Re-run this search with the SEG filter switched off

Re-run this search as BLASTP i.e. protein query (default)

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_56.224546.27ON31531516740.0
KLTH0C11044g6.27ON31531013200.0
SAKL0E01474g6.27ON31130510711e-147
NCAS0H015106.27ON31327710411e-142
CAGL0E02519g6.27ON31530010341e-141
NDAI0F017406.27ON31328810221e-139
ZYRO0C07612g6.27ON31927710121e-138
KAFR0G026506.27ON32127110081e-137
Kpol_1032.96.27ON31827410061e-137
KNAG0M012406.27ON31427610031e-136
KLLA0D01331g6.27ON3083099911e-134
TDEL0G044206.27ON3222999921e-134
TBLA0E030606.27ON3192989911e-134
Ecym_30316.27ON3282749431e-127
TPHA0M002906.27ON3273209421e-127
Suva_15.1736.27ON3272799331e-125
ACL002C6.27ON3293019311e-125
Smik_15.1686.27ON3272799251e-124
YOL002C (IZH2)6.27ON3172799241e-124
Skud_15.1606.27ON3272799121e-122
SAKL0C09218g3.90ON3142767751e-102
ZYRO0B06556g3.90ON3182837383e-96
TDEL0D053403.90ON3162777332e-95
CAGL0G04631g3.90ON3162837313e-95
KLLA0C12441g3.90ON3153037305e-95
TPHA0A006403.90ON3272967281e-94
Kwal_56.227043.90ON3202857229e-94
NDAI0A071603.90ON3302917212e-93
KLTH0C09504g3.90ON3192707123e-92
Skud_4.7663.90ON3163037071e-91
NCAS0I025703.90ON3143097011e-90
Kpol_1053.263.90ON3242827002e-90
AFR337W3.90ON3172736983e-90
Smik_4.7693.90ON3163036967e-90
YDR492W (IZH1)3.90ON3162886967e-90
Suva_2.6683.90ON3152836923e-89
Ecym_35883.90ON3052756773e-87
TBLA0B022903.90ON3262776777e-87
KAFR0A081303.90ON3192816499e-83
KNAG0K021603.90ON3233206142e-77
TBLA0B082553.90ON2962944173e-48
NCAS0C049203.90ON3262713382e-36
NDAI0G043003.90ON3182833347e-36
CAGL0I07491g3.90ON3012962498e-24
Suva_15.643.90ON3123182341e-21
KLLA0F15510g5.197ON6223082101e-17
Skud_15.533.90ON3123042051e-17
Smik_15.563.90ON3122421962e-16
Kpol_2002.945.197ON5772381975e-16
YOL101C (IZH4)3.90ON3122081865e-15
AAL153C5.197ON4193201814e-14
KAFR0J006705.197ON5092341815e-14
TPHA0E031205.197ON5692491735e-13
KLTH0B03498g5.197ON5462501727e-13
KNAG0K006703.90ON3212131653e-12
Ecym_71095.197ON5682471621e-11
TBLA0C060505.197ON4372321584e-11
Kwal_33.151225.197ON5662461532e-10
KNAG0B051005.197ON5383441522e-10
NCAS0D026005.197ON5432381504e-10
TDEL0E043205.197ON4502561487e-10
SAKL0G12980g5.197ON5632481471e-09
NDAI0I023305.197ON5782411471e-09
ZYRO0B10538g5.197ON5312411461e-09
YLR023C (IZH3)5.197ON5432391461e-09
CAGL0D03322g5.197ON5452461442e-09
Skud_12.915.197ON5422851424e-09
Smik_12.865.197ON5422391391e-08
Suva_10.1045.197ON5412401328e-08
KAFR0C014603.90ON219110840.037
Smik_1.90na 1ON23848780.23
ADR080W7.319ON69179780.36
Ecym_2743na 2ON1244163760.68
Skud_14.423.62ON52467750.79
Kpol_495.195.622ON607150712.5
Ecym_52573.182ON22735684.0
Suva_14.443.62ON52576694.2
ZYRO0A13002g8.545ON27972684.5
KNAG0I004201.459ON108551686.2
NDAI0C061108.231ON159574686.4
KNAG0D012307.491ON655116677.7
BLASTX 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Kwal_56.22454
         (948 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_56.22454 s56 (136175..137122) [948 bp, 315 aa] {ON} YOL002C...   649   0.0  
KLTH0C11044g Chr3 complement(908604..909551) [948 bp, 315 aa] {O...   513   0.0  
SAKL0E01474g Chr5 (112382..113317) [936 bp, 311 aa] {ON} similar...   417   e-147
NCAS0H01510 Chr8 complement(287981..288922) [942 bp, 313 aa] {ON...   405   e-142
CAGL0E02519g Chr5 complement(242867..243814) [948 bp, 315 aa] {O...   402   e-141
NDAI0F01740 Chr6 (429141..430082) [942 bp, 313 aa] {ON} Anc_6.27      398   e-139
ZYRO0C07612g Chr3 complement(578864..579823) [960 bp, 319 aa] {O...   394   e-138
KAFR0G02650 Chr7 complement(547561..548526) [966 bp, 321 aa] {ON...   392   e-137
Kpol_1032.9 s1032 (22700..23656) [957 bp, 318 aa] {ON} (22700..2...   392   e-137
KNAG0M01240 Chr13 (226766..227710) [945 bp, 314 aa] {ON} Anc_6.2...   390   e-136
KLLA0D01331g Chr4 (117469..118395) [927 bp, 308 aa] {ON} similar...   386   e-134
TDEL0G04420 Chr7 complement(802412..803380) [969 bp, 322 aa] {ON...   386   e-134
TBLA0E03060 Chr5 (769031..769990) [960 bp, 319 aa] {ON} Anc_6.27...   386   e-134
Ecym_3031 Chr3 (61592..62578) [987 bp, 328 aa] {ON} similar to A...   367   e-127
TPHA0M00290 Chr13 (57784..58767) [984 bp, 327 aa] {ON} Anc_6.27 ...   367   e-127
Suva_15.173 Chr15 complement(297915..298898) [984 bp, 327 aa] {O...   363   e-125
ACL002C Chr3 complement(353449..354438) [990 bp, 329 aa] {ON} Sy...   363   e-125
Smik_15.168 Chr15 complement(290724..291707) [984 bp, 327 aa] {O...   360   e-124
YOL002C Chr15 complement(323411..324364) [954 bp, 317 aa] {ON}  ...   360   e-124
Skud_15.160 Chr15 complement(283003..283986) [984 bp, 327 aa] {O...   355   e-122
SAKL0C09218g Chr3 (839747..840691) [945 bp, 314 aa] {ON} similar...   303   e-102
ZYRO0B06556g Chr2 (526478..527434) [957 bp, 318 aa] {ON} similar...   288   3e-96
TDEL0D05340 Chr4 (969608..970558) [951 bp, 316 aa] {ON} Anc_3.90...   286   2e-95
CAGL0G04631g Chr7 (441149..442099) [951 bp, 316 aa] {ON} similar...   286   3e-95
KLLA0C12441g Chr3 complement(1057427..1058374) [948 bp, 315 aa] ...   285   5e-95
TPHA0A00640 Chr1 complement(115042..116025) [984 bp, 327 aa] {ON...   285   1e-94
Kwal_56.22704 s56 (244431..245393) [963 bp, 320 aa] {ON} YDR492W...   282   9e-94
NDAI0A07160 Chr1 complement(1630482..1631474) [993 bp, 330 aa] {...   282   2e-93
KLTH0C09504g Chr3 complement(788442..789401) [960 bp, 319 aa] {O...   278   3e-92
Skud_4.766 Chr4 (1354630..1355580) [951 bp, 316 aa] {ON} YDR492W...   276   1e-91
NCAS0I02570 Chr9 complement(480266..481210) [945 bp, 314 aa] {ON...   274   1e-90
Kpol_1053.26 s1053 complement(40099..41073) [975 bp, 324 aa] {ON...   274   2e-90
AFR337W Chr6 (1051645..1052598) [954 bp, 317 aa] {ON} Syntenic h...   273   3e-90
Smik_4.769 Chr4 (1356263..1357213) [951 bp, 316 aa] {ON} YDR492W...   272   7e-90
YDR492W Chr4 (1434924..1435874) [951 bp, 316 aa] {ON}  IZH1Membr...   272   7e-90
Suva_2.668 Chr2 (1186763..1187710) [948 bp, 315 aa] {ON} YDR492W...   271   3e-89
Ecym_3588 Chr3 (1117646..1118563) [918 bp, 305 aa] {ON} similar ...   265   3e-87
TBLA0B02290 Chr2 complement(534472..535452) [981 bp, 326 aa] {ON...   265   7e-87
KAFR0A08130 Chr1 (1638153..1639112) [960 bp, 319 aa] {ON} Anc_3....   254   9e-83
KNAG0K02160 Chr11 (436744..437715) [972 bp, 323 aa] {ON} Anc_3.9...   241   2e-77
TBLA0B08255 Chr2 (1973757..1974647) [891 bp, 296 aa] {ON}             165   3e-48
NCAS0C04920 Chr3 complement(1003692..1004672) [981 bp, 326 aa] {...   134   2e-36
NDAI0G04300 Chr7 (1035664..1036620) [957 bp, 318 aa] {ON} Anc_3.90    133   7e-36
CAGL0I07491g Chr9 complement(719539..720444) [906 bp, 301 aa] {O...   100   8e-24
Suva_15.64 Chr15 complement(100035..100973) [939 bp, 312 aa] {ON...    95   1e-21
KLLA0F15510g Chr6 (1433494..1435362) [1869 bp, 622 aa] {ON} some...    86   1e-17
Skud_15.53 Chr15 complement(86339..87277) [939 bp, 312 aa] {ON} ...    84   1e-17
Smik_15.56 Chr15 complement(90083..91021) [939 bp, 312 aa] {ON} ...    80   2e-16
Kpol_2002.94 s2002 (229517..231250) [1734 bp, 577 aa] {ON} (2295...    80   5e-16
YOL101C Chr15 complement(126982..127920) [939 bp, 312 aa] {ON}  ...    76   5e-15
AAL153C Chr1 complement(75086..76345) [1260 bp, 419 aa] {ON} Syn...    74   4e-14
KAFR0J00670 Chr10 (120378..121907) [1530 bp, 509 aa] {ON} Anc_5....    74   5e-14
TPHA0E03120 Chr5 complement(654079..655788) [1710 bp, 569 aa] {O...    71   5e-13
KLTH0B03498g Chr2 complement(281148..282788) [1641 bp, 546 aa] {...    71   7e-13
KNAG0K00670 Chr11 complement(119419..120384) [966 bp, 321 aa] {O...    68   3e-12
Ecym_7109 Chr7 complement(210829..212535) [1707 bp, 568 aa] {ON}...    67   1e-11
TBLA0C06050 Chr3 (1468152..1469465) [1314 bp, 437 aa] {ON} Anc_5...    65   4e-11
Kwal_33.15122 s33 (968885..970585) [1701 bp, 566 aa] {ON} YLR023...    64   2e-10
KNAG0B05100 Chr2 (976101..977717) [1617 bp, 538 aa] {ON} Anc_5.1...    63   2e-10
NCAS0D02600 Chr4 (499689..501320) [1632 bp, 543 aa] {ON} Anc_5.1...    62   4e-10
TDEL0E04320 Chr5 complement(804655..806007) [1353 bp, 450 aa] {O...    62   7e-10
SAKL0G12980g Chr7 complement(1108751..1110442) [1692 bp, 563 aa]...    61   1e-09
NDAI0I02330 Chr9 (532412..534148) [1737 bp, 578 aa] {ON} Anc_5.197     61   1e-09
ZYRO0B10538g Chr2 complement(830311..831906) [1596 bp, 531 aa] {...    61   1e-09
YLR023C Chr12 complement(185498..187129) [1632 bp, 543 aa] {ON} ...    61   1e-09
CAGL0D03322g Chr4 complement(340949..342586) [1638 bp, 545 aa] {...    60   2e-09
Skud_12.91 Chr12 complement(177334..178962) [1629 bp, 542 aa] {O...    59   4e-09
Smik_12.86 Chr12 complement(172288..173916) [1629 bp, 542 aa] {O...    58   1e-08
Suva_10.104 Chr10 complement(191663..193288) [1626 bp, 541 aa] {...    55   8e-08
KAFR0C01460 Chr3 (300109..300768) [660 bp, 219 aa] {ON} Anc_3.90...    37   0.037
Smik_1.90 Chr1 (160467..161183) [717 bp, 238 aa] {ON} YAR033W (R...    35   0.23 
ADR080W Chr4 (850507..852582) [2076 bp, 691 aa] {ON} Syntenic ho...    35   0.36 
Ecym_2743 Chr2 (1438180..1441914) [3735 bp, 1244 aa] {ON} simila...    34   0.68 
Skud_14.42 Chr14 (70507..72081) [1575 bp, 524 aa] {ON} YNL295W (...    33   0.79 
Kpol_495.19 s495 (53075..54898) [1824 bp, 607 aa] {ON} (53075..5...    32   2.5  
Ecym_5257 Chr5 complement(535932..536615) [684 bp, 227 aa] {ON} ...    31   4.0  
Suva_14.44 Chr14 (73757..75334) [1578 bp, 525 aa] {ON} YNL295W (...    31   4.2  
ZYRO0A13002g Chr1 complement(1028405..1029244) [840 bp, 279 aa] ...    31   4.5  
KNAG0I00420 Chr9 complement(62534..65791) [3258 bp, 1085 aa] {ON...    31   6.2  
NDAI0C06110 Chr3 (1409081..1413868) [4788 bp, 1595 aa] {ON}            31   6.4  
KNAG0D01230 Chr4 (207381..209348) [1968 bp, 655 aa] {ON} Anc_7.4...    30   7.7  

>Kwal_56.22454 s56 (136175..137122) [948 bp, 315 aa] {ON} YOL002C -
           Hypothetical ORF [contig 185] FULL
          Length = 315

 Score =  649 bits (1674), Expect = 0.0
 Identities = 315/315 (100%), Positives = 315/315 (100%)
 Frame = +1

Query: 1   MVEAGLTKRKAVGIEPEGVMTEETTTLLNGSRIEERTRRRLYKWDEIPEWQKDNEHILNG 180
           MVEAGLTKRKAVGIEPEGVMTEETTTLLNGSRIEERTRRRLYKWDEIPEWQKDNEHILNG
Sbjct: 1   MVEAGLTKRKAVGIEPEGVMTEETTTLLNGSRIEERTRRRLYKWDEIPEWQKDNEHILNG 60

Query: 181 YILETKSVGACLKSLLYLHNESVNIYTHLIPGWCFLLMTLFNQLAIERYETTRMIDYIMI 360
           YILETKSVGACLKSLLYLHNESVNIYTHLIPGWCFLLMTLFNQLAIERYETTRMIDYIMI
Sbjct: 61  YILETKSVGACLKSLLYLHNESVNIYTHLIPGWCFLLMTLFNQLAIERYETTRMIDYIMI 120

Query: 361 DLFFLGGFTCLMMSSTFHCFKCHSLPVAVLGNKLDYLGIVALVVTSMVSILFYGFHDNNL 540
           DLFFLGGFTCLMMSSTFHCFKCHSLPVAVLGNKLDYLGIVALVVTSMVSILFYGFHDNNL
Sbjct: 121 DLFFLGGFTCLMMSSTFHCFKCHSLPVAVLGNKLDYLGIVALVVTSMVSILFYGFHDNNL 180

Query: 541 YFYVFSGLTIMFGLACTIVSLSDKFRSRDWRPYRAALFVAFGLSALFPVIAGICHYGFKV 720
           YFYVFSGLTIMFGLACTIVSLSDKFRSRDWRPYRAALFVAFGLSALFPVIAGICHYGFKV
Sbjct: 181 YFYVFSGLTIMFGLACTIVSLSDKFRSRDWRPYRAALFVAFGLSALFPVIAGICHYGFKV 240

Query: 721 TWTRIQLKWVFLEGVFYILGALLYGVRFPERVAPGTFDIWGQSHQLFHVLVVIAASCHLR 900
           TWTRIQLKWVFLEGVFYILGALLYGVRFPERVAPGTFDIWGQSHQLFHVLVVIAASCHLR
Sbjct: 241 TWTRIQLKWVFLEGVFYILGALLYGVRFPERVAPGTFDIWGQSHQLFHVLVVIAASCHLR 300

Query: 901 ALLGAYKWVHSQMLI 945
           ALLGAYKWVHSQMLI
Sbjct: 301 ALLGAYKWVHSQMLI 315

>KLTH0C11044g Chr3 complement(908604..909551) [948 bp, 315 aa] {ON}
           similar to uniprot|Q12442 Saccharomyces cerevisiae
           YOL002C IZH2 Membrane protein involved in zinc
           metabolism member of the four-protein IZH family direct
           target of the Zap1p transcription factor expression
           induced by zinc deficiency and fatty acids deletion
           increases sensitivity to elevated zinc
          Length = 315

 Score =  513 bits (1320), Expect = 0.0
 Identities = 239/310 (77%), Positives = 273/310 (88%)
 Frame = +1

Query: 1   MVEAGLTKRKAVGIEPEGVMTEETTTLLNGSRIEERTRRRLYKWDEIPEWQKDNEHILNG 180
           M + GLT+RK V +E    M EE ++LL  S +++RT+RRLY WDEIPEWQ+DNEHI+ G
Sbjct: 1   MEQGGLTQRKPVEVELHHRMVEENSSLLKDSNLKQRTKRRLYTWDEIPEWQRDNEHIVGG 60

Query: 181 YILETKSVGACLKSLLYLHNESVNIYTHLIPGWCFLLMTLFNQLAIERYETTRMIDYIMI 360
           YILETKS   CLKSLLYLHNESVNIYTHL+PGWCFLL+ +FNQ+ IE++ETTR+IDY+MI
Sbjct: 61  YILETKSTWECLKSLLYLHNESVNIYTHLLPGWCFLLVAVFNQVVIEKFETTRLIDYVMI 120

Query: 361 DLFFLGGFTCLMMSSTFHCFKCHSLPVAVLGNKLDYLGIVALVVTSMVSILFYGFHDNNL 540
           DLFFLGGFTCLMMSS FHCFKCHSLPVA+LGNKLDYLGIVALVVTS+VSILFYGFHD +L
Sbjct: 121 DLFFLGGFTCLMMSSVFHCFKCHSLPVAILGNKLDYLGIVALVVTSIVSILFYGFHDYDL 180

Query: 541 YFYVFSGLTIMFGLACTIVSLSDKFRSRDWRPYRAALFVAFGLSALFPVIAGICHYGFKV 720
           YF++FSGLT+ FGLAC  VSLS+KFRSR+WRPYRA+LFVAFGLSAL PVIAG  HYG K 
Sbjct: 181 YFWLFSGLTMAFGLACATVSLSNKFRSREWRPYRASLFVAFGLSALLPVIAGALHYGLKE 240

Query: 721 TWTRIQLKWVFLEGVFYILGALLYGVRFPERVAPGTFDIWGQSHQLFHVLVVIAASCHLR 900
           TWTRIQL+WV L GVFYILGA+LYG+RFPER+APG FDIWG SHQLFH+LVV+AA CHLR
Sbjct: 241 TWTRIQLEWVLLGGVFYILGAVLYGIRFPERMAPGCFDIWGHSHQLFHILVVVAALCHLR 300

Query: 901 ALLGAYKWVH 930
           ALLGAYK  H
Sbjct: 301 ALLGAYKLFH 310

>SAKL0E01474g Chr5 (112382..113317) [936 bp, 311 aa] {ON} similar to
           uniprot|Q12442 Saccharomyces cerevisiae YOL002C IZH2
           Membrane protein involved in zinc metabolism member of
           the four-protein IZH family direct target of the Zap1p
           transcription factor expression induced by zinc
           deficiency and fatty acids deletion increases
           sensitivity to elevated zinc
          Length = 311

 Score =  417 bits (1071), Expect = e-147
 Identities = 187/305 (61%), Positives = 245/305 (80%)
 Frame = +1

Query: 25  RKAVGIEPEGVMTEETTTLLNGSRIEERTRRRLYKWDEIPEWQKDNEHILNGYILETKSV 204
           R+ + I+   ++ EET   ++   I ++  RRLY W+EIP+WQKDNEHI +GY+ ET S 
Sbjct: 7   RRRLQIKRANIVKEET---MSTGTINKKRVRRLYSWEEIPDWQKDNEHIRHGYVRETNSF 63

Query: 205 GACLKSLLYLHNESVNIYTHLIPGWCFLLMTLFNQLAIERYETTRMIDYIMIDLFFLGGF 384
             C  SL Y+HNESVNIYTHL+PG CF  + LF+++AI+ ++TT  +DYIM+DLFFLG F
Sbjct: 64  LGCFDSLFYMHNESVNIYTHLLPGLCFFFVVLFDKVAIKVFDTTTFLDYIMVDLFFLGAF 123

Query: 385 TCLMMSSTFHCFKCHSLPVAVLGNKLDYLGIVALVVTSMVSILFYGFHDNNLYFYVFSGL 564
           TCL++SSTFHC K HSL +A+LGNKLDYLGIVAL+V+SM+SI++YGF D+  +FY FS L
Sbjct: 124 TCLILSSTFHCLKTHSLRIAILGNKLDYLGIVALIVSSMISIMYYGFFDSGKFFYGFSTL 183

Query: 565 TIMFGLACTIVSLSDKFRSRDWRPYRAALFVAFGLSALFPVIAGICHYGFKVTWTRIQLK 744
           T++FG+AC I SLSD FRSR+WRPYRAALFVAFGLSA+ P+ +G+  YGFK TW ++Q+K
Sbjct: 184 TLVFGIACAIASLSDTFRSREWRPYRAALFVAFGLSAVLPIFSGVAVYGFKETWVKVQVK 243

Query: 745 WVFLEGVFYILGALLYGVRFPERVAPGTFDIWGQSHQLFHVLVVIAASCHLRALLGAYKW 924
           WV L GVFYI+GALLY +R PER++PG FDIWG SHQ+FH+LVVIAA CHL+A+L +Y+ 
Sbjct: 244 WVLLGGVFYIIGALLYALRLPERISPGKFDIWGHSHQIFHILVVIAALCHLKAVLNSYEL 303

Query: 925 VHSQM 939
           VH ++
Sbjct: 304 VHKKL 308

>NCAS0H01510 Chr8 complement(287981..288922) [942 bp, 313 aa] {ON}
           Anc_6.27
          Length = 313

 Score =  405 bits (1041), Expect = e-142
 Identities = 185/277 (66%), Positives = 222/277 (80%)
 Frame = +1

Query: 109 TRRRLYKWDEIPEWQKDNEHILNGYILETKSVGACLKSLLYLHNESVNIYTHLIPGWCFL 288
           T R+LY WDEIPEWQKDNEHI+ GY+ ET S   C  SL Y+HNE+ N+Y+HL+PG  F 
Sbjct: 37  TIRKLYTWDEIPEWQKDNEHIIAGYVRETNSFRRCFDSLFYIHNETGNVYSHLVPGVVFF 96

Query: 289 LMTLFNQLAIERYETTRMIDYIMIDLFFLGGFTCLMMSSTFHCFKCHSLPVAVLGNKLDY 468
           L  LF++ AI  +ETT   DY++I+LFFLG FTCL++SSTFHCFK HSL +A  GNKLDY
Sbjct: 97  LTMLFDKYAIVSFETTTFTDYLIINLFFLGAFTCLILSSTFHCFKSHSLKIATFGNKLDY 156

Query: 469 LGIVALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLACTIVSLSDKFRSRDWRPYRAA 648
           LGIV L+VTSM+SILFYGF+DN  +FY FS LT+ FG AC IVSL DKFRSR+WRPYRA 
Sbjct: 157 LGIVVLIVTSMISILFYGFYDNGPFFYGFSLLTLSFGSACAIVSLKDKFRSREWRPYRAG 216

Query: 649 LFVAFGLSALFPVIAGICHYGFKVTWTRIQLKWVFLEGVFYILGALLYGVRFPERVAPGT 828
           LFVAFGLSA+ P++ G+ +YG   TWTRIQLKWV LEGVFYI GA LYG+RFPE+   GT
Sbjct: 217 LFVAFGLSAVLPILTGVMYYGPHETWTRIQLKWVVLEGVFYIFGAFLYGIRFPEKYVNGT 276

Query: 829 FDIWGQSHQLFHVLVVIAASCHLRALLGAYKWVHSQM 939
           FDIWG SHQ+FH+LVV+AA CHL+ALLG+Y+ VH  +
Sbjct: 277 FDIWGHSHQIFHLLVVVAAFCHLKALLGSYELVHMNL 313

>CAGL0E02519g Chr5 complement(242867..243814) [948 bp, 315 aa] {ON}
           similar to uniprot|Q12442 Saccharomyces cerevisiae
           YOL002c
          Length = 315

 Score =  402 bits (1034), Expect = e-141
 Identities = 187/300 (62%), Positives = 232/300 (77%), Gaps = 3/300 (1%)
 Frame = +1

Query: 55  VMTEETTTLLNGSRIEERTR---RRLYKWDEIPEWQKDNEHILNGYILETKSVGACLKSL 225
           V TEE   +    +I+ R +   R+LY W+EIPEWQKDNEHI  GY+ ET SV  C++SL
Sbjct: 13  VTTEEQPLIGTDGQIKLRKKTVVRKLYTWEEIPEWQKDNEHIHTGYVRETSSVMECIRSL 72

Query: 226 LYLHNESVNIYTHLIPGWCFLLMTLFNQLAIERYETTRMIDYIMIDLFFLGGFTCLMMSS 405
            YLHNE+VNIY+HLIP   F     FN+  +  Y TT +IDY++ID+FFLG F+CL++SS
Sbjct: 73  FYLHNETVNIYSHLIPAIAFFSTIFFNKYVVPTYSTTTLIDYLIIDIFFLGAFSCLILSS 132

Query: 406 TFHCFKCHSLPVAVLGNKLDYLGIVALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLA 585
           TFHC K HSL VAV GNKLDYLGIV L+V SMVSIL+YGFH N  +F +FS +T+ FG A
Sbjct: 133 TFHCLKSHSLRVAVFGNKLDYLGIVFLIVASMVSILYYGFHGNPWFFGIFSLITMTFGAA 192

Query: 586 CTIVSLSDKFRSRDWRPYRAALFVAFGLSALFPVIAGICHYGFKVTWTRIQLKWVFLEGV 765
           C +VSL D FRSR+WRPYRAALFV FGLSA+ P++AG+  YG   TWTRIQLKWV LEGV
Sbjct: 193 CAVVSLKDTFRSREWRPYRAALFVIFGLSAVLPILAGLFKYGPTETWTRIQLKWVILEGV 252

Query: 766 FYILGALLYGVRFPERVAPGTFDIWGQSHQLFHVLVVIAASCHLRALLGAYKWVHSQMLI 945
           FYI GA LYG+RFPE+++PG+FD+WG SHQ+FH+LVV+AA CHL+ALLG+Y  VH + +I
Sbjct: 253 FYIFGAFLYGIRFPEKMSPGSFDLWGHSHQIFHILVVVAALCHLKALLGSYSLVHYRFMI 312

>NDAI0F01740 Chr6 (429141..430082) [942 bp, 313 aa] {ON} Anc_6.27
          Length = 313

 Score =  398 bits (1022), Expect = e-139
 Identities = 182/288 (63%), Positives = 224/288 (77%), Gaps = 3/288 (1%)
 Frame = +1

Query: 85  NGSRIEERTRR---RLYKWDEIPEWQKDNEHILNGYILETKSVGACLKSLLYLHNESVNI 255
           NG  IE+  R+   +LY+WDEIPEWQKDNEHI++GY+ ET S   CL SL Y+HNES N+
Sbjct: 26  NGDSIEQVKRKVVYKLYRWDEIPEWQKDNEHIISGYVRETNSFKGCLHSLFYVHNESGNV 85

Query: 256 YTHLIPGWCFLLMTLFNQLAIERYETTRMIDYIMIDLFFLGGFTCLMMSSTFHCFKCHSL 435
           Y+HL+PG  F    + N+  I  Y TT ++DY+MIDLFF G F CL++SS FHCFK HSL
Sbjct: 86  YSHLLPGVFFFFTMVLNKYGITIYSTTSIVDYLMIDLFFFGAFCCLILSSLFHCFKSHSL 145

Query: 436 PVAVLGNKLDYLGIVALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLACTIVSLSDKF 615
            VA LGNKLDYLGIV L+VTSM+SI+++GF DN L+FY FS LT +FG AC  VSL D F
Sbjct: 146 KVATLGNKLDYLGIVILIVTSMISIMYFGFFDNPLFFYFFSSLTFLFGGACATVSLKDHF 205

Query: 616 RSRDWRPYRAALFVAFGLSALFPVIAGICHYGFKVTWTRIQLKWVFLEGVFYILGALLYG 795
           RSR+WRPYRA LFVAFGLSA+ P++AG  +YG + T+ RIQLKW+ LEG FYI GA LYG
Sbjct: 206 RSREWRPYRAGLFVAFGLSAILPILAGTFYYGIEETFIRIQLKWIILEGFFYIFGAFLYG 265

Query: 796 VRFPERVAPGTFDIWGQSHQLFHVLVVIAASCHLRALLGAYKWVHSQM 939
           VRFPE+  PG+FDIWG SHQ+FH+LVV+AA CHLR LL +Y+ VHS++
Sbjct: 266 VRFPEKYVPGSFDIWGHSHQIFHILVVVAAFCHLRGLLSSYEIVHSRL 313

>ZYRO0C07612g Chr3 complement(578864..579823) [960 bp, 319 aa] {ON}
           similar to uniprot|Q12442 Saccharomyces cerevisiae
           YOL002C IZH2 Membrane protein involved in zinc
           metabolism member of the four-protein IZH family direct
           target of the Zap1p transcription factor expression
           induced by zinc deficiency and fatty acids deletion
           increases sensitivity to elevated zinc
          Length = 319

 Score =  394 bits (1012), Expect = e-138
 Identities = 177/277 (63%), Positives = 219/277 (79%)
 Frame = +1

Query: 112 RRRLYKWDEIPEWQKDNEHILNGYILETKSVGACLKSLLYLHNESVNIYTHLIPGWCFLL 291
           ++ LY W+EIP+WQKDNEHI+ GY+ ET S+  CL+SLLYLHNES+NIYTH +PG CFL 
Sbjct: 39  KKLLYTWNEIPDWQKDNEHIVGGYVRETNSIRECLQSLLYLHNESINIYTHFLPGLCFLA 98

Query: 292 MTLFNQLAIERYETTRMIDYIMIDLFFLGGFTCLMMSSTFHCFKCHSLPVAVLGNKLDYL 471
             +F++ AI+ ++TT  IDY+ ID FF G F+CL++SSTFHCFK HS  V+V GNKLDYL
Sbjct: 99  TCIFDKFAIKNFDTTTWIDYMAIDFFFFGAFSCLILSSTFHCFKSHSSRVSVFGNKLDYL 158

Query: 472 GIVALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLACTIVSLSDKFRSRDWRPYRAAL 651
           GIV L+V SM+SIL+Y FHD+N  FY F+ +   FG++CTI S  D FRSR+WRPYRA L
Sbjct: 159 GIVILIVCSMISILYYAFHDSNKLFYSFTLIIFCFGVSCTIASFDDTFRSREWRPYRAGL 218

Query: 652 FVAFGLSALFPVIAGICHYGFKVTWTRIQLKWVFLEGVFYILGALLYGVRFPERVAPGTF 831
           FVAFGLSAL P++ GI  YGF  TWTRIQ+KWV LEG+FYI GA LY +RFPER+APG F
Sbjct: 219 FVAFGLSALLPIMGGIIKYGFHETWTRIQMKWVILEGIFYIFGAFLYSIRFPERLAPGAF 278

Query: 832 DIWGQSHQLFHVLVVIAASCHLRALLGAYKWVHSQML 942
           D  G SHQ+FHVLVVIAA CHL AL+ +Y+ VH+ +L
Sbjct: 279 DFVGHSHQIFHVLVVIAALCHLVALMNSYELVHTNLL 315

>KAFR0G02650 Chr7 complement(547561..548526) [966 bp, 321 aa] {ON}
           Anc_6.27 YOL002C
          Length = 321

 Score =  392 bits (1008), Expect = e-137
 Identities = 176/271 (64%), Positives = 218/271 (80%)
 Frame = +1

Query: 118 RLYKWDEIPEWQKDNEHILNGYILETKSVGACLKSLLYLHNESVNIYTHLIPGWCFLLMT 297
           +LY W+EIP+WQKDNEHI++GY+ ET S  +C++SL YLHNESVN+Y+HLIP  CFL+ +
Sbjct: 39  QLYNWNEIPDWQKDNEHIISGYVKETNSFFSCIESLFYLHNESVNVYSHLIPAVCFLMTS 98

Query: 298 LFNQLAIERYETTRMIDYIMIDLFFLGGFTCLMMSSTFHCFKCHSLPVAVLGNKLDYLGI 477
           L N+  + ++ TT ++DY+ IDLFFLG FTCL++SSTFHCFK HSL +A  GNKLDYLGI
Sbjct: 99  LLNKTIVPKFRTTTVLDYLYIDLFFLGAFTCLILSSTFHCFKSHSLRIATFGNKLDYLGI 158

Query: 478 VALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLACTIVSLSDKFRSRDWRPYRAALFV 657
           V L+ TSM+S+L+YGF+D    FYVF+ +T+ FGLAC  VSL DKFRSR+ R YRA LFV
Sbjct: 159 VVLISTSMISLLYYGFYDTPSLFYVFAFITLSFGLACATVSLKDKFRSRECRAYRATLFV 218

Query: 658 AFGLSALFPVIAGICHYGFKVTWTRIQLKWVFLEGVFYILGALLYGVRFPERVAPGTFDI 837
            FGLSA+ PVI G+ HYGF  TW RIQLKWV LEGVFYI GA LYG+RFPE+  PG +DI
Sbjct: 219 CFGLSAVLPVICGLYHYGFYNTWHRIQLKWVLLEGVFYIFGAFLYGIRFPEKYTPGKYDI 278

Query: 838 WGQSHQLFHVLVVIAASCHLRALLGAYKWVH 930
           WG SHQLFH+LVVIAA CH +AL+ +Y+ VH
Sbjct: 279 WGHSHQLFHILVVIAALCHFKALMCSYEHVH 309

>Kpol_1032.9 s1032 (22700..23656) [957 bp, 318 aa] {ON}
           (22700..23656) [957 nt, 319 aa]
          Length = 318

 Score =  392 bits (1006), Expect = e-137
 Identities = 173/274 (63%), Positives = 221/274 (80%)
 Frame = +1

Query: 118 RLYKWDEIPEWQKDNEHILNGYILETKSVGACLKSLLYLHNESVNIYTHLIPGWCFLLMT 297
           +L  W+ +P+WQKDNEHIL+GY+ ET S+ ACL SLL++HNESVNI++HL+P +CF+   
Sbjct: 40  QLVTWEHLPDWQKDNEHILSGYVKETNSIKACLHSLLFIHNESVNIFSHLVPAFCFMTTI 99

Query: 298 LFNQLAIERYETTRMIDYIMIDLFFLGGFTCLMMSSTFHCFKCHSLPVAVLGNKLDYLGI 477
           +F++  +ERY TT + DY+M+DLF  G FTCLMMSS FHC K HS  V+  GNKLDYLGI
Sbjct: 100 IFDKYVVERYPTTTLKDYLMLDLFLFGAFTCLMMSSAFHCLKAHSPYVSSFGNKLDYLGI 159

Query: 478 VALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLACTIVSLSDKFRSRDWRPYRAALFV 657
           V L+V+SM SIL+YGF+DN+  ++ FS +T  FGL+C +VSL ++FR+R+WRPYRAA+FV
Sbjct: 160 VVLIVSSMSSILYYGFYDNSFLYFTFSAITFTFGLSCAVVSLGERFRAREWRPYRAAMFV 219

Query: 658 AFGLSALFPVIAGICHYGFKVTWTRIQLKWVFLEGVFYILGALLYGVRFPERVAPGTFDI 837
           AFGLSAL P+ AG  +YG + T  R+QLKWV LEGVFYI GALLYGVRFPER+ PG FDI
Sbjct: 220 AFGLSALLPIFAGFLYYGVQETTIRVQLKWVVLEGVFYIFGALLYGVRFPERLKPGMFDI 279

Query: 838 WGQSHQLFHVLVVIAASCHLRALLGAYKWVHSQM 939
           WG SHQLFH+LVV+AA CHLR LLG+Y  VH+++
Sbjct: 280 WGHSHQLFHILVVVAALCHLRGLLGSYTIVHTRL 313

>KNAG0M01240 Chr13 (226766..227710) [945 bp, 314 aa] {ON} Anc_6.27
           YOL002C
          Length = 314

 Score =  390 bits (1003), Expect = e-136
 Identities = 171/276 (61%), Positives = 223/276 (80%)
 Frame = +1

Query: 103 ERTRRRLYKWDEIPEWQKDNEHILNGYILETKSVGACLKSLLYLHNESVNIYTHLIPGWC 282
           ++  +R+Y W+EIPEWQKDNEHI++GY+ ET S   C+ SL YLHNESVN+Y+HLIP  C
Sbjct: 30  KKITKRIYTWNEIPEWQKDNEHIIDGYVRETNSFLKCVHSLFYLHNESVNVYSHLIPALC 89

Query: 283 FLLMTLFNQLAIERYETTRMIDYIMIDLFFLGGFTCLMMSSTFHCFKCHSLPVAVLGNKL 462
           F  +   N+  ++ +ETT ++DY+ IDLFFLG FTCL++SSTFHCFK HSL VA  GNKL
Sbjct: 90  FFSVLFLNKYCVKSFETTSLVDYLFIDLFFLGAFTCLILSSTFHCFKSHSLKVATFGNKL 149

Query: 463 DYLGIVALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLACTIVSLSDKFRSRDWRPYR 642
           DYLGIV L+VTSM+SIL+YGF+D+++ FY FS +T+ FG AC +VSL D FRSR+WRPYR
Sbjct: 150 DYLGIVVLIVTSMISILYYGFYDSSVMFYFFSFVTLSFGTACGVVSLKDHFRSREWRPYR 209

Query: 643 AALFVAFGLSALFPVIAGICHYGFKVTWTRIQLKWVFLEGVFYILGALLYGVRFPERVAP 822
           A LFVAFGLSA+ P+++G+  YG +  + RIQ+KW+ LEGVFYILGA LYG+RFPE+ +P
Sbjct: 210 AGLFVAFGLSAILPILSGMFAYGIEEAFHRIQIKWIILEGVFYILGAFLYGIRFPEKGSP 269

Query: 823 GTFDIWGQSHQLFHVLVVIAASCHLRALLGAYKWVH 930
           G +DIWG SHQ+FH+LVV+AA CHL+ L+ +Y+ VH
Sbjct: 270 GKYDIWGHSHQVFHILVVVAALCHLKGLMVSYELVH 305

>KLLA0D01331g Chr4 (117469..118395) [927 bp, 308 aa] {ON} similar to
           uniprot|Q12442 Saccharomyces cerevisiae YOL002C IZH2
           Membrane protein involved in zinc metabolism member of
           the four-protein IZH family direct target of the Zap1p
           transcription factor expression induced by zinc
           deficiency and fatty acids deletion increases
           sensitivity to elevated zinc
          Length = 308

 Score =  386 bits (991), Expect = e-134
 Identities = 189/309 (61%), Positives = 221/309 (71%), Gaps = 1/309 (0%)
 Frame = +1

Query: 16  LTKRKAVGIEPEGVMTEETTTLLNGSRIEERTRRRLYKWDEIPEWQKDNEHILNGYILET 195
           ++ RK   +  E  + EET       R+ ER   R+Y WDEIP+WQKDNEHIL+GY+ ET
Sbjct: 1   MSTRKRSVVTEETALIEETPGTKKTVRVYER---RVYSWDEIPDWQKDNEHILHGYVRET 57

Query: 196 KSVGACLKSLLYLHNESVNIYTHLIPGWCFLLMTLF-NQLAIERYETTRMIDYIMIDLFF 372
           +S      SL YLHNESVNIYTHLIP      + LF     I  Y TT  IDY MI+LFF
Sbjct: 58  QSWKELFHSLFYLHNESVNIYTHLIPAVALFFIMLFATHHVINEYPTTSAIDYFMINLFF 117

Query: 373 LGGFTCLMMSSTFHCFKCHSLPVAVLGNKLDYLGIVALVVTSMVSILFYGFHDNNLYFYV 552
            G  TCL MSS FH  KCHSLP+A  GNKLDYLGIV L+ TSM+SILFYGFHD++L FY 
Sbjct: 118 FGCATCLTMSSMFHTIKCHSLPIATFGNKLDYLGIVVLISTSMISILFYGFHDSSLLFYP 177

Query: 553 FSGLTIMFGLACTIVSLSDKFRSRDWRPYRAALFVAFGLSALFPVIAGICHYGFKVTWTR 732
           F+GLT +FGL C  +SL DKFRSR+WRPYRA +FV FGLSA+FP++AG   YG   TW R
Sbjct: 178 FAGLTSLFGLICGYMSLKDKFRSREWRPYRATMFVLFGLSAVFPIVAGFIVYGKDETWKR 237

Query: 733 IQLKWVFLEGVFYILGALLYGVRFPERVAPGTFDIWGQSHQLFHVLVVIAASCHLRALLG 912
           +QL WV  EGV YI GA LYGVRFPER+APG FDIWG SHQLFHVLVV+AA CHL+AL+ 
Sbjct: 238 VQLTWVIWEGVLYIFGAFLYGVRFPERLAPGKFDIWGHSHQLFHVLVVVAALCHLKALVV 297

Query: 913 AYKWVHSQM 939
           +Y  VH  +
Sbjct: 298 SYGLVHQAL 306

>TDEL0G04420 Chr7 complement(802412..803380) [969 bp, 322 aa] {ON}
           Anc_6.27 YOL002C
          Length = 322

 Score =  386 bits (992), Expect = e-134
 Identities = 181/299 (60%), Positives = 228/299 (76%), Gaps = 2/299 (0%)
 Frame = +1

Query: 55  VMTEETTTLLNGSRIEE--RTRRRLYKWDEIPEWQKDNEHILNGYILETKSVGACLKSLL 228
           V  EET+  + G + ++  + +R+LY WDEIP WQ+DNEHIL+GY+ ET+S+  C  SL 
Sbjct: 21  VTKEETSGPVKGQKTDKMSKKKRKLYTWDEIPHWQRDNEHILSGYVGETRSMFQCFLSLF 80

Query: 229 YLHNESVNIYTHLIPGWCFLLMTLFNQLAIERYETTRMIDYIMIDLFFLGGFTCLMMSST 408
           YLHNESVNIYTHL+PG  FL +  F++ A+ ++ETT +IDY+MIDLF L  FTCL +SS 
Sbjct: 81  YLHNESVNIYTHLLPGIAFLFVLCFDKFAVTQFETTTLIDYVMIDLFSLVSFTCLTLSSI 140

Query: 409 FHCFKCHSLPVAVLGNKLDYLGIVALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLAC 588
           FHC K HS  VA  GNKLDYLGIV LVVTSMVSI++YGF +    FY+FS +T  FG AC
Sbjct: 141 FHCLKNHSRSVATFGNKLDYLGIVVLVVTSMVSIMYYGFFETPALFYLFSFITCTFGAAC 200

Query: 589 TIVSLSDKFRSRDWRPYRAALFVAFGLSALFPVIAGICHYGFKVTWTRIQLKWVFLEGVF 768
            +VSL + FR+R+WRPYRAA+FVAFGLSA+ P++ GI +YGF   + RIQ+KWV L G+F
Sbjct: 201 AVVSLKEGFRTREWRPYRAAMFVAFGLSAVLPIVTGIFYYGFSEIYLRIQVKWVLLGGIF 260

Query: 769 YILGALLYGVRFPERVAPGTFDIWGQSHQLFHVLVVIAASCHLRALLGAYKWVHSQMLI 945
           YI GA+LYGVRFPE+ APG +DIWG SHQLFHVLVV+AA CHL  L+ +Y  VH +M I
Sbjct: 261 YITGAVLYGVRFPEKYAPGKYDIWGHSHQLFHVLVVVAALCHLYGLIKSYNLVHLKMAI 319

>TBLA0E03060 Chr5 (769031..769990) [960 bp, 319 aa] {ON} Anc_6.27
           YOL002C
          Length = 319

 Score =  386 bits (991), Expect = e-134
 Identities = 178/298 (59%), Positives = 222/298 (74%), Gaps = 5/298 (1%)
 Frame = +1

Query: 61  TEETTTLLNGSRIEE-----RTRRRLYKWDEIPEWQKDNEHILNGYILETKSVGACLKSL 225
           TEE   LL G   ++      + +RLY WDEIP WQ DNE+I  GY+ ET S+     SL
Sbjct: 14  TEEGVELLYGDNQQQLNTSGSSGKRLYTWDEIPVWQHDNEYIYTGYVRETNSMKESFLSL 73

Query: 226 LYLHNESVNIYTHLIPGWCFLLMTLFNQLAIERYETTRMIDYIMIDLFFLGGFTCLMMSS 405
            Y+HNESVNIYTHLIP +CFL M LFN   ++ + TT   DY+ IDLFF+G FTCL +SS
Sbjct: 74  FYIHNESVNIYTHLIPAFCFLSMLLFNTYGVKPHPTTTYGDYVAIDLFFIGAFTCLGLSS 133

Query: 406 TFHCFKCHSLPVAVLGNKLDYLGIVALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLA 585
           TFHCFK HSL ++V GNKLDYLGIV L+ TS++S+L++G+HD+   FY+FSG+T+ FG+A
Sbjct: 134 TFHCFKSHSLKISVFGNKLDYLGIVILISTSLISVLYFGYHDDPFIFYIFSGITLCFGIA 193

Query: 586 CTIVSLSDKFRSRDWRPYRAALFVAFGLSALFPVIAGICHYGFKVTWTRIQLKWVFLEGV 765
           C I SL DKFR+R+WRPYRAALFV FGLS + P+IAGI  YG +  + R+QLKW+  EGV
Sbjct: 194 CGIASLKDKFRTREWRPYRAALFVLFGLSGVLPIIAGIMKYGIREVFERVQLKWIIWEGV 253

Query: 766 FYILGALLYGVRFPERVAPGTFDIWGQSHQLFHVLVVIAASCHLRALLGAYKWVHSQM 939
            YI GA LYG RFPE+  PG  DIWGQSHQ+FHVLVVIAA CHLR L+G+Y+ VH ++
Sbjct: 254 LYIFGAFLYGARFPEKFMPGKVDIWGQSHQIFHVLVVIAALCHLRGLIGSYELVHQKL 311

>Ecym_3031 Chr3 (61592..62578) [987 bp, 328 aa] {ON} similar to
           Ashbya gossypii ACL002C
          Length = 328

 Score =  367 bits (943), Expect = e-127
 Identities = 162/274 (59%), Positives = 212/274 (77%)
 Frame = +1

Query: 118 RLYKWDEIPEWQKDNEHILNGYILETKSVGACLKSLLYLHNESVNIYTHLIPGWCFLLMT 297
           +L+ W EIPEWQ+DNEHIL GY+ ET S    L SLLYLHNESVNIYTHLIPG CF  + 
Sbjct: 47  KLFSWHEIPEWQRDNEHILGGYVKETNSFKETLHSLLYLHNESVNIYTHLIPGVCFFCVL 106

Query: 298 LFNQLAIERYETTRMIDYIMIDLFFLGGFTCLMMSSTFHCFKCHSLPVAVLGNKLDYLGI 477
             N+  I R++TT   DY +ID FF+G F CL+MS T+HC K HS PV+++GN+LDY+GI
Sbjct: 107 FLNKYVISRFKTTTWKDYAIIDTFFVGAFACLVMSGTYHCLKSHSYPVSIVGNQLDYIGI 166

Query: 478 VALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLACTIVSLSDKFRSRDWRPYRAALFV 657
           V L+ TSM S+L+YGF++++  FY FSG+T++ G  CT+V+L  +FRSR WRPYRA++FV
Sbjct: 167 VILISTSMFSLLYYGFYNSSKMFYGFSGVTLLLGTICTVVTLDSRFRSRLWRPYRASIFV 226

Query: 658 AFGLSALFPVIAGICHYGFKVTWTRIQLKWVFLEGVFYILGALLYGVRFPERVAPGTFDI 837
           AFGLS++ P++A I +YG + TW  +QL W+ LEGV YI GA +YG+RFPE +APG+FDI
Sbjct: 227 AFGLSSILPILASILYYGSEETWNSVQLGWIILEGVLYIFGAFIYGIRFPESMAPGSFDI 286

Query: 838 WGQSHQLFHVLVVIAASCHLRALLGAYKWVHSQM 939
           WG SHQLFHVLVVIAA CH +A+  +Y+ VH ++
Sbjct: 287 WGHSHQLFHVLVVIAALCHFKAVTQSYELVHFRL 320

>TPHA0M00290 Chr13 (57784..58767) [984 bp, 327 aa] {ON} Anc_6.27
           YOL002C
          Length = 327

 Score =  367 bits (942), Expect = e-127
 Identities = 175/320 (54%), Positives = 225/320 (70%), Gaps = 11/320 (3%)
 Frame = +1

Query: 16  LTKRKAVGIEPEGVMTEETTTLLNGS--------RIEERTRRRLYK---WDEIPEWQKDN 162
           L KR    I     +TEE  T+ N          +I  R  R+L     WD++P+WQKDN
Sbjct: 7   LQKRNGETIVSSSAVTEEEYTIANDGVKSNKKLVKIIGRFTRQLITITHWDDLPDWQKDN 66

Query: 163 EHILNGYILETKSVGACLKSLLYLHNESVNIYTHLIPGWCFLLMTLFNQLAIERYETTRM 342
           EHI  GY+ ET S   C +SL +LHNESVNIY+H++PG C L M L +   I+++ TT  
Sbjct: 67  EHIHEGYVKETNSFINCFESLFFLHNESVNIYSHMVPGLCALFMLLIDINIIKKFPTTTF 126

Query: 343 IDYIMIDLFFLGGFTCLMMSSTFHCFKCHSLPVAVLGNKLDYLGIVALVVTSMVSILFYG 522
           +DY MIDLF  G F+CL++SS FH  K HSL VA+ GNKLDYLGIV L+VTSM+SIL+YG
Sbjct: 127 VDYFMIDLFLAGAFSCLILSSAFHTLKSHSLFVAIYGNKLDYLGIVILIVTSMISILYYG 186

Query: 523 FHDNNLYFYVFSGLTIMFGLACTIVSLSDKFRSRDWRPYRAALFVAFGLSALFPVIAGIC 702
           F+D   +F++FS +TI+FG+AC  VSL++KFRSR+WRPYRA LFV FGLSA+FPV+ GI 
Sbjct: 187 FYDTPYFFHLFSTITILFGIACGTVSLANKFRSREWRPYRATLFVCFGLSAVFPVLTGIW 246

Query: 703 HYGFKVTWTRIQLKWVFLEGVFYILGALLYGVRFPERVAPGTFDIWGQSHQLFHVLVVIA 882
           +YG + T+ RIQLKW+  EG FYI GA LY +R+PER+ PG FD+WG SHQ+FHV VVIA
Sbjct: 247 YYGLEDTFKRIQLKWIVTEGFFYIFGAFLYAMRYPERICPGAFDLWGHSHQIFHVFVVIA 306

Query: 883 ASCHLRALLGAYKWVHSQML 942
           A  H   LL AY++ H  ++
Sbjct: 307 AYSHFHGLLSAYEYAHEMLI 326

>Suva_15.173 Chr15 complement(297915..298898) [984 bp, 327 aa] {ON}
           YOL002C (REAL)
          Length = 327

 Score =  363 bits (933), Expect = e-125
 Identities = 165/279 (59%), Positives = 215/279 (77%)
 Frame = +1

Query: 103 ERTRRRLYKWDEIPEWQKDNEHILNGYILETKSVGACLKSLLYLHNESVNIYTHLIPGWC 282
           ++  +R+Y WDEIPEWQ+DN++IL+GY+ ET S     KSL Y+HNESVNIY+HLIP   
Sbjct: 43  KKVLKRVYSWDEIPEWQRDNDYILHGYVKETSSFVDTFKSLFYMHNESVNIYSHLIPAVG 102

Query: 283 FLLMTLFNQLAIERYETTRMIDYIMIDLFFLGGFTCLMMSSTFHCFKCHSLPVAVLGNKL 462
           FL + L ++  I  +ETT  +D++MIDLFF G F CL++SS+FHCFK HSL +A LGNKL
Sbjct: 103 FLTVLLLDKTTITVFETTTWLDHMMIDLFFTGAFACLILSSSFHCFKSHSLKIATLGNKL 162

Query: 463 DYLGIVALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLACTIVSLSDKFRSRDWRPYR 642
           DYLGI  L+VTSMVSIL+YG++D    F +F+ +T+ FG+AC+IVSL DKFR R+WRPYR
Sbjct: 163 DYLGICILIVTSMVSILYYGYYDKFPAFCLFALITVSFGIACSIVSLKDKFRKREWRPYR 222

Query: 643 AALFVAFGLSALFPVIAGICHYGFKVTWTRIQLKWVFLEGVFYILGALLYGVRFPERVAP 822
           A LFV FGLS++ P+ +G+ +Y F   W +IQL WV L G  YI+GA+LYG+RFPE+V P
Sbjct: 223 AGLFVCFGLSSIVPIFSGLYYYSFSEIWNQIQLFWVLLGGALYIIGAVLYGMRFPEKVYP 282

Query: 823 GTFDIWGQSHQLFHVLVVIAASCHLRALLGAYKWVHSQM 939
           G FDIWG SHQLFH LVVIA+ CH+R +L +Y+ VH +M
Sbjct: 283 GRFDIWGHSHQLFHFLVVIASLCHMRGVLNSYELVHIKM 321

>ACL002C Chr3 complement(353449..354438) [990 bp, 329 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL002C
          Length = 329

 Score =  363 bits (931), Expect = e-125
 Identities = 176/301 (58%), Positives = 216/301 (71%), Gaps = 7/301 (2%)
 Frame = +1

Query: 61  TEETTTLLNGSRIEERTRRR-------LYKWDEIPEWQKDNEHILNGYILETKSVGACLK 219
           T+ETT L +G+     T  R       L  WD++P+WQKDNEHIL+GY+ ET S     +
Sbjct: 25  TKETTFLQDGTVAAAITATRAIREVSSLCSWDDLPDWQKDNEHILSGYVRETNSYRKTFR 84

Query: 220 SLLYLHNESVNIYTHLIPGWCFLLMTLFNQLAIERYETTRMIDYIMIDLFFLGGFTCLMM 399
           SL YLHNESVNIY+HLIPG CFL + LFN+  +  Y TT   DY+MID+F LG   CL +
Sbjct: 85  SLFYLHNESVNIYSHLIPGICFLFIALFNKYVVADYSTTTWKDYLMIDIFLLGAVVCLTL 144

Query: 400 SSTFHCFKCHSLPVAVLGNKLDYLGIVALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFG 579
           S  +HC K HSL V+V GNKLDY+GIVAL+  SM+S ++YGF+D+   F +FS +T+   
Sbjct: 145 SGVYHCMKSHSLEVSVFGNKLDYIGIVALISCSMISQMYYGFYDSTAMFSLFSTVTLSLA 204

Query: 580 LACTIVSLSDKFRSRDWRPYRAALFVAFGLSALFPVIAGICHYGFKVTWTRIQLKWVFLE 759
           LAC +VSLS  FRSR+WR YRAA+F AFGLS L PVI    +YG    ++RIQLKW+ LE
Sbjct: 205 LACAVVSLSPHFRSREWRKYRAAIFTAFGLSGLLPVITSCFYYGPIEAYSRIQLKWLSLE 264

Query: 760 GVFYILGALLYGVRFPERVAPGTFDIWGQSHQLFHVLVVIAASCHLRALLGAYKWVHSQM 939
           GV YI GA+LYGVRFPE++ PG+FDIWG SHQLFHVLVVIAA CHLRALL  YK VH+  
Sbjct: 265 GVLYISGAVLYGVRFPEKLEPGSFDIWGHSHQLFHVLVVIAALCHLRALLSCYKNVHTNA 324

Query: 940 L 942
           L
Sbjct: 325 L 325

>Smik_15.168 Chr15 complement(290724..291707) [984 bp, 327 aa] {ON}
           YOL002C (REAL)
          Length = 327

 Score =  360 bits (925), Expect = e-124
 Identities = 166/279 (59%), Positives = 213/279 (76%)
 Frame = +1

Query: 103 ERTRRRLYKWDEIPEWQKDNEHILNGYILETKSVGACLKSLLYLHNESVNIYTHLIPGWC 282
           ++  +RLY WDEIPEWQ+DN+ IL+GY+ ET S     KSL YLHNESVNIY+HL+P   
Sbjct: 43  KKVLKRLYSWDEIPEWQRDNDFILHGYVRETSSFIETFKSLFYLHNESVNIYSHLVPALG 102

Query: 283 FLLMTLFNQLAIERYETTRMIDYIMIDLFFLGGFTCLMMSSTFHCFKCHSLPVAVLGNKL 462
           F  + L ++  I+ +ETT   D+++IDLF+ G F CL++SS+FHC K HSL +A LGNKL
Sbjct: 103 FFTVLLLDKSTIKVFETTTWKDHVVIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNKL 162

Query: 463 DYLGIVALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLACTIVSLSDKFRSRDWRPYR 642
           DYLGI  L+VTSMVSILFYG+++    F +F+ +T+ FG+AC+IVSL DKFR R+WRPYR
Sbjct: 163 DYLGICILIVTSMVSILFYGYYEKFSLFCLFALITVSFGVACSIVSLKDKFRKREWRPYR 222

Query: 643 AALFVAFGLSALFPVIAGICHYGFKVTWTRIQLKWVFLEGVFYILGALLYGVRFPERVAP 822
           A LFV FGLS++ P+ +G+  Y F   WT+IQL WV L GV YI+GA+LYG+RFPE+V P
Sbjct: 223 AGLFVCFGLSSIVPIFSGLYCYSFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCP 282

Query: 823 GTFDIWGQSHQLFHVLVVIAASCHLRALLGAYKWVHSQM 939
           G FDIWG SHQLFH LVVIA+ CHLR LL +Y+ VH +M
Sbjct: 283 GKFDIWGHSHQLFHFLVVIASLCHLRGLLNSYELVHIKM 321

>YOL002C Chr15 complement(323411..324364) [954 bp, 317 aa] {ON}
           IZH2Plasma membrane protein involved in zinc homeostasis
           and osmotin-induced apoptosis; transcription regulated
           by Zap1p, zinc and fatty acid levels; similar to
           mammalian adiponectins; deletion increases sensitivity
           to elevated zinc
          Length = 317

 Score =  360 bits (924), Expect = e-124
 Identities = 166/279 (59%), Positives = 212/279 (75%)
 Frame = +1

Query: 103 ERTRRRLYKWDEIPEWQKDNEHILNGYILETKSVGACLKSLLYLHNESVNIYTHLIPGWC 282
           ++  RRLY WDEIPEWQ+DN+ IL+GY+ ET S     KSL YLHNESVNIY+HLIP   
Sbjct: 33  KKVLRRLYSWDEIPEWQRDNDFILHGYVKETSSFIETFKSLFYLHNESVNIYSHLIPALG 92

Query: 283 FLLMTLFNQLAIERYETTRMIDYIMIDLFFLGGFTCLMMSSTFHCFKCHSLPVAVLGNKL 462
           F  + L ++  I+ + TT  +D+++IDLF+ G F CL++SS+FHC K HSL +A LGNKL
Sbjct: 93  FFTVLLLDKSTIKVFATTTWLDHMVIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNKL 152

Query: 463 DYLGIVALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLACTIVSLSDKFRSRDWRPYR 642
           DYLGI  L+VTSMVSIL+YG+ +    F +F+ +T+ FG+AC+IVSL DKFR R+WRPYR
Sbjct: 153 DYLGICILIVTSMVSILYYGYFEKFSLFCLFALITVSFGIACSIVSLKDKFRKREWRPYR 212

Query: 643 AALFVAFGLSALFPVIAGICHYGFKVTWTRIQLKWVFLEGVFYILGALLYGVRFPERVAP 822
           A LFV FGLS++ P+ +G+  Y F   WT+IQL WV L GV YI+GA+LYG+RFPE++ P
Sbjct: 213 AGLFVCFGLSSIIPIFSGLYCYSFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKICP 272

Query: 823 GTFDIWGQSHQLFHVLVVIAASCHLRALLGAYKWVHSQM 939
           G FDIWG SHQLFH LVVIAA CHLR LL +Y+ VH +M
Sbjct: 273 GKFDIWGHSHQLFHFLVVIAALCHLRGLLNSYELVHIKM 311

>Skud_15.160 Chr15 complement(283003..283986) [984 bp, 327 aa] {ON}
           YOL002C (REAL)
          Length = 327

 Score =  355 bits (912), Expect = e-122
 Identities = 163/279 (58%), Positives = 213/279 (76%)
 Frame = +1

Query: 103 ERTRRRLYKWDEIPEWQKDNEHILNGYILETKSVGACLKSLLYLHNESVNIYTHLIPGWC 282
           ++  +RLY WDEIPEWQ+DN++IL+GY+ ET S     KSL Y+HNESVNIY+HLIP   
Sbjct: 43  KKVLKRLYSWDEIPEWQRDNDYILHGYVRETCSFVETFKSLFYMHNESVNIYSHLIPALG 102

Query: 283 FLLMTLFNQLAIERYETTRMIDYIMIDLFFLGGFTCLMMSSTFHCFKCHSLPVAVLGNKL 462
           F  + L ++  I+ +ETT   D+++IDLF+ G F CL++SS+FHC K HSL +A LGNKL
Sbjct: 103 FFTVLLLDKSTIKVFETTTWKDHMIIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNKL 162

Query: 463 DYLGIVALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLACTIVSLSDKFRSRDWRPYR 642
           DYLGI  L+VTSM SIL+YG+++    F +F+ +T+ FG+AC+IV+L DKFR R+WRPYR
Sbjct: 163 DYLGICILIVTSMTSILYYGYYEKFSLFCLFALITVSFGIACSIVTLKDKFRKREWRPYR 222

Query: 643 AALFVAFGLSALFPVIAGICHYGFKVTWTRIQLKWVFLEGVFYILGALLYGVRFPERVAP 822
           A LFV FGLS++ P+ +G+  Y F   WT+IQL WV L GV YI+GA+LYG+RFPE+V P
Sbjct: 223 AGLFVCFGLSSIVPIFSGLYCYTFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCP 282

Query: 823 GTFDIWGQSHQLFHVLVVIAASCHLRALLGAYKWVHSQM 939
           G FDIWG SHQLFH LVVIA+ CHLR LL +Y+ VH +M
Sbjct: 283 GKFDIWGHSHQLFHFLVVIASFCHLRGLLNSYELVHLKM 321

>SAKL0C09218g Chr3 (839747..840691) [945 bp, 314 aa] {ON} similar to
           uniprot|Q6Q557 Saccharomyces cerevisiae YDR492W IZH1
           Membrane protein involved in zinc metabolism member of
           the four-protein IZH family transcription is regulated
           directly by Zap1p expression induced by zinc deficiency
           and fatty acids deletion increases sensitivity to
           elevated zinc
          Length = 314

 Score =  303 bits (775), Expect = e-102
 Identities = 140/276 (50%), Positives = 201/276 (72%), Gaps = 2/276 (0%)
 Frame = +1

Query: 112 RRRLYKWDEIPEWQKDNEHILNGYILETKSVGACLKSLLYLHNESVNIYTHLIPGWCFLL 291
           R+RL  ++E+P+WQKDNE IL+GY+ ET+SV  C KSLLY HNE+VNIYTHL+PG  +LL
Sbjct: 28  RKRLCTFEELPDWQKDNELILDGYVRETRSVSECFKSLLYFHNETVNIYTHLVPGVTYLL 87

Query: 292 MTLF--NQLAIERYETTRMIDYIMIDLFFLGGFTCLMMSSTFHCFKCHSLPVAVLGNKLD 465
           M +F  + + I ++ ++ M DYI+I+ F LG F CLM SS FHC K HS   + + +K+D
Sbjct: 88  MLMFLTDFILIPKFPSSTMTDYIIINFFLLGAFVCLMCSSCFHCLKQHSEEHSDIWSKVD 147

Query: 466 YLGIVALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLACTIVSLSDKFRSRDWRPYRA 645
           Y+GI+ L+  SMVSIL+YGFHD+  +F +F+ +T++ G  C    L+D+F S+++R +RA
Sbjct: 148 YMGIIVLISCSMVSILYYGFHDHLFHFKIFTVVTVILGSCCAAFVLNDRFNSKNFRVFRA 207

Query: 646 ALFVAFGLSALFPVIAGICHYGFKVTWTRIQLKWVFLEGVFYILGALLYGVRFPERVAPG 825
           + FV+FG S L P+I G+  +G   +  R+QLK+V LE VFYI GA+ YG R PE   PG
Sbjct: 208 SFFVSFGFSGLVPIIFGLVKFGISESVHRVQLKYVGLEAVFYIGGAVFYGFRIPENFGPG 267

Query: 826 TFDIWGQSHQLFHVLVVIAASCHLRALLGAYKWVHS 933
            FD+ G SHQ+FHV+VV+ + CHLRA++G+Y ++H+
Sbjct: 268 KFDLVGHSHQIFHVMVVLGSLCHLRAVVGSYIFMHT 303

>ZYRO0B06556g Chr2 (526478..527434) [957 bp, 318 aa] {ON} similar to
           uniprot|Q6Q557 Saccharomyces cerevisiae YDR492W IZH1
           Membrane protein involved in zinc metabolism member of
           the four-protein IZH family transcription is regulated
           directly by Zap1p expression induced by zinc deficiency
           and fatty acids deletion increases sensitivity to
           elevated zinc
          Length = 318

 Score =  288 bits (738), Expect = 3e-96
 Identities = 140/283 (49%), Positives = 196/283 (69%), Gaps = 2/283 (0%)
 Frame = +1

Query: 97  IEERTRRRLYKWDEIPEWQKDNEHILNGYILETKSVGACLKSLLYLHNESVNIYTHLIPG 276
           +EE+T   LY + E+PEWQ+DN+ IL GYI ETKSV  C++SL   +NE+VNIYTHL+  
Sbjct: 27  LEEKT---LYDFHELPEWQQDNDKILTGYIRETKSVLKCVRSLFIWNNETVNIYTHLVSA 83

Query: 277 WCFLLMTL--FNQLAIERYETTRMIDYIMIDLFFLGGFTCLMMSSTFHCFKCHSLPVAVL 450
             + L+ L   + + +  + T+   DY +I+ + LG F CLM SS FH FK HS P +  
Sbjct: 84  VSYFLLMLGITDLVMVPHFPTSTFTDYSVINFYLLGAFGCLMCSSCFHTFKQHSGPHSDA 143

Query: 451 GNKLDYLGIVALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLACTIVSLSDKFRSRDW 630
            +K+DY+GI+ L+  SM+S+++YGF D+  YF +F+ LT+    ACT+  LSDKF  +D+
Sbjct: 144 WSKVDYMGIIVLITCSMISLIYYGFFDHMEYFRLFTVLTLTLATACTVCVLSDKFNHKDF 203

Query: 631 RPYRAALFVAFGLSALFPVIAGICHYGFKVTWTRIQLKWVFLEGVFYILGALLYGVRFPE 810
           RP RA  F+AFGLS +FPV AGI  +G +    R+QLK++ LE +FYI GAL+YG R PE
Sbjct: 204 RPLRAGFFIAFGLSGVFPVAAGIIKFGIQGGVQRVQLKYLGLEAIFYIAGALIYGFRIPE 263

Query: 811 RVAPGTFDIWGQSHQLFHVLVVIAASCHLRALLGAYKWVHSQM 939
            + PG FD WG SHQ+FHVLVVIA+  HL+A++G+Y + HS +
Sbjct: 264 TMFPGRFDFWGHSHQIFHVLVVIASFLHLKAVMGSYIFKHSHL 306

>TDEL0D05340 Chr4 (969608..970558) [951 bp, 316 aa] {ON} Anc_3.90
           YOL101C
          Length = 316

 Score =  286 bits (733), Expect = 2e-95
 Identities = 132/277 (47%), Positives = 195/277 (70%), Gaps = 2/277 (0%)
 Frame = +1

Query: 115 RRLYKWDEIPEWQKDNEHILNGYILETKSVGACLKSLLYLHNESVNIYTHLIPGWCFLLM 294
           ++LY ++E+PEWQ+DN+ IL GY+ ETKSV  CL SL Y +NESVNIYTHL+    + ++
Sbjct: 30  KKLYHFNELPEWQQDNDKILTGYVRETKSVLRCLDSLSYWNNESVNIYTHLLSAVAYFVL 89

Query: 295 TLF--NQLAIERYETTRMIDYIMIDLFFLGGFTCLMMSSTFHCFKCHSLPVAVLGNKLDY 468
            LF  + L I  + +T M DYI+I+ + LG F CLM SS FHCFK HS   +   +K+DY
Sbjct: 90  LLFFTDILLIPSFPSTTMTDYIIINFYLLGAFVCLMCSSCFHCFKQHSNSQSDAWSKVDY 149

Query: 469 LGIVALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLACTIVSLSDKFRSRDWRPYRAA 648
           +GI+ L+  S++S+L+YG+ D+  YF +FS +T++  +AC++  LSD+F + D RP RA+
Sbjct: 150 MGIIGLISCSVISLLYYGYFDHVFYFKLFSVITVVLAMACSVCVLSDRFNTSDMRPLRAS 209

Query: 649 LFVAFGLSALFPVIAGICHYGFKVTWTRIQLKWVFLEGVFYILGALLYGVRFPERVAPGT 828
            F+ F  S++ P+  G+  +G+   + R+QL++V  E  FY+ GALLYG R PE +APG 
Sbjct: 210 FFITFAFSSVIPIATGMFKFGWTEVFHRVQLRFVGWEAFFYLSGALLYGYRIPETIAPGK 269

Query: 829 FDIWGQSHQLFHVLVVIAASCHLRALLGAYKWVHSQM 939
           FD  G SHQLFHVLVV+ + CHLRA++G+Y ++H+ +
Sbjct: 270 FDFIGSSHQLFHVLVVLGSFCHLRAVMGSYMFMHAHI 306

>CAGL0G04631g Chr7 (441149..442099) [951 bp, 316 aa] {ON} similar to
           uniprot|Q03419 Saccharomyces cerevisiae YDR492w
          Length = 316

 Score =  286 bits (731), Expect = 3e-95
 Identities = 131/283 (46%), Positives = 196/283 (69%), Gaps = 2/283 (0%)
 Frame = +1

Query: 100 EERTRRRLYKWDEIPEWQKDNEHILNGYILETKSVGACLKSLLYLHNESVNIYTHLIPGW 279
           EE++ + L+ ++E+PEWQKDN+ IL GY+ ET S   CL+SLLYL+NESVNIYTHLIP  
Sbjct: 31  EEKSEKLLWHFNELPEWQKDNDKILRGYVRETNSFKRCLQSLLYLNNESVNIYTHLIPAV 90

Query: 280 CFLLMTLF--NQLAIERYETTRMIDYIMIDLFFLGGFTCLMMSSTFHCFKCHSLPVAVLG 453
            ++ ++L+  N   I  Y +T  +DY++I++FFLG F CL+ SS FHC K HS     + 
Sbjct: 91  FYISLSLYLANVFLIPVYPSTSSVDYVIINVFFLGAFFCLLCSSCFHCMKQHSESQCNVW 150

Query: 454 NKLDYLGIVALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLACTIVSLSDKFRSRDWR 633
           +KLDYLGI+ L+  S V +++YG+ D+   F +F+G+T++  + C++  L+DKF + ++R
Sbjct: 151 SKLDYLGIICLISCSTVPMIYYGYFDHISEFTIFTGITLLLAIGCSVFVLTDKFNTTEYR 210

Query: 634 PYRAALFVAFGLSALFPVIAGICHYGFKVTWTRIQLKWVFLEGVFYILGALLYGVRFPER 813
           P RA+ F  FG S + P+ AG   +G +    RI L ++ LE +FYI GA++YG RFPE 
Sbjct: 211 PIRASFFTLFGFSGIIPLGAGFLKFGAEGVLQRISLPFIGLEALFYISGAIIYGFRFPET 270

Query: 814 VAPGTFDIWGQSHQLFHVLVVIAASCHLRALLGAYKWVHSQML 942
           +APG FD +G SHQ+FH++VV+ + CHL A++ +Y  +HS  L
Sbjct: 271 IAPGKFDFFGSSHQIFHIMVVLGSICHLFAMVESYHLIHSNFL 313

>KLLA0C12441g Chr3 complement(1057427..1058374) [948 bp, 315 aa]
           {ON} similar to uniprot|Q6Q557 Saccharomyces cerevisiae
           YDR492W IZH1 Membrane protein involved in zinc
           metabolism member of the four-protein IZH family
           transcription is regulated directly by Zap1p expression
           induced by zinc deficiency and fatty acids deletion
           increases sensitivity to elevated zinc
          Length = 315

 Score =  285 bits (730), Expect = 5e-95
 Identities = 134/303 (44%), Positives = 199/303 (65%), Gaps = 13/303 (4%)
 Frame = +1

Query: 70  TTTLLNGSRIEER-----------TRRRLYKWDEIPEWQKDNEHILNGYILETKSVGACL 216
           TTT+ +   I E+           T +RLY++ E+PEWQ+DN+ I+ GYI ETKSV  C+
Sbjct: 4   TTTIRHRRSISEKLEQLTPVAISSTIKRLYRYSELPEWQQDNDKIITGYIRETKSVKECV 63

Query: 217 KSLLYLHNESVNIYTHLIPG--WCFLLMTLFNQLAIERYETTRMIDYIMIDLFFLGGFTC 390
           KSL   HNES+NIY+HL+P   +  LL+ L +   + ++  + M+  +MI  F LG   C
Sbjct: 64  KSLFLFHNESINIYSHLVPTITYLVLLVGLADMFLVPQFPNSTMMQSVMIHFFLLGSVLC 123

Query: 391 LMMSSTFHCFKCHSLPVAVLGNKLDYLGIVALVVTSMVSILFYGFHDNNLYFYVFSGLTI 570
           L  SS FHC K HS     + +K+DY+GI+ ++  S++S+L+YGFHD+  +F  F+  T+
Sbjct: 124 LGCSSFFHCLKQHSESHCHIWSKVDYMGIIIMITCSIISLLYYGFHDHIFHFKCFTVFTV 183

Query: 571 MFGLACTIVSLSDKFRSRDWRPYRAALFVAFGLSALFPVIAGICHYGFKVTWTRIQLKWV 750
           + G  CT+ +L DKF S+ +RP+RA  +V FGLS + P++ G   +G      R+QLK+V
Sbjct: 184 ILGTICTVFALHDKFNSKTFRPFRAMFYVTFGLSGIVPIVTGFWKFGAYEAIRRVQLKYV 243

Query: 751 FLEGVFYILGALLYGVRFPERVAPGTFDIWGQSHQLFHVLVVIAASCHLRALLGAYKWVH 930
            LE +FYI GA++YG RFPE +APG FD  G SHQ+FH++VV+ + CH RA+LG+Y ++H
Sbjct: 244 LLEAMFYIAGAVIYGFRFPEVLAPGKFDFVGHSHQIFHIMVVLGSICHFRAILGSYVFMH 303

Query: 931 SQM 939
           + M
Sbjct: 304 TGM 306

>TPHA0A00640 Chr1 complement(115042..116025) [984 bp, 327 aa] {ON}
           Anc_3.90 YOL101C
          Length = 327

 Score =  285 bits (728), Expect = 1e-94
 Identities = 132/296 (44%), Positives = 199/296 (67%), Gaps = 2/296 (0%)
 Frame = +1

Query: 58  MTEETTTLLNGSRIEERTRRRLYKWDEIPEWQKDNEHILNGYILETKSVGACLKSLLYLH 237
           +++  T LL  + I E   ++LY + E+PEWQKDNE I+ GY+ ET S   C  SL Y H
Sbjct: 24  VSKNGTVLLESTEIVETYSKKLYSFHELPEWQKDNELIIQGYVRETNSWFKCFHSLSYFH 83

Query: 238 NESVNIYTHLIPGWCFLLMTLF--NQLAIERYETTRMIDYIMIDLFFLGGFTCLMMSSTF 411
           NES+NIYTHLIPG  + +M LF  + L +  + +T ++DYI+ID + LG F CL+ SS F
Sbjct: 84  NESINIYTHLIPGLVYFIMLLFYTDLLVVPSFPSTTIMDYIVIDFYLLGAFICLVGSSCF 143

Query: 412 HCFKCHSLPVAVLGNKLDYLGIVALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLACT 591
           HC K HS   +   +K+DY+GI+ L+  S++S+L+YG+ D+ +YF VF+ +T++    CT
Sbjct: 144 HCLKQHSEDQSNFWSKIDYVGIICLISCSLISLLYYGYFDHFIYFKVFTLITLILATICT 203

Query: 592 IVSLSDKFRSRDWRPYRAALFVAFGLSALFPVIAGICHYGFKVTWTRIQLKWVFLEGVFY 771
           +  L ++F ++++RP RA  FV F  SA+ P+  G+  + +     RIQL++V  E  FY
Sbjct: 204 VCVLDERFNAKNFRPIRAGFFVVFATSAVIPICTGLIKFDYVEVINRIQLRFVGWETFFY 263

Query: 772 ILGALLYGVRFPERVAPGTFDIWGQSHQLFHVLVVIAASCHLRALLGAYKWVHSQM 939
           ++GALLYG R PE  APG FD+ G SHQ+FHV+VVI +  HL+A++G+Y+++H  +
Sbjct: 264 VVGALLYGYRIPEIFAPGRFDLVGSSHQIFHVMVVIGSLFHLKAVIGSYEFMHKSL 319

>Kwal_56.22704 s56 (244431..245393) [963 bp, 320 aa] {ON} YDR492W -
           Hypothetical ORF [contig 184] FULL
          Length = 320

 Score =  282 bits (722), Expect = 9e-94
 Identities = 128/285 (44%), Positives = 191/285 (67%), Gaps = 2/285 (0%)
 Frame = +1

Query: 85  NGSRIEERTRRRLYKWDEIPEWQKDNEHILNGYILETKSVGACLKSLLYLHNESVNIYTH 264
           N    E+  +  L +++E+PEWQ+DNE IL GY+ ET+S+  CL+SL Y HNE++NIYTH
Sbjct: 23  NSKSAEQTKKSALCRFEELPEWQRDNEKILAGYVRETRSMRKCLESLTYFHNETLNIYTH 82

Query: 265 LIPGWCFLLMTLF--NQLAIERYETTRMIDYIMIDLFFLGGFTCLMMSSTFHCFKCHSLP 438
           LIP   +L++ +F  +   I  + +T M DYIMI+ + LG F CL+ S+ FHC K HS  
Sbjct: 83  LIPSGTYLVLLMFFTDVFLIPHFPSTTMSDYIMINFYLLGAFLCLLCSTCFHCLKQHSEA 142

Query: 439 VAVLGNKLDYLGIVALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLACTIVSLSDKFR 618
            + + +K+DY+GI+ L+  S VS+L+YGFHD   +F +F+   ++ G  C    L+D+F 
Sbjct: 143 QSNIWSKVDYMGIIVLISCSTVSLLYYGFHDYLFHFKIFTIAVVVLGSCCAAFVLNDRFN 202

Query: 619 SRDWRPYRAALFVAFGLSALFPVIAGICHYGFKVTWTRIQLKWVFLEGVFYILGALLYGV 798
           +++WR  RA  FV FG S + P+I G+  +G   +  R+QL++V LE  FYI GA++YG 
Sbjct: 203 AKNWRACRAGFFVTFGFSGIVPIIMGLVKFGVAESSKRVQLRFVLLEAFFYIGGAIIYGF 262

Query: 799 RFPERVAPGTFDIWGQSHQLFHVLVVIAASCHLRALLGAYKWVHS 933
           R PE + PG FD  G SHQ+FH+LVV+ + CH RAL+G+Y ++H+
Sbjct: 263 RIPETLIPGKFDFVGHSHQIFHILVVLGSLCHFRALIGSYFFMHT 307

>NDAI0A07160 Chr1 complement(1630482..1631474) [993 bp, 330 aa] {ON}
           Anc_3.90
          Length = 330

 Score =  282 bits (721), Expect = 2e-93
 Identities = 135/291 (46%), Positives = 193/291 (66%), Gaps = 9/291 (3%)
 Frame = +1

Query: 85  NGSRIEERTRRR-----LYKWDEIPEWQKDNEHILNGYILETKSVGACLKSLLYLHNESV 249
           N +  + +T RR     L K+DE+PEWQKDN+ IL GY+ ET S   C +SL YL+NE++
Sbjct: 36  NDTSQKPKTNRRKRKIHLSKFDELPEWQKDNDKILTGYVRETNSFIHCFQSLFYLNNETI 95

Query: 250 NIYTHLIPGWCFLLMTL----FNQLAIERYETTRMIDYIMIDLFFLGGFTCLMMSSTFHC 417
           NIYTHLIP   +L+++L     N +AI ++ TT +IDYI+I++F LG FTCL++SS FHC
Sbjct: 96  NIYTHLIPSIIYLIVSLTFIFINFIAIPKFPTTSVIDYIVINIFILGAFTCLLLSSCFHC 155

Query: 418 FKCHSLPVAVLGNKLDYLGIVALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLACTIV 597
            K HS     L +KLDY+GI+ L+  S++ IL++G+ D   YF  F+ LT  F + C+I+
Sbjct: 156 LKQHSFKQCTLWSKLDYIGIIILISCSIIPILYFGYFDRLSYFKFFTILTFSFAIVCSII 215

Query: 598 SLSDKFRSRDWRPYRAALFVAFGLSALFPVIAGICHYGFKVTWTRIQLKWVFLEGVFYIL 777
            L++KF    +RP RA LF+ F  + L P+I G   +G+K    RI L +V LE +FYI+
Sbjct: 216 VLNEKFDLPSYRPLRAGLFMLFSFTGLIPMITGFYIFGYKGVMERISLNFVLLEAIFYII 275

Query: 778 GALLYGVRFPERVAPGTFDIWGQSHQLFHVLVVIAASCHLRALLGAYKWVH 930
           G LLYG R PE   PG FD++G SHQ+FH+ VV+ + CH  A++ +Y  +H
Sbjct: 276 GTLLYGFRIPETFKPGNFDMFGSSHQIFHIFVVLGSICHFGAVIKSYCLMH 326

>KLTH0C09504g Chr3 complement(788442..789401) [960 bp, 319 aa] {ON}
           similar to uniprot|Q6Q557 Saccharomyces cerevisiae
           YDR492W IZH1 Membrane protein involved in zinc
           metabolism member of the four-protein IZH family
           transcription is regulated directly by Zap1p expression
           induced by zinc deficiency and fatty acids deletion
           increases sensitivity to elevated zinc
          Length = 319

 Score =  278 bits (712), Expect = 3e-92
 Identities = 126/270 (46%), Positives = 185/270 (68%), Gaps = 2/270 (0%)
 Frame = +1

Query: 130 WDEIPEWQKDNEHILNGYILETKSVGACLKSLLYLHNESVNIYTHLIPGWCFLLMTLF-- 303
           ++E+P+WQ+DN+ IL GY+ ET S+  C +SL Y HNE+VNIYTHLIP   +L+M +F  
Sbjct: 37  FEELPDWQRDNDKILAGYVRETNSMKKCFESLTYFHNETVNIYTHLIPSGTYLVMLMFFT 96

Query: 304 NQLAIERYETTRMIDYIMIDLFFLGGFTCLMMSSTFHCFKCHSLPVAVLGNKLDYLGIVA 483
           +   I ++ TT M DYIMI+ F LG F CLM S+ FHC K HS   + + +K+DY+GI+ 
Sbjct: 97  DLFLIPQFPTTTMSDYIMINFFLLGAFLCLMCSTCFHCLKQHSEAQSNIWSKVDYMGIIV 156

Query: 484 LVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLACTIVSLSDKFRSRDWRPYRAALFVAF 663
           L+  S VS+L+YGF+D   +F +F+   ++ G  C    L+D+F +++WR  RA  FV F
Sbjct: 157 LISCSTVSLLYYGFYDYLFHFKMFTIAVVVLGSCCAAFVLNDRFNAKNWRACRAGFFVTF 216

Query: 664 GLSALFPVIAGICHYGFKVTWTRIQLKWVFLEGVFYILGALLYGVRFPERVAPGTFDIWG 843
           G S + P++ G+  +G   +  R+QL++V LE +FYI GA++YG R PE + PG FD  G
Sbjct: 217 GFSGIVPIVVGLVKFGIAESSKRVQLRFVLLEALFYISGAVIYGFRIPETLLPGKFDFVG 276

Query: 844 QSHQLFHVLVVIAASCHLRALLGAYKWVHS 933
            SHQ+FH+LVV+ + CH RALLG+Y ++H+
Sbjct: 277 HSHQIFHILVVLGSLCHFRALLGSYFFMHT 306

>Skud_4.766 Chr4 (1354630..1355580) [951 bp, 316 aa] {ON} YDR492W
           (REAL)
          Length = 316

 Score =  276 bits (707), Expect = 1e-91
 Identities = 130/303 (42%), Positives = 197/303 (65%), Gaps = 6/303 (1%)
 Frame = +1

Query: 49  EGVMTEETTTLLNGSRIEERT----RRRLYKWDEIPEWQKDNEHILNGYILETKSVGACL 216
           E V  + TT  +    ++ +T     + L+ +DE+PEWQKDN+ IL GY+ ET S   CL
Sbjct: 12  ESVCCKATTASIKVEAVQSKTASEKEKLLHNFDELPEWQKDNDKILTGYVRETLSWKKCL 71

Query: 217 KSLLYLHNESVNIYTHLIPGWCFLL--MTLFNQLAIERYETTRMIDYIMIDLFFLGGFTC 390
           +SL Y +NE+VNIYTHL+P   + L  +TL N   I  + +T   DY +I++F +G F+C
Sbjct: 72  RSLFYWNNETVNIYTHLVPAIIYFLFAITLTNYFLIPVFPSTSWSDYTVINIFLMGAFSC 131

Query: 391 LMMSSTFHCFKCHSLPVAVLGNKLDYLGIVALVVTSMVSILFYGFHDNNLYFYVFSGLTI 570
           LM SS FHC K HS   +   +KLDYLGI++L+  SM+ I+++G+ D+  YF +F+ +T+
Sbjct: 132 LMCSSCFHCLKQHSEEQSNFWSKLDYLGIISLISCSMIPIIYFGYFDHVSYFSLFTTVTL 191

Query: 571 MFGLACTIVSLSDKFRSRDWRPYRAALFVAFGLSALFPVIAGICHYGFKVTWTRIQLKWV 750
           +    CT+  L +KF +  +RP+RA  F+ FG S L P+  G   +G +    RI++ +V
Sbjct: 192 VLATFCTVCVLHEKFNTSTFRPFRAMFFILFGFSGLLPLTTGFFKFGIQGVLNRIKVSFV 251

Query: 751 FLEGVFYILGALLYGVRFPERVAPGTFDIWGQSHQLFHVLVVIAASCHLRALLGAYKWVH 930
           F E +FYI GA++YG R PE +APG FD  G SHQ+FH++VV+ + CHL+A++ +YK +H
Sbjct: 252 FWEALFYISGAVIYGFRIPETIAPGKFDFLGSSHQIFHIMVVLGSLCHLKAIIDSYKLMH 311

Query: 931 SQM 939
           S +
Sbjct: 312 SHI 314

>NCAS0I02570 Chr9 complement(480266..481210) [945 bp, 314 aa] {ON}
           Anc_3.90 YDR492W
          Length = 314

 Score =  274 bits (701), Expect = 1e-90
 Identities = 130/309 (42%), Positives = 196/309 (63%), Gaps = 2/309 (0%)
 Frame = +1

Query: 19  TKRKAVGIEPEGVMTEETTTLLNGSRIEERTRRRLYKWDEIPEWQKDNEHILNGYILETK 198
           T+RK   ++   V    +    +G + +   +RRL+ ++E+PEWQ+DN+ IL GY+ ETK
Sbjct: 7   TRRKPTKVQ--AVAVGSSNKHADGDKTKRNWKRRLFNFNELPEWQRDNDKILTGYVRETK 64

Query: 199 SVGACLKSLLYLHNESVNIYTHLIPGWCFLLM--TLFNQLAIERYETTRMIDYIMIDLFF 372
           S   CL+SLLY +NE++NIYTHLIP   +L +  TL N + +  + TT ++DY +I++F 
Sbjct: 65  SFKQCLQSLLYWNNETINIYTHLIPALFYLTISVTLINYVVVPHFPTTSIMDYFVINVFL 124

Query: 373 LGGFTCLMMSSTFHCFKCHSLPVAVLGNKLDYLGIVALVVTSMVSILFYGFHDNNLYFYV 552
           +G F CL++SS FHC K HS     L +KLDY+GI+ L+  S++ ++++G+ D+  Y   
Sbjct: 125 MGAFVCLILSSCFHCLKQHSSRQCTLWSKLDYMGIIILISCSLIPMIYFGYFDHLYYVNF 184

Query: 553 FSGLTIMFGLACTIVSLSDKFRSRDWRPYRAALFVAFGLSALFPVIAGICHYGFKVTWTR 732
           F  LT  F   C+I  L++KF    +RP+RA +F+ F  S   P++ G   +GF   + R
Sbjct: 185 FIILTFSFATLCSICVLNEKFNVPHYRPFRAIVFMLFSFSGFIPILTGFYLFGFHGVFER 244

Query: 733 IQLKWVFLEGVFYILGALLYGVRFPERVAPGTFDIWGQSHQLFHVLVVIAASCHLRALLG 912
           + LK+V  E +FYI GA LYG R PE   PG FD  G SHQ+FH+LVV+ + CH RA++ 
Sbjct: 245 VALKFVAWEALFYITGATLYGFRIPECFKPGDFDFLGSSHQIFHILVVLGSICHFRAVIK 304

Query: 913 AYKWVHSQM 939
           +Y  +HS M
Sbjct: 305 SYILMHSSM 313

>Kpol_1053.26 s1053 complement(40099..41073) [975 bp, 324 aa] {ON}
           complement(40099..41073) [975 nt, 325 aa]
          Length = 324

 Score =  274 bits (700), Expect = 2e-90
 Identities = 127/282 (45%), Positives = 193/282 (68%), Gaps = 2/282 (0%)
 Frame = +1

Query: 100 EERTRRRLYKWDEIPEWQKDNEHILNGYILETKSVGACLKSLLYLHNESVNIYTHLIPGW 279
           EE    +L  + E+P+WQKDNE IL GY+ ET S+  CL+SL   +NES+NIY+HLI   
Sbjct: 34  EEHEEIKLCHFHELPDWQKDNEFILTGYVRETNSIKKCLRSLGCFNNESINIYSHLIAAI 93

Query: 280 CFLLMTLF--NQLAIERYETTRMIDYIMIDLFFLGGFTCLMMSSTFHCFKCHSLPVAVLG 453
            + ++ LF  + L I  + +T  +DY++IDL+ LG FTCL+ SS FHC K HS   + + 
Sbjct: 94  SYFVVLLFYTDILCIPSFPSTTFVDYMVIDLYLLGAFTCLIGSSLFHCMKQHSESHSDMW 153

Query: 454 NKLDYLGIVALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLACTIVSLSDKFRSRDWR 633
           +K+DY+GI+ L+  S++S+L+YG+ D+ +YF VF+ +T++    CTI  L  +F S+++R
Sbjct: 154 SKVDYIGIICLITCSLISLLYYGYMDHFIYFKVFTVITLVLATICTICVLDQRFNSKNFR 213

Query: 634 PYRAALFVAFGLSALFPVIAGICHYGFKVTWTRIQLKWVFLEGVFYILGALLYGVRFPER 813
           P RA  F+ F +SA+ P+ AG   +GF     RIQL++V  E  FY++GALLYG R PE 
Sbjct: 214 PIRAGFFILFSMSAVIPIGAGFSKFGFTEVLQRIQLRFVAWETFFYVVGALLYGFRIPET 273

Query: 814 VAPGTFDIWGQSHQLFHVLVVIAASCHLRALLGAYKWVHSQM 939
           + PG FD+ G SHQ+FH++V++ +  HL+A+LG+Y ++HS +
Sbjct: 274 LYPGNFDLVGSSHQIFHIMVILGSVFHLKAVLGSYTFMHSNI 315

>AFR337W Chr6 (1051645..1052598) [954 bp, 317 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR492W (IZH1) and
           YOL101C (IZH4)
          Length = 317

 Score =  273 bits (698), Expect = 3e-90
 Identities = 136/273 (49%), Positives = 185/273 (67%), Gaps = 2/273 (0%)
 Frame = +1

Query: 115 RRLYKWDEIPEWQKDNEHILNGYILETKSVGACLKSLLYLHNESVNIYTHLIPGWCFLLM 294
           R+LY +DE+P WQKDNE IL+GY+ ET SV  CL+++ Y +NES+NIYTHLIPG  +L++
Sbjct: 32  RKLYTFDELPAWQKDNELILSGYVRETNSVKECLRAMTYFNNESINIYTHLIPGVAYLVL 91

Query: 295 TL-FNQLAIERY-ETTRMIDYIMIDLFFLGGFTCLMMSSTFHCFKCHSLPVAVLGNKLDY 468
            L F  L + +        ++ M+  + LG FTCL  SS FHC K HS P + L +K+DY
Sbjct: 92  FLIFADLVLAQLLPGLDAGEHRMLRFYLLGAFTCLACSSCFHCLKQHSEPHSRLWSKVDY 151

Query: 469 LGIVALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLACTIVSLSDKFRSRDWRPYRAA 648
           LGI+A +  S +S+L+YG+H    +F  FS LT+    AC ++ L+D F +  +RP RA 
Sbjct: 152 LGILAQITCSTISLLYYGYHSYPSHFVFFSTLTVALCSACAVLVLNDSFNTVAFRPLRAF 211

Query: 649 LFVAFGLSALFPVIAGICHYGFKVTWTRIQLKWVFLEGVFYILGALLYGVRFPERVAPGT 828
           LF+AFGLS + PV+AG   +GF     RIQLK+V  E VFYI GAL+YG R PER APG 
Sbjct: 212 LFMAFGLSGVIPVLAGSYQFGFAEWAARIQLKYVLYEAVFYITGALVYGFRIPERFAPGK 271

Query: 829 FDIWGQSHQLFHVLVVIAASCHLRALLGAYKWV 927
           FD+ G SHQ+FH+LVV+   CH RA+ G+Y ++
Sbjct: 272 FDMVGHSHQIFHLLVVLGTLCHFRAVTGSYIFI 304

>Smik_4.769 Chr4 (1356263..1357213) [951 bp, 316 aa] {ON} YDR492W
           (REAL)
          Length = 316

 Score =  272 bits (696), Expect = 7e-90
 Identities = 130/303 (42%), Positives = 195/303 (64%), Gaps = 6/303 (1%)
 Frame = +1

Query: 49  EGVMTEETTTLLNGSRIEERT----RRRLYKWDEIPEWQKDNEHILNGYILETKSVGACL 216
           E V    TT  +    +   T    ++ L+ +DE+PEWQKDN+ IL GY+ ET S   CL
Sbjct: 12  ESVCCSVTTGSIKVEAVSSTTVSEKKKLLHNFDELPEWQKDNDKILTGYVRETLSWKKCL 71

Query: 217 KSLLYLHNESVNIYTHLIPGWCFLL--MTLFNQLAIERYETTRMIDYIMIDLFFLGGFTC 390
            SL Y +NE+VNIYTHL+P   + +  +TL N   I  + +T   DY +I++F +G F+C
Sbjct: 72  YSLFYWNNETVNIYTHLVPAVIYFVFAITLTNYFLIPVFPSTSWSDYTVINIFLMGAFSC 131

Query: 391 LMMSSTFHCFKCHSLPVAVLGNKLDYLGIVALVVTSMVSILFYGFHDNNLYFYVFSGLTI 570
           LM SS FHC K HS   +   +KLDYLGI++L+  SM+ I+++G+ D+  YF +F+ +T+
Sbjct: 132 LMCSSCFHCMKQHSEKQSNFWSKLDYLGIISLISCSMIPIIYFGYFDHISYFSLFTIVTL 191

Query: 571 MFGLACTIVSLSDKFRSRDWRPYRAALFVAFGLSALFPVIAGICHYGFKVTWTRIQLKWV 750
           +    CT+  L +KF +  +RP+RA  F+ FG S L P+  G   +G +    RI++ +V
Sbjct: 192 VLATFCTVCVLHEKFNTSTFRPFRAMFFILFGFSGLLPLTTGFFKFGIQGVLNRIKVSFV 251

Query: 751 FLEGVFYILGALLYGVRFPERVAPGTFDIWGQSHQLFHVLVVIAASCHLRALLGAYKWVH 930
           F E +FYI GA++YG R PE +APG FD  G SHQ+FH++VV+ + CHL+A++G+YK +H
Sbjct: 252 FWEALFYISGAVIYGFRIPETLAPGKFDFLGSSHQIFHIMVVLGSICHLKAIIGSYKLMH 311

Query: 931 SQM 939
           S +
Sbjct: 312 SHI 314

>YDR492W Chr4 (1434924..1435874) [951 bp, 316 aa] {ON}  IZH1Membrane
           protein involved in zinc ion homeostasis, member of the
           four-protein IZH family; transcription is regulated
           directly by Zap1p, expression induced by zinc deficiency
           and fatty acids; deletion increases sensitivity to
           elevated zinc
          Length = 316

 Score =  272 bits (696), Expect = 7e-90
 Identities = 127/288 (44%), Positives = 194/288 (67%), Gaps = 2/288 (0%)
 Frame = +1

Query: 82  LNGSRIEERTRRRLYKWDEIPEWQKDNEHILNGYILETKSVGACLKSLLYLHNESVNIYT 261
           ++G  + E+ ++ L+ +DE+PEWQKDN+ IL GY+ ET S   CL SL Y +NE+VNIYT
Sbjct: 28  VSGQTVFEK-QKLLHNFDELPEWQKDNDKILTGYVRETLSWKKCLYSLFYWNNETVNIYT 86

Query: 262 HLIPGWCFLL--MTLFNQLAIERYETTRMIDYIMIDLFFLGGFTCLMMSSTFHCFKCHSL 435
           HL+P   + +  +TL N   I  + +T   DY +I++F +G F+CLM SS FHC K HS 
Sbjct: 87  HLVPAIVYFVFAITLTNYFLIPVFPSTSWSDYTVINIFLMGAFSCLMCSSCFHCMKQHSE 146

Query: 436 PVAVLGNKLDYLGIVALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLACTIVSLSDKF 615
             +   +KLDYLGI++L+  SM+ I+++G+ D+  YF +F+ +T++    CT+  L DKF
Sbjct: 147 KQSNFWSKLDYLGIISLISCSMIPIIYFGYFDHISYFSLFTIVTLVLATFCTVCVLHDKF 206

Query: 616 RSRDWRPYRAALFVAFGLSALFPVIAGICHYGFKVTWTRIQLKWVFLEGVFYILGALLYG 795
            +  +RP+RA  F+ FG S L P+  G   +G +    RI++ +VF E +FYI GA++YG
Sbjct: 207 NTSTFRPFRAMFFILFGFSGLLPLTTGFFKFGIQGVLNRIKVSFVFWEALFYISGAVIYG 266

Query: 796 VRFPERVAPGTFDIWGQSHQLFHVLVVIAASCHLRALLGAYKWVHSQM 939
            R PE +APG FD +G SHQ+FH++VV+ + CHL+A++ +YK +HS +
Sbjct: 267 FRIPETLAPGKFDFFGSSHQIFHIMVVLGSVCHLKAIIDSYKLMHSHI 314

>Suva_2.668 Chr2 (1186763..1187710) [948 bp, 315 aa] {ON} YDR492W
           (REAL)
          Length = 315

 Score =  271 bits (692), Expect = 3e-89
 Identities = 126/283 (44%), Positives = 189/283 (66%), Gaps = 2/283 (0%)
 Frame = +1

Query: 91  SRIEERTRRRLYKWDEIPEWQKDNEHILNGYILETKSVGACLKSLLYLHNESVNIYTHLI 270
           S++  R  + L+ + E+P+WQ+DN+ IL GY+ ET S   CL SL Y +NE+VNIYTHL+
Sbjct: 29  SKVTLRKEKLLHDFHELPDWQRDNDKILTGYVRETLSWKKCLYSLFYWNNETVNIYTHLV 88

Query: 271 PGWCFLL--MTLFNQLAIERYETTRMIDYIMIDLFFLGGFTCLMMSSTFHCFKCHSLPVA 444
           P   + +  +TL N   I  + +T   DY +I++F +G F CLM SS FHC K HS   +
Sbjct: 89  PAIVYFVFGVTLTNYFLIPVFPSTTWSDYTVINIFLMGAFLCLMCSSCFHCMKQHSEKQS 148

Query: 445 VLGNKLDYLGIVALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLACTIVSLSDKFRSR 624
              +KLDYLGI++L+  SM+ I+++G+ D+  YF +F+ +T++    CTI  L DKF + 
Sbjct: 149 DFWSKLDYLGIISLISCSMIPIIYFGYFDHASYFSLFTIVTLVLATFCTICVLHDKFNTS 208

Query: 625 DWRPYRAALFVAFGLSALFPVIAGICHYGFKVTWTRIQLKWVFLEGVFYILGALLYGVRF 804
            +RP+RA  F+ FG S L P+  G+  +G +    RI++ +VF E +FYI GAL+YG R 
Sbjct: 209 TFRPFRAMFFILFGFSGLLPLTTGLFKFGLQGVLNRIRVSFVFWEALFYISGALIYGFRI 268

Query: 805 PERVAPGTFDIWGQSHQLFHVLVVIAASCHLRALLGAYKWVHS 933
           PE +APG FD +G SHQ+FH++VV+ + CHL+A++ +YK +HS
Sbjct: 269 PETLAPGKFDFFGSSHQIFHIMVVLGSVCHLKAIIDSYKLMHS 311

>Ecym_3588 Chr3 (1117646..1118563) [918 bp, 305 aa] {ON} similar to
           Ashbya gossypii AFR337W
          Length = 305

 Score =  265 bits (677), Expect = 3e-87
 Identities = 132/275 (48%), Positives = 180/275 (65%), Gaps = 2/275 (0%)
 Frame = +1

Query: 115 RRLYKWDEIPEWQKDNEHILNGYILETKSVGACLKSLLYLHNESVNIYTHLIPGWC-FLL 291
           RRLY +DE+PEWQKDNE I  GY+ ET S   CLKS+ Y +NESVNIYTHL+P    F+L
Sbjct: 20  RRLYSFDELPEWQKDNELIRMGYVRETNSFLECLKSMTYFNNESVNIYTHLVPSVTYFIL 79

Query: 292 MTLFNQLAIE-RYETTRMIDYIMIDLFFLGGFTCLMMSSTFHCFKCHSLPVAVLGNKLDY 468
           + LF  L +   +  T M +YIMID +  G F CLM S+ FHC K HS     + +K+DY
Sbjct: 80  LLLFVDLVVTPMFPGTTMREYIMIDFYLFGVFVCLMCSTCFHCLKQHSESHNRIWSKVDY 139

Query: 469 LGIVALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLACTIVSLSDKFRSRDWRPYRAA 648
           +GI+  + +S+VSIL+YGF+D+  +    S LT+  G+ C    L+D+F + D+R  RA 
Sbjct: 140 IGIIVQITSSIVSILYYGFYDHISHIKWLSVLTLTLGVCCVTFVLNDRFNAIDYRLLRAI 199

Query: 649 LFVAFGLSALFPVIAGICHYGFKVTWTRIQLKWVFLEGVFYILGALLYGVRFPERVAPGT 828
            F  FG S + PV+ GI  +G      RIQLK+V    +FYI GAL+YG R PE +APG 
Sbjct: 200 FFTVFGFSGVVPVLIGIYQFGLIEWLARIQLKFVLAGTIFYIFGALIYGFRIPEALAPGK 259

Query: 829 FDIWGQSHQLFHVLVVIAASCHLRALLGAYKWVHS 933
           FD  G SHQ+FH+LVV+ + CH RA++G+Y ++ +
Sbjct: 260 FDFIGHSHQIFHLLVVLGSICHFRAVIGSYVFMRT 294

>TBLA0B02290 Chr2 complement(534472..535452) [981 bp, 326 aa] {ON}
           Anc_3.90 YOL101C
          Length = 326

 Score =  265 bits (677), Expect = 7e-87
 Identities = 125/277 (45%), Positives = 183/277 (66%), Gaps = 3/277 (1%)
 Frame = +1

Query: 121 LYKWDEIPEWQKDNEHILNGYILETKSVGACLKSLLYLHNESVNIYTHLIPGWCFLLMTL 300
           LY ++E+P WQ+DNE IL GYI ET S   CL+SL + HNE++NIY+H I    +LL+ +
Sbjct: 43  LYTYEELPSWQQDNEMILTGYIRETNSWKLCLRSLTFFHNETINIYSHGISAAIYLLLLV 102

Query: 301 F---NQLAIERYETTRMIDYIMIDLFFLGGFTCLMMSSTFHCFKCHSLPVAVLGNKLDYL 471
           F   N + +  + TT + DY+++D++ LG  TCL +SS FHC K HS   + + +K+DY+
Sbjct: 103 FFFTNLIYLPSFPTTTLHDYLVLDIYLLGAATCLTLSSCFHCLKQHSQSQSDIWSKMDYI 162

Query: 472 GIVALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLACTIVSLSDKFRSRDWRPYRAAL 651
           GI+ L+  S +S+L++G+ D+  YF  F+  T +  + CT+    +KF +RDW+  RA  
Sbjct: 163 GIICLITCSTISLLYFGYRDHFNYFKFFAISTFILAITCTVFVTMEKFNTRDWKHVRALF 222

Query: 652 FVAFGLSALFPVIAGICHYGFKVTWTRIQLKWVFLEGVFYILGALLYGVRFPERVAPGTF 831
           F+AF  S L P+I GI  +GF   W R+QL  + LE + Y++GALLYG R PE  APG F
Sbjct: 223 FIAFAGSGLIPLITGINIFGFPEVWQRVQLPSLTLELICYVIGALLYGYRIPEVFAPGKF 282

Query: 832 DIWGQSHQLFHVLVVIAASCHLRALLGAYKWVHSQML 942
           D  G SHQ FH+ VV+ +  HLRAL+G+Y ++HS +L
Sbjct: 283 DNIGNSHQWFHIFVVLGSLLHLRALVGSYYFMHSFLL 319

>KAFR0A08130 Chr1 (1638153..1639112) [960 bp, 319 aa] {ON} Anc_3.90
           YOL101C
          Length = 319

 Score =  254 bits (649), Expect = 9e-83
 Identities = 121/281 (43%), Positives = 178/281 (63%), Gaps = 6/281 (2%)
 Frame = +1

Query: 112 RRRLYKWDEIPEWQKDNEHILNGYILETKSVGACLKSLLYLHNESVNIYTHLIPGWCFLL 291
           +R LY + E+P WQ+DN+ IL GY+ ET S   C++SL YL+NES+NIY+HLIP   +L 
Sbjct: 36  KRILYHFHELPTWQQDNDKILGGYVRETNSFTKCIESLFYLNNESINIYSHLIPSLIYLT 95

Query: 292 MTLFNQLAIER------YETTRMIDYIMIDLFFLGGFTCLMMSSTFHCFKCHSLPVAVLG 453
           + +   + I++      Y TT   D+I I++F +G F CL+ S  FH  K HS       
Sbjct: 96  IAVMLLIEIDQFLNIPIYPTTTKYDFIFINIFLVGAFLCLLGSGCFHLLKQHSELQCNFW 155

Query: 454 NKLDYLGIVALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLACTIVSLSDKFRSRDWR 633
           +++DY+GI+ L+  SM+ +L+YGF D+ + FY F  LT+ F   C+I+ +S+ F    +R
Sbjct: 156 SRIDYMGIIVLISCSMMPVLYYGFFDHIVLFYCFITLTLAFASVCSIIVMSETFNLSKYR 215

Query: 634 PYRAALFVAFGLSALFPVIAGICHYGFKVTWTRIQLKWVFLEGVFYILGALLYGVRFPER 813
             RA +F AFG S L P+I G   +G    + RI LK++F E VFY++GA LYG R PE 
Sbjct: 216 LLRACVFAAFGFSGLIPMIVGFSKFGLSGVFQRISLKFIFWESVFYLVGATLYGFRIPES 275

Query: 814 VAPGTFDIWGQSHQLFHVLVVIAASCHLRALLGAYKWVHSQ 936
           + PG FD++G SHQLFH  VVI +  H +A++ +Y  +HS+
Sbjct: 276 ILPGKFDLFGSSHQLFHCFVVIGSVLHFKAVIESYILMHSR 316

>KNAG0K02160 Chr11 (436744..437715) [972 bp, 323 aa] {ON} Anc_3.90
           YOL101C
          Length = 323

 Score =  241 bits (614), Expect = 2e-77
 Identities = 125/320 (39%), Positives = 189/320 (59%), Gaps = 14/320 (4%)
 Frame = +1

Query: 22  KRKAVGIEPEGVMTEETTTLLNGSR-----------IEERTRRRLYKWDEIPEWQKDNEH 168
           +++AV +   G    ET T+  GSR                R RL +++E+P WQ+DN+ 
Sbjct: 6   RKRAVSL---GETAIETATVSRGSRGKLLVTGTSSGAPSGQRGRLCRYEELPAWQQDNDC 62

Query: 169 ILNGYILETKSVGACLKSLLYLHNESVNIYTHLIPGWCFLL--MTLFNQLAIERYETTRM 342
           I  GY+ ET SV  CL SLLY +NESVN+Y+HL+P   ++       +Q  + R+ TT  
Sbjct: 63  IRTGYVRETLSVRRCLGSLLYWNNESVNMYSHLVPAVLYIAGATLALSQWGVPRFPTTTW 122

Query: 343 IDYIMIDLFFLGGFTCLMMSSTFHCFKCHSLPVAVLGNKLDYLGIVALVVTSMVSILFYG 522
            DY++I+ F +G   CL+ SS FHC K HS       +++DY+GI+ L+  S + ++++G
Sbjct: 123 SDYLIINTFLVGAGACLLCSSLFHCLKQHSERHCEAWSRMDYMGIILLIACSTIPMIYFG 182

Query: 523 FHDNNLYFYVFSGLTIMFGLACTIVSLSDK-FRSRDWRPYRAALFVAFGLSALFPVIAGI 699
           + D   +  +F+ +T+  G+AC+ V L +K F S  ++  RAA F+AF  + L P+  G 
Sbjct: 183 YFDYMGHCLLFTAVTVALGVACSGVVLFNKQFNSSSFKLVRAAFFIAFAFNGLIPMATGF 242

Query: 700 CHYGFKVTWTRIQLKWVFLEGVFYILGALLYGVRFPERVAPGTFDIWGQSHQLFHVLVVI 879
             +G      RI LK+V+ E VFYI GA+LYG R PE   PG  D+WG SHQ+FHV+VV 
Sbjct: 243 VKFGIPGVLDRISLKYVWFEAVFYIAGAMLYGFRVPEIWIPGKVDLWGNSHQMFHVMVVF 302

Query: 880 AASCHLRALLGAYKWVHSQM 939
            + CHL+A+L +Y  +H  +
Sbjct: 303 GSLCHLKAVLESYSLMHRHL 322

>TBLA0B08255 Chr2 (1973757..1974647) [891 bp, 296 aa] {ON}
          Length = 296

 Score =  165 bits (417), Expect = 3e-48
 Identities = 99/294 (33%), Positives = 151/294 (51%), Gaps = 21/294 (7%)
 Frame = +1

Query: 118 RLYKWDEIPEWQKDNEHILNGYILETKSVGACLKSLLYLHNESVNIYTHLIPGWCFLLMT 297
           +L  ++++P+WQKDN  I+N Y+ ET S+   L S+   H+ES+NI+THLIP    LL  
Sbjct: 7   QLCNFNDLPDWQKDNPLIVNYYVRETNSLFKSLCSIFLFHSESMNIFTHLIPA---LLYA 63

Query: 298 LFNQLAIERYETTRMIDYIMIDLFFLGGFTCLMMSSTFHCFKCHSLPVAVLGNKLDYLGI 477
            F   AI    T   + Y ++  + +    C ++SS FH FKC S+       KLDY+GI
Sbjct: 64  KFTYNAIT---TLEQVSYPIV-FYLISVIICFLLSSLFHLFKCTSVQSNEFWGKLDYVGI 119

Query: 478 VALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLACTIVSLSDKFRSR----------- 624
             L+  ++VS+   GF+++       + +T    L   ++ L+ K   +           
Sbjct: 120 SLLINATIVSMALLGFNESRYTIMKNTFVTQTSCLTAYVIILAIKSHPKQGENEDDNDGT 179

Query: 625 ----------DWRPYRAALFVAFGLSALFPVIAGICHYGFKVTWTRIQLKWVFLEGVFYI 774
                     D +  RA LF + GLS L PVI G+  YG KV + +I +  V    + YI
Sbjct: 180 LSEDDDCCCDDHKGTRAKLFASLGLSGLIPVITGLYIYGPKVVYYKINIPMVIASVLCYI 239

Query: 775 LGALLYGVRFPERVAPGTFDIWGQSHQLFHVLVVIAASCHLRALLGAYKWVHSQ 936
           +G L+Y  + PE+  PG FD+ G SHQLFH+ +V    CH  A+  A  +  +Q
Sbjct: 240 VGTLIYVFKIPEKFYPGRFDLVGSSHQLFHIFIVFGTVCHYHAIQTAKNFALNQ 293

>NCAS0C04920 Chr3 complement(1003692..1004672) [981 bp, 326 aa] {ON}
           Anc_3.90
          Length = 326

 Score =  134 bits (338), Expect = 2e-36
 Identities = 81/271 (29%), Positives = 141/271 (52%), Gaps = 5/271 (1%)
 Frame = +1

Query: 136 EIPEWQKD--NEHILNGYILETKSVGACLKSLLYLHNESVNIYTHLIPGWCFLLMTLF-- 303
           E+P+WQK   N  I+NGY+ ET S+  CL ++ Y +N++VNI  + +    +  + LF  
Sbjct: 46  ELPQWQKQYSNSKIINGYVRETNSLIKCLHTVTYWNNQTVNIILNTVFSTVYFTLLLFFT 105

Query: 304 NQLAIERYETTRMIDYIMIDLFFLGGFTCLMMSSTFHCFKCHSLPVAVLGNKLDYLGIVA 483
           +   I     T M DYIM++ +  G F    ++S F+  + HSL    L  KL +L  + 
Sbjct: 106 DLYLIPSSPATTMSDYIMVNFYLFGAFQYFALNSIFYLLESHSLAKCHLWFKLSHLAFIN 165

Query: 484 LVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLACTIVSLSDKFRSRDWRPYRAALFVAF 663
            + TS+++ L+Y F DN  YF   +  T++      I +LS++F  ++ R  R  + + F
Sbjct: 166 YISTSIITQLYYTFFDNVFYFKFLTISTLLISSIFAIFTLSEQFLRKN-RSQRNMVSITF 224

Query: 664 GLSAL-FPVIAGICHYGFKVTWTRIQLKWVFLEGVFYILGALLYGVRFPERVAPGTFDIW 840
            +S L  P  + +  +       R++ K + LE   Y+    L  V+ PER +   FD  
Sbjct: 225 IVSLLILPTASLMFKFNTFRILRRVEGKAILLELSLYLFSMTLKAVQVPERFSE-NFDFI 283

Query: 841 GQSHQLFHVLVVIAASCHLRALLGAYKWVHS 933
           G S  ++H+ +++ +  H + LL +Y ++HS
Sbjct: 284 GNSENIYHICIILGSLLHFKMLLNSYFFMHS 314

>NDAI0G04300 Chr7 (1035664..1036620) [957 bp, 318 aa] {ON} Anc_3.90
          Length = 318

 Score =  133 bits (334), Expect = 7e-36
 Identities = 80/283 (28%), Positives = 139/283 (49%), Gaps = 4/283 (1%)
 Frame = +1

Query: 97  IEERTRRRLYKWDEIPEWQKD--NEHILNGYILETKSVGACLKSLLYLHNESVNIYTHLI 270
           I + + R  YK  E+PEWQ++  +  ++ G++ ET S   CL S +Y HN S+NI  + I
Sbjct: 25  ISKLSTRNHYKLKELPEWQREFNSGKVITGFLKETNSFKKCLWSTMYWHNSSINISLNGI 84

Query: 271 PGWCFLLMTLF--NQLAIERYETTRMIDYIMIDLFFLGGFTCLMMSSTFHCFKCHSLPVA 444
               + ++  F  +   I  + +T M DYI+++L+ L      M+ + F+  K HS   A
Sbjct: 85  AATVYFMLLFFFTDCYLIPSFPSTTMSDYIVLNLYLLTATQNFMVGTIFYIMKSHSKQQA 144

Query: 445 VLGNKLDYLGIVALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLACTIVSLSDKFRSR 624
            L  KL+ +G++  + +S+V++L+Y + D   YF  F+ +T++     T   +SD F   
Sbjct: 145 FLWYKLNNIGLINHIASSVVTLLYYHYFDYVFYFKFFTIVTLLLITLFTCSIISDSFNKM 204

Query: 625 DWRPYRAALFVAFGLSALFPVIAGICHYGFKVTWTRIQLKWVFLEGVFYILGALLYGVRF 804
                   L     L  L P +  I  +G      RI L  + LE   Y  G  +   + 
Sbjct: 205 TRIRKNFLLLAYIILLTLMPSLFAILRFGLAKVLERISLNLIILEIFIYAFGLTIRTSQL 264

Query: 805 PERVAPGTFDIWGQSHQLFHVLVVIAASCHLRALLGAYKWVHS 933
           PER    +FD  G S  ++ + +++ +  H + L+ +Y  +HS
Sbjct: 265 PERFF-NSFDFLGNSENVYQLSIIVCSFIHFKILMNSYCLMHS 306

>CAGL0I07491g Chr9 complement(719539..720444) [906 bp, 301 aa] {ON}
           similar to uniprot|Q03419 Saccharomyces cerevisiae
           YDR492w
          Length = 301

 Score =  100 bits (249), Expect = 8e-24
 Identities = 82/296 (27%), Positives = 143/296 (48%), Gaps = 15/296 (5%)
 Frame = +1

Query: 97  IEERT-RRRLYKWDEIPEWQK--DNEHILNGYILETKSVG-ACLKSLLYLHNESVNIYTH 264
           +E++T + ++   +++P W +   N  I  GY   T +    CL+ L+  +N+S++IY +
Sbjct: 1   MEKKTVQSKIVTLEKLPVWYRRYGNSRIKTGYFYYTNATYLGCLQKLVKFNNDSISIYMN 60

Query: 265 LIPGWCFLLMTLF--NQLAIERYETTRMIDYIMIDLFFLGGFTCLMMSSTFHCFKCHSLP 438
           L+ G    +M LF  +   I  + +T M DYI+I+LF +   T     +     K HS  
Sbjct: 61  LVCGLISGVMLLFYTDVRLIPSHPSTTMTDYIIINLFLMATTTYFATMTLGQLLKGHSEY 120

Query: 439 VAVLGNKLDYLGIVALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLACTIVSLSDKFR 618
              L N+   L +V L+  S+V++L+Y F D+   F +F   T +     +IV ++D+++
Sbjct: 121 QGKLWNQAKQLALVLLLTCSIVTLLYYAFFDHVFLFKLFVIWTCLLMSITSIVIINDQYK 180

Query: 619 SRDWRPYRAALFVAFG-LSALFPVIAGICHYGFKVTW--TRIQLKWVFLEGVFYILGALL 789
               R  + +  V FG LS   P+   I  +G   ++   RI  + +  E V Y L A+L
Sbjct: 181 ----RVQKLSCVVIFGVLSISLPIAVSIIKFGLFDSYKKQRIPFQVLTWEIVLYSLSAML 236

Query: 790 YGVRFPERVAPGTFD-IW-----GQSHQLFHVLVVIAASCHLRALLGAYKWVHSQM 939
              R PE       D  W     G S Q+  ++ + A   H   ++ AY+ VH+ +
Sbjct: 237 QLTRLPELTLSTLGDSFWIVDYLGNSDQVSQLVTIFAIIVHFNTIIFAYEVVHASI 292

>Suva_15.64 Chr15 complement(100035..100973) [939 bp, 312 aa] {ON}
           YOL101C (REAL)
          Length = 312

 Score = 94.7 bits (234), Expect = 1e-21
 Identities = 82/318 (25%), Positives = 149/318 (46%), Gaps = 8/318 (2%)
 Frame = +1

Query: 10  AGLTKRKAVGIEPEGVM---TEETTTLLNGSRIEERTRRRLYKWDEIPEWQKDNEHILNG 180
           A LT  +   +EP+      ++ T  + + + +E +  ++ + + ++ +WQK  ++    
Sbjct: 2   ASLTTVEQSPVEPKTATEKYSDATGAVTSNADVETKETKKGFPFHDLAKWQKQYKN---- 57

Query: 181 YILETKSVGACLKSLLYLHNESVNIYTHLIPGWCFLLMTLFNQLAIERYETTRMIDYIMI 360
                 S    L +L+YL   S++ +  LI    F L+ LF         TT M DYI+ 
Sbjct: 58  ----KSSRSESLVALIYLLG-SMSSFCLLIFFTDFYLIPLFPT-------TTTMTDYIVF 105

Query: 361 DLFFLGGFTCLMMSSTFHCFKCHSLPVAV-LGNKLDYLGIVALVVTSMVSILFYGFHDNN 537
           + + L  F   M+   +H  K  SL   + +  K  YL  + L+++S ++IL+Y F+D  
Sbjct: 106 NFYLLNVFVFCMIHFIYHFIKNISLQQHIEIWQKFSYLANINLLISSQITILYYLFYDYV 165

Query: 538 LYFYVFSGLTIMFGLACTIVSLSDKFRSRDWRPYRAALFVAFG-LSALFPVIAGICHY-G 711
            +F +F+ L    GLA   V L+DK  S   R  +   F++   +    P++  I  + G
Sbjct: 166 FFFKIFTLLMTFIGLAAYFVILTDKLNSYK-RFNKTVFFISVSVVCCSLPLLTAIITFDG 224

Query: 712 FKVTWTRIQLKWVFLEGVFYILGALLYGVRFPERVAPGT--FDIWGQSHQLFHVLVVIAA 885
            +    RI+L  +  E V  ++ +++Y  RFPE +       + W  S   FH+L+   A
Sbjct: 225 LENLKDRIKLNAITWELVTLVVASMIYVTRFPESLCRRNEKEEGWNHSEYFFHLLISGTA 284

Query: 886 SCHLRALLGAYKWVHSQM 939
             H   L+ +Y  +HS +
Sbjct: 285 FYHFFILIQSYILMHSSL 302

>KLLA0F15510g Chr6 (1433494..1435362) [1869 bp, 622 aa] {ON} some
            similarities with uniprot|Q07959 Saccharomyces cerevisiae
            YLR023C IZH3 Membrane protein involved in zinc metabolism
            member of the four-protein IZH family expression induced
            by zinc deficiency deletion reduces sensitivity to
            elevated zinc and shortens lag phase overexpression
            reduces Zap1p activity
          Length = 622

 Score = 85.5 bits (210), Expect = 1e-17
 Identities = 80/308 (25%), Positives = 137/308 (44%), Gaps = 19/308 (6%)
 Frame = +1

Query: 64   EETTTLLNGSRIEERTRRRLYKWDEIPEWQKDNEHILNGYILETKSVGACLKSLLYL--H 237
            ++T    N     +  R+R   + E+P   ++N +I++GY      V + L  + +   H
Sbjct: 279  KKTIQFYNWDNACDLGRQRHLHFYELPFPWRENRYIIHGYRFYDSHVKSVLSVVNWYGWH 338

Query: 238  NESVNIYTHLIPGWCFLLMTLFNQLAIERY---ETTRMIDYIMIDLFFLGGFTCLMMSST 408
            NE++NI++HL  G  +L   LF QL   +    +   +   ++I +F + G  CL+ SS 
Sbjct: 339  NETLNIWSHLF-GAVYLAYLLFIQLPTTKVFMSQDVPLFGKLIIQVFLIAGVKCLLSSSV 397

Query: 409  FHCFK--CHSLPVAVLGNKLDYLGIVALVVTSMVSILFYGFHDN-----NLYFYVFSGLT 567
            +H     C  LP+      +DY GI  L+  S++S  F   ++      +    V+  L+
Sbjct: 398  WHTLNGTC-CLPLRCKFACIDYTGITVLITASILSTEFVSVYNLATQSLSTSMTVYMSLS 456

Query: 568  IMFGLACTIVSLSDKFRSRDWRPYRAALFVAF-GLSAL----FPVIAGICHYG--FKVTW 726
            +  G+  + ++ S +F   + RP+R A +V   GL  +      +  GI H    FK  W
Sbjct: 457  LCLGIFGSFMNWSPRFDRPESRPFRIAFYVLLAGLGMISFLHLTISRGIDHSSQFFKPVW 516

Query: 727  TRIQLKWVFLEGVFYILGALLYGVRFPERVAPGTFDIWGQSHQLFHVLVVIAASCHLRAL 906
             R  L W       Y++G + YG   PER        W    +L + +   A  C    +
Sbjct: 517  NR-SLIW-------YLIGVVFYGSFIPER--------WRTDVELDYTIPTDAELCSNLDI 560

Query: 907  LGAYKWVH 930
            L  +K VH
Sbjct: 561  LTKHKHVH 568

>Skud_15.53 Chr15 complement(86339..87277) [939 bp, 312 aa] {ON}
           YOL101C (REAL)
          Length = 312

 Score = 83.6 bits (205), Expect = 1e-17
 Identities = 79/304 (25%), Positives = 140/304 (46%), Gaps = 7/304 (2%)
 Frame = +1

Query: 49  EGVMTEETTTLLNGSRIEERTR--RRLYKWDEIPEWQKDNEHILNGYILETKSVGACLKS 222
           +G  T ETT     S ++  T+  ++ + + ++ +WQ+   +          S    L +
Sbjct: 20  KGNGTGETTN----SNVDAETKEIKKGFPFHDLAKWQQQYRN--------KSSRNESLVA 67

Query: 223 LLYLHNESVNIYTHLIPGWCFLLMTLFNQLAIERYETTRMIDYIMIDLFFLGGFTCLMMS 402
           L+YL   S++ +  LI    F L+ LF         TT M DYI+ + + L  F   M+ 
Sbjct: 68  LIYLLG-SMSSFCLLIFFTDFYLIPLFPT-------TTTMTDYIVFNFYLLNVFVFCMVH 119

Query: 403 STFHCFKCHSLPVAVLG-NKLDYLGIVALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFG 579
             +H  K  SL   +    K  YL  + L+++S ++IL+Y F+D   +F +F+ L    G
Sbjct: 120 FVYHFIKNISLQQHLEHWQKFSYLSNINLLISSQITILYYLFYDYVFFFKIFTLLMNFIG 179

Query: 580 LACTIVSLSDKFRSRDWRPYRAALFVAFG-LSALFPVIAGICHY-GFKVTWTRIQLKWVF 753
           L      L+DK  S   R  +   F++   +    P++  I  + G +    RI++K + 
Sbjct: 180 LVAYFFILTDKLNSSK-RFNKTVFFISVSVVCCSLPLLTAIITFDGLENLKERIKVKAIT 238

Query: 754 LEGVFYILGALLYGVRFPERV--APGTFDIWGQSHQLFHVLVVIAASCHLRALLGAYKWV 927
            E V  +  +++Y  RFPE +       + W  S  LFH+++   A  H   L+ +Y  +
Sbjct: 239 CELVALVAASIIYVTRFPESLFRRNKKEESWNHSEYLFHLVISGTAFYHFFILIQSYILM 298

Query: 928 HSQM 939
           HS +
Sbjct: 299 HSSL 302

>Smik_15.56 Chr15 complement(90083..91021) [939 bp, 312 aa] {ON}
           YOL101C (REAL)
          Length = 312

 Score = 80.1 bits (196), Expect = 2e-16
 Identities = 67/242 (27%), Positives = 112/242 (46%), Gaps = 8/242 (3%)
 Frame = +1

Query: 238 NESVNIYTHLIPGWC-FLLMTLFNQLAIERY--ETTRMIDYIMIDLFFLGGFTCLMMSST 408
           NESV    +L+     F L+  F    +      TT M DYI+ + + L  F   M+   
Sbjct: 62  NESVVALIYLLGSMLSFCLLIFFTDFYLIPLFPTTTTMTDYIVFNFYLLNVFVFCMVHFI 121

Query: 409 FHCFKCHSLPVAVLG-NKLDYLGIVALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLA 585
           +H  K  SL   +    K  YL  + L+++S ++IL+Y F+D   +F +F+ L    GL 
Sbjct: 122 YHFIKNISLQQHLEHWQKFSYLSNINLLISSQITILYYLFYDYVFFFKIFTLLMNFIGLV 181

Query: 586 CTIVSLSDKFRSRDWRPYRAALFVAFG-LSALFPVIAGICHY-GFKVTWTRIQLKWVFLE 759
                L+DK  S   R  +   F++   +    P++  I  + G +    RI++  +  E
Sbjct: 182 AYFFILTDKLISSK-RFNKTVFFISVSVICCSLPLLTAIITFDGLENLKERIKVNAITWE 240

Query: 760 GVFYILGALLYGVRFPERVAPG--TFDIWGQSHQLFHVLVVIAASCHLRALLGAYKWVHS 933
            V  +  +++Y  RFPE    G    + W  S  LFH+++  AA  H   L+ +Y  +HS
Sbjct: 241 LVALVAASIIYVTRFPELFLRGKKKEEGWNHSEYLFHLIISGAAFYHFFILIQSYILMHS 300

Query: 934 QM 939
            +
Sbjct: 301 SL 302

>Kpol_2002.94 s2002 (229517..231250) [1734 bp, 577 aa] {ON}
           (229517..231250) [1734 nt, 578 aa]
          Length = 577

 Score = 80.5 bits (197), Expect = 5e-16
 Identities = 62/238 (26%), Positives = 106/238 (44%), Gaps = 12/238 (5%)
 Frame = +1

Query: 136 EIPEWQKDNEHILNGYILETKSVGACLKSLLY--LHNESVNIYTHLIPGWCFLLMTLFN- 306
           ++P   ++N +I+NGY    K+    L    +   HNE+ NI++HL+    F  + LF  
Sbjct: 255 QLPFPWRENRYIINGYRFYHKNSKLLLSVFNWYGFHNETANIWSHLLGAIYFAYIVLFEF 314

Query: 307 --QLAIERYETTRMIDYIMIDLFFLGGFTCLMMSSTFHCFK--CHSLPVAVLGNKLDYLG 474
                ++  E      YI+  LF L G  C++ S  +H F   C S+ +      +DY G
Sbjct: 315 PKSFIVQSPEVPPSAKYIVY-LFLLAGIKCMLASVFWHTFNGTC-SIKLRPKYCCVDYSG 372

Query: 475 IVALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLACTIVSLSDKFRSRDWRPYRAALF 654
           I  L+  S+++  F   +D+     V+  L+++FG     ++ S KF S + RP R   F
Sbjct: 373 ITILITASILTAEFVSLYDHRSIMTVYMSLSLLFGCFGLYLNWSPKFDSPEARPLRIKFF 432

Query: 655 VAFGLSALFPVIAGICHYGFKVTWTRIQLKWVF-----LEGVFYILGALLYGVRFPER 813
           +      L   + G+  +            W++        V+Y++G   YG   PER
Sbjct: 433 I------LLAALGGLAFFHVAYLEGMAYAAWLYSPVTSKSIVWYLIGVFFYGSFIPER 484

>YOL101C Chr15 complement(126982..127920) [939 bp, 312 aa] {ON}
           IZH4Membrane protein involved in zinc ion homeostasis,
           member of the four-protein IZH family, expression
           induced by fatty acids and altered zinc levels; deletion
           reduces sensitivity to excess zinc; possible role in
           sterol metabolism
          Length = 312

 Score = 76.3 bits (186), Expect = 5e-15
 Identities = 58/208 (27%), Positives = 99/208 (47%), Gaps = 5/208 (2%)
 Frame = +1

Query: 331 TTRMIDYIMIDLFFLGGFTCLMMSSTFHCFKCHSLPVAVLG-NKLDYLGIVALVVTSMVS 507
           TT M DYI+ + + L  F   M+   +H  K  SL   +    K  YL  + L+++S ++
Sbjct: 96  TTTMTDYIVFNFYLLNVFVFCMVHFIYHFVKNISLQQHLEHWQKFSYLSNINLLISSQIT 155

Query: 508 ILFYGFHDNNLYFYVFSGLTIMFGLACTIVSLSDKFRSRDWRPYRAALFVAFG-LSALFP 684
           IL+Y F+D   +F +F+ L    GL      L+DK  S   R  +   F++   +    P
Sbjct: 156 ILYYLFYDYVFFFKIFTLLMNFIGLVAYFFILTDKLISSK-RFNKTVFFISVSVVCCSLP 214

Query: 685 VIAGICHY-GFKVTWTRIQLKWVFLEGVFYILGALLYGVRFPERV--APGTFDIWGQSHQ 855
           ++  I  + G +    RI++  +  E V  +  +++Y  RFPE +       + W  S  
Sbjct: 215 LLTAIITFDGLENLKERIKVNAITWELVALVAASIIYVTRFPESLFRRNKKEEGWNHSEY 274

Query: 856 LFHVLVVIAASCHLRALLGAYKWVHSQM 939
           LFH+L+   A  H   L+ +Y  +HS +
Sbjct: 275 LFHLLISGTAFYHFFILIQSYILMHSSL 302

>AAL153C Chr1 complement(75086..76345) [1260 bp, 419 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YLR023C
          Length = 419

 Score = 74.3 bits (181), Expect = 4e-14
 Identities = 87/320 (27%), Positives = 134/320 (41%), Gaps = 50/320 (15%)
 Frame = +1

Query: 100  EERTR---RRLYKWDEIPEWQKDNEHILNG---YILETKSVGACLKSLLYLHNESVNIYT 261
            E R R   R L+ W E+P   ++N +I+ G   Y    KS+ + L +  + HNE++NI++
Sbjct: 95   ESRARGLARHLHYW-ELPYAWRENRYIIYGHRFYHSHRKSLLSVLNAYGW-HNETINIWS 152

Query: 262  HLIPG--WCFLLMTLFNQLAIERYETTRMIDYIMIDLFFLGGFTCLMMSSTFHCFK--CH 429
            HL+      +LL   + +  + R      +    I  F   G  C+  S  +H F   CH
Sbjct: 153  HLVGAAVLAYLLCWGWPRSDVYRAAQVPRLAKWAIGAFLACGVKCMASSVAWHTFNGTCH 212

Query: 430  SLPVAVLGNKLDYLGIVALVVTSM---VSILFYGFHDNNLYFYVFSGLTIMFGLACTIVS 600
             L +      +DY GI  LV  S+   V++  YG     +Y Y+ +  +I  G A  +++
Sbjct: 213  -LKLRSRFVCVDYTGITLLVTASVVTTVAVTLYGLSRPLMYAYMVA--SIGLGTAAGVMN 269

Query: 601  LSDKFRSRDWRPYRAALFVAFGLSALFPVIAGICHYGFKVTWTRIQL--KWVFLEGVFYI 774
             S  F   + RP R A++V  GL+AL   +    H   +V W    L    V+   V+Y 
Sbjct: 270  WSPHFDRPEARPLRIAVYV--GLAAL--GLVSFVHVWMQVRWASAHLMAPLVYKSLVWYG 325

Query: 775  LGALLYGVRFPER---------------------------VAPGTFDIWG--------QS 849
            +G + Y    PER                           VA      W          S
Sbjct: 326  IGVVFYATLVPERWRSDVTLDCCSGPVHEAACRQFRDLPPVARKDRQFWSLWWVDYFCHS 385

Query: 850  HQLFHVLVVIAASCHLRALL 909
            H L+HV VV+    H RA+L
Sbjct: 386  HFLWHVFVVLGVVGHYRAVL 405

>KAFR0J00670 Chr10 (120378..121907) [1530 bp, 509 aa] {ON} Anc_5.197
           YLR023C
          Length = 509

 Score = 74.3 bits (181), Expect = 5e-14
 Identities = 63/234 (26%), Positives = 109/234 (46%), Gaps = 8/234 (3%)
 Frame = +1

Query: 136 EIPEWQKDNEHILNGYILETKSVGACLKSLLYLHNESVNIYTHLIPGWCFLLMTLFNQLA 315
           ++P   ++N +I+N Y        + L S+  LHNE+ NI++HL+ G  + L  LF+ L 
Sbjct: 197 QLPFPYRENRYIINNYRFYDSHKKSLL-SIFKLHNEATNIWSHLL-GAIYFLYVLFHDLP 254

Query: 316 IERYETTRMID---YIMIDLFFLGGFTCLMMSSTFHCFKCHSLPVAVLGNK---LDYLGI 477
                ++ M+     + + LF      C++ S+ +H F   S+    L  K   +DY GI
Sbjct: 255 NSIIVSSSMVPTTAKLFLYLFVFASLKCMLSSTFYHTFNGTSM--LKLRRKFMCVDYSGI 312

Query: 478 VALVVTSMVSILFYGFHD--NNLYFYVFSGLTIMFGLACTIVSLSDKFRSRDWRPYRAAL 651
             L+ +S++SI F   +D  N L FY+ +  + M G+    ++ S  F S + RP R   
Sbjct: 313 SILITSSILSIQFISLYDYPNILKFYMCA--SFMLGVLGIFMNWSPLFDSPEARPLRIKF 370

Query: 652 FVAFGLSALFPVIAGICHYGFKVTWTRIQLKWVFLEGVFYILGALLYGVRFPER 813
           F+       F ++  +           + L       V+Y++G + YG   PER
Sbjct: 371 FILLSSCGAFALLHLVFLEKSIFAAIDVLLPLTNKSIVWYLVGVVFYGSFIPER 424

>TPHA0E03120 Chr5 complement(654079..655788) [1710 bp, 569 aa] {ON}
           Anc_5.197 YLR023C
          Length = 569

 Score = 71.2 bits (173), Expect = 5e-13
 Identities = 64/249 (25%), Positives = 110/249 (44%), Gaps = 15/249 (6%)
 Frame = +1

Query: 112 RRRLYKWDEIPEWQKDNEHILNGYILETKSVGACLKSLLY--LHNESVNIYTHLIPGW-- 279
           + R   + E+P   ++N++I++GY    K     L    +  +HNE+ NI+TH++  +  
Sbjct: 240 KERHLHYYELPFPWRENKYIIHGYRFHDKFYQLILSVFNWYGVHNETTNIWTHMLAAFYL 299

Query: 280 CFLLMTLFNQ--LAIERYETTRMIDYIMIDLFFLGGFTCLMMSSTFHCFK-CHSLPVAVL 450
            +LL   F +  + ++         YI I +F   G  C+  S  +H F    S+ +   
Sbjct: 300 IYLLTVDFQKTFIVLDTEHVPATTKYI-IYMFLGAGIKCMFASVFWHTFNGTTSIRLRPK 358

Query: 451 GNKLDYLGIVALVVTSMVS---ILFYGFHDNNLYFYVFSGLTIMFGLACTIVSLSDKFRS 621
              +DY GI  L+  S++S   I  Y +     ++ + SG+  +FGL    ++ S KF S
Sbjct: 359 FCCVDYTGITLLISASIMSAEYITLYDYPKAMSFYMILSGIFAVFGL---YLNWSPKFDS 415

Query: 622 RDWRPYRAALFVAFGLSALFPVIAGICHYGFKVTWTRIQLKWVF-----LEGVFYILGAL 786
            + RP R   FV          +  +C  G        +  W+F        ++YI+G  
Sbjct: 416 PEARPLRIKFFVLLAAVGGLSFVNLVCLEGLS------RAIWLFSPVTNKSVIYYIIGVF 469

Query: 787 LYGVRFPER 813
            YG   PER
Sbjct: 470 FYGSFIPER 478

>KLTH0B03498g Chr2 complement(281148..282788) [1641 bp, 546 aa] {ON}
           some similarities with uniprot|Q07959 Saccharomyces
           cerevisiae YLR023C IZH3 Membrane protein involved in
           zinc metabolism member of the four-protein IZH family
           expression induced by zinc deficiency deletion reduces
           sensitivity to elevated zinc and shortens lag phase
           overexpression reduces Zap1p activity
          Length = 546

 Score = 70.9 bits (172), Expect = 7e-13
 Identities = 68/250 (27%), Positives = 113/250 (45%), Gaps = 16/250 (6%)
 Frame = +1

Query: 112 RRRLYKWDEIPEWQKDNEHILNGYILETKSVGACLKSLLYL------HNESVNIYTHLIP 273
           ++R   + E+P   ++N  I++GY    +   +  KSLL +      HNE+VNI+THL  
Sbjct: 211 QQRHLHYYELPFPWRENRFIIHGY----RFYNSYSKSLLSIFNWYGWHNETVNIWTHLCG 266

Query: 274 G--WCFLLMTLFNQLAIERYETTRMIDYIMIDLFFLGGFTCLMMSSTFHCFK--CHSLPV 441
              + FL+   F+Q  + + E        M  +F   G  C + S  +H F   CH L  
Sbjct: 267 ALYFAFLIFKGFSQTTVYQSELVPTAAKFMAFVFLTAGLECFLFSVVWHTFNGICH-LKQ 325

Query: 442 AVLGNKLDYLGIVALVVTSMVSILFY---GFHDNNLYFYV--FSGLTIMFGLACTIVSLS 606
                 +DY GI  LV  S+++  F    G  D    + +  F+G +   G     ++ S
Sbjct: 326 RSNCACVDYTGITVLVTASILTTEFVTLSGSSDATFTWSLLFFTGASAALGAVGVFMNWS 385

Query: 607 DKFRSRDWRPYRAALFVAFGLSALFPVIAGICHYGFKVTWTRIQLKWVFLEGV-FYILGA 783
            KF   + RP R A ++       F  +     +   V  + + +K VF++ + +YI+G 
Sbjct: 386 PKFDRPESRPLRIAFYLLLASFGFFSYLHSRL-FNTAVDSSDL-IKPVFMKSLAWYIIGV 443

Query: 784 LLYGVRFPER 813
           + YG   PER
Sbjct: 444 VFYGTFIPER 453

>KNAG0K00670 Chr11 complement(119419..120384) [966 bp, 321 aa] {ON} 
          Length = 321

 Score = 68.2 bits (165), Expect = 3e-12
 Identities = 47/213 (22%), Positives = 96/213 (45%), Gaps = 6/213 (2%)
 Frame = +1

Query: 283 FLLMTLFNQL-AIERYETTRMIDYIMIDLFFLGGFTCLMMSSTFHCFKCHSLP--VAVLG 453
           F+L+  F  +  + R+ +T M DY+++++F         +++ F C  CH +       G
Sbjct: 107 FVLLVFFTDVYLVPRHVSTTMTDYVLLNVF---------LATAFQCAACHMVQCFTTTAG 157

Query: 454 NKLDYLGIVALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGL---ACTIVSLSDKFRSR 624
           + L  + ++     S V++L+Y ++DN  YF + +  T  + L   A T+ S +     R
Sbjct: 158 SVLSTITMLNHWACSAVTLLYYSYYDNVFYFKLLALFTANWTLVVAAVTVTSTASNSPKR 217

Query: 625 DWRPYRAALFVAFGLSALFPVIAGICHYGFKVTWTRIQLKWVFLEGVFYILGALLYGVRF 804
            W   R  L V   +    P++ G+  +G      R+  + +  E   Y++  + YG   
Sbjct: 218 QWWSRRTLLLVYVVVLVSVPLVVGLLRFGTAKVLRRLDWRLLLAELAVYLISGVFYGGTE 277

Query: 805 PERVAPGTFDIWGQSHQLFHVLVVIAASCHLRA 903
            + +    F +   +  L H+ +++ A   +RA
Sbjct: 278 KDTLPKLPFYVAFHTASLIHLQLLLNAFHLMRA 310

>Ecym_7109 Chr7 complement(210829..212535) [1707 bp, 568 aa] {ON}
           similar to Ashbya gossypii AAL153C
          Length = 568

 Score = 67.0 bits (162), Expect = 1e-11
 Identities = 62/247 (25%), Positives = 113/247 (45%), Gaps = 13/247 (5%)
 Frame = +1

Query: 112 RRRLYKWDEIPEWQKDNEHILNG---YILETKSVGACLKSLLYLHNESVNIYTHLIPGWC 282
           R R   + E+P+  ++N +I+ G   Y    KS+ + L ++   HNE++NI++H+     
Sbjct: 236 RARHLHYYELPQPWRENPYIIYGHRFYHSHKKSLLSIL-NVYGWHNETINIWSHIAGAII 294

Query: 283 FLLMTLFNQLAIERYETTRM--IDYIMIDLFFLGGFTCLMMSSTFHCFK--CHSLPVAVL 450
            L + L      + + +T++  +    I +F L G  C++ S  +H F   CH LP+   
Sbjct: 295 LLYIMLRGFPNSDVFNSTQVPKVAKGAIYVFLLCGIKCMVSSVMWHTFSGTCH-LPLRSR 353

Query: 451 GNKLDYLGIVALVVTSMV---SILFYGFHDNNLYFYVFSGLTIMFGLACTIVSLSDKFRS 621
            + +DY GI  L+  S++   +   Y      +Y Y+  G+++  G+     + S +F  
Sbjct: 354 FSCVDYTGITILITASVMTTEAFTLYRLAPKAMYLYM--GISLCLGVFAAFTNWSRRFDG 411

Query: 622 RDWRPYRAALFVAFGLSALFPVIAGICHYGFKVTWTRIQLKWVFLEG---VFYILGALLY 792
            D R +R A +V      L   +    H      W+  +L    L     V+Y++G + Y
Sbjct: 412 PDSRIFRVAFYVILAGLGLISFV----HLTVHSDWSSSRLMITPLINKSIVWYLIGVVFY 467

Query: 793 GVRFPER 813
               PER
Sbjct: 468 ATLVPER 474

>TBLA0C06050 Chr3 (1468152..1469465) [1314 bp, 437 aa] {ON}
           Anc_5.197 YLR023C
          Length = 437

 Score = 65.5 bits (158), Expect = 4e-11
 Identities = 50/232 (21%), Positives = 101/232 (43%), Gaps = 6/232 (2%)
 Frame = +1

Query: 136 EIPEWQKDNEHILNGYILETKSVGACLKSLLYL--HNESVNIYTHLIPGWCFLLMTLFNQ 309
           ++P   ++N +I+ GY     +V   L  + Y   HNE++NI++HL      L + +F  
Sbjct: 118 QLPFPWRENRYIIKGYRFYDSNVKCLLSVVNYYGWHNETLNIWSHLGGFLTLLYIAVFVY 177

Query: 310 LAIERYETTRM--IDYIMIDLFFLGGFTCLMMSSTFHCFK-CHSLPVAVLGNKLDYLGIV 480
              E Y++  +     +++ +F + G  C++ S  +H F    S  +      +DY GI 
Sbjct: 178 PNTEVYQSELIPTTAKMLLFVFLIAGMKCMLASVFWHTFDGTCSYTLRPKFCCVDYTGIT 237

Query: 481 ALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLACTIVSLSDKFRSRDWRPYRAALFVA 660
            L+  S+++  +       ++ +++  L++  G     ++ S KF   + RP R   FV 
Sbjct: 238 ILITASILTAEYVSLSHAPIWMFIYMSLSLALGTFGVYINWSPKFDGPEARPLRIKFFVT 297

Query: 661 FGLSALFPVIAGICHYGFK-VTWTRIQLKWVFLEGVFYILGALLYGVRFPER 813
                    +  I     +   W    +  +    ++Y++G   YG   PE+
Sbjct: 298 LSAMGCLSFVHLIFTTSLRHACWLLAPI--ISKSTIWYVIGVFFYGSFIPEK 347

>Kwal_33.15122 s33 (968885..970585) [1701 bp, 566 aa] {ON} YLR023C -
           Hypothetical ORF [contig 94] FULL
          Length = 566

 Score = 63.5 bits (153), Expect = 2e-10
 Identities = 68/246 (27%), Positives = 108/246 (43%), Gaps = 20/246 (8%)
 Frame = +1

Query: 136 EIPEWQKDNEHILNGYILETKSVGACLKSLLYL------HNESVNIYTHLIPGW--CFLL 291
           E+P   ++N  I++GY    +   +  KSLL +      HNE+VNI+THL       +LL
Sbjct: 239 ELPFPWRENRFIIHGY----RFYNSYKKSLLSIFNWYGWHNETVNIWTHLGGALYLAYLL 294

Query: 292 MTLFNQLAIERYETTRMIDYIMIDLFFLGGFTCLMMSSTFHCFK--CHSLPVAVLGNKLD 465
              F+Q A+ + E        M  +F L G  C + S  +H F   CH L        +D
Sbjct: 295 FRGFSQTAVYQSELVPTAAKCMAFVFLLSGLECFLFSVVWHTFNGICH-LQQRSNCACVD 353

Query: 466 YLGIVALVVTSMVSILFY--------GFHDNNLYFYVFSGLTIMFGLACTIVSLSDKFRS 621
           Y GI  LV  S+++  F          F  + L+F   S +    G+    ++ S KF  
Sbjct: 354 YTGITILVTASILTTEFVTLSGAAEAPFTWSLLFFTTTSSI---LGVIGVYMNWSPKFDR 410

Query: 622 RDWRPYRAALFVAFGLSALFPVI-AGICHYGFKVTWTRIQLKWVFLEGV-FYILGALLYG 795
            + RP R A ++       F  + + I H       +   +K V  + + +Y++G + YG
Sbjct: 411 PESRPLRIAFYLLLASFGFFSYLHSRIFHTSIS---SSELIKPVLSKSLAWYLIGVVFYG 467

Query: 796 VRFPER 813
              PER
Sbjct: 468 TFIPER 473

>KNAG0B05100 Chr2 (976101..977717) [1617 bp, 538 aa] {ON} Anc_5.197
            YLR023C
          Length = 538

 Score = 63.2 bits (152), Expect = 2e-10
 Identities = 67/344 (19%), Positives = 135/344 (39%), Gaps = 56/344 (16%)
 Frame = +1

Query: 64   EETTTLLNGSRIEERTRRRLYKWDEIPEWQKDNEHILNGYILETKSVGACLKSLLYL--H 237
            E   T  N     +  R +L  + E+P   ++N +I++ Y     +V + L ++ +   H
Sbjct: 197  EALITAYNHDVAFQEGREKLLHYYELPFPWRENRYIIHNYRFYDSNVKSLLSAINWYGWH 256

Query: 238  NESVNIYTHLIPGW--CFLLMTLFNQLAIERYETTRMIDYIMIDLFFLGGFTCLMMSSTF 411
            NE+ NI++H +  +   +L +  F Q  + + +        ++ +F      CL+ S+ +
Sbjct: 257  NETSNIWSHFLGFFYVVYLAVYEFPQSVVFQSDRIPSSAKFVVYIFLFAAMKCLIASAFW 316

Query: 412  HCFKCHS-LPVAVLGNKLDYLGIVALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLAC 588
            H F   + L +      +DY GI  L+  S+++  F   +D+     ++  +++  G+  
Sbjct: 317  HTFNGTAFLKMRRRFACVDYSGISILITASILTAEFVTLNDHRPMMILYMTISLTLGIIG 376

Query: 589  TIVSLSDKFRSRDWRPYRAALFVAFGLSALFPVIAGICHYGFKVTWT-RIQLKWVFLEG- 762
              ++ S +F + + RP R   F+      +   I    +  +  +W   + L        
Sbjct: 377  VFLNCSPQFDTPEARPLRIRFFMLLAAMGVLSFI----NASYLESWAYAVDLLSPITNKS 432

Query: 763  -VFYILGALLYGVRFPERV----------------------------------------- 816
             V+Y++G + YG   PER                                          
Sbjct: 433  IVWYLVGVVFYGSFIPERFRTDVVVDDRIPTTFQLGTDLDIITKDKEIHFRHKPTCCHHP 492

Query: 817  APGTFDIW-----GQSHQLFHVLVVIAASCHLRALLGAY--KWV 927
              G F  W     G SH  +H+ VV+    H +A++  +  KW+
Sbjct: 493  RKGIFSCWWVDYVGCSHTFWHIFVVLGVVGHYKAIIDMFTTKWL 536

>NCAS0D02600 Chr4 (499689..501320) [1632 bp, 543 aa] {ON} Anc_5.197
           YLR023C
          Length = 543

 Score = 62.4 bits (150), Expect = 4e-10
 Identities = 57/238 (23%), Positives = 102/238 (42%), Gaps = 12/238 (5%)
 Frame = +1

Query: 136 EIPEWQKDNEHILNGYILETKSVGACLKSLLYL------HNESVNIYTHLIPGWCFLLMT 297
           ++P   ++N +I+  Y    +   +  KSLL +      HNE+ NI+THLI G   + M 
Sbjct: 220 QLPFPWRENRYIIYNY----RFYDSHKKSLLSIFNWYGWHNETSNIWTHLIGGLYLIYMA 275

Query: 298 LFNQLAIERYETTRM--IDYIMIDLFFLGGFTCLMMSSTFHCFK-CHSLPVAVLGNKLDY 468
           +++    E + + ++     +++ LF      CL  S  +H F    +L +      +DY
Sbjct: 276 VYDFPRSEIFLSDKIPTTAKLIVYLFLFAAIKCLFASVFWHSFNGTCTLKLRSKFACVDY 335

Query: 469 LGIVALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLACTIVSLSDKFRSRDWRPYRAA 648
            GI  L+  S+++  F   + +     V+  +++  G+    ++ S KF   + RP R  
Sbjct: 336 SGISILITASILTTEFVTLYSSYRAMCVYMAISLSLGIFGVFMNWSPKFDRPEARPLRIK 395

Query: 649 LFVAFGLSALFPVIAGICHYGFKVTW---TRIQLKWVFLEGVFYILGALLYGVRFPER 813
            FV          +    H  F   W   T +         V+Y +G + YG   PER
Sbjct: 396 FFVLLASMG----VLSFLHLTFLTDWKYATWLLAPVTNKSIVWYCIGVVFYGSFIPER 449

>TDEL0E04320 Chr5 complement(804655..806007) [1353 bp, 450 aa] {ON}
           Anc_5.197 YLR023C
          Length = 450

 Score = 61.6 bits (148), Expect = 7e-10
 Identities = 63/256 (24%), Positives = 112/256 (43%), Gaps = 15/256 (5%)
 Frame = +1

Query: 91  SRIEERTRRRLYKWDEIPEWQKDNEHILNGYILETKSVGACLKSLLYL------HNESVN 252
           ++  E  R R   + ++P   ++N  I++GY    +   +  KSLL +      HNE+ N
Sbjct: 121 AQANELGRERHLHYYQLPFPWRENRFIIHGY----RFYDSHYKSLLSIVNWYGWHNETAN 176

Query: 253 IYTHLIPGWCFLLMTL--FNQLAIERYETTRMIDYIMIDLFFLGGFTCLMMSSTFHCFKC 426
           I+THL      L + +  F + ++   E   M+   ++ +F      C++ S   H F  
Sbjct: 177 IWTHLGGALYVLWLAVYDFPRTSVWESEQVPMVAKCIVYVFLAAALKCMLASVFGHTF-- 234

Query: 427 HSLPVAVLGNK---LDYLGIVALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLACTIV 597
           +      L +K   +DY GI  L+  S+++  F   ++       +  ++ + G+   I+
Sbjct: 235 NGTCCLALRSKFACVDYSGITMLITASILTTEFVTMYNYPWSLRFYLAVSTVLGIFGVIM 294

Query: 598 SLSDKFRSRDWRPYRAALFVAF----GLSALFPVIAGICHYGFKVTWTRIQLKWVFLEGV 765
           + S KF   + RP R   F+      GLS +   + G   Y    +W    +    L  V
Sbjct: 295 NWSPKFDRPEARPLRIKFFILLAAMGGLSFMQLGLLGGWKY---ASWLMAPVTHKSL--V 349

Query: 766 FYILGALLYGVRFPER 813
           +Y+LG   YG   PER
Sbjct: 350 WYLLGVAFYGSFVPER 365

>SAKL0G12980g Chr7 complement(1108751..1110442) [1692 bp, 563 aa]
           {ON} some similarities with uniprot|Q07959 Saccharomyces
           cerevisiae YLR023C IZH3 Membrane protein involved in
           zinc metabolism member of the four-protein IZH family
           expression induced by zinc deficiency deletion reduces
           sensitivity to elevated zinc and shortens lag phase
           overexpression reduces Zap1p activity
          Length = 563

 Score = 61.2 bits (147), Expect = 1e-09
 Identities = 68/248 (27%), Positives = 109/248 (43%), Gaps = 22/248 (8%)
 Frame = +1

Query: 136 EIPEWQKDNEHILNGYILETKSVGACLKSLLYL--HNESVNIYTHLIPGW--CFLLMTLF 303
           E+P   ++N  I++GY        + L  L +   HNE+ NI+THL       +L    F
Sbjct: 236 ELPFPWRENRFIIHGYRFYHSHTKSLLSILNWYGWHNETTNIWTHLFGSLYIAYLAFYEF 295

Query: 304 NQLAIERYETTRMIDYIMIDLFFLGGFTCLMMSSTFHCFK-CHSLPVAVLGNKLDYLGIV 480
            Q ++            M+ LF   GF CL+ S T+H F     L +      +DY GI 
Sbjct: 296 PQSSVYLSGDVPQFAKYMVYLFLGAGFKCLVSSVTWHTFNGTCKLHLRSKFACMDYTGIT 355

Query: 481 ALVVTSMVSILF---YGFHDN-------NLYFYV-FSGLTIMFGLACTIVSLSDKFRSRD 627
            L+  S+++  F   YG  DN       +L FY+  S +   FG+    ++ S +F   +
Sbjct: 356 VLITASIMTAEFVSLYGNGDNPNSPVTFSLIFYMAVSSVLCCFGV---FMNWSPRFDRPE 412

Query: 628 WRPYRAALFVAF-GLSAL----FPVIAGICHYGFKVTWTRIQLKWVFLEGV-FYILGALL 789
            RP R A ++   G+  L      +I    H     +W    ++ V  + V +Y++G + 
Sbjct: 413 SRPLRIAFYLLLAGMGFLAFLHLTLITNFAH----SSWL---IRPVLDKSVCWYLIGVIF 465

Query: 790 YGVRFPER 813
           YG   PER
Sbjct: 466 YGSFIPER 473

>NDAI0I02330 Chr9 (532412..534148) [1737 bp, 578 aa] {ON} Anc_5.197
          Length = 578

 Score = 61.2 bits (147), Expect = 1e-09
 Identities = 58/241 (24%), Positives = 109/241 (45%), Gaps = 15/241 (6%)
 Frame = +1

Query: 136 EIPEWQKDNEHILNGYILETKSVGACLKSLLYL------HNESVNIYTHLIPGWCFLLMT 297
           ++P   ++N +I+  Y    +   +  KSLL +      HNES NI+THL+     + ++
Sbjct: 254 QLPFPWRENRYIIYNY----RFYDSHKKSLLSIFNWYGWHNESSNIWTHLLGAIYLIYLS 309

Query: 298 LFNQLAIERYETTRM--IDYIMIDLFFLGGFTCLMMSSTFHCFKCHS-LPVAVLGNKLDY 468
           +++    E +++ ++     +++ LF      CL+ S  +H F   S L +      +DY
Sbjct: 310 IYDFPNSEIFQSEKVPTTAKLIVYLFLFAAIKCLLASVFWHTFNGTSFLKLRSKFACVDY 369

Query: 469 LGIVALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLACTIVSLSDKFRSRDWRPYRAA 648
            GI  L+  S+++  F   + +     ++  +++  G+    ++ S KF   + RP R  
Sbjct: 370 SGITILITASILTTEFVTMYSSFFAMCIYMTISLSLGMFGVFMNWSPKFDRPEARPLRIK 429

Query: 649 LFVAFG----LSALFPVIAGICHYGFKVTW--TRIQLKWVFLEGVFYILGALLYGVRFPE 810
            F+       LS L         Y    TW  T +  K +    V+Y++G + YG   PE
Sbjct: 430 FFILLASMGVLSFLHLTYLTNLQY---ATWLLTPVTNKSI----VWYLVGVVFYGSFIPE 482

Query: 811 R 813
           R
Sbjct: 483 R 483

>ZYRO0B10538g Chr2 complement(830311..831906) [1596 bp, 531 aa] {ON}
           some similarities with uniprot|Q07959 Saccharomyces
           cerevisiae YLR023C IZH3 Membrane protein involved in
           zinc metabolism member of the four-protein IZH family
           expression induced by zinc deficiency deletion reduces
           sensitivity to elevated zinc and shortens lag phase
           overexpression reduces Zap1p activity
          Length = 531

 Score = 60.8 bits (146), Expect = 1e-09
 Identities = 54/241 (22%), Positives = 104/241 (43%), Gaps = 15/241 (6%)
 Frame = +1

Query: 136 EIPEWQKDNEHILNGYILETKSVGACLKSLLYL--HNESVNIYTHLIPGWCFLLMTLFNQ 309
           ++P   ++N++I++GY        + L  + +   HNE+ NI+THL+ G   + +  ++ 
Sbjct: 209 QLPFPYRENKYIIHGYRFYASHKKSFLSIINWYGWHNETSNIWTHLLGGLYLIYLAFYHF 268

Query: 310 LAIERYETTRMID--YIMIDLFFLGGFTCLMMSSTFHCFK-CHSLPVAVLGNKLDYLGIV 480
                + + R+      ++ +F      C+  S  +H F   H L +      +DY GI 
Sbjct: 269 PHSNIWLSDRVPKPAKCIVAVFLAAAIKCMFASVFWHTFNGTHLLRLRSKFACVDYTGIT 328

Query: 481 ALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLACTIVSLSDKFRSRDWRPYRAALFV- 657
            L+  S++++ F   +D  +    +   ++  G+    ++ S KF   + RP R   F+ 
Sbjct: 329 ILITASILTVEFVTMYDYKISLLFYMICSLALGIIGVSMNWSPKFDRPEARPLRIKFFIL 388

Query: 658 --AFGLSALFPVIAGICHYGFKVTW-------TRIQLKWVFLEGVFYILGALLYGVRFPE 810
               G S+   ++       F   W       T +  K V    V+Y++G   YG   PE
Sbjct: 389 LATVGCSSFIRLV-------FLTNWRYAADLLTPLTNKSV----VWYLIGVFFYGSFIPE 437

Query: 811 R 813
           R
Sbjct: 438 R 438

>YLR023C Chr12 complement(185498..187129) [1632 bp, 543 aa] {ON}
           IZH3Membrane protein involved in zinc ion homeostasis,
           member of the four-protein IZH family, expression
           induced by zinc deficiency; deletion reduces sensitivity
           to elevated zinc and shortens lag phase, overexpression
           reduces Zap1p activity
          Length = 543

 Score = 60.8 bits (146), Expect = 1e-09
 Identities = 54/239 (22%), Positives = 107/239 (44%), Gaps = 13/239 (5%)
 Frame = +1

Query: 136 EIPEWQKDNEHILNGYILETKSVGACLKSLLYL------HNESVNIYTHLIPGWCFLLMT 297
           ++P   ++N +I++GY    +      KSLL +      HNE+ NI++HL+     + + 
Sbjct: 220 QLPFPWRENRYIIHGY----RFYNTHSKSLLSIFNWYGWHNETSNIWSHLLGAIYIIYLA 275

Query: 298 LFNQLAIERYETTRMIDYI--MIDLFFLGGFTCLMMSSTFHCFKCHS-LPVAVLGNKLDY 468
           +++    E +  +++      ++ +F      C++ S  +H F   S L +      +DY
Sbjct: 276 IYDFPQSEVWRNSQVPPQARWIVFMFLAAALKCMLSSVFWHTFNGTSFLKLRSKFACVDY 335

Query: 469 LGIVALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLACTIVSLSDKFRSRDWRPYRAA 648
            GI  L+  S+++  F   +      Y +  +++  G+    ++ S +F   + RP R  
Sbjct: 336 SGITILITASILTTEFVTMYSCYWAMYTYMSISLALGVFGVFMNWSPRFDRPEARPLRIR 395

Query: 649 LFVAFG----LSALFPVIAGICHYGFKVTWTRIQLKWVFLEGVFYILGALLYGVRFPER 813
            F+       LS L  +     HY     ++ +  K V    V+Y++G + YG   PER
Sbjct: 396 FFILLATMGVLSFLHLIFLTDLHYA-ATLFSPVTYKSV----VWYLVGVVFYGSFIPER 449

>CAGL0D03322g Chr4 complement(340949..342586) [1638 bp, 545 aa] {ON}
           similar to uniprot|Q07959 Saccharomyces cerevisiae
           YLR023c
          Length = 545

 Score = 60.1 bits (144), Expect = 2e-09
 Identities = 63/246 (25%), Positives = 104/246 (42%), Gaps = 20/246 (8%)
 Frame = +1

Query: 136 EIPEWQKDNEHILNGYILETKSVGACLKSLLYL------HNESVNIYTHLIPGWCFLLMT 297
           E+P   ++N  I+NGY    +   +  KSLL +      HNE+ NI+THL+ G   L + 
Sbjct: 218 ELPFPWRENRCIINGY----RFYNSHKKSLLSIVNWYGWHNETSNIWTHLLGGLYILYLM 273

Query: 298 LFNQLAIERY------ETTRMIDYIMIDLFFLGGFTCLMMSSTFHCFKCHS-LPVAVLGN 456
            +   + E +      +  ++I Y+    F +    CL  S  +H F   S L +     
Sbjct: 274 FYQFPSSEVFMSEQVPKAAKLITYV----FLIAAAKCLFSSVFWHTFNGTSLLRLRCKFA 329

Query: 457 KLDYLGIVALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLACTIVSLSDKFRSRDWRP 636
            +DY GI  L+  S+++  F   +        +  L+   G+    ++ S KF   + RP
Sbjct: 330 CVDYSGISILITASILTTEFVTMYQCPWAMVSYMALSTALGIFGVFMNWSPKFDRPEARP 389

Query: 637 YRAALFVAFGLSAL-----FPVIAGICHYGFKVTW--TRIQLKWVFLEGVFYILGALLYG 795
            R   F+      +        I  + H     TW  + I  K V    V+Y++G + YG
Sbjct: 390 LRIKFFILLASMGILSFLHLTFITSLSH----STWLLSPITKKSV----VWYLVGVVFYG 441

Query: 796 VRFPER 813
              PER
Sbjct: 442 SFIPER 447

>Skud_12.91 Chr12 complement(177334..178962) [1629 bp, 542 aa] {ON}
            YLR023C (REAL)
          Length = 542

 Score = 59.3 bits (142), Expect = 4e-09
 Identities = 62/285 (21%), Positives = 121/285 (42%), Gaps = 15/285 (5%)
 Frame = +1

Query: 4    VEAGLTKRKAVGIEPEGVMTEETTTL--LNGSRIEERTRRRLYKWDEIPEWQKDNEHILN 177
            ++A + KR+ +  EP    T+  + +   N S        +   + ++P   ++N +I++
Sbjct: 173  MKASMIKREILIEEPLNPTTDIKSFINSYNHSEAYSLGESQHLHYYQLPFPWRENRYIIH 232

Query: 178  GYILETKSVGACLKSLLYL------HNESVNIYTHLIPGWCFLLMTL--FNQLAIERYET 333
            GY    +      KSLL +      HNE+ NI++HL+     + + +  F Q  + R   
Sbjct: 233  GY----RFYNTHSKSLLSIINWYGWHNETSNIWSHLLGAMYIIYLAIYDFPQSEVWRNPN 288

Query: 334  TRMIDYIMIDLFFLGGFTCLMMSSTFHCFKCHS-LPVAVLGNKLDYLGIVALVVTSMVSI 510
                   ++ +F      C++ S  +H F   S L +      +DY GI  L+  S+++ 
Sbjct: 289  VPQQARWIVFMFLAAALKCMLSSVFWHTFNGTSFLRLRSKFACVDYSGITILITASILTT 348

Query: 511  LFYGFHDNNLYFYVFSGLTIMFGLACTIVSLSDKFRSRDWRPYRAALFVAFG----LSAL 678
             F   +        + G+++  G+    ++ S +F   + RP R   F+       LS L
Sbjct: 349  EFVTMYSCYWAMCTYMGISLALGVIGVFMNWSPRFDRPEARPLRIRFFILLATMGVLSFL 408

Query: 679  FPVIAGICHYGFKVTWTRIQLKWVFLEGVFYILGALLYGVRFPER 813
              +     +Y      +R+     +   V+Y++G + YG   PER
Sbjct: 409  HLIFLTDIYYA-----SRLFGPVTYKSVVWYLVGVVFYGSFIPER 448

>Smik_12.86 Chr12 complement(172288..173916) [1629 bp, 542 aa] {ON}
           YLR023C (REAL)
          Length = 542

 Score = 58.2 bits (139), Expect = 1e-08
 Identities = 53/239 (22%), Positives = 107/239 (44%), Gaps = 13/239 (5%)
 Frame = +1

Query: 136 EIPEWQKDNEHILNGYILETKSVGACLKSLLYL------HNESVNIYTHLIPGWCFLLMT 297
           ++P   ++N +I++GY    +      KSLL +      HNE+ NI++HL+     + + 
Sbjct: 219 QLPFPWRENRYIIHGY----RFYNTHSKSLLSIFNWYGWHNETSNIWSHLLGAMYLIYLA 274

Query: 298 LFNQLAIERYETTRMIDYI--MIDLFFLGGFTCLMMSSTFHCFKCHS-LPVAVLGNKLDY 468
           +++    E ++  ++      ++ +F      C++ S  +H F   S L +      +DY
Sbjct: 275 IYDFPQSEVWKNPKVPPQARWIVFMFLAAALKCMLSSVFWHTFNGTSFLKLRSKFACVDY 334

Query: 469 LGIVALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLACTIVSLSDKFRSRDWRPYRAA 648
            GI  L+  S+++  F   +        + G+++  G+    ++ S +F   + RP R  
Sbjct: 335 SGITILITASILTTEFVTMYSCYWAMCTYMGISLALGIFGVFMNWSPRFDRPEARPLRIR 394

Query: 649 LFVAFG----LSALFPVIAGICHYGFKVTWTRIQLKWVFLEGVFYILGALLYGVRFPER 813
            F+       LS L  +      Y  ++ ++ +  K V    V+Y++G   YG   PER
Sbjct: 395 FFILLATMGVLSFLHLIFLTDLRYAARL-FSPVTYKSV----VWYLVGVAFYGSFIPER 448

>Suva_10.104 Chr10 complement(191663..193288) [1626 bp, 541 aa] {ON}
           YLR023C (REAL)
          Length = 541

 Score = 55.5 bits (132), Expect = 8e-08
 Identities = 51/240 (21%), Positives = 100/240 (41%), Gaps = 14/240 (5%)
 Frame = +1

Query: 136 EIPEWQKDNEHILNGYILETKSVGACLKSLLYL--HNESVNIYTHLIPGWCFLLMTLFNQ 309
           ++P   ++N +I++GY        + L  + +   HNE+ NI+THL+     + + +++ 
Sbjct: 219 QLPFPWRENRYIIHGYRFYNTHYKSLLSVINWYGWHNETSNIWTHLLGAMYIVYLAVYDF 278

Query: 310 LAIERYETTRMIDYI--MIDLFFLGGFTCLMMSSTFHCFKCHS-LPVAVLGNKLDYLGIV 480
              E ++   +      ++  F      C++ S  +H F   S L +      +DY GI 
Sbjct: 279 PHSEVWQNPEVPQQARWIVFAFLAAALKCMLSSVFWHTFNGTSFLGLRSKFACVDYSGIT 338

Query: 481 ALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLACTIVSLSDKFRSRDWRPYRAALFVA 660
            L+  S+++  F   +        +  +++  G+    ++ S +F   + RP R   F+ 
Sbjct: 339 ILITASILTTEFVTMYSCYWAMCTYMTISLALGVFGVFMNWSPRFDRPEARPLRIRFFIL 398

Query: 661 FG----LSALFPVIAGICHYGFKVTWTRIQLKWVF-----LEGVFYILGALLYGVRFPER 813
                 LS L  +     HY            W+F        V+Y++G + YG   PER
Sbjct: 399 LATMGVLSFLHLIFLTDLHYAI----------WLFSPVTNKSVVWYLVGVVFYGSFIPER 448

>KAFR0C01460 Chr3 (300109..300768) [660 bp, 219 aa] {ON} Anc_3.90
           YOL101C
          Length = 219

 Score = 37.0 bits (84), Expect = 0.037
 Identities = 32/110 (29%), Positives = 51/110 (46%), Gaps = 1/110 (0%)
 Frame = +1

Query: 277 WCFLLMTLFNQLAIERYETTR-MIDYIMIDLFFLGGFTCLMMSSTFHCFKCHSLPVAVLG 453
           + FLL+   +   I RY++   M DYI+I+++      CL  S   +  K     +  L 
Sbjct: 48  YLFLLVFFTDVYLISRYKSVMTMTDYIIINVYIA---ICLKFS-ILNLLKKEKKIMKNLN 103

Query: 454 NKLDYLGIVALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLACTIVSL 603
           N         L + S+VS+L+Y ++DN  YF V S L     L    +S+
Sbjct: 104 N---------LQIISIVSLLYYIYYDNIFYFKVLSLLIFCINLLIQSISI 144

>Smik_1.90 Chr1 (160467..161183) [717 bp, 238 aa] {ON} YAR033W
           (REAL)
          Length = 238

 Score = 34.7 bits (78), Expect = 0.23
 Identities = 20/48 (41%), Positives = 31/48 (64%), Gaps = 2/48 (4%)
 Frame = +1

Query: 475 IVALVVTSMVSILFYGFHDN--NLYFYVFSGLTIMFGLACTIVSLSDK 612
           ++ LV TS+VS+L + FHD+  + +FYVFS L   F L  T++   D+
Sbjct: 53  LMLLVTTSLVSLLVF-FHDSYRSTFFYVFSSLVSGFLLQGTLIVFCDE 99

>ADR080W Chr4 (850507..852582) [2076 bp, 691 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR214W (FRE1)
          Length = 691

 Score = 34.7 bits (78), Expect = 0.36
 Identities = 21/79 (26%), Positives = 39/79 (49%)
 Frame = +1

Query: 709 GFKVTWTRIQLKWVFLEGVFYILGALLYGVRFPERVAPGTFDIWGQSHQLFHVLVVIAAS 888
           GFK  W     KW    G+F  + A L  +   + +   T++ +   H+LF+++ ++   
Sbjct: 331 GFKAWWGDAYFKW----GLFATVLAGLLVLHSEKFIRQRTYEFFLILHKLFNIVFIVCMY 386

Query: 889 CHLRALLGAYKWVHSQMLI 945
            H++  LG + WV S + I
Sbjct: 387 MHIKT-LGWHGWVWSMVAI 404

>Ecym_2743 Chr2 (1438180..1441914) [3735 bp, 1244 aa] {ON} similar
           to Ashbya gossypii AER194W
          Length = 1244

 Score = 33.9 bits (76), Expect = 0.68
 Identities = 39/163 (23%), Positives = 71/163 (43%), Gaps = 19/163 (11%)
 Frame = +1

Query: 172 LNGYILETKSVGACL---KSLLYLHNESVNIYTHLIPGWCFLLMT---LFNQLAIERYET 333
           LNGYI+  + +   L     L    N++ ++  +L     F  +T   +F++L    Y  
Sbjct: 157 LNGYIVSARGIATVLLAPNDLAAKRNDNFSLSRNLKALKSFSNITHFYIFDELDSMNYGK 216

Query: 334 TR-----------MIDYIMIDLFF--LGGFTCLMMSSTFHCFKCHSLPVAVLGNKLDYLG 474
            R           +IDY  I   +  L G+    MSS  H   C  + +AV+        
Sbjct: 217 QRELLRFLVVPLTVIDYFWIVAIYAALIGYFIYSMSSLRHIKSCVGISIAVVCQLT---- 272

Query: 475 IVALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLACTIVSL 603
            + +  +  ++ LFY  +D+N+ +++F    I+  L  +IV+L
Sbjct: 273 -LVIAASRTITALFYKSNDDNVLWFLFYIPVIVISLT-SIVNL 313

>Skud_14.42 Chr14 (70507..72081) [1575 bp, 524 aa] {ON} YNL295W
           (REAL)
          Length = 524

 Score = 33.5 bits (75), Expect = 0.79
 Identities = 21/67 (31%), Positives = 30/67 (44%), Gaps = 10/67 (14%)
 Frame = +1

Query: 253 IYTHLIPGWCFLLMTLFNQLAIERYET----------TRMIDYIMIDLFFLGGFTCLMMS 402
           I  H+ P +  +L TL N    +++ET          TR+ D I    FF  G  C++  
Sbjct: 395 IMDHIYPVYTTILSTLANSKDSKKFETKIKGYIEKIITRLSDEIPSTYFFQDGVDCIIQP 454

Query: 403 STFHCFK 423
           S  H FK
Sbjct: 455 SPVHNFK 461

>Kpol_495.19 s495 (53075..54898) [1824 bp, 607 aa] {ON}
           (53075..54898) [1824 nt, 608 aa]
          Length = 607

 Score = 32.0 bits (71), Expect = 2.5
 Identities = 31/150 (20%), Positives = 59/150 (39%), Gaps = 13/150 (8%)
 Frame = +1

Query: 223 LLYLHNESVNIYTHLIP-GWCF------------LLMTLFNQLAIERYETTRMIDYIMID 363
           + Y+H+ S  I T +IP   C             LL+TL ++L      T     Y+ I 
Sbjct: 226 IYYMHHNSKRIVTKIIPFPECIRNNRNRFIVLGGLLLTLVDELFYTLLLTDVSFLYVSIS 285

Query: 364 LFFLGGFTCLMMSSTFHCFKCHSLPVAVLGNKLDYLGIVALVVTSMVSILFYGFHDNNLY 543
              + GF+ ++ SS    +  H     +  N +       L    +  IL+  +H + + 
Sbjct: 286 YKIIEGFSYILFSSLVVAYIWHDFGYTLRPNHVQDKN-RKLTFGEVTKILWRSYH-STVP 343

Query: 544 FYVFSGLTIMFGLACTIVSLSDKFRSRDWR 633
             +++ + I+         +++KF    WR
Sbjct: 344 LIIYNAIVILLLFCVFFFFVANKFNKFSWR 373

>Ecym_5257 Chr5 complement(535932..536615) [684 bp, 227 aa] {ON}
           similar to Ashbya gossypii AER217W
          Length = 227

 Score = 30.8 bits (68), Expect = 4.0
 Identities = 12/35 (34%), Positives = 20/35 (57%)
 Frame = +1

Query: 769 YILGALLYGVRFPERVAPGTFDIWGQSHQLFHVLV 873
           YILG L   + F    +P TF++W    + F+V++
Sbjct: 9   YILGGLAVWLPFCCEASPVTFELWADKEECFYVII 43

>Suva_14.44 Chr14 (73757..75334) [1578 bp, 525 aa] {ON} YNL295W
           (REAL)
          Length = 525

 Score = 31.2 bits (69), Expect = 4.2
 Identities = 19/76 (25%), Positives = 34/76 (44%), Gaps = 10/76 (13%)
 Frame = +1

Query: 226 LYLHNESVNIYTHLIPGWCFLLMTLFNQLAIERYET----------TRMIDYIMIDLFFL 375
           L+  +  + I  H+ P +  +L +L +   ++++E           TR+ D I    FF 
Sbjct: 387 LFQRSLRMKIMDHIYPVYTTILSSLTHSKDLKKFENKIKESIEKIITRLSDEIPSTYFFQ 446

Query: 376 GGFTCLMMSSTFHCFK 423
            G  C++  S  H FK
Sbjct: 447 DGVDCIIQPSPIHNFK 462

>ZYRO0A13002g Chr1 complement(1028405..1029244) [840 bp, 279 aa]
           {ON} similar to uniprot|P46961 Saccharomyces cerevisiae
           YPL076W GPI2 Protein involved in the synthesis of N-
           acetylglucosaminyl phosphatidylinositol (GlcNAc-PI) the
           first intermediate in the synthesis of
           glycosylphosphatidylinositol (GPI) anchors homologous to
           the human PIG-C protein
          Length = 279

 Score = 30.8 bits (68), Expect = 4.5
 Identities = 23/72 (31%), Positives = 34/72 (47%)
 Frame = +1

Query: 484 LVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLACTIVSLSDKFRSRDWRPYRAALFVAF 663
           L+ TS+V I F     N +Y Y    L     L   I+ LS K  +R W   R++L + F
Sbjct: 67  LLSTSLVFIAF-----NFIYHYKVDPLPYTIALTVFILYLSWK-STRRWVDLRSSLVITF 120

Query: 664 GLSALFPVIAGI 699
            +  L PV+  +
Sbjct: 121 AMLTLSPVLKSL 132

>KNAG0I00420 Chr9 complement(62534..65791) [3258 bp, 1085 aa] {ON}
           Anc_1.459 YJR035W
          Length = 1085

 Score = 30.8 bits (68), Expect = 6.2
 Identities = 16/51 (31%), Positives = 30/51 (58%), Gaps = 1/51 (1%)
 Frame = +1

Query: 97  IEERTRRRLY-KWDEIPEWQKDNEHILNGYILETKSVGACLKSLLYLHNES 246
           I++R+  R Y KW ++PEW+K +  I    + +T  V   + SLL+ + ++
Sbjct: 268 IKKRSVDRKYDKWPDLPEWRKPHPDIPTARLNDTFKVPGEIHSLLFNYQKT 318

>NDAI0C06110 Chr3 (1409081..1413868) [4788 bp, 1595 aa] {ON} 
          Length = 1595

 Score = 30.8 bits (68), Expect = 6.4
 Identities = 19/74 (25%), Positives = 34/74 (45%), Gaps = 4/74 (5%)
 Frame = +1

Query: 715  KVTWTRIQLKWVFLEGVFYILGALLYGVRFPERVAPGTFDIWGQSHQLFHVLVVIAA--- 885
            ++ W + +  W  L+G++       +      R    T +  G  H+ F+V V++A    
Sbjct: 1270 RLDWNQTKFLWYMLDGLYQSCICFFFPYAMYHRTMIITHNGLGLDHR-FYVGVMVATLAV 1328

Query: 886  -SCHLRALLGAYKW 924
             SC+L  LL  Y+W
Sbjct: 1329 LSCNLYILLHQYRW 1342

>KNAG0D01230 Chr4 (207381..209348) [1968 bp, 655 aa] {ON} Anc_7.491
           YJR110W
          Length = 655

 Score = 30.4 bits (67), Expect = 7.7
 Identities = 32/116 (27%), Positives = 49/116 (42%), Gaps = 6/116 (5%)
 Frame = +1

Query: 7   EAGLTKRKAVGIEPEGVMTEETTTLLNGSRIEERTRRRLYKWDEIPEWQKDNEHILNGYI 186
           EA +TKR  +GI+   VM++  + L++   I+      L +        K   H L    
Sbjct: 301 EASVTKRLFLGIDNIHVMSDTMSNLIDSFLIDTDVSSELSQ----ALIHKKAFHWLRSVE 356

Query: 187 LETKSVGACLKSLLYLHNESVNIYTHLIPGW------CFLLMTLFNQLAIERYETT 336
           L   SV   +KS+++    + NI  H   GW      C L+     QL I+ Y  T
Sbjct: 357 LILSSVDKLVKSIVF---NNANILVHCSDGWDRTAQICSLI-----QLCIDPYYRT 404

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 89,329,864
Number of extensions: 1997258
Number of successful extensions: 5985
Number of sequences better than 10.0: 81
Number of HSP's gapped: 5913
Number of HSP's successfully gapped: 81
Length of query: 316
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 207
Effective length of database: 40,982,805
Effective search space: 8483440635
Effective search space used: 8483440635
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 34 (17.7 bits)