IILLLLRCSKNQFLCGMTQIERWEWERIENQFNNGRLIPQLLENLAEIYGD--DILNSPN 237
           I LL  RC  NQ + G TQIE WE +R+EN+F   +L+PQL+ NL E+Y +     +   
Sbjct: 181 ITLLFCRCLFNQIINGKTQIEDWEMDRLENRFYLKKLLPQLILNLWELYPELKSAKHDEE 240

Query: 238 AKKLINARDLQLEEIVNFPYDLNIVANTRHAIGNLLTCILPWSSPVGNGLKFTKNDLSSY 297
           A++LI  + ++ + IVNFPYDL I  N    +G  L  + P+  P GNG+ F KN+++ +
Sbjct: 241 AERLIEKKGIRYDSIVNFPYDLGIFKNITALVGQPLYWLWPFGGPSGNGMNFEKNEIALF 300

Query: 298 DTCHTIEDKLLSLPWPPDGGRQQPTGDSQVSSRIEMHSSRGEPVLRKRLRDPRINMQRTE 357
           D   ++    L+LPWPPD GR   +      S +E  ++ GE V+R R       + R E
Sbjct: 301 DPDSSLPVFTLALPWPPDKGRHNNSKTLNTDSNVEFITTDGEQVVRNRTHAKNPILSREE 360

Query: 358 WYNDWGENLSDFGVDVESET 377
           W+N+WGENL DFGVDVE E 
Sbjct: 361 WFNEWGENLEDFGVDVEMEN 380

>Smik_15.167 Chr15 complement(289180..290316) [1137 bp, 378 aa] {ON}
           YOL003C (REAL)
          Length = 378

 Score =  386 bits (991), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 192/379 (50%), Positives = 259/379 (68%), Gaps = 4/379 (1%)

Query: 1   MPVKLKWPWLGIAIPSSLIAFIGYGSHYFILGNFLSLGQQVWFQICLSMIWISYALAIFT 60
           M VKL+WPWLGIAIP+ LI+FIGYG+HYFIL NFL + +Q+ F+  LSMIW SY LAI+T
Sbjct: 1   MAVKLRWPWLGIAIPTLLISFIGYGAHYFILSNFLPIAKQIGFEFSLSMIWFSYYLAIYT 60

Query: 61  NPGKPPTGFQPLPHQWKNICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNF 120
           NPG+P   +QP P  W N C+KC+ YKPER+HHCKTC+QCVL+MDHHCPWTMNCVG  N+
Sbjct: 61  NPGRPLPNYQPTPGIWPNFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNY 120

Query: 121 PHFVRFLVWVIITTSYLGFMLWKRIFMHWQLRHTRIYV-QKIELVFIFINTPLNAFVWLT 179
           PHF+RFL W+IITTS L  +  KRI   WQ R+   Y+ +K EL F+ I +PLN FV LT
Sbjct: 121 PHFLRFLFWIIITTSILFCIQVKRICFIWQRRNFPGYLFKKSELTFLTILSPLNFFVLLT 180

Query: 180 IILLLLRCSKNQFLCGMTQIERWEWERIENQFNNGRLIPQLLENLAEIYGDD--ILNSPN 237
           I +L LRC  NQ + G +QIE W+ +R+E+ F++ RLI +L+ N   IY +   + +  +
Sbjct: 181 ITVLFLRCLFNQIVNGRSQIESWDMDRLESLFDSRRLIQKLIYNTWRIYPESKTLQHERD 240

Query: 238 AKKLINARDLQLEEIVNFPYDLNIVANTRHAIGNLLTCILPWSSPVGNGLKFTKNDLSSY 297
           A+ L+  +    E +VNFPY+ ++  N    +G +   + P+  P GNG  F KND+S+Y
Sbjct: 241 AEGLLKQQRSSFEGLVNFPYNFDLHTNAILYLGPVHLWLWPYGIPTGNGNNFPKNDISNY 300

Query: 298 DTCHTIEDKLLSLPWPPDGGRQQPTGDSQVSSRIEMHSSRGEPVLRKRLRDPRINMQRTE 357
           +    +ED +LSLPWPPDGG      + + S+ IE  +  GE V+R R+     +  R +
Sbjct: 301 EVDSPLEDIILSLPWPPDGGETTTVSNPKTST-IETCNEGGEQVVRSRVAQNGRSASREK 359

Query: 358 WYNDWGENLSDFGVDVESE 376
           W+NDWGE+L DFGVDV+ E
Sbjct: 360 WFNDWGESLDDFGVDVDME 378

>ACL003C Chr3 complement(352024..353151) [1128 bp, 375 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL003C
          Length = 375

 Score =  371 bits (953), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 191/378 (50%), Positives = 246/378 (65%), Gaps = 5/378 (1%)

Query: 1   MPVKLKWPWLGIAIPSSLIAFIGYGSHYFILGNFLSLGQQVWFQICLSMIWISYALAIFT 60
           M V +KWPWLG+AIP  LI+F GY +H+F+L NFLS  + +WFQ+ LSMIWISY  AI+ 
Sbjct: 1   MAVLVKWPWLGVAIPCFLISFTGYFAHFFVLTNFLSFKELLWFQVSLSMIWISYWKAIYK 60

Query: 61  NPGKPPTGFQPLPHQWKNICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNF 120
           NPG+P  GF+PL ++W+N C KC+TYKPERTHHCK C+QCVLVMDHHCPWTMNC+G    
Sbjct: 61  NPGRPTKGFRPLRYEWQNYCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLGLQYL 120

Query: 121 PHFVRFLVWVIITTSYLGFMLWKRIFMHWQLRH-TRIYVQKIELVFIFINTPLNAFVWLT 179
                   W+I TT  L     KRI   W  R+ T   V K EL+F+ I TPL+AF+ LT
Sbjct: 121 APQHSIFCWIIATTGILLHYFVKRIKFTWVNRYATANLVSKQELIFLTILTPLDAFILLT 180

Query: 180 IILLLLRCSKNQFLCGMTQIERWEWERIENQFNNGRLIPQLLENLAEIY-GDDILNSPNA 238
           I LL +RC KNQ + G TQIE WE +RIEN F + RL+PQLL NL EIY G         
Sbjct: 181 ISLLFVRCVKNQIVNGRTQIEAWEMDRIENLFYHQRLLPQLLTNLKEIYPGSLEGQEKEV 240

Query: 239 KKLINARDLQLEEIVNFPYDLNIVANTRHAIGNLLTCILPWSSPVGNGLKFTKNDLSSYD 298
           ++ +++     +E++NFPYD+N   N  + +G+ L  + P+  P  +G+ F KN++S YD
Sbjct: 241 EEFLSSSTCSFDEVINFPYDINPWVNLLNCMGSPLNWLNPFGGPKADGMVFQKNEISDYD 300

Query: 299 TCHTIEDKLLSLPWPPDGGRQQPTGDSQVSSRIEMHSSRGEPVLRKRLRDPRINMQRTEW 358
              +I+DKLL+LPWPPD  R      S   S +E  +  GE V+R+R   P     R EW
Sbjct: 301 EATSIQDKLLALPWPPDDTRHGIAFPS--VSHVEKDTQGGEQVVRRR-HVPIAVPPRNEW 357

Query: 359 YNDWGENLSDFGVDVESE 376
           YNDWGE+L  FGVDVE E
Sbjct: 358 YNDWGESLEHFGVDVEVE 375

>KNAG0F02930 Chr6 complement(557052..558212) [1161 bp, 386 aa] {ON}
           Anc_6.28 YOL003C
          Length = 386

 Score =  344 bits (883), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 184/389 (47%), Positives = 246/389 (63%), Gaps = 16/389 (4%)

Query: 1   MPVKLKWPWLGIAIPSSLIAFIGYGSHYFILGNFLSLGQQVWFQICLSMIWISYALAIFT 60
           MPV+LK PW GIAIP SLI FIGY +H+FIL N LS  +Q+ FQ CL+MIWISY +AI+T
Sbjct: 1   MPVQLKQPWHGIAIPCSLIFFIGYPAHWFILRNSLSNKRQIIFQFCLTMIWISYYMAIYT 60

Query: 61  NPGKPPTGF--QPLPHQWKNICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHN 118
           NPGKPP G   Q         C KC  +KPER+HHCKTC QCVL+MDHHCPWTMNC+G  
Sbjct: 61  NPGKPPHGSAQQHTDGDMNRYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFG 120

Query: 119 NFPHFVRFLVWVIITTSYLGFMLWKRIFMHWQLRHTRIYVQKI-----ELVFIFINTPLN 173
           NFP F+RFL+WVIITTS L + L  RI   WQ R+  I    +     ELV + + TP++
Sbjct: 121 NFPQFMRFLIWVIITTSQLFWYLLLRIAAIWQARNMPIKGGVVSTTTKELVSLVVLTPMD 180

Query: 174 AFVWLTIILLLLRCSKNQFLCGMTQIERWEWERIENQFNNGRLIPQLLENLAEIYGDDIL 233
            FV  TI  L +RC  NQ + GMTQIE WE ER++N F + +L+P ++E + E +  +  
Sbjct: 181 LFVLFTITALFVRCVTNQVIGGMTQIESWEMERLQNMFYSKKLLPIMIERVWEKFPHEQT 240

Query: 234 --NSPNAKKLINARD---LQLEEIVNFPYDLNIVANTRHAIGNLLTCILPWSSPVGNGLK 288
             +   A+KL+   +   L+   +VNFPYD++++ N   ++G+ +  + P+S+  GNG+ 
Sbjct: 241 PEHELEAEKLLEMNEQGLLKFSSVVNFPYDVDLLTNIHQSLGSPMLLLWPFSTAQGNGVT 300

Query: 289 FTKNDLSSYDTCHTIEDKLLSLPWPPDGGRQQPTGDSQVSSR-IEMHSSRGEPVLRKRLR 347
           F KND+S+Y+   +I D LL L WPPDGGR+ P    +  +  I+     GE ++RKR  
Sbjct: 301 FQKNDISTYEDNLSISDLLLCLSWPPDGGRRIPHPQREDGAHMIDQTVEDGEFMIRKRNS 360

Query: 348 DPRINMQRTEWYNDWGENLSDFGVDVESE 376
                  RT W N WGE L  FGVD  +E
Sbjct: 361 PIE---SRTTWENQWGETLEGFGVDPMNE 386

>KAFR0A05130 Chr1 complement(1019919..1021109) [1191 bp, 396 aa]
           {ON} Anc_6.28 YOL003C
          Length = 396

 Score =  320 bits (821), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 176/400 (44%), Positives = 247/400 (61%), Gaps = 28/400 (7%)

Query: 1   MPVKLKWPWLGIAIPSSLIAFIGYGSHYFILGNFLSLGQQVWFQICLSMIWISYALAIFT 60
           M ++LKWPWLGIAIP+ LI+FIGY +HYFIL + LS   Q+WFQ  LSMIW+SY LAI  
Sbjct: 1   MAIQLKWPWLGIAIPTFLISFIGYSAHYFILLDHLSWKLQLWFQFSLSMIWLSYYLAIKA 60

Query: 61  NPGKPPTGFQPLP-HQWKNICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNN 119
           +PG P    +       +  C+KC  YKP R HHCKTC++C+L+MDHHCPWTMNCVG  N
Sbjct: 61  DPGSPSIADKNEDIKTIRTYCKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKN 120

Query: 120 FPHFVRFLVWVIITTSYLGFMLWKRIFMHW-QLRHTRIYVQKIELVFIFINTPLNAFVWL 178
           +PHF+RFL WVI+TT++L   L++RI   W     +   VQ+ E+V + I TP++AF+ L
Sbjct: 121 YPHFLRFLFWVIVTTAFLLAQLFRRIGFIWTNWYSSSALVQRQEIVMLTILTPMDAFILL 180

Query: 179 TIILLLLRCSKNQFLCGMTQIERWEWERIENQFNNGR-----LIPQLLENLAEIYGDDIL 233
           TI LLL+RC+ NQ   GM+QIE+WE ER+E+ F + +      +  L+ N+  I+   I 
Sbjct: 181 TITLLLIRCTMNQIFSGMSQIEKWEMERLESSFYSRKEKSRDFLMILINNVFTIFS--IE 238

Query: 234 NSPNAKKLINA-------RDLQLEEIVNFPYDLNIVANTRHAIGNLLTCILPWSSPVGNG 286
           +  + ++ +N        R L    I+NFPYD++I+ N    +G   + + P+ +P G+G
Sbjct: 239 SPEDYQEEVNGLLRQHDKRRLAFHSIINFPYDIDILTNATCVLGPFFSWLNPFGAPEGDG 298

Query: 287 LKFTKNDLSSYDTCHTIEDKLLSLPWPPDGGRQQPTGDS--QVSSRIEMHSSRGEPVLRK 344
           + F  N+++S +   T+ D LLSLPWPPD    +  G S  + +  +E H   GE VLR 
Sbjct: 299 MHFELNEIAS-EKASTLADLLLSLPWPPDTCTSK-YGKSIDEGTKYVETHIEGGECVLRN 356

Query: 345 RLRDPRIN--------MQRTEWYNDWGENLSDFGVDVESE 376
           R   P  +        + R  W N+WGENL  FGVD+E E
Sbjct: 357 RTVSPSFDLPTANENQLSRKSWTNEWGENLQAFGVDIEGE 396

>TBLA0B00480 Chr2 (93291..94424) [1134 bp, 377 aa] {ON} Anc_6.28
           YOL003C
          Length = 377

 Score =  180 bits (456), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 145/405 (35%), Positives = 207/405 (51%), Gaps = 60/405 (14%)

Query: 1   MPVKLKWPWLGIAIPSSLIAFIGYGSHYFILGNFLSLGQQVWFQICLSMIWISYALAIFT 60
           M ++   PW G+AIPS +I  +   S++ IL + L+  Q +W+     MI  SY LAI T
Sbjct: 1   MVIEFSRPWYGVAIPSCIIFTLTTVSYFGILQDVLTTNQTIWYFTTAIMISYSYYLAIVT 60

Query: 61  NPGKPPTGF-QPLPHQWKN---------ICQKCKTYKPERTHHCKTCDQCVLVMDHHCPW 110
            P   P+   Q       N          C+KCK  K  R HHCKTC+ CV++MDHHCPW
Sbjct: 61  PPTPAPSTLTQSFISDVMNNENDIFPTTTCKKCKKIKLPRAHHCKTCNTCVVMMDHHCPW 120

Query: 111 TMNCVGHNNFPHFVRFLVWVIITTSYLGFMLWKRIFMHWQLRHTRIYVQ---KIELVFIF 167
           TMNCVG+ N+PHF+RFL WVII+T+ L   L K+ +  +  R++  ++    K +++ + 
Sbjct: 121 TMNCVGYTNYPHFIRFLAWVIISTTNLLSQLIKQAYKLYIYRNSPFHLYQNVKYKIIILT 180

Query: 168 INTPLNAFVWLTIILLLLRCSKNQFLCGMTQIERWEWERIENQFNNGR-----LIPQLLE 222
           +  P   FVWLT++LLLL+  +NQ   GMTQIE W++E IEN++   +     L  QLLE
Sbjct: 181 LLIPGTIFVWLTVLLLLLKTLQNQIWNGMTQIEYWQFEMIENKYFQSKSSKVALQLQLLE 240

Query: 223 NLAEIYGDDILNSPNAK--KLINAR------DLQLEEIVNFPYDLNIVANTRHAIGNL-- 272
           NL   Y   +      K  KLI++       +     I+NFPYDL +  N    +G+L  
Sbjct: 241 NLLNFYNKKLSTDSITKIQKLISSLQNGARWNTSFHSIINFPYDLGLSNNITTTMGSLNP 300

Query: 273 LTCILPWSSPVGNGLKFTKNDLSSYDTCHT---IEDKLLSLPWPPDGGRQQPTGDSQVSS 329
           L+   PW +P+        N+ + +D   T   I+D LL LPWP +        D     
Sbjct: 301 LSWFNPWYTPLTASYN-KINEFAIWDDNETHDNIKDMLLCLPWPLNYSNNSTFQD----- 354

Query: 330 RIEMHSSRGEPVLRKRLRDPRINMQRTEWYNDWGENLSDFGVDVE 374
                   GE V++                ND+GE L DFGVD +
Sbjct: 355 --------GELVVKS---------------NDYGETLQDFGVDYD 376

>KLLA0E02069g Chr5 complement(195185..196162) [978 bp, 325 aa] {ON}
           weakly similar to uniprot|P42836 Saccharomyces
           cerevisiae YNL326C PFA3 Palmitoyltransferase for Vac8p
           one of three yeast DHHC-cysteine rich domain proteins
           (Pfa3p Erf2p Akr1p) with palmitoyltransferase activity
           required for vacuolar integrity under stress conditions
          Length = 325

 Score = 84.7 bits (208), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 52/171 (30%), Positives = 87/171 (50%), Gaps = 26/171 (15%)

Query: 80  CQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFVRFLVWVIITTSYLGF 139
           CQ C+ +KP+R HHC  C++C L MDHHCPW  +CVG  N   FV+FL +  + + Y+  
Sbjct: 105 CQTCEIWKPDRCHHCSKCNKCFLKMDHHCPWFASCVGFRNQKFFVQFLAYTTVYSLYVLL 164

Query: 140 MLWKRIFMHWQLRHTRIYVQKIELVFIFINTPLNA---FVWLTIILLLLRCSKNQFLCGM 196
           M   +++  ++    +  +  + L+ +++ + + A   F + T  + L+  +KN+     
Sbjct: 165 MTSAQLYSWFRQMKYKSELLDLHLLVVWVLSVIAAIATFAFTTYTIWLV--TKNE----- 217

Query: 197 TQIERWEWERIENQFNNGRLIPQLLENLAEIYGDDILNSPNAKKLINARDL 247
           T IE++EW  I +                EIYGD I  + N   + N  DL
Sbjct: 218 TTIEQYEWGNIRHDL--------------EIYGDSI--NCNMGSVDNVFDL 252

>KAFR0A08590 Chr1 (1722408..1723403) [996 bp, 331 aa] {ON} Anc_3.12
           YNL326C
          Length = 331

 Score = 84.3 bits (207), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 71/134 (52%), Gaps = 4/134 (2%)

Query: 79  ICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFVRFLVWVIITTSYLG 138
           ICQ C  +KP+R HHC +C++C+L MDHHCPW   C+G  N  +F++FL +    +  + 
Sbjct: 105 ICQTCMFWKPDRCHHCSSCNRCILKMDHHCPWFAECIGFKNQKYFIQFLFYCTSYSIIVL 164

Query: 139 FMLWKRIFMHWQLRHTRIYVQKIELVFIFINTPLNAFVWLTIILLLLRCSKNQFLCGMTQ 198
           F+   +I+ HW  R T    + I+  F  +   L A V    ++L    S  Q L   T 
Sbjct: 165 FVTSIQIY-HW-FRSTSYEYEFID--FKLLTVWLLAIVIFISLVLFTGFSVFQLLGNQTT 220

Query: 199 IERWEWERIENQFN 212
           IE + + R + + N
Sbjct: 221 IELYAYRRYKAELN 234

>KLTH0F19580g Chr6 (1586776..1587804) [1029 bp, 342 aa] {ON} similar
           to uniprot|P42836 Saccharomyces cerevisiae YNL326C PFA3
           Palmitoyltransferase for Vac8p one of three yeast
           DHHC-cysteine rich domain proteins (Pfa3p Erf2p Akr1p)
           with palmitoyltransferase activity required for vacuolar
           integrity under stress conditions
          Length = 342

 Score = 83.2 bits (204), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 48/140 (34%), Positives = 76/140 (54%), Gaps = 18/140 (12%)

Query: 80  CQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFVRFLVWVIITTSYLGF 139
           C+ C  +KP+R HHC  C +C L MDHHCPW  +CVG+ N  +FV+FL++  +  S L F
Sbjct: 106 CRVCAVWKPDRCHHCSACKKCFLKMDHHCPWFASCVGYANQKYFVQFLIYGTV-FSILIF 164

Query: 140 MLWKRIFMHWQLRHTRIYVQKIEL-------VFIFINTPLNAFVWLTIILLLLRCSKNQF 192
           +L     + W  ++ R   + I+L       + + I+  + AF   T+ L+    +KNQ 
Sbjct: 165 LLSGTELLLW-FKNQRYNQEMIQLPLLVVWILSVAISISMLAFTSYTVYLI----TKNQ- 218

Query: 193 LCGMTQIERWEWERIENQFN 212
               T IE +EW  ++ + N
Sbjct: 219 ----TTIEMYEWSNLKAEAN 234

>KNAG0K02570 Chr11 (511867..512853) [987 bp, 328 aa] {ON} Anc_3.12
           YNL326C
          Length = 328

 Score = 82.8 bits (203), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 48/136 (35%), Positives = 77/136 (56%), Gaps = 10/136 (7%)

Query: 78  NICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFVRFLVWVIITTSYL 137
            +CQ C+ +KP+R HHC +CD+C+L MDHHCPW   CVG  N   F++FL++   TT+Y 
Sbjct: 101 RVCQSCRYWKPDRCHHCSSCDRCILKMDHHCPWIAGCVGFRNQKLFIQFLLY---TTAYA 157

Query: 138 GFMLWKRIFMHWQLRHTRIYVQKI---ELVFIFINTPLNAFVWLTIILLLLRCSKNQFLC 194
            F+L       ++  +   + +++    L+F++I + L  F+ +T   L    S +Q L 
Sbjct: 158 IFVLSMTSVQLYRWFYNDKFQEELISGYLLFLWIFS-LVVFIAMT---LFSAFSVSQVLK 213

Query: 195 GMTQIERWEWERIENQ 210
             T IE +  +R  NQ
Sbjct: 214 NQTTIEMYGVQRWRNQ 229

>NDAI0G01340 Chr7 (301254..302261) [1008 bp, 335 aa] {ON} Anc_3.12
          Length = 335

 Score = 82.0 bits (201), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 51/163 (31%), Positives = 79/163 (48%), Gaps = 15/163 (9%)

Query: 79  ICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFVRFLVWVIITTSYLG 138
           +CQ C+ +KP+R HHC TC++C+L MDHHCPW   C+G  N   F++FL++  I  +++ 
Sbjct: 108 LCQTCQVWKPDRCHHCSTCNKCILKMDHHCPWFAECIGFKNQKFFIQFLIYCTI-YAFVA 166

Query: 139 FMLWKRIFMHWQLRHTRIYVQKIELVFIFINTPLNAFVWLTIILLLLRCSKNQFLCGMTQ 198
             L    F++W  ++     + I+   + +   L AFV    +L     S  Q L   T 
Sbjct: 167 LGLISYQFVNW-YKNQNYMNEYIDFTLLIVG--LLAFVISISVLAFSSFSIYQVLKNRTT 223

Query: 199 IERWEWERI-----------ENQFNNGRLIPQLLENLAEIYGD 230
           IE +   R            E+ F N   +   L N  E+ GD
Sbjct: 224 IEMYGIRRYNRDFAILNGTEESDFKNIFELDSNLLNWKEVMGD 266

>Kpol_1014.29 s1014 (48992..49972) [981 bp, 326 aa] {ON}
           (48992..49972) [981 nt, 327 aa]
          Length = 326

 Score = 81.6 bits (200), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 42/106 (39%), Positives = 63/106 (59%), Gaps = 11/106 (10%)

Query: 79  ICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFVRFL----VWVIITT 134
           +C+ C  +KP+R HHC  CD+C+L MDHHCPW   CVG  N  +FV+FL    V+ I+  
Sbjct: 105 VCRTCNVWKPDRCHHCSACDKCILKMDHHCPWFAECVGFKNQKYFVQFLIYTTVYAILVM 164

Query: 135 SYLGFMLWKRIFMHWQLRHTRIYVQKIELVFIFINTPLNAFVWLTI 180
           +Y  F ++   +   +L  T I   KI L+ ++I   L+  V+LT+
Sbjct: 165 TYTSFQIYD--WFKNELYETEII--KIRLLMVWI---LSVAVFLTV 203

>NCAS0E01300 Chr5 complement(250120..251103) [984 bp, 327 aa] {ON}
           Anc_3.12
          Length = 327

 Score = 81.3 bits (199), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 46/162 (28%), Positives = 80/162 (49%), Gaps = 11/162 (6%)

Query: 79  ICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFVRFLVWVIITTSYLG 138
           +CQ C+ +KP+R HHC TCD+C+L MDHHCPW   C+G  N  +FV+FL++   T   + 
Sbjct: 100 LCQTCQVWKPDRCHHCSTCDKCILKMDHHCPWFAECIGFENQKYFVQFLIYC--TAYSIV 157

Query: 139 FMLWKRIFMHWQLRHTRIYVQKIELVFIFINTPLNAFVWLTIILLLLRCSKNQFLCGMTQ 198
            + +    +H+     +   + I+L  + +   + A V    ++     S  Q L   T 
Sbjct: 158 VLFFTSCELHYWFSGKQYEDELIDL--MLLTVWILAIVITVSLIFFSSFSIYQLLKNQTT 215

Query: 199 IERWEWERIENQFNNGRLIPQLLENLAEIYGDDILNSPNAKK 240
           IE +  +R +          +LL  L +   D+I +  + ++
Sbjct: 216 IEMYGMKREKRDL-------ELLRGLEDAEVDNIFDLGSRRR 250

>Kwal_55.22126 s55 (1121936..1123018) [1083 bp, 360 aa] {ON} YNL326C
           - Hypothetical ORF [contig 124] FULL
          Length = 360

 Score = 81.3 bits (199), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 45/138 (32%), Positives = 71/138 (51%), Gaps = 14/138 (10%)

Query: 80  CQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFVRFLVWVIITTSYLGF 139
           C+ C  +KP+R HHC  C++C L MDHHCPW  +CVG+ N  +F+ FL++    +  + F
Sbjct: 133 CRTCVVWKPDRCHHCSGCNKCYLKMDHHCPWFASCVGYRNQKYFIHFLLYTTAYSILVFF 192

Query: 140 MLWKRIFMHWQLRHTRIYVQKIELVFI-----FINTPLNAFVWLTIILLLLRCSKNQFLC 194
           +    + M ++ +     +  + L+ +      I   + AF   TI L+    +KNQ   
Sbjct: 193 LTGADLLMWFRSQGYNQELINLPLLIVWILSLVITISMLAFTSYTIYLV----AKNQ--- 245

Query: 195 GMTQIERWEWERIENQFN 212
             T IE +EW    NQ N
Sbjct: 246 --TTIEMYEWTNYRNQRN 261

>TBLA0H00150 Chr8 complement(13169..14206) [1038 bp, 345 aa] {ON}
           Anc_3.12 YNL326C
          Length = 345

 Score = 80.5 bits (197), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 41/136 (30%), Positives = 70/136 (51%), Gaps = 10/136 (7%)

Query: 79  ICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFVRFLVWVIITTSYLG 138
           +C+ C  +KP+R HHC +CD+C+L MDHHCPW   C+G  N  +F+ FL++  +  +++ 
Sbjct: 105 VCRTCLVWKPDRCHHCSSCDRCILKMDHHCPWFAECIGFKNHKYFINFLIYNSLYATFVC 164

Query: 139 FMLWKRIFMHWQLRHTRIYVQK---IELVFIFINTPLNAFVWLTIILLLLRCSKNQFLCG 195
            +  K +   W       YV +   I L+ +FI + + +      + L    S  Q L  
Sbjct: 165 LISSKEL---WNWFSQEKYVTELINIHLLLLFIVSLITS----VSMTLFTAYSIYQVLIN 217

Query: 196 MTQIERWEWERIENQF 211
            T IE + + R + + 
Sbjct: 218 RTTIELYAYRRYKEEL 233

>ZYRO0C03410g Chr3 (265684..266667) [984 bp, 327 aa] {ON} similar to
           uniprot|P42836 Saccharomyces cerevisiae YNL326C PFA3
           Palmitoyltransferase for Vac8p one of three yeast
           DHHC-cysteine rich domain proteins (Pfa3p Erf2p Akr1p)
           with palmitoyltransferase activity required for vacuolar
           integrity under stress conditions
          Length = 327

 Score = 79.3 bits (194), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 57/205 (27%), Positives = 93/205 (45%), Gaps = 32/205 (15%)

Query: 79  ICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFVRFLVWVIITTSYLG 138
           +C+ C  +KP+R HHC  CD+C+L MDHHCPW   C+G NN   F+++L++   T S + 
Sbjct: 106 VCRTCHVWKPDRCHHCSRCDKCILKMDHHCPWFPGCIGFNNQRFFIQYLLYA-TTYSIVI 164

Query: 139 FMLWKRIFMHW------QLRHTRIYVQKIELVFIFINTPLNAFVWLTIILLLLRCSKNQF 192
           F+      +HW      ++     ++  + L+ + ++  L+ F   +I     + +KNQ 
Sbjct: 165 FLFSSIQLLHWFNTKQYEVELIDFHLLSVWLLGVAVSVSLSFFTGFSI----YQVTKNQT 220

Query: 193 LCGMTQIERWEWERIENQFNNGRLIPQLLENLAEIYGDDILNSPNAKKLI----NARDLQ 248
              M    R+  E               LE LA+  G    N  NA  L     N +DL 
Sbjct: 221 TVEMHIYRRYREE---------------LEILADTCGSINPNRDNAYDLGSTMNNWKDLM 265

Query: 249 LEEIVN--FPYDLNIVANTRHAIGN 271
            E  +   FP D +     R+ + +
Sbjct: 266 GERWIEWLFPIDTSRAKKNRNTLDH 290

>NCAS0B03590 Chr2 complement(636400..637389) [990 bp, 329 aa] {ON} 
          Length = 329

 Score = 78.6 bits (192), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 46/139 (33%), Positives = 70/139 (50%), Gaps = 11/139 (7%)

Query: 79  ICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFVRFLVWVIITTSYLG 138
           +C+ C++YKP R+ HC  CD+CVLV DHHC W  NCVG  N+ +F  FL+    + +Y  
Sbjct: 136 LCRTCQSYKPARSKHCSICDRCVLVADHHCIWVNNCVGKGNYTYFYMFLITNTFSLTY-A 194

Query: 139 FMLWKRIFMHWQLRHTRIYVQKIELVFIFINTPLNAFVWLTIILLLLRCSKNQFLCGMTQ 198
           F+    IF       T +Y+ K  L    +      F  +  I   L+ +  Q   GMT 
Sbjct: 195 FIRLLTIFY-----TTNVYLPKNTLTLTIL---CGCFSVICGIFTFLQLNLAQ--EGMTT 244

Query: 199 IERWEWERIENQFNNGRLI 217
            E+ +W  +     +G+L+
Sbjct: 245 NEKDKWFTVHEFMRDGKLV 263

>SAKL0C13596g Chr3 (1198957..1199958) [1002 bp, 333 aa] {ON} similar
           to uniprot|P42836 Saccharomyces cerevisiae YNL326C PFA3
           Palmitoyltransferase for Vac8p one of three yeast
           DHHC-cysteine rich domain proteins (Pfa3p Erf2p Akr1p)
           with palmitoyltransferase activity required for vacuolar
           integrity under stress conditions
          Length = 333

 Score = 77.8 bits (190), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 46/139 (33%), Positives = 74/139 (53%), Gaps = 16/139 (11%)

Query: 79  ICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFVRFLVWVIITTSYLG 138
           IC+ CK +KP+R+HHC +C++C L MDHHCPW  +C+G  N   F++FL++   TT Y  
Sbjct: 104 ICRNCKVWKPDRSHHCSSCNKCFLKMDHHCPWFASCIGFKNQKLFIQFLLY---TTWYAV 160

Query: 139 FMLWKRIFMHWQLRHTRIYVQKIELVFIFINTPLNAFVWLTIIL----LLLRCSKNQFLC 194
           F+        W+    ++Y +  EL+ + + T     VWL  I+    +    S + +L 
Sbjct: 161 FVFMTTGLQLWKWLDNKMYEK--ELIDLSLMT-----VWLLSIISCISMFAFTSYSIYLV 213

Query: 195 --GMTQIERWEWERIENQF 211
               T IE + W   ++Q 
Sbjct: 214 TKNTTTIEMYGWTHYKSQL 232

>CAGL0D02508g Chr4 (256760..257758) [999 bp, 332 aa] {ON} similar to
           uniprot|P42836 Saccharomyces cerevisiae YNL326c
          Length = 332

 Score = 77.4 bits (189), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 39/54 (72%)

Query: 79  ICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFVRFLVWVII 132
           +C+ C ++KP+R HHC TC+ CVL MDHHCPW   CVG+ N   F++FL++  +
Sbjct: 105 VCKSCSSWKPDRCHHCSTCNVCVLKMDHHCPWFAGCVGYRNQKFFIQFLIYCTV 158

>TPHA0C01070 Chr3 complement(244556..245557) [1002 bp, 333 aa] {ON}
           Anc_8.286 YDR126W
          Length = 333

 Score = 77.0 bits (188), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 52/197 (26%), Positives = 83/197 (42%), Gaps = 13/197 (6%)

Query: 69  FQPLPHQWKNICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFVRFLV 128
           F  + +   N+C  C   KP R+ HC  C  C+L+ DHHC W  NC+G  N+ +F  FL+
Sbjct: 128 FDNIIYHSGNVCSTCNIEKPARSKHCNICGTCILLQDHHCIWVNNCIGLGNYKYFFMFLL 187

Query: 129 WVIITTSYLGFMLWKRIFMHWQLRHTRIYVQKIELVFIFINTPLNAFVWLTIILLLLRCS 188
              I+ SY    L     +H  L    +   K  L    +    +    +   L + + +
Sbjct: 188 LNTISLSYAFLRL-----LHITLSKPDVPKSKNILALCILTGSFSVICGVFFYLQMKQVN 242

Query: 189 KNQFLCGMTQIERWEWERIENQFNNGRLIPQLLENLAEIYGDDILNSPNAKKLINARDLQ 248
                 GMT  E  +W  ++     G+LI     N   +  +D  +SP+     N  D +
Sbjct: 243 N-----GMTTNETDKWYAVQELMREGKLIKSEDNNWFALSTEDAPDSPSQVYSTNFYDNK 297

Query: 249 LEEIVNFPYDLNIVANT 265
             +I N   D +IV + 
Sbjct: 298 TYKISN---DYHIVKDA 311

>TDEL0F04130 Chr6 (759451..760437) [987 bp, 328 aa] {ON} Anc_8.286
           YDR126W
          Length = 328

 Score = 77.0 bits (188), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 68/222 (30%), Positives = 98/222 (44%), Gaps = 26/222 (11%)

Query: 51  WISYALAIFTNPGKPPTGFQPLPHQW----KNI-CQKCKTYKPERTHHCKTCDQCVLVMD 105
           W+S  +   T+ G  P   Q   + +     N+ C+ C   KP R+ HC  C +CVLV D
Sbjct: 104 WLSMTVKAKTSRGCQPGSAQEYDYDYILYYPNVQCRTCHIEKPARSRHCNLCRECVLVAD 163

Query: 106 HHCPWTMNCVGHNNFPHFVRFLVWVIITTSYLGFM--LWKRIFMHWQLRHTRIYVQKIEL 163
           HHC W  NC+G  N+  F  FLV  +I+ SY GF+  LW  +     +    +Y + I +
Sbjct: 164 HHCVWVNNCIGKGNYQFFYAFLVVNVISLSY-GFLRVLWISVMKDPSM---VVYPRSILI 219

Query: 164 VFIFINTPLNAFVWLTIILLLLRCSKNQFLCGMTQIERWEWERIENQFNNGRLIPQLLEN 223
             I   T   A +      L L+   +    GMT  E+ +W  I+     G L+  L   
Sbjct: 220 FTILCGT--FAIICGVFTYLQLQLVND----GMTTGEKDKWYTIQQIMREGNLVRTL--- 270

Query: 224 LAEIYGDDILNSPNAKKLINARDLQL-----EEIVNFPYDLN 260
             + +  D  N PN     NA D +L       IVN P D+ 
Sbjct: 271 DGQFFIQDQQN-PNQFYSTNAYDSKLYVPQNYSIVNDPKDIT 311

>TPHA0P01560 Chr16 (318550..319545) [996 bp, 331 aa] {ON} Anc_3.12
           YNL326C
          Length = 331

 Score = 76.3 bits (186), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 63/111 (56%), Gaps = 5/111 (4%)

Query: 79  ICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFVRFLVWVIITTSYLG 138
           +C+ C  +KP+R+HHC TC++CVL MDHHCPW   C+G  N   F++FL++       + 
Sbjct: 109 VCRTCNVWKPDRSHHCSTCNRCVLKMDHHCPWFSECIGFKNQKFFIQFLIYNTTYAYVIA 168

Query: 139 FMLWKRIFM-----HWQLRHTRIYVQKIELVFIFINTPLNAFVWLTIILLL 184
            +  K+++       ++     +Y+  + ++ + ++  L+ F   ++ +++
Sbjct: 169 ILTSKQMYNWFDDGSYENEFVNMYLLFLWILALVVSLALSCFAGFSVYMVM 219

>Suva_14.15 Chr14 complement(23560..24552) [993 bp, 330 aa] {ON}
           YNL326C (REAL)
          Length = 330

 Score = 75.1 bits (183), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 66/234 (28%), Positives = 99/234 (42%), Gaps = 34/234 (14%)

Query: 78  NICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFVRFLVWVIITTSYL 137
            +CQ C  +KP+R HHC +CD C+L MDHHCPW   C G  N   F++FL++   TT Y 
Sbjct: 104 RVCQICHVWKPDRCHHCSSCDMCILKMDHHCPWFAECTGFKNQKLFIQFLMY---TTFYA 160

Query: 138 GFMLWKRIFMHWQLRHTRIYVQKIELVFIFINTPLNAFVWLTIILLLLRCSKNQFLCGMT 197
             +L    +      H+  + Q++ + F  +   L A      +L     S  Q     T
Sbjct: 161 FLVLIYSCYELGTWFHSGSFNQEL-IDFHLLGVALLAIAIFISVLAFTAFSIYQVCNNQT 219

Query: 198 QIERWEWERIENQFNNGRLIPQLLENLAEIYGDDILNSPNAKKLINARDLQLEEIVNFPY 257
            IE +   R              LE + + YG D                QLE I +   
Sbjct: 220 TIELYGMRRYRRD----------LEIINDTYGADT---------------QLENIFDLG- 253

Query: 258 DLNIVANTRHAIG-NLLTCILPWSSPVGNGLKFTKNDLSSY-DTCHTIEDKLLS 309
             + +AN +  +G + L  +LP  +      K TK++   Y D     +D+LLS
Sbjct: 254 --SSIANWQDLMGMSWLEWLLPIETYKYKRSKHTKDEKGLYFDIRPEAQDRLLS 305

>KLLA0F19690g Chr6 (1820355..1821329) [975 bp, 324 aa] {ON} similar
           to uniprot|Q04629 Saccharomyces cerevisiae YDR126W SWF1
           Spore Wall Formation
          Length = 324

 Score = 74.7 bits (182), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 60/233 (25%), Positives = 99/233 (42%), Gaps = 28/233 (12%)

Query: 39  QQVWFQICLSMIWISYALAIFTNPGKPPTG--FQP--LPHQWKNICQKCKTYKPERTHHC 94
           ++ +  I ++   ++   ++F  P     G  FQP  +      +CQ CKT K  R+ HC
Sbjct: 84  EKAFIPITIAFTSLTGVASVFVKPLGLQAGPQFQPDYIIFHPSAVCQTCKTIKVPRSKHC 143

Query: 95  KTCDQCVLVMDHHCPWTMNCVGHNNFPHFVRFLVWVIITTSYLGFMLWKRIFMHWQLRHT 154
             C++C+ + DHHC W  NCVG+ N+ +F  FL+   +  +Y    L         L   
Sbjct: 144 PICERCIPLHDHHCIWINNCVGYGNYEYFYSFLLSNCLLLTYASLRL---------LTLF 194

Query: 155 RIYVQKIELVFIFINTPLNAFVWLTIILLLLRCSKNQFLCGMTQIERWEWERIENQFNNG 214
           RI   K +  F+ +     AF  + I+    +        GMT  E+ +W  ++    NG
Sbjct: 195 RITAFKKDKFFLSLFLLTTAFSLIAIVFTYYQLKLVN--DGMTNNEQDKWYLVQEYMRNG 252

Query: 215 RLIPQL------------LENLAEIYGDDILNSPNAKKLIN-ARDLQLEEIVN 254
            L+  +             +    I+    L   +   LIN A+ L  EEI+N
Sbjct: 253 NLVKDMDGVLYYRSMSTDAQTAEPIFYSTNLYDHSKYHLINPAKILSHEEIIN 305

>KAFR0B05370 Chr2 complement(1105534..1106523) [990 bp, 329 aa] {ON}
           Anc_8.286 YDR126W
          Length = 329

 Score = 73.9 bits (180), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 47/149 (31%), Positives = 68/149 (45%), Gaps = 11/149 (7%)

Query: 69  FQPLPHQWKNICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFVRFLV 128
           F  L       C  C+  KP R+ HC  C++CVL+ DHHC W  NC+G  N+ +F  FLV
Sbjct: 126 FDSLIFYPNTFCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLV 185

Query: 129 WVIITTSYLGFMLWKRIFMHWQLRHTRIYVQKIELVFIFINTPLNAFVWLTIILLLLRCS 188
                T  LG+   + I +     ++ I    I L F+ ++    A     I+L+     
Sbjct: 186 ---SNTLLLGYAFLRIILL---TAYSDIGFPNIVLTFLILSGAFFA-----ILLVFTYLQ 234

Query: 189 KNQFLCGMTQIERWEWERIENQFNNGRLI 217
                 GMT  E+ +W  I+     GRLI
Sbjct: 235 FALVYDGMTTNEKDKWFTIQEFMREGRLI 263

>TDEL0A00310 Chr1 complement(54006..54995) [990 bp, 329 aa] {ON}
           Anc_3.12 YNL326C
          Length = 329

 Score = 73.6 bits (179), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 39/55 (70%)

Query: 78  NICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFVRFLVWVII 132
            +C+ C  +KP+R HHC  C++C+L MDHHCPW  +CVG  N  +F++FL++  +
Sbjct: 106 RLCRTCHVWKPDRCHHCSACNRCILRMDHHCPWLPDCVGFRNQKYFIQFLMYATL 160

>Skud_14.15 Chr14 complement(20841..21851) [1011 bp, 336 aa] {ON}
           YNL326C (REAL)
          Length = 336

 Score = 73.2 bits (178), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 41/63 (65%), Gaps = 4/63 (6%)

Query: 79  ICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFVRFLVWVIITTSYLG 138
           +CQ C  +KP+R HHC +CD C+L MDHHCPW   C G  N   F++FL++    T++  
Sbjct: 105 VCQICHVWKPDRCHHCSSCDICILKMDHHCPWFAECTGFKNQKFFIQFLMY----TTFYA 160

Query: 139 FML 141
           F++
Sbjct: 161 FLV 163

>Smik_14.6 Chr14 complement(11864..12868) [1005 bp, 334 aa] {ON}
           YNL326C (REAL)
          Length = 334

 Score = 73.2 bits (178), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 40/63 (63%), Gaps = 3/63 (4%)

Query: 79  ICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFVRFLVWVIITTSYLG 138
           +CQ C  +KP+R HHC +CD CVL MDHHCPW   C G  N   F++FL++   TT Y  
Sbjct: 105 VCQVCHVWKPDRCHHCSSCDICVLKMDHHCPWFAECTGFKNQKFFIQFLMY---TTCYAF 161

Query: 139 FML 141
            +L
Sbjct: 162 LVL 164

>YNL326C Chr14 complement(27337..28347) [1011 bp, 336 aa] {ON}
           PFA3Palmitoyltransferase for Vac8p, required for
           vacuolar membrane fusion; contains an
           Asp-His-His-Cys-cysteine rich (DHHC-CRD) domain;
           autoacylates; required for vacuolar integrity under
           stress conditions
          Length = 336

 Score = 72.4 bits (176), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 36/54 (66%)

Query: 79  ICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFVRFLVWVII 132
           +CQ C  +KP+R HHC +CD C+L MDHHCPW   C G  N   F++FL++  +
Sbjct: 105 VCQVCHVWKPDRCHHCSSCDVCILKMDHHCPWFAECTGFRNQKFFIQFLMYTTL 158

>SAKL0H16434g Chr8 complement(1447419..1449086) [1668 bp, 555 aa]
           {ON} similar to uniprot|Q04629 Saccharomyces cerevisiae
           YDR126W SWF1 Spore Wall Formation
          Length = 555

 Score = 72.8 bits (177), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 41/139 (29%), Positives = 66/139 (47%), Gaps = 9/139 (6%)

Query: 79  ICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFVRFLVWVIITTSYLG 138
           ICQ C   KP R+ HC  C++C+L++DHHC W  NC+G  N+ +F  FL+  +   SY  
Sbjct: 131 ICQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLLSNVTLLSY-S 189

Query: 139 FMLWKRIFMHWQLRHTRIYVQKIELVFIFINTPLNAFVWLTIILLLLRCSKNQFLCGMTQ 198
           F+    I +  Q  + +    K  LV   +    +      I+ +      N    GMT 
Sbjct: 190 FLRLTSIQLMSQTENIK---TKPMLVLTILTGCFD-----IIVAVFGYTQFNLVHDGMTT 241

Query: 199 IERWEWERIENQFNNGRLI 217
            E+ +W  ++    +G L+
Sbjct: 242 NEQDKWFTVQEFMRDGNLV 260

>Skud_12.321 Chr12 (571368..572438) [1071 bp, 356 aa] {ON} YLR246W
           (REAL)
          Length = 356

 Score = 72.0 bits (175), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 39/58 (67%)

Query: 80  CQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFVRFLVWVIITTSYL 137
           CQ C+ ++P RT HC TC+ CV+V DHHC W  NCVG  N+  F+ FL+  I ++ +L
Sbjct: 175 CQSCRIWRPPRTSHCSTCNVCVMVHDHHCVWVNNCVGKRNYRFFLIFLLSAIFSSVFL 232

>TBLA0D04040 Chr4 complement(1006179..1007168) [990 bp, 329 aa] {ON}
           Anc_8.286 YDR126W
          Length = 329

 Score = 71.6 bits (174), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 36/62 (58%)

Query: 80  CQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFVRFLVWVIITTSYLGF 139
           C+ CK  KP R+ HC  CDQC+LV DHHC W  NC+G  NF +F  FL    +  SY   
Sbjct: 137 CKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGNFLYFYLFLFDNTLFMSYASM 196

Query: 140 ML 141
            L
Sbjct: 197 RL 198

>NDAI0J01000 Chr10 (229188..230207) [1020 bp, 339 aa] {ON} Anc_8.286
           YDR126W
          Length = 339

 Score = 71.6 bits (174), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 54/195 (27%), Positives = 87/195 (44%), Gaps = 13/195 (6%)

Query: 80  CQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFVRFLVWVIITTSYLGF 139
           C+ C   KP R+ HC+ C+ C+L+ DHHC W  NC+G  N+ +F  FL+   IT +Y  F
Sbjct: 139 CRTCGIVKPARSKHCEICNSCILLCDHHCLWVNNCIGEGNYLYFYSFLLCNCITMTY-SF 197

Query: 140 MLWKRIFMHWQLRHTRIYVQKIELVFIFINTPLNAFVWLTIILLLLRCSKNQFLCGMTQI 199
           +   R+F+ +   H         ++ + I     A +      L L+  K+    GMT  
Sbjct: 198 I---RLFLMYCQGHAP---SSRNILTLLILCGSFAVICAGFTFLQLQLVKD----GMTTN 247

Query: 200 ERWEWERIENQFNNGRLIPQLLENLAEIY--GDDILNSPNAKKLINARDLQLEEIVNFPY 257
           E+ +W  ++    +G+LI    EN   I    DD   + NA  +  + +    E  +   
Sbjct: 248 EQDKWFTLQEYMRDGKLIRTKDENKWFIANPNDDATITINADTIFYSTNAYDHEGYHLSS 307

Query: 258 DLNIVANTRHAIGNL 272
           D   +      I NL
Sbjct: 308 DEYTIVEDPRQITNL 322

>YDR126W Chr4 (703234..704244) [1011 bp, 336 aa] {ON}
           SWF1Palmitoyltransferase that acts on transmembrane
           proteins, including the SNAREs Snc1p, Syn8p, Tlg1p and
           likely all SNAREs; contains an Asp-His-His-Cys-cysteine
           rich (DHHC-CRD) domain; may have a role in vacuole
           fusion
          Length = 336

 Score = 71.6 bits (174), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 43/141 (30%), Positives = 64/141 (45%), Gaps = 11/141 (7%)

Query: 80  CQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFVRFLVWVIITTSYLGF 139
           C  C+  KP R+ HC  C++CVLV DHHC W  NC+G  N+  F  FL+  I +  Y   
Sbjct: 136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLISNIFSMCYAFL 195

Query: 140 MLWKRIFMHWQLRHTRIYVQKIELVFIFINTPLNAFVWLTIILLLLRCSKNQFLCGMTQI 199
            LW     +  L  T    + +  + I        F  +  I   L+ +  +   GMT  
Sbjct: 196 RLW-----YISLNSTSTLPRAVLTLTILC----GCFTIICAIFTYLQLAIVKE--GMTTN 244

Query: 200 ERWEWERIENQFNNGRLIPQL 220
           E+ +W  I+     G+L+  L
Sbjct: 245 EQDKWYTIQEYMREGKLVRSL 265

>ADL197C Chr4 complement(350991..352163) [1173 bp, 390 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL326C
          Length = 390

 Score = 72.0 bits (175), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 30/72 (41%), Positives = 40/72 (55%), Gaps = 6/72 (8%)

Query: 80  CQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFVRFLVWVIITTSYLGF 139
           C KCK +KP+R HHC  CD+C L  DHHC W   C+G+NN   F+ FL++  +      +
Sbjct: 171 CVKCKVWKPDRCHHCSACDKCYLRRDHHCVWFPGCIGYNNHKFFLHFLLYASV------Y 224

Query: 140 MLWKRIFMHWQL 151
             W  I   W L
Sbjct: 225 AFWICIITTWDL 236

>SAKL0H13860g Chr8 (1185970..1187028) [1059 bp, 352 aa] {ON} similar
           to uniprot|Q6B217 Saccharomyces cerevisiae YLR246W ERF2
           Subunit of a palmitoyltransferase composed of Erf2p and
           Shr5p that adds a palmitoyl lipid moiety to Ras2p
           through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 352

 Score = 71.2 bits (173), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 27/72 (37%), Positives = 42/72 (58%)

Query: 66  PTGFQPLPHQWKNICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFVR 125
           PTG   + +     C  C+ ++P R  HC TC+ C++  DHHC W  NC+G  N+ +F  
Sbjct: 158 PTGNPLIANIEVKYCTTCRIWRPPRASHCSTCEACIITHDHHCKWVNNCIGQRNYHYFFT 217

Query: 126 FLVWVIITTSYL 137
           FLV  +I T+++
Sbjct: 218 FLVSCVIATAFI 229

>KLTH0G13112g Chr7 complement(1129318..1130367) [1050 bp, 349 aa]
           {ON} similar to uniprot|Q04629 Saccharomyces cerevisiae
           YDR126W SWF1 Spore Wall Formation
          Length = 349

 Score = 71.2 bits (173), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 48/164 (29%), Positives = 74/164 (45%), Gaps = 20/164 (12%)

Query: 6   KWPWLGIAIPSSLIAFIGYGSHYF-------ILGNFLSLGQQVWFQICLSMIWISYALAI 58
           ++ W   AIP+  ++   Y +  F       I      + + +   + LS   I+  L I
Sbjct: 47  RFRWKFRAIPAFYLSIYAYCTFLFFKDIEGLIRSRLFGVERLLIIPVALSAPIITGLLTI 106

Query: 59  FTNPGKPPTGFQPLPHQWKNI-------CQKCKTYKPERTHHCKTCDQCVLVMDHHCPWT 111
           +  P    T   P+   +  +       C+ CK  K  RT HC  CDQCV + DHHC W 
Sbjct: 107 WIKPKS--TYASPMLDAYDELIFHSGVSCRTCKLPKFARTKHCPICDQCVQLADHHCVWA 164

Query: 112 MNCVGHNNFPHFVRFLVWVIITTSYLGFMLWKRIFMHWQLRHTR 155
            NC+G  N+ +F  FLV  +  T+Y GF+   R+    +  H+R
Sbjct: 165 NNCIGRGNYQYFYLFLVSNVFLTNY-GFL---RLLFLQRFVHSR 204

>Skud_4.387 Chr4 (675002..676012) [1011 bp, 336 aa] {ON} YDR126W
           (REAL)
          Length = 336

 Score = 70.9 bits (172), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 65/141 (46%), Gaps = 11/141 (7%)

Query: 80  CQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFVRFLVWVIITTSYLGF 139
           C  C+  KP R+ HC  C++C+LV DHHC W  NC+G  N+  F  FL+  I++ SY  F
Sbjct: 136 CSTCRITKPARSRHCSICNRCILVADHHCIWVNNCIGKGNYIQFYLFLISNIVSMSY-AF 194

Query: 140 MLWKRIFMHWQLRHTRIYVQKIELVFIFINTPLNAFVWLTIILLLLRCSKNQFLCGMTQI 199
           +    I +       R          + ++     F  +  I   L+ +  +   GMT  
Sbjct: 195 LRLCSISLKSSTALPR--------AVLTLSILCGCFTIICAIFTYLQLAIVRE--GMTTN 244

Query: 200 ERWEWERIENQFNNGRLIPQL 220
           E+ +W  I+     G+L+  L
Sbjct: 245 EQDKWYTIQEYMREGKLVRSL 265

>Ecym_2014 Chr2 complement(19723..20742) [1020 bp, 339 aa] {ON}
           similar to Ashbya gossypii ADL197C
          Length = 339

 Score = 70.9 bits (172), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 36/50 (72%)

Query: 80  CQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFVRFLVW 129
           C  C  +KP+R+HHC +C++C L  DHHCPW  +C+G NN   FV+FL++
Sbjct: 110 CATCGVWKPDRSHHCSSCNKCYLKRDHHCPWFSSCIGFNNQKFFVQFLMY 159

>ZYRO0D06600g Chr4 complement(573724..574716) [993 bp, 330 aa] {ON}
           similar to uniprot|Q04629 Saccharomyces cerevisiae
           YDR126W SWF1 Spore Wall Formation
          Length = 330

 Score = 70.1 bits (170), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 42/139 (30%), Positives = 64/139 (46%), Gaps = 12/139 (8%)

Query: 80  CQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFVRFLVWVIITTSYLGF 139
           C+ C+  KP R+ HC  C+QCVL +DHHC W  NCVG  N+ +F  FLV   ++ SY   
Sbjct: 135 CRTCQLPKPARSKHCNVCNQCVLAVDHHCIWINNCVGLGNYLYFYLFLVLNSLSMSYAFI 194

Query: 140 MLWKRIFMHWQLRHTRIYVQKIELVFIFINTPLNAFVWLTIILLLLR-CSKNQFLCGMTQ 198
                + +   +++ R          +  N     F  + I+   L+ C   +   GMT 
Sbjct: 195 RSMSIVGLKPNIKYPR--------SILAFNLLTGCFALICIVFTYLQLCMVRE---GMTT 243

Query: 199 IERWEWERIENQFNNGRLI 217
            E+ +W  I       RL+
Sbjct: 244 NEKDKWFTIHEYMREKRLV 262

>Suva_2.289 Chr2 (498420..499427) [1008 bp, 335 aa] {ON} YDR126W
           (REAL)
          Length = 335

 Score = 70.1 bits (170), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 43/154 (27%), Positives = 62/154 (40%), Gaps = 37/154 (24%)

Query: 80  CQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFVRFLVWVIITTSYLGF 139
           C  C+T K  R+ HC  C++CVLV DHHC W  NC+G  N+  F  FL   I + SY   
Sbjct: 136 CSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLFSNIFSMSYAFL 195

Query: 140 MLWKRIFMHWQLRHTRIYVQKIELVFIFINTPLNAFVWLTIILLLLRCSKNQFLC----- 194
            L+                        FI+    A +   ++ L + C     +C     
Sbjct: 196 RLY------------------------FISFNSTAVLPRAVLTLTILCGCFTIICAIFTY 231

Query: 195 --------GMTQIERWEWERIENQFNNGRLIPQL 220
                   GMT  E+ +W  I+     G+L+  L
Sbjct: 232 LQLAIVKEGMTTNEQDKWYTIQEYMREGKLVRSL 265

>Smik_12.306 Chr12 (568353..569432) [1080 bp, 359 aa] {ON} YLR246W
           (REAL)
          Length = 359

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 38/55 (69%)

Query: 80  CQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFVRFLVWVIITT 134
           CQ C+ ++P R+ HC TC+ CV+V DHHC W  NC+G  N+  F+ FL+  +I++
Sbjct: 175 CQSCRIWRPPRSSHCSTCNVCVMVHDHHCIWVNNCIGKRNYRFFLVFLLSAVISS 229

>ZYRO0C04092g Chr3 complement(320634..321734) [1101 bp, 366 aa] {ON}
           similar to uniprot|Q6B217 Saccharomyces cerevisiae
           YLR246W ERF2 Subunit of a palmitoyltransferase composed
           of Erf2p and Shr5p that adds a palmitoyl lipid moiety to
           Ras2p through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 366

 Score = 69.3 bits (168), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 37/58 (63%)

Query: 80  CQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFVRFLVWVIITTSYL 137
           C  C+ ++P R  HC TC+ C+L  DHHC W  NC+G  N+ +F+ FL   I+++ +L
Sbjct: 181 CTSCRIWRPPRASHCSTCEACILTHDHHCIWVNNCIGQRNYRYFILFLASAILSSIFL 238

>KLLA0D18370g Chr4 complement(1549382..1550449) [1068 bp, 355 aa]
           {ON} similar to uniprot|Q6B217 Saccharomyces cerevisiae
           YLR246W ERF2 Subunit of a palmitoyltransferase composed
           of Erf2p and Shr5p that adds a palmitoyl lipid moiety to
           Ras2p through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 355

 Score = 68.9 bits (167), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 35/98 (35%), Positives = 53/98 (54%)

Query: 80  CQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFVRFLVWVIITTSYLGF 139
           CQ C+ ++P R+ HC  CD CVL  DHHC W  NC+G  N+  F+ FL+   I+   L  
Sbjct: 174 CQTCRIWRPPRSAHCSVCDVCVLSHDHHCKWLNNCIGKRNYRFFLEFLMASTISCILLIL 233

Query: 140 MLWKRIFMHWQLRHTRIYVQKIELVFIFINTPLNAFVW 177
           +   R+    Q+R+T + +  I    + I  PL  F++
Sbjct: 234 LSSFRLSYSPQVRYTPVSLLIICYCGLGIWYPLILFIY 271

>Smik_4.372 Chr4 (664437..665444) [1008 bp, 335 aa] {ON} YDR126W
           (REAL)
          Length = 335

 Score = 68.6 bits (166), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 42/144 (29%), Positives = 66/144 (45%), Gaps = 11/144 (7%)

Query: 80  CQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFVRFLVWVIITTSYLGF 139
           C  C   KP R+ HC  C++C+LV DHHC W  NC+G  N+  F  FL+  I +  Y   
Sbjct: 136 CSTCHIIKPARSKHCSICNRCILVADHHCIWVNNCIGKGNYLQFYLFLISNIFSLLYAFL 195

Query: 140 MLWKRIFMHWQLRHTRIYVQKIELVFIFINTPLNAFVWLTIILLLLRCSKNQFLCGMTQI 199
            LW          +++  + +  L    +      F  + II   L+ +  +   GMT  
Sbjct: 196 RLWCISL------NSKTALPRAVLTLTIL---CGCFTIICIIFTYLQLTIVRE--GMTTN 244

Query: 200 ERWEWERIENQFNNGRLIPQLLEN 223
           E+ +W  I+     G+L+  L +N
Sbjct: 245 EQDKWYTIQEYMREGKLVRSLNDN 268

>TDEL0F05130 Chr6 complement(961887..962966) [1080 bp, 359 aa] {ON}
           Anc_8.389 YLR246W
          Length = 359

 Score = 68.9 bits (167), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 27/73 (36%), Positives = 39/73 (53%)

Query: 65  PPTGFQPLPHQWKNICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFV 124
           P +   PL       C  C+ ++P R  HC TC  CV+  DHHC W  NCVG  N+ +F+
Sbjct: 166 PKSNVDPLSKIDIRYCTSCRIWRPPRASHCSTCGVCVMTHDHHCIWVNNCVGQRNYRYFI 225

Query: 125 RFLVWVIITTSYL 137
            FL+  ++   +L
Sbjct: 226 IFLIGTVLAELFL 238

>TPHA0C02360 Chr3 (531446..532660) [1215 bp, 404 aa] {ON} Anc_8.389
           YLR246W
          Length = 404

 Score = 68.9 bits (167), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 26/58 (44%), Positives = 38/58 (65%)

Query: 80  CQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFVRFLVWVIITTSYL 137
           C+ C+ ++P R+ HC  CD CV+ +DHHC W  NCVG  N+ +F+ FL   I+T  +L
Sbjct: 196 CRTCRIWRPPRSSHCSICDCCVMSLDHHCLWLNNCVGKRNYRYFLIFLTSTIMTVIFL 253

>NCAS0C02920 Chr3 (549815..550939) [1125 bp, 374 aa] {ON} Anc_8.389
          Length = 374

 Score = 67.8 bits (164), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 38/58 (65%)

Query: 80  CQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFVRFLVWVIITTSYL 137
           C+ C+ ++P R+ HC  C+ CVL+ DHHC W  NCVG  N+ +F+ FL    +T+ +L
Sbjct: 184 CKTCRIWRPPRSSHCSICETCVLMHDHHCVWVNNCVGQRNYRYFLTFLTSSTLTSIFL 241

>CAGL0B01991g Chr2 (182894..183886) [993 bp, 330 aa] {ON} similar to
           uniprot|Q04629 Saccharomyces cerevisiae YDR126w
          Length = 330

 Score = 67.4 bits (163), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 40/139 (28%), Positives = 67/139 (48%), Gaps = 8/139 (5%)

Query: 80  CQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFVRFLVWVIITTSYLGF 139
           C+ CK  KP R+ HC  C+ C+ + DHHC W  NCVG  N+ +F  FL   ++  SY   
Sbjct: 136 CRTCKQVKPARSKHCTVCNSCIYLADHHCVWINNCVGMGNYMYFYSFLCSNLLLLSY--- 192

Query: 140 MLWKRIFMHWQLRHTRIYVQKIELVFIFINTPLNAFVWLTIILLLLRCSKNQFL-CGMTQ 198
              + IF+ +  +         E   + ++    +F   T+IL +      + +  GMT 
Sbjct: 193 SFIRLIFIQFN-KSAYNTTPTGEKSLLILSILCGSF---TVILAVYCYFVFELVNSGMTT 248

Query: 199 IERWEWERIENQFNNGRLI 217
            E+ +W+ + +  N G L+
Sbjct: 249 NEKDKWQMVHDYINTGDLV 267

>KLTH0F08668g Chr6 (750644..751720) [1077 bp, 358 aa] {ON} similar
           to uniprot|Q6B217 Saccharomyces cerevisiae YLR246W ERF2
           Subunit of a palmitoyltransferase composed of Erf2p and
           Shr5p that adds a palmitoyl lipid moiety to Ras2p
           through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 358

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 34/56 (60%)

Query: 80  CQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFVRFLVWVIITTS 135
           C  C+ ++P R  HC TC+ CVL  DHHC W  NC+G  N+ +F+ FL    + T+
Sbjct: 178 CATCRIWRPPRASHCSTCEACVLTHDHHCTWVNNCIGQRNYRYFLTFLASCCLATT 233

>YLR246W Chr12 (627118..628197) [1080 bp, 359 aa] {ON}  ERF2Subunit
           of a palmitoyltransferase, composed of Erf2p and Shr5p,
           that adds a palmitoyl lipid moiety to heterolipidated
           substrates such as Ras1p and Ras2p through a thioester
           linkage; mutants partially mislocalize Ras2p to the
           vacuole
          Length = 359

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 38/58 (65%)

Query: 80  CQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFVRFLVWVIITTSYL 137
           C  C+ ++P R+ HC TC+ CV+V DHHC W  NC+G  N+  F+ FL+  I+++  L
Sbjct: 175 CPSCRIWRPPRSSHCSTCNVCVMVHDHHCIWVNNCIGKRNYRFFLIFLLGAILSSVIL 232

>KAFR0H01980 Chr8 (367846..368931) [1086 bp, 361 aa] {ON} Anc_8.389
           YLR246W
          Length = 361

 Score = 66.2 bits (160), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%)

Query: 80  CQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFVRFLVWVIITTSYL 137
           C+ C+ ++P R  HC  C+ CV+  DHHC W  NCVG  N+ +FV FL+   + + +L
Sbjct: 178 CRTCRIWRPPRASHCSICEACVMTHDHHCIWINNCVGQRNYRYFVTFLISGTLASIFL 235

>KNAG0A02710 Chr1 (294783..295847) [1065 bp, 354 aa] {ON} Anc_8.389
           YLR246W
          Length = 354

 Score = 65.9 bits (159), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 53/126 (42%), Gaps = 29/126 (23%)

Query: 41  VWFQICLSMIWISYALAIFTNPG-----------KPPTGFQPL--PHQWKNI-------- 79
           V F  C +M  +++  +  T PG             P G  P+  P ++ NI        
Sbjct: 118 VVFYYCWAMAAVNFVQSSTTGPGVLPRNIHVPKVGGPPGQTPVQSPQEYYNIVTLPTAQR 177

Query: 80  --------CQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFVRFLVWVI 131
                   C  CK ++P R  HC+ C  CV   DHHC W  NCVG  N+ +F+ FL    
Sbjct: 178 SAHVEVKYCTACKIWRPPRASHCRICQVCVQTQDHHCAWINNCVGQRNYRYFLTFLTATC 237

Query: 132 ITTSYL 137
            T + L
Sbjct: 238 ATCTVL 243

>Suva_10.342 Chr10 (593959..595029) [1071 bp, 356 aa] {ON} YLR246W
           (REAL)
          Length = 356

 Score = 65.5 bits (158), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 37/58 (63%)

Query: 80  CQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFVRFLVWVIITTSYL 137
           C  C+ ++P R+ HC TC+ CV+V DHHC W  NC+G  N+  F+ FL+  I ++  L
Sbjct: 175 CTSCRIWRPPRSSHCSTCNICVMVHDHHCIWVNNCIGKRNYRFFLIFLLSAIFSSILL 232

>NDAI0G02250 Chr7 (503564..504733) [1170 bp, 389 aa] {ON} Anc_8.389
          Length = 389

 Score = 65.5 bits (158), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 49/179 (27%), Positives = 79/179 (44%), Gaps = 27/179 (15%)

Query: 80  CQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFVRFLVWVIITTSYLGF 139
           C  C+ ++P R+ HC  C+ C++  DHHC W  NC+G  N+  F+ FL+    T+ +L  
Sbjct: 217 CTTCRIWRPPRSSHCSICEACIITHDHHCIWVNNCIGQRNYRFFLTFLLSGTFTSIFLII 276

Query: 140 MLWKRIFMHWQLRHTRIYVQKIELVFIFINTPLNAFVWLTIILLLLRCSKNQFLCGMTQI 199
                I    ++R T + V    L+ I+        +W  +IL         F+ G  Q 
Sbjct: 277 NASIDIARTPKVRDTPVAV----LLIIYGGLT----IWYPLILFCYHI----FMTGTQQT 324

Query: 200 ERWE----------WERIENQFNNGRLIPQLLENLAEIYGDDILNSPNAKKLINARDLQ 248
            R            + RI+ Q NN       L+NL  IY   ++  P    +++AR+ Q
Sbjct: 325 TREYLKSIGSKNPVFHRIKRQENNPFEQGSFLKNL--IY---LMCQPRGLSMVSARERQ 378

>Ecym_4178 Chr4 (375346..376452) [1107 bp, 368 aa] {ON} similar to
           Ashbya gossypii AGL125C
          Length = 368

 Score = 64.7 bits (156), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 34/54 (62%)

Query: 80  CQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFVRFLVWVIIT 133
           C  C+ ++P R  HC TC+ C++  DHHC W  NCVG  N+ +F+ F+   ++T
Sbjct: 189 CTTCRIWRPLRASHCSTCNSCIMTFDHHCIWVNNCVGQRNYRYFLTFIYSAVLT 242

>TBLA0H00920 Chr8 (203681..204763) [1083 bp, 360 aa] {ON} Anc_8.389
           YLR246W
          Length = 360

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 44/79 (55%), Gaps = 1/79 (1%)

Query: 59  FTNPGKPPTGFQPLPHQWKNICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHN 118
           +TN  + P   +    + K  C  C  ++P R  HC  C  C+ V DHHC W  NCVG+ 
Sbjct: 170 YTNTIRLPVANKNHSIELK-YCSTCHIWRPPRASHCSICQACIDVHDHHCIWINNCVGNR 228

Query: 119 NFPHFVRFLVWVIITTSYL 137
           N+ +F+ FLV  I+++ ++
Sbjct: 229 NYRYFIIFLVGAILSSIFI 247

>CAGL0G08217g Chr7 complement(778823..779803) [981 bp, 326 aa] {ON}
           similar to uniprot|Q06551 Saccharomyces cerevisiae
           YLR246w ERF2
          Length = 326

 Score = 63.9 bits (154), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 34/58 (58%)

Query: 80  CQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFVRFLVWVIITTSYL 137
           C  CK ++P R  HC  C+ CVL  DHHC W  NCVG  N+ +F+ FL+   +  + L
Sbjct: 160 CHTCKIWRPPRASHCSVCECCVLTHDHHCIWVNNCVGQRNYRYFLAFLLSSTLACALL 217

>AGL125C Chr7 complement(473496..474599) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR246W
           (ERF2)
          Length = 367

 Score = 62.8 bits (151), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 35/58 (60%)

Query: 80  CQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFVRFLVWVIITTSYL 137
           C  C+ ++P R  HC  CD C+L  DHHC W  NC+G  N  +F+ FL   ++++ +L
Sbjct: 187 CTTCRIWRPPRASHCAVCDSCILSFDHHCDWLNNCIGQRNHRYFLAFLFSSVLSSIWL 244

>Kwal_23.3302 s23 (234749..235810) [1062 bp, 353 aa] {ON} YLR246W
           (ERF2) - Mutation has an Effect on Ras Function [contig
           251] FULL
          Length = 353

 Score = 62.4 bits (150), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 22/49 (44%), Positives = 30/49 (61%)

Query: 80  CQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFVRFLV 128
           C  C+ ++P R  HC  C  C+L  DHHC W  NC+G  N+ +F+ FLV
Sbjct: 173 CPTCRIWRPPRASHCSVCGACILNHDHHCKWVNNCIGQRNYRYFLTFLV 221

>Kpol_1033.16 s1033 (35544..36509) [966 bp, 321 aa] {ON}
           (35544..36509) [966 nt, 322 aa]
          Length = 321

 Score = 62.0 bits (149), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 31/48 (64%)

Query: 80  CQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFVRFL 127
           C+ C+  KP R+ HC  CD+C+L+ DHHC W  NC+G  N+  F  F+
Sbjct: 135 CKTCRKPKPARSKHCSICDKCILLQDHHCIWVNNCIGMGNYKWFYLFI 182

>KNAG0H03110 Chr8 complement(584877..585872) [996 bp, 331 aa] {ON}
           Anc_8.286 YDR126W
          Length = 331

 Score = 61.6 bits (148), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 46/102 (45%), Gaps = 12/102 (11%)

Query: 47  LSMIWISYALAIFTNP---GKPPTGFQPLPHQW---------KNICQKCKTYKPERTHHC 94
           L+ I +S  L +FT P   G    G  P   QW            C+ C T K  R+ HC
Sbjct: 94  LAAIPVSGLLTMFTRPEGCGGRDQGVAPSEGQWPYDGILYYPNTTCRSCHTVKWARSKHC 153

Query: 95  KTCDQCVLVMDHHCPWTMNCVGHNNFPHFVRFLVWVIITTSY 136
             C +C+ + DHHC W   C+G  NF +F  FL    +  +Y
Sbjct: 154 SICRRCIQLADHHCIWFNTCIGRGNFFYFYVFLACHCLILTY 195

>Ecym_4282 Chr4 complement(608898..609920) [1023 bp, 340 aa] {ON}
           similar to Ashbya gossypii AGR065W
          Length = 340

 Score = 61.6 bits (148), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 32/50 (64%)

Query: 79  ICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFVRFLV 128
           +C+ C+  K  R+ HC  C +C+LV DHHC W  NC+G  N+ +F  FL+
Sbjct: 132 VCRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFLL 181

>Skud_4.734 Chr4 complement(1302386..1303528) [1143 bp, 380 aa] {ON}
           YDR459C (REAL)
          Length = 380

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 43/84 (51%), Gaps = 4/84 (4%)

Query: 65  PPTGFQPLPHQWKNICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFV 124
           PP  +Q  PH +   C  C++ K ERTHH      CV   DH+C W    +G +N+  FV
Sbjct: 117 PPKCYQSDPHGYPIWCSPCQSLKTERTHHSSELGHCVPRFDHYCMWAGTVIGRDNYRLFV 176

Query: 125 RFLVWVIITTSYLGFMLWKRIFMH 148
           +F+ +     S L  ++W  I ++
Sbjct: 177 QFVAYF----SILLLIMWASICVY 196

>TBLA0E02830 Chr5 (700364..701524) [1161 bp, 386 aa] {ON} Anc_5.579
           YDR459C
          Length = 386

 Score = 59.3 bits (142), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 47/90 (52%), Gaps = 6/90 (6%)

Query: 65  PPTGFQPLPHQWKNICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFV 124
           PP  +Q  PH +   C +C++ K ERTHH      CV   DH+C W    +G +N+  F+
Sbjct: 108 PPITYQCDPHGYPFWCSECQSLKLERTHHSSAMGHCVPRFDHYCVWVGTVIGKDNYLLFL 167

Query: 125 RFLVWVIITTSYLGFMLWKRI--FMHWQLR 152
           +F+ +  I  S    ++W  I  ++H  +R
Sbjct: 168 QFVAYYAINLS----IIWVSIVSYIHMIIR 193

>Kwal_56.23697 s56 complement(665965..666981) [1017 bp, 338 aa] {ON}
           YDR126W (PSL10) - Hypothetical ORF [contig 174] FULL
          Length = 338

 Score = 58.9 bits (141), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 33/60 (55%), Gaps = 1/60 (1%)

Query: 80  CQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFVRFLVWVIITTSYLGF 139
           C+ CK  K  R+ HC  C +C  + DHHC W  NC+G  N+ +F  FL   +  T Y GF
Sbjct: 131 CRTCKMPKYARSKHCAICGRCTQLADHHCVWANNCIGKGNYEYFYLFLASNVFLTVY-GF 189

>YDR459C Chr4 complement(1382319..1383443) [1125 bp, 374 aa] {ON}
           PFA5Palmitoyltransferase with autoacylation activity;
           likely functions in pathway(s) outside Ras; member of a
           family of putative palmitoyltransferases containing an
           Asp-His-His-Cys-cysteine rich (DHHC-CRD) domain
          Length = 374

 Score = 58.9 bits (141), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 45/87 (51%), Gaps = 4/87 (4%)

Query: 65  PPTGFQPLPHQWKNICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFV 124
           PP  +Q  PH +   C +C++ K ERTHH      C+   DH+C W    +G +N+  FV
Sbjct: 116 PPKCYQSDPHGYPIWCSECQSLKMERTHHSSELGHCIPRFDHYCMWIGTVIGRDNYRLFV 175

Query: 125 RFLVWVIITTSYLGFMLWKRIFMHWQL 151
           +F  +     S L  ++W  I ++ ++
Sbjct: 176 QFAAYF----STLLLIMWVSICVYIRI 198

>AGR065W Chr7 (835871..836851) [981 bp, 326 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR126W (SWF1)
          Length = 326

 Score = 57.4 bits (137), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 21/44 (47%), Positives = 27/44 (61%)

Query: 80  CQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHF 123
           C+ C+  KP R+ HC  C +CV + DHHC W  NCVG  N+  F
Sbjct: 126 CRTCRVRKPARSRHCGVCGRCVPLADHHCVWLNNCVGRGNYGLF 169

>Smik_4.737 Chr4 complement(1303557..1304693) [1137 bp, 378 aa] {ON}
           YDR459C (REAL)
          Length = 378

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 52/227 (22%), Positives = 93/227 (40%), Gaps = 25/227 (11%)

Query: 65  PPTGFQPLPHQWKNICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFV 124
           PP  +Q  P+ +   C  C++ K ER+HH      C+   DH+C W    +G +N+  FV
Sbjct: 116 PPKCYQSDPNGYPIWCSPCQSLKMERSHHSSELGHCIPRFDHYCVWIGTIIGRDNYRPFV 175

Query: 125 RFLVWVIITTSYLGFMLWKRIFMHWQLRHTRIYVQKIELVFIFINTPLNAFVWLTIILLL 184
           +F  +     S L  ++W  I          ++++ I       N+PLNA V+LT+   +
Sbjct: 176 QFTGYF----SSLLLIMWVSIC---------VFIRNITQHHHNHNSPLNANVFLTLAFAI 222

Query: 185 LRCSKNQFLCGMTQIERWEWERIENQFNNGRLIPQLLENLAEIYGDDIL--NSPNAKKLI 242
                     G           I     N   +  ++++  + +G   +      A KL 
Sbjct: 223 F---------GWLFTTSMLASNIFYMCQNKTYLEAIMDSKRKNFGTRKIFCYYSEANKLR 273

Query: 243 NARDLQLEEIVNFPYDLNIVANTRHAIG-NLLTCILPWSSPVGNGLK 288
              + +  E  +F     I AN +  +G N+L  ++P+  P+    K
Sbjct: 274 FVVEFERTEFHSFWSKKTIFANIKDFMGPNMLMWLIPFGKPLSFSCK 320

>Kwal_47.18366 s47 (796220..797290) [1071 bp, 356 aa] {ON} YDR459C -
           Hypothetical ORF [contig 196] FULL
          Length = 356

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 38/78 (48%)

Query: 60  TNPGKPPTGFQPLPHQWKNICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNN 119
           T   KPP  +Q  P  +   C  C++ K  RTHH  T   C+   DH+C W    VG  N
Sbjct: 105 TRSIKPPRIYQCDPQGYPIWCTACQSLKSNRTHHSSTLGYCIPRFDHYCVWIGTIVGRKN 164

Query: 120 FPHFVRFLVWVIITTSYL 137
           +  FV+F  +  + T Y+
Sbjct: 165 YRLFVQFAFYFWLFTIYM 182

>Suva_2.634 Chr2 complement(1134492..1135658) [1167 bp, 388 aa] {ON}
           YDR459C (REAL)
          Length = 388

 Score = 56.2 bits (134), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 35/121 (28%), Positives = 52/121 (42%), Gaps = 13/121 (10%)

Query: 65  PPTGFQPLPHQWKNICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFV 124
           PP  +Q  PH +   C  C++ K ERTHH      CV   DH+C W    +G +N+  FV
Sbjct: 122 PPRCYQCDPHGYPIWCSPCQSLKMERTHHSSELGHCVPRFDHYCLWVGTVIGRDNYRLFV 181

Query: 125 RFLVWVIITTSYLGFMLWKRIFMHWQLRHTRIYVQKIELVFIFINTPLNAFVWLTIILLL 184
           +F+ +       +   +              +Y++ I       N PLN  V LT+ L L
Sbjct: 182 QFVTYFSSLLLLMWLSIC-------------VYIRDITQRHRGHNPPLNVNVILTLALAL 228

Query: 185 L 185
            
Sbjct: 229 F 229

>KNAG0C02830 Chr3 complement(563740..564804) [1065 bp, 354 aa] {ON}
           Anc_5.579 YDR459C
          Length = 354

 Score = 55.8 bits (133), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 39/74 (52%), Gaps = 2/74 (2%)

Query: 59  FTNP--GKPPTGFQPLPHQWKNICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVG 116
           FT+P   KPP  +Q   + +   C  C++ K  RTHH      CV   DH+C W    +G
Sbjct: 103 FTSPQVNKPPLIYQCDENGYPTWCAHCQSVKSLRTHHSGRTGSCVFKFDHYCGWLGTLIG 162

Query: 117 HNNFPHFVRFLVWV 130
             N+  F++FLV++
Sbjct: 163 AGNYLLFIQFLVYM 176

>NDAI0H01890 Chr8 complement(458111..459331) [1221 bp, 406 aa] {ON}
           Anc_5.579 YDR459C
          Length = 406

 Score = 55.5 bits (132), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 36/66 (54%)

Query: 64  KPPTGFQPLPHQWKNICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHF 123
           KPP  +Q  P+ +   C  C++ K ER HH +    C+   DH+C W    +G NN+  F
Sbjct: 101 KPPLYYQCDPNGYPIWCTYCQSLKLERVHHSRQLGYCIFRFDHYCAWIGTVIGRNNYRLF 160

Query: 124 VRFLVW 129
           ++++ +
Sbjct: 161 IQYVFY 166

>Ecym_4114 Chr4 complement(238112..239230) [1119 bp, 372 aa] {ON}
           similar to Ashbya gossypii ABR203W
          Length = 372

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 56/118 (47%), Gaps = 8/118 (6%)

Query: 65  PPTGFQPLPHQWKNICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFV 124
           PP  +Q  P  +   C  C++ K ER+HH +    CV   DH+C W    +G  N+  F+
Sbjct: 112 PPDIYQCDPQGYPMWCSTCQSLKIERSHHSELLKYCVPRFDHYCVWLGTVIGRKNYKLFM 171

Query: 125 RFLVW--VIITTSYLGFMLWKRIFMHWQLRHTR------IYVQKIELVFIFINTPLNA 174
           +++++  + + T+ L   L+ +  + +   H        I +  + L F F  TPL A
Sbjct: 172 QYVMYFTIYLVTASLTIALFMKRIVDYNKEHDLTLNLNIIVLFILVLAFAFFVTPLFA 229

>TDEL0A04440 Chr1 complement(795121..796218) [1098 bp, 365 aa] {ON}
           Anc_5.579 YDR459C
          Length = 365

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 37/73 (50%)

Query: 65  PPTGFQPLPHQWKNICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFV 124
           PP  +Q  P      C  C + K ER HH    + CV   DH C W    +G +N+  F+
Sbjct: 112 PPVCYQSCPRGNPIWCSACDSVKTERAHHSSDMEYCVPRFDHKCAWLGAVIGRDNYRFFI 171

Query: 125 RFLVWVIITTSYL 137
           +F++++ I + ++
Sbjct: 172 QFVMYMAILSLFV 184

>NCAS0F01390 Chr6 complement(275879..277003) [1125 bp, 374 aa] {ON}
           Anc_5.579 YDR459C
          Length = 374

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 49/250 (19%), Positives = 100/250 (40%), Gaps = 26/250 (10%)

Query: 64  KPPTGFQPLPHQWKNICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHF 123
           KPP  +Q   + +   C  C++ K  R+HH K   +C+L  DH+C W    +  NN+  F
Sbjct: 102 KPPKYYQCDKNGYPPWCTHCQSLKLSRSHHSKQVGRCILRFDHYCAWIGCVIARNNYRLF 161

Query: 124 VRFLVWVIITTSYLGFMLWKRIFMHWQLRHTRIYVQKIELV--FIFINTPLNAFVWLTII 181
           ++++ W               + + W      ++++ I ++   + +   L+   W+  +
Sbjct: 162 LQYVGWF-------------NLLLLWYWLTIAVFIRTIGMLNGNVIVGFILSCLGWMMTL 208

Query: 182 LLLLR----CSKNQFLCGMTQIERWEWERIENQFNNGRLIPQLLENLAEIYGDDILNSPN 237
            L +      S N+     T IE  + ER + + +   +    +E+    Y        N
Sbjct: 209 GLFISHIYYMSNNK-----TSIETLDAERGKRKKHKMMVTNDEIEHARIEYNRKYFCYYN 263

Query: 238 AK-KLINARDLQLEEIVNFPYDLNIVANTRHAIG-NLLTCILPWSSPVGNGLKFTKNDLS 295
            + K     +L  +E        +   N R  +G +++  + PW S   +  K   +   
Sbjct: 264 QQDKFRYVVELTADEFAKCWKKRSFWINAREFLGSDIIFWLFPWGSYFPDLRKREASSFQ 323

Query: 296 SYDTCHTIED 305
           SY   + +E+
Sbjct: 324 SYGQSYDLEN 333

>KLTH0G04972g Chr7 complement(404787..405890) [1104 bp, 367 aa] {ON}
           similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459C likely functions in pathway(s) outside Ras
          Length = 367

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 39/78 (50%), Gaps = 7/78 (8%)

Query: 65  PPTGFQPLPHQWKNICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFV 124
           PP  +Q  P  +   C  C++ K  RTHH  T   C+   DH+C W    VG  N+  FV
Sbjct: 117 PPRIYQCDPQGYPIWCTACQSIKANRTHHSSTLGYCIPRFDHYCVWIGTVVGRKNYRLFV 176

Query: 125 R-------FLVWVIITTS 135
           +       F ++VI++T+
Sbjct: 177 QFAFYFWAFAIFVIVSTA 194

>SAKL0G06160g Chr7 complement(514850..515944) [1095 bp, 364 aa] {ON}
           similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459C likely functions in pathway(s) outside Ras
          Length = 364

 Score = 52.4 bits (124), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 34/65 (52%)

Query: 65  PPTGFQPLPHQWKNICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFV 124
           PP  +Q  P  +   C  C++ K ERTHH  T   CV   DH+C W    VG  N+  F+
Sbjct: 112 PPDIYQCDPQGYPIWCSMCQSLKMERTHHSATLGYCVPRFDHYCVWIGTVVGRKNYRLFI 171

Query: 125 RFLVW 129
           +F ++
Sbjct: 172 QFSMY 176

>Kpol_1004.57 s1004 complement(123368..124456) [1089 bp, 362 aa]
           {ON} complement(123368..124456) [1089 nt, 363 aa]
          Length = 362

 Score = 49.3 bits (116), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 33/65 (50%)

Query: 65  PPTGFQPLPHQWKNICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFV 124
           PP  ++   + +   C  CK+ K  RTHH K    C+   DHHC W    +G +N+  F 
Sbjct: 109 PPVFYECDINGYPIWCDTCKSLKIGRTHHSKRLGYCIPRFDHHCMWVGTVIGKSNYLLFT 168

Query: 125 RFLVW 129
           +F+ +
Sbjct: 169 QFVFY 173

>ZYRO0D13860g Chr4 complement(1171732..1172829) [1098 bp, 365 aa]
           {ON} similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459C likely functions in pathway(s) outside Ras
          Length = 365

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 50/199 (25%), Positives = 80/199 (40%), Gaps = 44/199 (22%)

Query: 42  WFQICLSMIWISYALAIFTNPGKPP------------------------------TGFQP 71
           + QI L +IW   A+A+   PGK P                                +Q 
Sbjct: 61  FLQILLLLIWFQIAVAV--GPGKLPQVLPYLILSAQESDLGASEKYQNHGSDGSSICYQC 118

Query: 72  LPHQWKNICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFVRFLVWVI 131
            P+ +   C  C++ K ER HH +    CV   DH C +  + +G +N+  FV++ V++ 
Sbjct: 119 DPNGYPIWCTNCQSLKTERAHHSRELGHCVPKFDHKCTYLGSIIGKDNYRLFVQYCVFMT 178

Query: 132 ITTSYLGFMLWKRIFMHWQ--LRHTRIYVQKI--ELVFIFINTPLNAFVWLTIILLLLRC 187
           I  +    ++W  I  + +   R  R +   +   L+ I I   L    W+T+  LLL  
Sbjct: 179 IWLA----IIWTSIVAYIRSITRDYRGHGSHLNGNLIAILI---LTTLFWITVTSLLLT- 230

Query: 188 SKNQFLCGMTQIERWEWER 206
             N  +   T IE  E  R
Sbjct: 231 QLNCIVKNKTSIEVMERRR 249

>KAFR0I01110 Chr9 (214426..215538) [1113 bp, 370 aa] {ON} Anc_5.579
           YDR459C
          Length = 370

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 38/168 (22%), Positives = 62/168 (36%), Gaps = 44/168 (26%)

Query: 6   KWPWLGIAIPSSLIAFIGYGSHYFI----------------LGNFLSLGQQVWFQICLSM 49
           K+P L   +P+     + YG+  FI                 G  L + Q V F + +S 
Sbjct: 9   KYPQLRCVVPTVFFCLMVYGTWAFIHKLCVKQLLGRHNHHAAGIALIVVQSVLFAV-ISF 67

Query: 50  IWISYALAIFTNPGK------------------------PPTGFQPLPHQWKNICQKCKT 85
           IW   A  +   PG+                        P   +Q   + +   C  C+ 
Sbjct: 68  IW---AQILVVGPGRQPHIAPFELVSTNTTSETQPTSTVPAKLYQCDSNGYPRWCSNCEG 124

Query: 86  YKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFVRFLVWVIIT 133
            K  R+HH    + C+   DH+C W    +G +N+  FV FL +  ++
Sbjct: 125 LKSLRSHHSSVANYCIPRFDHYCIWLGTTIGKDNYKQFVIFLFYCTVS 172

>CAGL0K06347g Chr11 complement(624046..625104) [1059 bp, 352 aa]
           {ON} similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459c
          Length = 352

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 34/76 (44%)

Query: 57  AIFTNPGKPPTGFQPLPHQWKNICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVG 116
           A   N    P  +Q  PH +   C  C++ K  RT H      CV   DH+C W    +G
Sbjct: 93  ADLENTTVAPNCYQSDPHGYPVWCSNCQSLKVGRTKHSSHQGHCVPRFDHYCVWLGAVIG 152

Query: 117 HNNFPHFVRFLVWVII 132
             N+  FV+F+ +  +
Sbjct: 153 FKNYRLFVQFVFYFAV 168

>NDAI0H00850 Chr8 (190934..193294) [2361 bp, 786 aa] {ON} Anc_5.626
           YDR264C
          Length = 786

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 40/78 (51%), Gaps = 3/78 (3%)

Query: 77  KNICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFVRFLVWV---IIT 133
           KN C +  T KP R+ +    +  V   DH CPW  N VG  N  +F+ F++ V   IIT
Sbjct: 471 KNFCLESWTRKPLRSKYSHLNNALVARFDHFCPWIYNDVGLKNHKNFIGFILLVEAGIIT 530

Query: 134 TSYLGFMLWKRIFMHWQL 151
            + L F  +  +  H+++
Sbjct: 531 FASLCFEYFDELKDHFEV 548

>KLLA0D06149g Chr4 (527705..528754) [1050 bp, 349 aa] {ON} similar
           to uniprot|Q03289 Saccharomyces cerevisiae YDR459C
           likely functions in pathway(s) outside Ras
          Length = 349

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 35/79 (44%)

Query: 52  ISYALAIFTNPGKPPTGFQPLPHQWKNICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWT 111
           +S   A+  N   PP  +      +   C  C++ K  RTHH      CV   DH+C W 
Sbjct: 100 VSSESAVPDNSIAPPDIYPCDERGYPIWCSNCQSLKMSRTHHSTKVGYCVPRFDHYCVWI 159

Query: 112 MNCVGHNNFPHFVRFLVWV 130
              +G  N+  FV+F  ++
Sbjct: 160 GTVLGRLNYKLFVQFTFYL 178

>Kpol_526.32 s526 complement(77926..80259) [2334 bp, 777 aa] {ON}
           complement(77926..80259) [2334 nt, 778 aa]
          Length = 777

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 43/110 (39%), Gaps = 14/110 (12%)

Query: 36  SLGQQVWFQICLSMIWISYALAIFTNPGKPPTGFQPLP-------------HQWKNICQK 82
           S G  V   I +S+ ++   L + ++PG  P  F                     N C +
Sbjct: 423 SFGNFVMLSIIISLSYLFVNL-VRSDPGTKPAEFNHDSIRETITNLMLIGKFDTNNFCIE 481

Query: 83  CKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFVRFLVWVII 132
               KP R+ +       V   DH CPW  N +G  N   FV F++ ++I
Sbjct: 482 SSVRKPLRSRYSYLNSAIVTRFDHFCPWIYNDIGLKNHKLFVLFIILMVI 531

>ABR203W Chr2 (782704..783783) [1080 bp, 359 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR459C
          Length = 359

 Score = 42.7 bits (99), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 31/64 (48%)

Query: 65  PPTGFQPLPHQWKNICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFV 124
           PP  +Q     +   C  C++ K  RTHH      CV  +DH+C W    +G  N+  F 
Sbjct: 107 PPDVYQCDTQGYPVWCSVCQSLKGLRTHHSVHLGFCVPRLDHYCVWLGTVIGRRNYRLFN 166

Query: 125 RFLV 128
           +FL+
Sbjct: 167 QFLM 170

>Skud_4.527 Chr4 complement(938779..941073) [2295 bp, 764 aa] {ON}
           YDR264C (REAL)
          Length = 764

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 25/52 (48%)

Query: 77  KNICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFVRFLV 128
           KN C +  T KP R+      +  V   DH+CPW  N VG  N   F+ F+ 
Sbjct: 469 KNFCIETWTRKPLRSKFSSLNNAVVARFDHYCPWIFNDVGLKNHKAFIFFIA 520

>Smik_4.515 Chr4 complement(928882..931176) [2295 bp, 764 aa] {ON}
           YDR264C (REAL)
          Length = 764

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 26/52 (50%)

Query: 77  KNICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFVRFLV 128
           K+ C +  T KP R+ +    +  V   DH+CPW  N VG  N   F+ F+ 
Sbjct: 469 KSFCIETWTRKPLRSKYSSLNNAVVARFDHYCPWIFNDVGLKNHKAFIFFIT 520

>ZYRO0C11132g Chr3 complement(861388..863667) [2280 bp, 759 aa] {ON}
           similar to uniprot|P39010 Saccharomyces cerevisiae
           YDR264C AKR1 Palmitoyl transferase involved in protein
           palmitoylation acts as a negative regulator of pheromone
           response pathway required for endocytosis of pheromone
           receptors involved in cell shape control contains
           ankyrin repeats
          Length = 759

 Score = 40.0 bits (92), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 26/105 (24%), Positives = 43/105 (40%), Gaps = 15/105 (14%)

Query: 43  FQICLSMIWISYALAIF--TNPGKPPTG-------------FQPLPHQWKNICQKCKTYK 87
           F + + ++ +SY L +   ++PG+ PT                      KN C +    K
Sbjct: 412 FLLMIIILAVSYLLVVLVKSDPGRIPTEKNTQVIRETIKDLLATGKFDSKNFCIETWVKK 471

Query: 88  PERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFVRFLVWVII 132
           P R+      +  V   DH+CPW  N +G  N   F+  ++ V I
Sbjct: 472 PLRSRFSSLSNSLVARFDHYCPWVYNDIGLRNHKAFLMCILLVEI 516

>KAFR0H00570 Chr8 (100639..102912) [2274 bp, 757 aa] {ON} Anc_5.626
           YOR034C
          Length = 757

 Score = 39.3 bits (90), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 32/72 (44%), Gaps = 8/72 (11%)

Query: 77  KNICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFVRF--------LV 128
           +N C +    KP R+      +  V   DH+CPW  N +G  N   F+ F        L+
Sbjct: 460 RNFCIETWIRKPLRSKFSTFYNSTVSRFDHYCPWVYNDIGLKNHKIFIFFIISVEIGILI 519

Query: 129 WVIITTSYLGFM 140
           +V +T  Y  F+
Sbjct: 520 FVCLTMKYFDFL 531

>KNAG0C06230 Chr3 complement(1208896..1211154) [2259 bp, 752 aa]
           {ON} Anc_5.626 YOR034C
          Length = 752

 Score = 39.3 bits (90), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 45/104 (43%), Gaps = 13/104 (12%)

Query: 40  QVWFQICLSMIWISYALAIFTNPG--KPPTGFQPLPHQ-----------WKNICQKCKTY 86
            + F   L  + + +   ++++PG  +P T F  + ++            KN C +    
Sbjct: 407 SILFVAVLGCVHLLFFQLVYSDPGVLEPETDFNEIRNKISELLKIGKFDTKNFCIETWQR 466

Query: 87  KPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFVRFLVWV 130
           KP R        + VL  DH+CPW  N VG  N   F+ +++ V
Sbjct: 467 KPLRCKFSSFHSRLVLRFDHYCPWVYNDVGLLNHKKFMYYVMSV 510

>TPHA0C00370 Chr3 (62796..65075) [2280 bp, 759 aa] {ON} Anc_5.626
           YOR034C
          Length = 759

 Score = 38.9 bits (89), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 27/55 (49%)

Query: 74  HQWKNICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFVRFLV 128
           +   N C +  T KP R+ +    +  V   DH+CPW  N VG  N   F+ F++
Sbjct: 458 YDTSNFCIETLTRKPLRSRYSYMNNALVSRFDHYCPWVYNDVGLKNHKTFLFFIL 512

>CAGL0M08712g Chr13 (866454..868745) [2292 bp, 763 aa] {ON} similar
           to uniprot|P39010 Saccharomyces cerevisiae YDR264c
           ankyrin repeat-containing protein
          Length = 763

 Score = 38.9 bits (89), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 27/52 (51%)

Query: 77  KNICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFVRFLV 128
           ++ C +    KP R+ +    D  +L  DH+CPW  N VG  N   F+ F++
Sbjct: 453 RSFCLETWVRKPLRSKYSYLNDALILRFDHYCPWIYNDVGLKNHKLFIFFIL 504

>Suva_2.432 Chr2 complement(762658..764949) [2292 bp, 763 aa] {ON}
           YDR264C (REAL)
          Length = 763

 Score = 38.9 bits (89), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 24/52 (46%)

Query: 77  KNICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFVRFLV 128
           KN C +    KP R+      +  V   DH+CPW  N VG  N   F+ F+ 
Sbjct: 468 KNFCIETWARKPLRSRFSSLNNAVVARFDHYCPWIFNDVGLKNHKGFMFFIT 519

>YOR034C Chr15 complement(394837..397086) [2250 bp, 749 aa] {ON}
           AKR2Ankyrin repeat-containing protein similar to Akr1p;
           member of a family of putative palmitoyltransferases
           containing an Asp-His-His-Cys-cysteine rich (DHHC-CRD)
           domain; possibly involved in constitutive endocytosis of
           Ste3p
          Length = 749

 Score = 38.5 bits (88), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 25/54 (46%)

Query: 77  KNICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFVRFLVWV 130
           +N C +    KP R+ +       V   DH+CPW  N VG  N   FV F V V
Sbjct: 445 ENFCVETLERKPLRSKYSFFSGALVARYDHYCPWIYNDVGLKNHKLFVFFAVTV 498

>KLTH0E02420g Chr5 complement(211548..213752) [2205 bp, 734 aa] {ON}
           similar to uniprot|P39010 Saccharomyces cerevisiae
           YDR264C AKR1 Palmitoyl transferase involved in protein
           palmitoylation acts as a negative regulator of pheromone
           response pathway required for endocytosis of pheromone
           receptors involved in cell shape control contains
           ankyrin repeats
          Length = 734

 Score = 38.5 bits (88), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 28/59 (47%)

Query: 77  KNICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFVRFLVWVIITTS 135
           ++ C      KP R+   +  +  ++  DH CPW  N VG  N   F+ FL+ ++   S
Sbjct: 451 RHFCVDTYKRKPLRSKFSRFNEALIVRFDHFCPWIYNDVGLLNHKQFIYFLLSLVSGVS 509

>YDR264C Chr4 complement(996029..998323) [2295 bp, 764 aa] {ON}
           AKR1Palmitoyl transferase involved in protein
           palmitoylation; acts as a negative regulator of
           pheromone response pathway; required for endocytosis of
           pheromone receptors; involved in cell shape control;
           contains ankyrin repeats
          Length = 764

 Score = 38.5 bits (88), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 24/52 (46%)

Query: 77  KNICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFVRFLV 128
           KN C +    KP R+      +  V   DH+CPW  N VG  N   F+ F+ 
Sbjct: 469 KNFCIETWIRKPLRSKFSPLNNAVVARFDHYCPWIFNDVGLKNHKAFIFFIT 520

>NCAS0C05280 Chr3 complement(1073710..1075983) [2274 bp, 757 aa]
           {ON} Anc_5.626
          Length = 757

 Score = 37.7 bits (86), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 25/52 (48%)

Query: 77  KNICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFVRFLV 128
           KN C +    KP R+H        V   DH CPW  N +G  N  +F+ F++
Sbjct: 454 KNFCLETWIRKPLRSHFSTLNTHNVARFDHFCPWIYNDIGLKNHKNFMWFIL 505

>KNAG0B03140 Chr2 (604028..606076) [2049 bp, 682 aa] {ON} Anc_5.626
           YOR034C
          Length = 682

 Score = 37.4 bits (85), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 28/114 (24%), Positives = 48/114 (42%), Gaps = 13/114 (11%)

Query: 43  FQICLSMIWISYALAIFTNPGKPP--TGFQPLPHQWKNICQ----KCKTY-------KPE 89
           F +  +++ + Y   IF++PG  P  T    + +  + + +     C T+       KP 
Sbjct: 355 FPVLSTLLLLCYGRLIFSDPGCIPEETDTDLIRNDIEKLIKLGSFNCHTFCLKTWIRKPV 414

Query: 90  RTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFVRFLVWVIITTSYLGFMLWK 143
           R    K   Q V   DH+C W  N VG  N   ++ FL+ +       G + W+
Sbjct: 415 RCSLSKLNQQQVARFDHYCAWIYNDVGLKNHKLYIFFLILLETFLMTFGVLNWR 468

>TBLA0J00830 Chr10 complement(187815..190034) [2220 bp, 739 aa] {ON}
           Anc_5.626 YOR034C
          Length = 739

 Score = 35.0 bits (79), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 26/57 (45%)

Query: 77  KNICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFVRFLVWVIIT 133
           ++ C +    KP R+         V   DH+CPW  N +G  N   F+ F+ +  +T
Sbjct: 465 RHFCLETWVRKPLRSKFSYLNQSVVNRYDHYCPWVYNDIGLRNHKRFIMFIFFSEVT 521

>TDEL0A04920 Chr1 complement(867970..870222) [2253 bp, 750 aa] {ON}
           Anc_5.626 YOR034C
          Length = 750

 Score = 34.7 bits (78), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 15/60 (25%), Positives = 26/60 (43%)

Query: 74  HQWKNICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFVRFLVWVIIT 133
           +  ++ C +    KP R+         +   DH+CPW  N VG  N   F+ F+  + + 
Sbjct: 456 YDTRHFCIESWIRKPLRSRFSSLNGTLIARFDHYCPWIYNDVGLKNHKRFLYFVALIEVA 515

>Suva_8.87 Chr8 complement(157531..159723) [2193 bp, 730 aa] {ON}
           YOR034C (REAL)
          Length = 730

 Score = 34.3 bits (77), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 44/184 (23%), Positives = 71/184 (38%), Gaps = 41/184 (22%)

Query: 78  NICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFVRFLVWVIITTSYL 137
           N C +    KP R+ +       V   +H+CPW  N +G  N   F+ F      +  Y 
Sbjct: 429 NFCVETLERKPLRSKYSLFSGALVARFNHYCPWVYNDIGLKNHKLFMFF----AFSVQYE 484

Query: 138 GFM-LWKRIFMHWQLRHTRIYVQKIELV---------------------FIFINTPLNAF 175
            F+ +W  + + +  +   IY Q  E                       F+FI   +N F
Sbjct: 485 MFLFMW--LCLEYFKKTNHIYEQVEEYAKCTFLKNETLCKGSNYDPSTFFLFIWISMN-F 541

Query: 176 VWLTIILLLLRCSKNQFLCGMTQIERWEWERIENQFNNGRLIPQLLENLAEIYGDDILNS 235
           VWL   +L+++C   Q   G+T  E +   + E +     LIP         + + I + 
Sbjct: 542 VWLG-GMLIVQCF--QIFKGITSPELYALIKEERKAEALNLIP---------FENPIFSI 589

Query: 236 PNAK 239
           PN K
Sbjct: 590 PNGK 593

>Smik_15.213 Chr15 complement(360836..363070) [2235 bp, 744 aa] {ON}
           YOR034C (REAL)
          Length = 744

 Score = 34.3 bits (77), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 38/160 (23%), Positives = 62/160 (38%), Gaps = 24/160 (15%)

Query: 77  KNICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFVRFLVWVIITTSY 136
           +N C +    KP R+         V   DH CPW  N +G  N   F+ F     +T  Y
Sbjct: 442 ENFCVETLERKPLRSKFSPFSGALVARYDHFCPWVYNDIGLKNHKLFLFF----ALTVQY 497

Query: 137 LGFM-LWKRIFMHWQLRHTRIYVQKIELVFIFINTPLNA-----------FVWLTI---- 180
             F+ +W  +    +  H    V       +F N  L             F+W+++    
Sbjct: 498 HMFLFMWLCLAYFKRTNHIYEQVDGYARCALFKNETLCKGSNYDPSTFFLFIWVSVNFLW 557

Query: 181 --ILLLLRCSKNQFLCGMTQIERWEWERIENQFNNGRLIP 218
              +L+++C   Q L G+T  E +   + E +  +  LIP
Sbjct: 558 LGAMLIVQCF--QILKGITVPELFILIKEERRAKSFSLIP 595

>AER388C Chr5 complement(1365604..1367778) [2175 bp, 724 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR264C
           (AKR1) and YOR034C (AKR2)
          Length = 724

 Score = 33.9 bits (76), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 22/50 (44%)

Query: 77  KNICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFVRF 126
           K+ C       P R  + +     +L  DH+CPW  N +G  N   F+ F
Sbjct: 445 KHFCIHSWIRLPLRAKYKRFVHSVILRYDHYCPWIYNYIGFRNHKIFIYF 494

>Smik_7.267 Chr7 complement(442158..444161) [2004 bp, 667 aa] {ON}
           YGL023C (REAL)
          Length = 667

 Score = 33.5 bits (75), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 25/51 (49%), Gaps = 7/51 (13%)

Query: 64  KPPTGFQPLPHQWKNICQKCKTYKP----ERTHHCKTCDQCVLVMDHHCPW 110
           KPPT    +P   +N C+ C  +KP    ER HHC+ C   +   DH   W
Sbjct: 474 KPPTKDHWIPDSKRNSCRYC--HKPFTLWERKHHCRHCGD-IFCQDHLRHW 521

>Ecym_1330 Chr1 (684758..686977) [2220 bp, 739 aa] {ON} similar to
           Ashbya gossypii AER388C
          Length = 739

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 28/138 (20%), Positives = 54/138 (39%), Gaps = 17/138 (12%)

Query: 30  ILGNFLSLGQQVWFQICLSMIWISYA----LAIFTNPGKPPTGFQPL------------- 72
           I  N L   + V+  I L +++I+ +    + + ++PG  P    P              
Sbjct: 389 ITRNTLKYHKGVYANIILPVLFITVSSLLVILMQSDPGSIPASSDPKEIRATMSELLRIG 448

Query: 73  PHQWKNICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFVRFLVWVII 132
               K+ C       P R+ +    +  +   DH+CPW  N +G  N   F+ F++++ I
Sbjct: 449 KFDAKHFCIHSWVRIPLRSKYKTARNVLIARYDHYCPWVYNQIGFCNHKIFLFFIMFLQI 508

Query: 133 TTSYLGFMLWKRIFMHWQ 150
                  +  +   + WQ
Sbjct: 509 GVFIFVRLSIRYFELEWQ 526

>SAKL0G07326g Chr7 complement(599477..601690) [2214 bp, 737 aa] {ON}
           uniprot|Q875S9 Saccharomyces kluyveri AKR1
           Palmitoyltransferase AKR1
          Length = 737

 Score = 32.7 bits (73), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 22/52 (42%)

Query: 77  KNICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFVRFLV 128
           K+ C      KP R+         V   DH CPW  N +G  N   F+ F++
Sbjct: 449 KHFCISTWVRKPIRSKFSNFSRALVTRFDHFCPWIYNDIGLRNHKTFLFFIL 500

>Skud_15.199 Chr15 complement(354702..356927) [2226 bp, 741 aa] {ON}
           YOR034C (REAL)
          Length = 741

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 40/164 (24%), Positives = 61/164 (37%), Gaps = 32/164 (19%)

Query: 77  KNICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFVRFLVWVIITTSY 136
           +N C +    K  R+ +       V   DH+CPW  N +G  N     +  ++  +T  Y
Sbjct: 439 ENFCVETLERKSLRSKYSVFSGALVARFDHYCPWIYNDIGLKNH----KLSLFFAMTVQY 494

Query: 137 LGFM-LWKRIFMHWQLRHTRIYVQKIELV---------------------FIFINTPLNA 174
             F+ +W  +    +  H  IY Q  E                       F+FI   +N 
Sbjct: 495 HMFLFMWLSLAYFKKTNH--IYEQVDEYAKCTFLKNETLCKGSNYDPSTFFLFIWISVN- 551

Query: 175 FVWLTIILLLLRCSKNQFLCGMTQIERWEWERIENQFNNGRLIP 218
           FVWL     +L     Q L G+T  E +   + E +     LIP
Sbjct: 552 FVWLGA---MLSVQFFQILKGITTPELFTLIKEERRAETFNLIP 592

>KNAG0A05970 Chr1 (893640..896657) [3018 bp, 1005 aa] {ON} Anc_2.402
           YLR039C
          Length = 1005

 Score = 31.6 bits (70), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 17/68 (25%), Positives = 31/68 (45%), Gaps = 1/68 (1%)

Query: 92  HHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFVRFLVWVIITTSYLGFMLWKRIFM-HWQ 150
           H   T    + ++DH  P +     +++F  F  FLV       +  + LWK     H+ 
Sbjct: 378 HFYTTLGNLLFLIDHDSPHSYPHYNYSDFTSFSNFLVTTSKRGEFQLWELWKEYSQTHYD 437

Query: 151 LRHTRIYV 158
            R+T++Y+
Sbjct: 438 FRNTKVYL 445

>NDAI0G03950 Chr7 (941809..943185) [1377 bp, 458 aa] {ON} Anc_3.46
           YOL125W
          Length = 458

 Score = 31.2 bits (69), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 36/65 (55%), Gaps = 4/65 (6%)

Query: 233 LNSPNAKKL-INARDLQLEEIVNFPYDLNIVANTRHAIGNLLTCILPWSSPVGNGLKFTK 291
           +N P+ K++ I+ RDL+L+ +++FP + N VA ++H  G      L     + N    T 
Sbjct: 260 MNVPDIKRVKIDIRDLKLDPLLSFPNNNNYVAISKHLCGVATDLTLKC---IQNSDILTG 316

Query: 292 NDLSS 296
            DLSS
Sbjct: 317 KDLSS 321

>YGL023C Chr7 complement(450197..452104) [1908 bp, 635 aa] {ON}
           PIB2Protein of unknown function; contains FYVE domain;
           similar to Fab1 and Vps27
          Length = 635

 Score = 31.2 bits (69), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 24/50 (48%), Gaps = 7/50 (14%)

Query: 65  PPTGFQPLPHQWKNICQKCKTYKP----ERTHHCKTCDQCVLVMDHHCPW 110
           PPT    +P   +N C+ C  +KP    ER HHC+ C   +   DH   W
Sbjct: 443 PPTKDHWIPDSKRNSCRYC--HKPFTLWERKHHCRHCGD-IFCQDHLRHW 489

>KLLA0E16721g Chr5 (1484752..1487010) [2259 bp, 752 aa] {ON} similar
           to uniprot|P39010 Saccharomyces cerevisiae YDR264C AKR1
           Palmitoyl transferase involved in protein palmitoylation
          Length = 752

 Score = 31.2 bits (69), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 25/58 (43%)

Query: 77  KNICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFVRFLVWVIITT 134
           K+ C       P R+ + +     +   DH CPW  N +G  N   F  F+V + I+ 
Sbjct: 465 KHFCVHTWIRIPLRSKYDRDSACLISAFDHFCPWVYNQIGLLNHKLFYMFVVLLEISV 522

>KLLA0E23783g Chr5 complement(2115721..2115885,2115988..2117484)
           [1662 bp, 553 aa] {ON} weakly similar to uniprot|P38126
           Saccharomyces cerevisiae YBR186W PCH2 Nucleolar
           component of the pachytene checkpoint which prevents
           chromosome segregation when recombination and chromosome
           synapsis are defective also represses meiotic
           interhomolog recombination in the rDNA
          Length = 553

 Score = 30.8 bits (68), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 37/76 (48%), Gaps = 3/76 (3%)

Query: 230 DDILNSPNAKKLINARDLQLEE---IVNFPYDLNIVANTRHAIGNLLTCILPWSSPVGNG 286
           D IL++  +++    +DL+L E   + +  Y++N   N     GNL +CI      +G  
Sbjct: 162 DGILSNRESEQTKFLKDLKLSEQCRMKSLSYEMNFYINIEDKQGNLDSCISQEFDNIGLS 221

Query: 287 LKFTKNDLSSYDTCHT 302
                +D + ++T HT
Sbjct: 222 DSGNNSDSTLFETVHT 237

>Suva_7.256 Chr7 complement(440959..443025) [2067 bp, 688 aa] {ON}
           YGL023C (REAL)
          Length = 688

 Score = 30.4 bits (67), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 24/50 (48%), Gaps = 7/50 (14%)

Query: 65  PPTGFQPLPHQWKNICQKCKTYKP----ERTHHCKTCDQCVLVMDHHCPW 110
           PPT    +P   +N C+ C  +KP    ER HHC+ C   +   DH   W
Sbjct: 493 PPTMDHWIPDSKRNSCRYC--HKPFTLWERKHHCRHCGD-IFCQDHLRHW 539

>Skud_5.307 Chr5 complement(506123..507763) [1641 bp, 546 aa] {ON}
           YER168C (REAL)
          Length = 546

 Score = 30.4 bits (67), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 28/114 (24%), Positives = 51/114 (44%), Gaps = 28/114 (24%)

Query: 219 QLLENLAEIYGDDILNS----------------PNAKKLIN-----ARDLQLEEIVNFPY 257
           Q ++ ++ IYGD+ILNS                P  +++I       ++  L   ++   
Sbjct: 308 QDMDKISHIYGDNILNSHLQNFIELYPMFLEKLPVLREMIRQSPSFQQNFILSATLSPMA 367

Query: 258 DLNIVANTRHAIGNLLTCILPWSSPVGNGLKFTKNDL----SSYDTCHTIEDKL 307
           +L I+ N +  + NL++      S V  GLK +KND      + D+  + E+ L
Sbjct: 368 NLKIIGNPKKKVNNLVSVT---ESIVKEGLKLSKNDAVIISKTVDSISSYEEML 418

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.140    0.475 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 44,868,787
Number of extensions: 2030226
Number of successful extensions: 6725
Number of sequences better than 10.0: 138
Number of HSP's gapped: 6769
Number of HSP's successfully gapped: 138
Length of query: 383
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 272
Effective length of database: 40,753,473
Effective search space: 11084944656
Effective search space used: 11084944656
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 67 (30.4 bits)