Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_56.224546.27ON31531516780.0
KLTH0C11044g6.27ON31531013170.0
SAKL0E01474g6.27ON31130610731e-147
CAGL0E02519g6.27ON31530010351e-141
NCAS0H015106.27ON31328010341e-141
NDAI0F017406.27ON31330010231e-139
ZYRO0C07612g6.27ON31929710141e-138
Kpol_1032.96.27ON31827410081e-137
KNAG0M012406.27ON31430610061e-137
KAFR0G026506.27ON32127110001e-136
TDEL0G044206.27ON32231610001e-136
KLLA0D01331g6.27ON3083099981e-136
TBLA0E030606.27ON3192989901e-134
TPHA0M002906.27ON3273219451e-127
Ecym_30316.27ON3282849421e-127
ACL002C6.27ON3293199281e-125
Smik_15.1686.27ON3272909211e-124
YOL002C (IZH2)6.27ON3172799161e-123
Skud_15.1606.27ON3273089111e-122
Suva_15.1736.27ON3272799031e-121
SAKL0C09218g3.90ON3142787841e-103
ZYRO0B06556g3.90ON3182837366e-96
TDEL0D053403.90ON3163067322e-95
CAGL0G04631g3.90ON3162837271e-94
Kwal_56.227043.90ON3202857262e-94
TPHA0A006403.90ON3272967253e-94
KLTH0C09504g3.90ON3192767097e-92
KLLA0C12441g3.90ON3153037052e-91
Skud_4.7663.90ON3163137043e-91
AFR337W3.90ON3172737027e-91
YDR492W (IZH1)3.90ON3162886931e-89
Smik_4.7693.90ON3162886922e-89
Kpol_1053.263.90ON3242766923e-89
Suva_2.6683.90ON3152846881e-88
NDAI0A071603.90ON3302916847e-88
NCAS0I025703.90ON3143156766e-87
TBLA0B022903.90ON3262846654e-85
Ecym_35883.90ON3052806513e-83
KAFR0A081303.90ON3192816428e-82
KNAG0K021603.90ON3233205733e-71
TBLA0B082553.90ON2962944016e-46
NCAS0C049203.90ON3263193392e-36
NDAI0G043003.90ON3182843223e-34
CAGL0I07491g3.90ON3012962411e-22
Suva_15.643.90ON3123182332e-21
Skud_15.533.90ON3123191997e-17
KLLA0F15510g5.197ON6222921974e-16
Smik_15.563.90ON3122081847e-15
YOL101C (IZH4)3.90ON3122081803e-14
AAL153C5.197ON4193201771e-13
Kpol_2002.945.197ON5772381772e-13
KAFR0J006705.197ON5092341719e-13
KLTH0B03498g5.197ON5462501672e-12
TPHA0E031205.197ON5692471567e-11
Ecym_71095.197ON5682451504e-10
Kwal_33.151225.197ON5662431452e-09
TBLA0C060505.197ON4372331432e-09
KNAG0B051005.197ON5382581407e-09
TDEL0E043205.197ON4502561398e-09
SAKL0G12980g5.197ON5632491335e-08
NCAS0D026005.197ON5432391326e-08
NDAI0I023305.197ON5782411311e-07
YLR023C (IZH3)5.197ON5432391301e-07
Skud_12.915.197ON5422811282e-07
Smik_12.865.197ON5422351221e-06
Suva_10.1045.197ON5412441158e-06
CAGL0D03322g5.197ON5452461131e-05
KNAG0K006703.90ON3211221112e-05
ZYRO0B10538g5.197ON5312411103e-05
Skud_14.423.62ON52467860.029
Smik_14.363.62ON52491810.13
YNL295W3.62ON52498770.37
Suva_14.443.62ON52569770.40
Smik_1.90na 1ON23848711.8
TPHA0H018306.252ON62893693.8
KNAG0I004201.459ON108551694.5
KAFR0C014603.90ON21997674.7
Ecym_2743na 2ON1244227678.5
Ecym_52573.182ON22735659.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_56.22454
         (315 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_56.22454 s56 (136175..137122) [948 bp, 315 aa] {ON} YOL002C...   650   0.0  
KLTH0C11044g Chr3 complement(908604..909551) [948 bp, 315 aa] {O...   511   0.0  
SAKL0E01474g Chr5 (112382..113317) [936 bp, 311 aa] {ON} similar...   417   e-147
CAGL0E02519g Chr5 complement(242867..243814) [948 bp, 315 aa] {O...   403   e-141
NCAS0H01510 Chr8 complement(287981..288922) [942 bp, 313 aa] {ON...   402   e-141
NDAI0F01740 Chr6 (429141..430082) [942 bp, 313 aa] {ON} Anc_6.27      398   e-139
ZYRO0C07612g Chr3 complement(578864..579823) [960 bp, 319 aa] {O...   395   e-138
Kpol_1032.9 s1032 (22700..23656) [957 bp, 318 aa] {ON} (22700..2...   392   e-137
KNAG0M01240 Chr13 (226766..227710) [945 bp, 314 aa] {ON} Anc_6.2...   392   e-137
KAFR0G02650 Chr7 complement(547561..548526) [966 bp, 321 aa] {ON...   389   e-136
TDEL0G04420 Chr7 complement(802412..803380) [969 bp, 322 aa] {ON...   389   e-136
KLLA0D01331g Chr4 (117469..118395) [927 bp, 308 aa] {ON} similar...   389   e-136
TBLA0E03060 Chr5 (769031..769990) [960 bp, 319 aa] {ON} Anc_6.27...   385   e-134
TPHA0M00290 Chr13 (57784..58767) [984 bp, 327 aa] {ON} Anc_6.27 ...   368   e-127
Ecym_3031 Chr3 (61592..62578) [987 bp, 328 aa] {ON} similar to A...   367   e-127
ACL002C Chr3 complement(353449..354438) [990 bp, 329 aa] {ON} Sy...   362   e-125
Smik_15.168 Chr15 complement(290724..291707) [984 bp, 327 aa] {O...   359   e-124
YOL002C Chr15 complement(323411..324364) [954 bp, 317 aa] {ON}  ...   357   e-123
Skud_15.160 Chr15 complement(283003..283986) [984 bp, 327 aa] {O...   355   e-122
Suva_15.173 Chr15 complement(297915..298898) [984 bp, 327 aa] {O...   352   e-121
SAKL0C09218g Chr3 (839747..840691) [945 bp, 314 aa] {ON} similar...   306   e-103
ZYRO0B06556g Chr2 (526478..527434) [957 bp, 318 aa] {ON} similar...   288   6e-96
TDEL0D05340 Chr4 (969608..970558) [951 bp, 316 aa] {ON} Anc_3.90...   286   2e-95
CAGL0G04631g Chr7 (441149..442099) [951 bp, 316 aa] {ON} similar...   284   1e-94
Kwal_56.22704 s56 (244431..245393) [963 bp, 320 aa] {ON} YDR492W...   284   2e-94
TPHA0A00640 Chr1 complement(115042..116025) [984 bp, 327 aa] {ON...   283   3e-94
KLTH0C09504g Chr3 complement(788442..789401) [960 bp, 319 aa] {O...   277   7e-92
KLLA0C12441g Chr3 complement(1057427..1058374) [948 bp, 315 aa] ...   276   2e-91
Skud_4.766 Chr4 (1354630..1355580) [951 bp, 316 aa] {ON} YDR492W...   275   3e-91
AFR337W Chr6 (1051645..1052598) [954 bp, 317 aa] {ON} Syntenic h...   275   7e-91
YDR492W Chr4 (1434924..1435874) [951 bp, 316 aa] {ON}  IZH1Membr...   271   1e-89
Smik_4.769 Chr4 (1356263..1357213) [951 bp, 316 aa] {ON} YDR492W...   271   2e-89
Kpol_1053.26 s1053 complement(40099..41073) [975 bp, 324 aa] {ON...   271   3e-89
Suva_2.668 Chr2 (1186763..1187710) [948 bp, 315 aa] {ON} YDR492W...   269   1e-88
NDAI0A07160 Chr1 complement(1630482..1631474) [993 bp, 330 aa] {...   268   7e-88
NCAS0I02570 Chr9 complement(480266..481210) [945 bp, 314 aa] {ON...   265   6e-87
TBLA0B02290 Chr2 complement(534472..535452) [981 bp, 326 aa] {ON...   260   4e-85
Ecym_3588 Chr3 (1117646..1118563) [918 bp, 305 aa] {ON} similar ...   255   3e-83
KAFR0A08130 Chr1 (1638153..1639112) [960 bp, 319 aa] {ON} Anc_3....   251   8e-82
KNAG0K02160 Chr11 (436744..437715) [972 bp, 323 aa] {ON} Anc_3.9...   225   3e-71
TBLA0B08255 Chr2 (1973757..1974647) [891 bp, 296 aa] {ON}             159   6e-46
NCAS0C04920 Chr3 complement(1003692..1004672) [981 bp, 326 aa] {...   135   2e-36
NDAI0G04300 Chr7 (1035664..1036620) [957 bp, 318 aa] {ON} Anc_3.90    128   3e-34
CAGL0I07491g Chr9 complement(719539..720444) [906 bp, 301 aa] {O...    97   1e-22
Suva_15.64 Chr15 complement(100035..100973) [939 bp, 312 aa] {ON...    94   2e-21
Skud_15.53 Chr15 complement(86339..87277) [939 bp, 312 aa] {ON} ...    81   7e-17
KLLA0F15510g Chr6 (1433494..1435362) [1869 bp, 622 aa] {ON} some...    80   4e-16
Smik_15.56 Chr15 complement(90083..91021) [939 bp, 312 aa] {ON} ...    75   7e-15
YOL101C Chr15 complement(126982..127920) [939 bp, 312 aa] {ON}  ...    74   3e-14
AAL153C Chr1 complement(75086..76345) [1260 bp, 419 aa] {ON} Syn...    73   1e-13
Kpol_2002.94 s2002 (229517..231250) [1734 bp, 577 aa] {ON} (2295...    73   2e-13
KAFR0J00670 Chr10 (120378..121907) [1530 bp, 509 aa] {ON} Anc_5....    70   9e-13
KLTH0B03498g Chr2 complement(281148..282788) [1641 bp, 546 aa] {...    69   2e-12
TPHA0E03120 Chr5 complement(654079..655788) [1710 bp, 569 aa] {O...    65   7e-11
Ecym_7109 Chr7 complement(210829..212535) [1707 bp, 568 aa] {ON}...    62   4e-10
Kwal_33.15122 s33 (968885..970585) [1701 bp, 566 aa] {ON} YLR023...    60   2e-09
TBLA0C06050 Chr3 (1468152..1469465) [1314 bp, 437 aa] {ON} Anc_5...    60   2e-09
KNAG0B05100 Chr2 (976101..977717) [1617 bp, 538 aa] {ON} Anc_5.1...    59   7e-09
TDEL0E04320 Chr5 complement(804655..806007) [1353 bp, 450 aa] {O...    58   8e-09
SAKL0G12980g Chr7 complement(1108751..1110442) [1692 bp, 563 aa]...    56   5e-08
NCAS0D02600 Chr4 (499689..501320) [1632 bp, 543 aa] {ON} Anc_5.1...    55   6e-08
NDAI0I02330 Chr9 (532412..534148) [1737 bp, 578 aa] {ON} Anc_5.197     55   1e-07
YLR023C Chr12 complement(185498..187129) [1632 bp, 543 aa] {ON} ...    55   1e-07
Skud_12.91 Chr12 complement(177334..178962) [1629 bp, 542 aa] {O...    54   2e-07
Smik_12.86 Chr12 complement(172288..173916) [1629 bp, 542 aa] {O...    52   1e-06
Suva_10.104 Chr10 complement(191663..193288) [1626 bp, 541 aa] {...    49   8e-06
CAGL0D03322g Chr4 complement(340949..342586) [1638 bp, 545 aa] {...    48   1e-05
KNAG0K00670 Chr11 complement(119419..120384) [966 bp, 321 aa] {O...    47   2e-05
ZYRO0B10538g Chr2 complement(830311..831906) [1596 bp, 531 aa] {...    47   3e-05
Skud_14.42 Chr14 (70507..72081) [1575 bp, 524 aa] {ON} YNL295W (...    38   0.029
Smik_14.36 Chr14 (61288..62862) [1575 bp, 524 aa] {ON} YNL295W (...    36   0.13 
YNL295W Chr14 (76946..78520) [1575 bp, 524 aa] {ON} Putative pro...    34   0.37 
Suva_14.44 Chr14 (73757..75334) [1578 bp, 525 aa] {ON} YNL295W (...    34   0.40 
Smik_1.90 Chr1 (160467..161183) [717 bp, 238 aa] {ON} YAR033W (R...    32   1.8  
TPHA0H01830 Chr8 (420005..421891) [1887 bp, 628 aa] {ON} Anc_6.2...    31   3.8  
KNAG0I00420 Chr9 complement(62534..65791) [3258 bp, 1085 aa] {ON...    31   4.5  
KAFR0C01460 Chr3 (300109..300768) [660 bp, 219 aa] {ON} Anc_3.90...    30   4.7  
Ecym_2743 Chr2 (1438180..1441914) [3735 bp, 1244 aa] {ON} simila...    30   8.5  
Ecym_5257 Chr5 complement(535932..536615) [684 bp, 227 aa] {ON} ...    30   9.6  

>Kwal_56.22454 s56 (136175..137122) [948 bp, 315 aa] {ON} YOL002C -
           Hypothetical ORF [contig 185] FULL
          Length = 315

 Score =  650 bits (1678), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/315 (100%), Positives = 315/315 (100%)

Query: 1   MVEAGLTKRKAVGIEPEGVMTEETTTLLNGSRIEERTRRRLYKWDEIPEWQKDNEHILNG 60
           MVEAGLTKRKAVGIEPEGVMTEETTTLLNGSRIEERTRRRLYKWDEIPEWQKDNEHILNG
Sbjct: 1   MVEAGLTKRKAVGIEPEGVMTEETTTLLNGSRIEERTRRRLYKWDEIPEWQKDNEHILNG 60

Query: 61  YILETKSVGACLKSLLYLHNESVNIYTHLIPGWCFLLMTLFNQLAIERYETTRMIDYIMI 120
           YILETKSVGACLKSLLYLHNESVNIYTHLIPGWCFLLMTLFNQLAIERYETTRMIDYIMI
Sbjct: 61  YILETKSVGACLKSLLYLHNESVNIYTHLIPGWCFLLMTLFNQLAIERYETTRMIDYIMI 120

Query: 121 DLFFLGGFTCLMMSSTFHCFKCHSLPVAVLGNKLDYLGIVALVVTSMVSILFYGFHDNNL 180
           DLFFLGGFTCLMMSSTFHCFKCHSLPVAVLGNKLDYLGIVALVVTSMVSILFYGFHDNNL
Sbjct: 121 DLFFLGGFTCLMMSSTFHCFKCHSLPVAVLGNKLDYLGIVALVVTSMVSILFYGFHDNNL 180

Query: 181 YFYVFSGLTIMFGLACTIVSLSDKFRSRDWRPYRAALFVAFGLSALFPVIAGICHYGFKV 240
           YFYVFSGLTIMFGLACTIVSLSDKFRSRDWRPYRAALFVAFGLSALFPVIAGICHYGFKV
Sbjct: 181 YFYVFSGLTIMFGLACTIVSLSDKFRSRDWRPYRAALFVAFGLSALFPVIAGICHYGFKV 240

Query: 241 TWTRIQLKWVFLEGVFYILGALLYGVRFPERVAPGTFDIWGQSHQLFHVLVVIAASCHLR 300
           TWTRIQLKWVFLEGVFYILGALLYGVRFPERVAPGTFDIWGQSHQLFHVLVVIAASCHLR
Sbjct: 241 TWTRIQLKWVFLEGVFYILGALLYGVRFPERVAPGTFDIWGQSHQLFHVLVVIAASCHLR 300

Query: 301 ALLGAYKWVHSQMLI 315
           ALLGAYKWVHSQMLI
Sbjct: 301 ALLGAYKWVHSQMLI 315

>KLTH0C11044g Chr3 complement(908604..909551) [948 bp, 315 aa] {ON}
           similar to uniprot|Q12442 Saccharomyces cerevisiae
           YOL002C IZH2 Membrane protein involved in zinc
           metabolism member of the four-protein IZH family direct
           target of the Zap1p transcription factor expression
           induced by zinc deficiency and fatty acids deletion
           increases sensitivity to elevated zinc
          Length = 315

 Score =  511 bits (1317), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 239/310 (77%), Positives = 273/310 (88%)

Query: 1   MVEAGLTKRKAVGIEPEGVMTEETTTLLNGSRIEERTRRRLYKWDEIPEWQKDNEHILNG 60
           M + GLT+RK V +E    M EE ++LL  S +++RT+RRLY WDEIPEWQ+DNEHI+ G
Sbjct: 1   MEQGGLTQRKPVEVELHHRMVEENSSLLKDSNLKQRTKRRLYTWDEIPEWQRDNEHIVGG 60

Query: 61  YILETKSVGACLKSLLYLHNESVNIYTHLIPGWCFLLMTLFNQLAIERYETTRMIDYIMI 120
           YILETKS   CLKSLLYLHNESVNIYTHL+PGWCFLL+ +FNQ+ IE++ETTR+IDY+MI
Sbjct: 61  YILETKSTWECLKSLLYLHNESVNIYTHLLPGWCFLLVAVFNQVVIEKFETTRLIDYVMI 120

Query: 121 DLFFLGGFTCLMMSSTFHCFKCHSLPVAVLGNKLDYLGIVALVVTSMVSILFYGFHDNNL 180
           DLFFLGGFTCLMMSS FHCFKCHSLPVA+LGNKLDYLGIVALVVTS+VSILFYGFHD +L
Sbjct: 121 DLFFLGGFTCLMMSSVFHCFKCHSLPVAILGNKLDYLGIVALVVTSIVSILFYGFHDYDL 180

Query: 181 YFYVFSGLTIMFGLACTIVSLSDKFRSRDWRPYRAALFVAFGLSALFPVIAGICHYGFKV 240
           YF++FSGLT+ FGLAC  VSLS+KFRSR+WRPYRA+LFVAFGLSAL PVIAG  HYG K 
Sbjct: 181 YFWLFSGLTMAFGLACATVSLSNKFRSREWRPYRASLFVAFGLSALLPVIAGALHYGLKE 240

Query: 241 TWTRIQLKWVFLEGVFYILGALLYGVRFPERVAPGTFDIWGQSHQLFHVLVVIAASCHLR 300
           TWTRIQL+WV L GVFYILGA+LYG+RFPER+APG FDIWG SHQLFH+LVV+AA CHLR
Sbjct: 241 TWTRIQLEWVLLGGVFYILGAVLYGIRFPERMAPGCFDIWGHSHQLFHILVVVAALCHLR 300

Query: 301 ALLGAYKWVH 310
           ALLGAYK  H
Sbjct: 301 ALLGAYKLFH 310

>SAKL0E01474g Chr5 (112382..113317) [936 bp, 311 aa] {ON} similar to
           uniprot|Q12442 Saccharomyces cerevisiae YOL002C IZH2
           Membrane protein involved in zinc metabolism member of
           the four-protein IZH family direct target of the Zap1p
           transcription factor expression induced by zinc
           deficiency and fatty acids deletion increases
           sensitivity to elevated zinc
          Length = 311

 Score =  417 bits (1073), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 187/306 (61%), Positives = 245/306 (80%), Gaps = 3/306 (0%)

Query: 8   KRKAVGIEPEGVMTEETTTLLNGSRIEERTRRRLYKWDEIPEWQKDNEHILNGYILETKS 67
            R+ + I+   ++ EET   ++   I ++  RRLY W+EIP+WQKDNEHI +GY+ ET S
Sbjct: 6   NRRRLQIKRANIVKEET---MSTGTINKKRVRRLYSWEEIPDWQKDNEHIRHGYVRETNS 62

Query: 68  VGACLKSLLYLHNESVNIYTHLIPGWCFLLMTLFNQLAIERYETTRMIDYIMIDLFFLGG 127
              C  SL Y+HNESVNIYTHL+PG CF  + LF+++AI+ ++TT  +DYIM+DLFFLG 
Sbjct: 63  FLGCFDSLFYMHNESVNIYTHLLPGLCFFFVVLFDKVAIKVFDTTTFLDYIMVDLFFLGA 122

Query: 128 FTCLMMSSTFHCFKCHSLPVAVLGNKLDYLGIVALVVTSMVSILFYGFHDNNLYFYVFSG 187
           FTCL++SSTFHC K HSL +A+LGNKLDYLGIVAL+V+SM+SI++YGF D+  +FY FS 
Sbjct: 123 FTCLILSSTFHCLKTHSLRIAILGNKLDYLGIVALIVSSMISIMYYGFFDSGKFFYGFST 182

Query: 188 LTIMFGLACTIVSLSDKFRSRDWRPYRAALFVAFGLSALFPVIAGICHYGFKVTWTRIQL 247
           LT++FG+AC I SLSD FRSR+WRPYRAALFVAFGLSA+ P+ +G+  YGFK TW ++Q+
Sbjct: 183 LTLVFGIACAIASLSDTFRSREWRPYRAALFVAFGLSAVLPIFSGVAVYGFKETWVKVQV 242

Query: 248 KWVFLEGVFYILGALLYGVRFPERVAPGTFDIWGQSHQLFHVLVVIAASCHLRALLGAYK 307
           KWV L GVFYI+GALLY +R PER++PG FDIWG SHQ+FH+LVVIAA CHL+A+L +Y+
Sbjct: 243 KWVLLGGVFYIIGALLYALRLPERISPGKFDIWGHSHQIFHILVVIAALCHLKAVLNSYE 302

Query: 308 WVHSQM 313
            VH ++
Sbjct: 303 LVHKKL 308

>CAGL0E02519g Chr5 complement(242867..243814) [948 bp, 315 aa] {ON}
           similar to uniprot|Q12442 Saccharomyces cerevisiae
           YOL002c
          Length = 315

 Score =  403 bits (1035), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 187/300 (62%), Positives = 232/300 (77%), Gaps = 3/300 (1%)

Query: 19  VMTEETTTLLNGSRIEERTR---RRLYKWDEIPEWQKDNEHILNGYILETKSVGACLKSL 75
           V TEE   +    +I+ R +   R+LY W+EIPEWQKDNEHI  GY+ ET SV  C++SL
Sbjct: 13  VTTEEQPLIGTDGQIKLRKKTVVRKLYTWEEIPEWQKDNEHIHTGYVRETSSVMECIRSL 72

Query: 76  LYLHNESVNIYTHLIPGWCFLLMTLFNQLAIERYETTRMIDYIMIDLFFLGGFTCLMMSS 135
            YLHNE+VNIY+HLIP   F     FN+  +  Y TT +IDY++ID+FFLG F+CL++SS
Sbjct: 73  FYLHNETVNIYSHLIPAIAFFSTIFFNKYVVPTYSTTTLIDYLIIDIFFLGAFSCLILSS 132

Query: 136 TFHCFKCHSLPVAVLGNKLDYLGIVALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLA 195
           TFHC K HSL VAV GNKLDYLGIV L+V SMVSIL+YGFH N  +F +FS +T+ FG A
Sbjct: 133 TFHCLKSHSLRVAVFGNKLDYLGIVFLIVASMVSILYYGFHGNPWFFGIFSLITMTFGAA 192

Query: 196 CTIVSLSDKFRSRDWRPYRAALFVAFGLSALFPVIAGICHYGFKVTWTRIQLKWVFLEGV 255
           C +VSL D FRSR+WRPYRAALFV FGLSA+ P++AG+  YG   TWTRIQLKWV LEGV
Sbjct: 193 CAVVSLKDTFRSREWRPYRAALFVIFGLSAVLPILAGLFKYGPTETWTRIQLKWVILEGV 252

Query: 256 FYILGALLYGVRFPERVAPGTFDIWGQSHQLFHVLVVIAASCHLRALLGAYKWVHSQMLI 315
           FYI GA LYG+RFPE+++PG+FD+WG SHQ+FH+LVV+AA CHL+ALLG+Y  VH + +I
Sbjct: 253 FYIFGAFLYGIRFPEKMSPGSFDLWGHSHQIFHILVVVAALCHLKALLGSYSLVHYRFMI 312

>NCAS0H01510 Chr8 complement(287981..288922) [942 bp, 313 aa] {ON}
           Anc_6.27
          Length = 313

 Score =  402 bits (1034), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 185/280 (66%), Positives = 223/280 (79%)

Query: 34  EERTRRRLYKWDEIPEWQKDNEHILNGYILETKSVGACLKSLLYLHNESVNIYTHLIPGW 93
           +  T R+LY WDEIPEWQKDNEHI+ GY+ ET S   C  SL Y+HNE+ N+Y+HL+PG 
Sbjct: 34  KTTTIRKLYTWDEIPEWQKDNEHIIAGYVRETNSFRRCFDSLFYIHNETGNVYSHLVPGV 93

Query: 94  CFLLMTLFNQLAIERYETTRMIDYIMIDLFFLGGFTCLMMSSTFHCFKCHSLPVAVLGNK 153
            F L  LF++ AI  +ETT   DY++I+LFFLG FTCL++SSTFHCFK HSL +A  GNK
Sbjct: 94  VFFLTMLFDKYAIVSFETTTFTDYLIINLFFLGAFTCLILSSTFHCFKSHSLKIATFGNK 153

Query: 154 LDYLGIVALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLACTIVSLSDKFRSRDWRPY 213
           LDYLGIV L+VTSM+SILFYGF+DN  +FY FS LT+ FG AC IVSL DKFRSR+WRPY
Sbjct: 154 LDYLGIVVLIVTSMISILFYGFYDNGPFFYGFSLLTLSFGSACAIVSLKDKFRSREWRPY 213

Query: 214 RAALFVAFGLSALFPVIAGICHYGFKVTWTRIQLKWVFLEGVFYILGALLYGVRFPERVA 273
           RA LFVAFGLSA+ P++ G+ +YG   TWTRIQLKWV LEGVFYI GA LYG+RFPE+  
Sbjct: 214 RAGLFVAFGLSAVLPILTGVMYYGPHETWTRIQLKWVVLEGVFYIFGAFLYGIRFPEKYV 273

Query: 274 PGTFDIWGQSHQLFHVLVVIAASCHLRALLGAYKWVHSQM 313
            GTFDIWG SHQ+FH+LVV+AA CHL+ALLG+Y+ VH  +
Sbjct: 274 NGTFDIWGHSHQIFHLLVVVAAFCHLKALLGSYELVHMNL 313

>NDAI0F01740 Chr6 (429141..430082) [942 bp, 313 aa] {ON} Anc_6.27
          Length = 313

 Score =  398 bits (1023), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 184/300 (61%), Positives = 228/300 (76%), Gaps = 7/300 (2%)

Query: 17  EGVMTEETTTLLNGSRIEERTRR---RLYKWDEIPEWQKDNEHILNGYILETKSVGACLK 73
           EG++        NG  IE+  R+   +LY+WDEIPEWQKDNEHI++GY+ ET S   CL 
Sbjct: 18  EGIINNTD----NGDSIEQVKRKVVYKLYRWDEIPEWQKDNEHIISGYVRETNSFKGCLH 73

Query: 74  SLLYLHNESVNIYTHLIPGWCFLLMTLFNQLAIERYETTRMIDYIMIDLFFLGGFTCLMM 133
           SL Y+HNES N+Y+HL+PG  F    + N+  I  Y TT ++DY+MIDLFF G F CL++
Sbjct: 74  SLFYVHNESGNVYSHLLPGVFFFFTMVLNKYGITIYSTTSIVDYLMIDLFFFGAFCCLIL 133

Query: 134 SSTFHCFKCHSLPVAVLGNKLDYLGIVALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFG 193
           SS FHCFK HSL VA LGNKLDYLGIV L+VTSM+SI+++GF DN L+FY FS LT +FG
Sbjct: 134 SSLFHCFKSHSLKVATLGNKLDYLGIVILIVTSMISIMYFGFFDNPLFFYFFSSLTFLFG 193

Query: 194 LACTIVSLSDKFRSRDWRPYRAALFVAFGLSALFPVIAGICHYGFKVTWTRIQLKWVFLE 253
            AC  VSL D FRSR+WRPYRA LFVAFGLSA+ P++AG  +YG + T+ RIQLKW+ LE
Sbjct: 194 GACATVSLKDHFRSREWRPYRAGLFVAFGLSAILPILAGTFYYGIEETFIRIQLKWIILE 253

Query: 254 GVFYILGALLYGVRFPERVAPGTFDIWGQSHQLFHVLVVIAASCHLRALLGAYKWVHSQM 313
           G FYI GA LYGVRFPE+  PG+FDIWG SHQ+FH+LVV+AA CHLR LL +Y+ VHS++
Sbjct: 254 GFFYIFGAFLYGVRFPEKYVPGSFDIWGHSHQIFHILVVVAAFCHLRGLLSSYEIVHSRL 313

>ZYRO0C07612g Chr3 complement(578864..579823) [960 bp, 319 aa] {ON}
           similar to uniprot|Q12442 Saccharomyces cerevisiae
           YOL002C IZH2 Membrane protein involved in zinc
           metabolism member of the four-protein IZH family direct
           target of the Zap1p transcription factor expression
           induced by zinc deficiency and fatty acids deletion
           increases sensitivity to elevated zinc
          Length = 319

 Score =  395 bits (1014), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 182/297 (61%), Positives = 228/297 (76%), Gaps = 6/297 (2%)

Query: 20  MTEETTTLLNGSRIE--ERTRRRLYKWDEIPEWQKDNEHILNGYILETKSVGACLKSLLY 77
           + +E TT+    +IE     ++ LY W+EIP+WQKDNEHI+ GY+ ET S+  CL+SLLY
Sbjct: 23  VNQEQTTI----KIEPVNTQKKLLYTWNEIPDWQKDNEHIVGGYVRETNSIRECLQSLLY 78

Query: 78  LHNESVNIYTHLIPGWCFLLMTLFNQLAIERYETTRMIDYIMIDLFFLGGFTCLMMSSTF 137
           LHNES+NIYTH +PG CFL   +F++ AI+ ++TT  IDY+ ID FF G F+CL++SSTF
Sbjct: 79  LHNESINIYTHFLPGLCFLATCIFDKFAIKNFDTTTWIDYMAIDFFFFGAFSCLILSSTF 138

Query: 138 HCFKCHSLPVAVLGNKLDYLGIVALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLACT 197
           HCFK HS  V+V GNKLDYLGIV L+V SM+SIL+Y FHD+N  FY F+ +   FG++CT
Sbjct: 139 HCFKSHSSRVSVFGNKLDYLGIVILIVCSMISILYYAFHDSNKLFYSFTLIIFCFGVSCT 198

Query: 198 IVSLSDKFRSRDWRPYRAALFVAFGLSALFPVIAGICHYGFKVTWTRIQLKWVFLEGVFY 257
           I S  D FRSR+WRPYRA LFVAFGLSAL P++ GI  YGF  TWTRIQ+KWV LEG+FY
Sbjct: 199 IASFDDTFRSREWRPYRAGLFVAFGLSALLPIMGGIIKYGFHETWTRIQMKWVILEGIFY 258

Query: 258 ILGALLYGVRFPERVAPGTFDIWGQSHQLFHVLVVIAASCHLRALLGAYKWVHSQML 314
           I GA LY +RFPER+APG FD  G SHQ+FHVLVVIAA CHL AL+ +Y+ VH+ +L
Sbjct: 259 IFGAFLYSIRFPERLAPGAFDFVGHSHQIFHVLVVIAALCHLVALMNSYELVHTNLL 315

>Kpol_1032.9 s1032 (22700..23656) [957 bp, 318 aa] {ON}
           (22700..23656) [957 nt, 319 aa]
          Length = 318

 Score =  392 bits (1008), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 173/274 (63%), Positives = 221/274 (80%)

Query: 40  RLYKWDEIPEWQKDNEHILNGYILETKSVGACLKSLLYLHNESVNIYTHLIPGWCFLLMT 99
           +L  W+ +P+WQKDNEHIL+GY+ ET S+ ACL SLL++HNESVNI++HL+P +CF+   
Sbjct: 40  QLVTWEHLPDWQKDNEHILSGYVKETNSIKACLHSLLFIHNESVNIFSHLVPAFCFMTTI 99

Query: 100 LFNQLAIERYETTRMIDYIMIDLFFLGGFTCLMMSSTFHCFKCHSLPVAVLGNKLDYLGI 159
           +F++  +ERY TT + DY+M+DLF  G FTCLMMSS FHC K HS  V+  GNKLDYLGI
Sbjct: 100 IFDKYVVERYPTTTLKDYLMLDLFLFGAFTCLMMSSAFHCLKAHSPYVSSFGNKLDYLGI 159

Query: 160 VALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLACTIVSLSDKFRSRDWRPYRAALFV 219
           V L+V+SM SIL+YGF+DN+  ++ FS +T  FGL+C +VSL ++FR+R+WRPYRAA+FV
Sbjct: 160 VVLIVSSMSSILYYGFYDNSFLYFTFSAITFTFGLSCAVVSLGERFRAREWRPYRAAMFV 219

Query: 220 AFGLSALFPVIAGICHYGFKVTWTRIQLKWVFLEGVFYILGALLYGVRFPERVAPGTFDI 279
           AFGLSAL P+ AG  +YG + T  R+QLKWV LEGVFYI GALLYGVRFPER+ PG FDI
Sbjct: 220 AFGLSALLPIFAGFLYYGVQETTIRVQLKWVVLEGVFYIFGALLYGVRFPERLKPGMFDI 279

Query: 280 WGQSHQLFHVLVVIAASCHLRALLGAYKWVHSQM 313
           WG SHQLFH+LVV+AA CHLR LLG+Y  VH+++
Sbjct: 280 WGHSHQLFHILVVVAALCHLRGLLGSYTIVHTRL 313

>KNAG0M01240 Chr13 (226766..227710) [945 bp, 314 aa] {ON} Anc_6.27
           YOL002C
          Length = 314

 Score =  392 bits (1006), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 175/306 (57%), Positives = 234/306 (76%), Gaps = 3/306 (0%)

Query: 8   KRKAVGIEPEGVMTEETTTLLNGSRIEERTRRRLYKWDEIPEWQKDNEHILNGYILETKS 67
           +R+ V I    V  ++   +   ++   +  +R+Y W+EIPEWQKDNEHI++GY+ ET S
Sbjct: 6   QRQTVTITEPVVYEDDGGEMKTATK---KITKRIYTWNEIPEWQKDNEHIIDGYVRETNS 62

Query: 68  VGACLKSLLYLHNESVNIYTHLIPGWCFLLMTLFNQLAIERYETTRMIDYIMIDLFFLGG 127
              C+ SL YLHNESVN+Y+HLIP  CF  +   N+  ++ +ETT ++DY+ IDLFFLG 
Sbjct: 63  FLKCVHSLFYLHNESVNVYSHLIPALCFFSVLFLNKYCVKSFETTSLVDYLFIDLFFLGA 122

Query: 128 FTCLMMSSTFHCFKCHSLPVAVLGNKLDYLGIVALVVTSMVSILFYGFHDNNLYFYVFSG 187
           FTCL++SSTFHCFK HSL VA  GNKLDYLGIV L+VTSM+SIL+YGF+D+++ FY FS 
Sbjct: 123 FTCLILSSTFHCFKSHSLKVATFGNKLDYLGIVVLIVTSMISILYYGFYDSSVMFYFFSF 182

Query: 188 LTIMFGLACTIVSLSDKFRSRDWRPYRAALFVAFGLSALFPVIAGICHYGFKVTWTRIQL 247
           +T+ FG AC +VSL D FRSR+WRPYRA LFVAFGLSA+ P+++G+  YG +  + RIQ+
Sbjct: 183 VTLSFGTACGVVSLKDHFRSREWRPYRAGLFVAFGLSAILPILSGMFAYGIEEAFHRIQI 242

Query: 248 KWVFLEGVFYILGALLYGVRFPERVAPGTFDIWGQSHQLFHVLVVIAASCHLRALLGAYK 307
           KW+ LEGVFYILGA LYG+RFPE+ +PG +DIWG SHQ+FH+LVV+AA CHL+ L+ +Y+
Sbjct: 243 KWIILEGVFYILGAFLYGIRFPEKGSPGKYDIWGHSHQVFHILVVVAALCHLKGLMVSYE 302

Query: 308 WVHSQM 313
            VH  +
Sbjct: 303 LVHKGL 308

>KAFR0G02650 Chr7 complement(547561..548526) [966 bp, 321 aa] {ON}
           Anc_6.27 YOL002C
          Length = 321

 Score =  389 bits (1000), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 176/271 (64%), Positives = 218/271 (80%)

Query: 40  RLYKWDEIPEWQKDNEHILNGYILETKSVGACLKSLLYLHNESVNIYTHLIPGWCFLLMT 99
           +LY W+EIP+WQKDNEHI++GY+ ET S  +C++SL YLHNESVN+Y+HLIP  CFL+ +
Sbjct: 39  QLYNWNEIPDWQKDNEHIISGYVKETNSFFSCIESLFYLHNESVNVYSHLIPAVCFLMTS 98

Query: 100 LFNQLAIERYETTRMIDYIMIDLFFLGGFTCLMMSSTFHCFKCHSLPVAVLGNKLDYLGI 159
           L N+  + ++ TT ++DY+ IDLFFLG FTCL++SSTFHCFK HSL +A  GNKLDYLGI
Sbjct: 99  LLNKTIVPKFRTTTVLDYLYIDLFFLGAFTCLILSSTFHCFKSHSLRIATFGNKLDYLGI 158

Query: 160 VALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLACTIVSLSDKFRSRDWRPYRAALFV 219
           V L+ TSM+S+L+YGF+D    FYVF+ +T+ FGLAC  VSL DKFRSR+ R YRA LFV
Sbjct: 159 VVLISTSMISLLYYGFYDTPSLFYVFAFITLSFGLACATVSLKDKFRSRECRAYRATLFV 218

Query: 220 AFGLSALFPVIAGICHYGFKVTWTRIQLKWVFLEGVFYILGALLYGVRFPERVAPGTFDI 279
            FGLSA+ PVI G+ HYGF  TW RIQLKWV LEGVFYI GA LYG+RFPE+  PG +DI
Sbjct: 219 CFGLSAVLPVICGLYHYGFYNTWHRIQLKWVLLEGVFYIFGAFLYGIRFPEKYTPGKYDI 278

Query: 280 WGQSHQLFHVLVVIAASCHLRALLGAYKWVH 310
           WG SHQLFH+LVVIAA CH +AL+ +Y+ VH
Sbjct: 279 WGHSHQLFHILVVIAALCHFKALMCSYEHVH 309

>TDEL0G04420 Chr7 complement(802412..803380) [969 bp, 322 aa] {ON}
           Anc_6.27 YOL002C
          Length = 322

 Score =  389 bits (1000), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 184/316 (58%), Positives = 233/316 (73%), Gaps = 5/316 (1%)

Query: 5   GLTKRKAVGI---EPEGVMTEETTTLLNGSRIEE--RTRRRLYKWDEIPEWQKDNEHILN 59
            L KR    +   +   V  EET+  + G + ++  + +R+LY WDEIP WQ+DNEHIL+
Sbjct: 4   SLKKRSQCSLTTDQTSTVTKEETSGPVKGQKTDKMSKKKRKLYTWDEIPHWQRDNEHILS 63

Query: 60  GYILETKSVGACLKSLLYLHNESVNIYTHLIPGWCFLLMTLFNQLAIERYETTRMIDYIM 119
           GY+ ET+S+  C  SL YLHNESVNIYTHL+PG  FL +  F++ A+ ++ETT +IDY+M
Sbjct: 64  GYVGETRSMFQCFLSLFYLHNESVNIYTHLLPGIAFLFVLCFDKFAVTQFETTTLIDYVM 123

Query: 120 IDLFFLGGFTCLMMSSTFHCFKCHSLPVAVLGNKLDYLGIVALVVTSMVSILFYGFHDNN 179
           IDLF L  FTCL +SS FHC K HS  VA  GNKLDYLGIV LVVTSMVSI++YGF +  
Sbjct: 124 IDLFSLVSFTCLTLSSIFHCLKNHSRSVATFGNKLDYLGIVVLVVTSMVSIMYYGFFETP 183

Query: 180 LYFYVFSGLTIMFGLACTIVSLSDKFRSRDWRPYRAALFVAFGLSALFPVIAGICHYGFK 239
             FY+FS +T  FG AC +VSL + FR+R+WRPYRAA+FVAFGLSA+ P++ GI +YGF 
Sbjct: 184 ALFYLFSFITCTFGAACAVVSLKEGFRTREWRPYRAAMFVAFGLSAVLPIVTGIFYYGFS 243

Query: 240 VTWTRIQLKWVFLEGVFYILGALLYGVRFPERVAPGTFDIWGQSHQLFHVLVVIAASCHL 299
             + RIQ+KWV L G+FYI GA+LYGVRFPE+ APG +DIWG SHQLFHVLVV+AA CHL
Sbjct: 244 EIYLRIQVKWVLLGGIFYITGAVLYGVRFPEKYAPGKYDIWGHSHQLFHVLVVVAALCHL 303

Query: 300 RALLGAYKWVHSQMLI 315
             L+ +Y  VH +M I
Sbjct: 304 YGLIKSYNLVHLKMAI 319

>KLLA0D01331g Chr4 (117469..118395) [927 bp, 308 aa] {ON} similar to
           uniprot|Q12442 Saccharomyces cerevisiae YOL002C IZH2
           Membrane protein involved in zinc metabolism member of
           the four-protein IZH family direct target of the Zap1p
           transcription factor expression induced by zinc
           deficiency and fatty acids deletion increases
           sensitivity to elevated zinc
          Length = 308

 Score =  389 bits (998), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 189/309 (61%), Positives = 221/309 (71%), Gaps = 4/309 (1%)

Query: 6   LTKRKAVGIEPEGVMTEETTTLLNGSRIEERTRRRLYKWDEIPEWQKDNEHILNGYILET 65
           ++ RK   +  E  + EET       R+ ER   R+Y WDEIP+WQKDNEHIL+GY+ ET
Sbjct: 1   MSTRKRSVVTEETALIEETPGTKKTVRVYER---RVYSWDEIPDWQKDNEHILHGYVRET 57

Query: 66  KSVGACLKSLLYLHNESVNIYTHLIPGWCFLLMTLF-NQLAIERYETTRMIDYIMIDLFF 124
           +S      SL YLHNESVNIYTHLIP      + LF     I  Y TT  IDY MI+LFF
Sbjct: 58  QSWKELFHSLFYLHNESVNIYTHLIPAVALFFIMLFATHHVINEYPTTSAIDYFMINLFF 117

Query: 125 LGGFTCLMMSSTFHCFKCHSLPVAVLGNKLDYLGIVALVVTSMVSILFYGFHDNNLYFYV 184
            G  TCL MSS FH  KCHSLP+A  GNKLDYLGIV L+ TSM+SILFYGFHD++L FY 
Sbjct: 118 FGCATCLTMSSMFHTIKCHSLPIATFGNKLDYLGIVVLISTSMISILFYGFHDSSLLFYP 177

Query: 185 FSGLTIMFGLACTIVSLSDKFRSRDWRPYRAALFVAFGLSALFPVIAGICHYGFKVTWTR 244
           F+GLT +FGL C  +SL DKFRSR+WRPYRA +FV FGLSA+FP++AG   YG   TW R
Sbjct: 178 FAGLTSLFGLICGYMSLKDKFRSREWRPYRATMFVLFGLSAVFPIVAGFIVYGKDETWKR 237

Query: 245 IQLKWVFLEGVFYILGALLYGVRFPERVAPGTFDIWGQSHQLFHVLVVIAASCHLRALLG 304
           +QL WV  EGV YI GA LYGVRFPER+APG FDIWG SHQLFHVLVV+AA CHL+AL+ 
Sbjct: 238 VQLTWVIWEGVLYIFGAFLYGVRFPERLAPGKFDIWGHSHQLFHVLVVVAALCHLKALVV 297

Query: 305 AYKWVHSQM 313
           +Y  VH  +
Sbjct: 298 SYGLVHQAL 306

>TBLA0E03060 Chr5 (769031..769990) [960 bp, 319 aa] {ON} Anc_6.27
           YOL002C
          Length = 319

 Score =  385 bits (990), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 178/298 (59%), Positives = 222/298 (74%), Gaps = 5/298 (1%)

Query: 21  TEETTTLLNGSRIEE-----RTRRRLYKWDEIPEWQKDNEHILNGYILETKSVGACLKSL 75
           TEE   LL G   ++      + +RLY WDEIP WQ DNE+I  GY+ ET S+     SL
Sbjct: 14  TEEGVELLYGDNQQQLNTSGSSGKRLYTWDEIPVWQHDNEYIYTGYVRETNSMKESFLSL 73

Query: 76  LYLHNESVNIYTHLIPGWCFLLMTLFNQLAIERYETTRMIDYIMIDLFFLGGFTCLMMSS 135
            Y+HNESVNIYTHLIP +CFL M LFN   ++ + TT   DY+ IDLFF+G FTCL +SS
Sbjct: 74  FYIHNESVNIYTHLIPAFCFLSMLLFNTYGVKPHPTTTYGDYVAIDLFFIGAFTCLGLSS 133

Query: 136 TFHCFKCHSLPVAVLGNKLDYLGIVALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLA 195
           TFHCFK HSL ++V GNKLDYLGIV L+ TS++S+L++G+HD+   FY+FSG+T+ FG+A
Sbjct: 134 TFHCFKSHSLKISVFGNKLDYLGIVILISTSLISVLYFGYHDDPFIFYIFSGITLCFGIA 193

Query: 196 CTIVSLSDKFRSRDWRPYRAALFVAFGLSALFPVIAGICHYGFKVTWTRIQLKWVFLEGV 255
           C I SL DKFR+R+WRPYRAALFV FGLS + P+IAGI  YG +  + R+QLKW+  EGV
Sbjct: 194 CGIASLKDKFRTREWRPYRAALFVLFGLSGVLPIIAGIMKYGIREVFERVQLKWIIWEGV 253

Query: 256 FYILGALLYGVRFPERVAPGTFDIWGQSHQLFHVLVVIAASCHLRALLGAYKWVHSQM 313
            YI GA LYG RFPE+  PG  DIWGQSHQ+FHVLVVIAA CHLR L+G+Y+ VH ++
Sbjct: 254 LYIFGAFLYGARFPEKFMPGKVDIWGQSHQIFHVLVVIAALCHLRGLIGSYELVHQKL 311

>TPHA0M00290 Chr13 (57784..58767) [984 bp, 327 aa] {ON} Anc_6.27
           YOL002C
          Length = 327

 Score =  368 bits (945), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 178/321 (55%), Positives = 227/321 (70%), Gaps = 12/321 (3%)

Query: 6   LTKRKAVGIEPEGVMTEETTTLLNGS--------RIEERTRRRLYK---WDEIPEWQKDN 54
           L KR    I     +TEE  T+ N          +I  R  R+L     WD++P+WQKDN
Sbjct: 7   LQKRNGETIVSSSAVTEEEYTIANDGVKSNKKLVKIIGRFTRQLITITHWDDLPDWQKDN 66

Query: 55  EHILNGYILETKSVGACLKSLLYLHNESVNIYTHLIPGWCFLLMTLFNQLAIERYETTRM 114
           EHI  GY+ ET S   C +SL +LHNESVNIY+H++PG C L M L +   I+++ TT  
Sbjct: 67  EHIHEGYVKETNSFINCFESLFFLHNESVNIYSHMVPGLCALFMLLIDINIIKKFPTTTF 126

Query: 115 IDYIMIDLFFLGGFTCLMMSSTFHCFKCHSLPVAVLGNKLDYLGIVALVVTSMVSILFYG 174
           +DY MIDLF  G F+CL++SS FH  K HSL VA+ GNKLDYLGIV L+VTSM+SIL+YG
Sbjct: 127 VDYFMIDLFLAGAFSCLILSSAFHTLKSHSLFVAIYGNKLDYLGIVILIVTSMISILYYG 186

Query: 175 FHDNNLYFYVFSGLTIMFGLACTIVSLSDKFRSRDWRPYRAALFVAFGLSALFPVIAGIC 234
           F+D   +F++FS +TI+FG+AC  VSL++KFRSR+WRPYRA LFV FGLSA+FPV+ GI 
Sbjct: 187 FYDTPYFFHLFSTITILFGIACGTVSLANKFRSREWRPYRATLFVCFGLSAVFPVLTGIW 246

Query: 235 HYGFKVTWTRIQLKWVFLEGVFYILGALLYGVRFPERVAPGTFDIWGQSHQLFHVLVVIA 294
           +YG + T+ RIQLKW+  EG FYI GA LY +R+PER+ PG FD+WG SHQ+FHV VVIA
Sbjct: 247 YYGLEDTFKRIQLKWIVTEGFFYIFGAFLYAMRYPERICPGAFDLWGHSHQIFHVFVVIA 306

Query: 295 ASCHLRALLGAYKWVHSQMLI 315
           A  H   LL AY++ H +MLI
Sbjct: 307 AYSHFHGLLSAYEYAH-EMLI 326

>Ecym_3031 Chr3 (61592..62578) [987 bp, 328 aa] {ON} similar to
           Ashbya gossypii ACL002C
          Length = 328

 Score =  367 bits (942), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 164/284 (57%), Positives = 214/284 (75%)

Query: 27  LLNGSRIEERTRRRLYKWDEIPEWQKDNEHILNGYILETKSVGACLKSLLYLHNESVNIY 86
           L   + I  +   +L+ W EIPEWQ+DNEHIL GY+ ET S    L SLLYLHNESVNIY
Sbjct: 34  LNQATTIPLKPASKLFSWHEIPEWQRDNEHILGGYVKETNSFKETLHSLLYLHNESVNIY 93

Query: 87  THLIPGWCFLLMTLFNQLAIERYETTRMIDYIMIDLFFLGGFTCLMMSSTFHCFKCHSLP 146
           THLIPG CF  +   N+  I R++TT   DY +ID FF+G F CL+MS T+HC K HS P
Sbjct: 94  THLIPGVCFFCVLFLNKYVISRFKTTTWKDYAIIDTFFVGAFACLVMSGTYHCLKSHSYP 153

Query: 147 VAVLGNKLDYLGIVALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLACTIVSLSDKFR 206
           V+++GN+LDY+GIV L+ TSM S+L+YGF++++  FY FSG+T++ G  CT+V+L  +FR
Sbjct: 154 VSIVGNQLDYIGIVILISTSMFSLLYYGFYNSSKMFYGFSGVTLLLGTICTVVTLDSRFR 213

Query: 207 SRDWRPYRAALFVAFGLSALFPVIAGICHYGFKVTWTRIQLKWVFLEGVFYILGALLYGV 266
           SR WRPYRA++FVAFGLS++ P++A I +YG + TW  +QL W+ LEGV YI GA +YG+
Sbjct: 214 SRLWRPYRASIFVAFGLSSILPILASILYYGSEETWNSVQLGWIILEGVLYIFGAFIYGI 273

Query: 267 RFPERVAPGTFDIWGQSHQLFHVLVVIAASCHLRALLGAYKWVH 310
           RFPE +APG+FDIWG SHQLFHVLVVIAA CH +A+  +Y+ VH
Sbjct: 274 RFPESMAPGSFDIWGHSHQLFHVLVVIAALCHFKAVTQSYELVH 317

>ACL002C Chr3 complement(353449..354438) [990 bp, 329 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL002C
          Length = 329

 Score =  362 bits (928), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 178/319 (55%), Positives = 221/319 (69%), Gaps = 12/319 (3%)

Query: 8   KRKAVGIEPEG-----VMTEETTTLLNGSRIEERTR-------RRLYKWDEIPEWQKDNE 55
           K++   + PE        T+ETT L +G+     T          L  WD++P+WQKDNE
Sbjct: 7   KQRVKFVAPENDTASSYSTKETTFLQDGTVAAAITATRAIREVSSLCSWDDLPDWQKDNE 66

Query: 56  HILNGYILETKSVGACLKSLLYLHNESVNIYTHLIPGWCFLLMTLFNQLAIERYETTRMI 115
           HIL+GY+ ET S     +SL YLHNESVNIY+HLIPG CFL + LFN+  +  Y TT   
Sbjct: 67  HILSGYVRETNSYRKTFRSLFYLHNESVNIYSHLIPGICFLFIALFNKYVVADYSTTTWK 126

Query: 116 DYIMIDLFFLGGFTCLMMSSTFHCFKCHSLPVAVLGNKLDYLGIVALVVTSMVSILFYGF 175
           DY+MID+F LG   CL +S  +HC K HSL V+V GNKLDY+GIVAL+  SM+S ++YGF
Sbjct: 127 DYLMIDIFLLGAVVCLTLSGVYHCMKSHSLEVSVFGNKLDYIGIVALISCSMISQMYYGF 186

Query: 176 HDNNLYFYVFSGLTIMFGLACTIVSLSDKFRSRDWRPYRAALFVAFGLSALFPVIAGICH 235
           +D+   F +FS +T+   LAC +VSLS  FRSR+WR YRAA+F AFGLS L PVI    +
Sbjct: 187 YDSTAMFSLFSTVTLSLALACAVVSLSPHFRSREWRKYRAAIFTAFGLSGLLPVITSCFY 246

Query: 236 YGFKVTWTRIQLKWVFLEGVFYILGALLYGVRFPERVAPGTFDIWGQSHQLFHVLVVIAA 295
           YG    ++RIQLKW+ LEGV YI GA+LYGVRFPE++ PG+FDIWG SHQLFHVLVVIAA
Sbjct: 247 YGPIEAYSRIQLKWLSLEGVLYISGAVLYGVRFPEKLEPGSFDIWGHSHQLFHVLVVIAA 306

Query: 296 SCHLRALLGAYKWVHSQML 314
            CHLRALL  YK VH+  L
Sbjct: 307 LCHLRALLSCYKNVHTNAL 325

>Smik_15.168 Chr15 complement(290724..291707) [984 bp, 327 aa] {ON}
           YOL002C (REAL)
          Length = 327

 Score =  359 bits (921), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 169/290 (58%), Positives = 217/290 (74%), Gaps = 2/290 (0%)

Query: 26  TLLNGSRIEERTR--RRLYKWDEIPEWQKDNEHILNGYILETKSVGACLKSLLYLHNESV 83
           T  N + + E  +  +RLY WDEIPEWQ+DN+ IL+GY+ ET S     KSL YLHNESV
Sbjct: 32  TSANPAEVAEAKKVLKRLYSWDEIPEWQRDNDFILHGYVRETSSFIETFKSLFYLHNESV 91

Query: 84  NIYTHLIPGWCFLLMTLFNQLAIERYETTRMIDYIMIDLFFLGGFTCLMMSSTFHCFKCH 143
           NIY+HL+P   F  + L ++  I+ +ETT   D+++IDLF+ G F CL++SS+FHC K H
Sbjct: 92  NIYSHLVPALGFFTVLLLDKSTIKVFETTTWKDHVVIDLFYSGAFACLILSSSFHCLKSH 151

Query: 144 SLPVAVLGNKLDYLGIVALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLACTIVSLSD 203
           SL +A LGNKLDYLGI  L+VTSMVSILFYG+++    F +F+ +T+ FG+AC+IVSL D
Sbjct: 152 SLRIATLGNKLDYLGICILIVTSMVSILFYGYYEKFSLFCLFALITVSFGVACSIVSLKD 211

Query: 204 KFRSRDWRPYRAALFVAFGLSALFPVIAGICHYGFKVTWTRIQLKWVFLEGVFYILGALL 263
           KFR R+WRPYRA LFV FGLS++ P+ +G+  Y F   WT+IQL WV L GV YI+GA+L
Sbjct: 212 KFRKREWRPYRAGLFVCFGLSSIVPIFSGLYCYSFSEIWTQIQLFWVLLGGVLYIIGAVL 271

Query: 264 YGVRFPERVAPGTFDIWGQSHQLFHVLVVIAASCHLRALLGAYKWVHSQM 313
           YG+RFPE+V PG FDIWG SHQLFH LVVIA+ CHLR LL +Y+ VH +M
Sbjct: 272 YGMRFPEKVCPGKFDIWGHSHQLFHFLVVIASLCHLRGLLNSYELVHIKM 321

>YOL002C Chr15 complement(323411..324364) [954 bp, 317 aa] {ON}
           IZH2Plasma membrane protein involved in zinc homeostasis
           and osmotin-induced apoptosis; transcription regulated
           by Zap1p, zinc and fatty acid levels; similar to
           mammalian adiponectins; deletion increases sensitivity
           to elevated zinc
          Length = 317

 Score =  357 bits (916), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 166/279 (59%), Positives = 212/279 (75%)

Query: 35  ERTRRRLYKWDEIPEWQKDNEHILNGYILETKSVGACLKSLLYLHNESVNIYTHLIPGWC 94
           ++  RRLY WDEIPEWQ+DN+ IL+GY+ ET S     KSL YLHNESVNIY+HLIP   
Sbjct: 33  KKVLRRLYSWDEIPEWQRDNDFILHGYVKETSSFIETFKSLFYLHNESVNIYSHLIPALG 92

Query: 95  FLLMTLFNQLAIERYETTRMIDYIMIDLFFLGGFTCLMMSSTFHCFKCHSLPVAVLGNKL 154
           F  + L ++  I+ + TT  +D+++IDLF+ G F CL++SS+FHC K HSL +A LGNKL
Sbjct: 93  FFTVLLLDKSTIKVFATTTWLDHMVIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNKL 152

Query: 155 DYLGIVALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLACTIVSLSDKFRSRDWRPYR 214
           DYLGI  L+VTSMVSIL+YG+ +    F +F+ +T+ FG+AC+IVSL DKFR R+WRPYR
Sbjct: 153 DYLGICILIVTSMVSILYYGYFEKFSLFCLFALITVSFGIACSIVSLKDKFRKREWRPYR 212

Query: 215 AALFVAFGLSALFPVIAGICHYGFKVTWTRIQLKWVFLEGVFYILGALLYGVRFPERVAP 274
           A LFV FGLS++ P+ +G+  Y F   WT+IQL WV L GV YI+GA+LYG+RFPE++ P
Sbjct: 213 AGLFVCFGLSSIIPIFSGLYCYSFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKICP 272

Query: 275 GTFDIWGQSHQLFHVLVVIAASCHLRALLGAYKWVHSQM 313
           G FDIWG SHQLFH LVVIAA CHLR LL +Y+ VH +M
Sbjct: 273 GKFDIWGHSHQLFHFLVVIAALCHLRGLLNSYELVHIKM 311

>Skud_15.160 Chr15 complement(283003..283986) [984 bp, 327 aa] {ON}
           YOL002C (REAL)
          Length = 327

 Score =  355 bits (911), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 169/308 (54%), Positives = 222/308 (72%), Gaps = 13/308 (4%)

Query: 8   KRKAVGIEPEGVMTEETTTLLNGSRIEERTR--RRLYKWDEIPEWQKDNEHILNGYILET 65
           K++A G  P            N + + E  +  +RLY WDEIPEWQ+DN++IL+GY+ ET
Sbjct: 25  KKRAAGKTPA-----------NPAEVAEAKKVLKRLYSWDEIPEWQRDNDYILHGYVRET 73

Query: 66  KSVGACLKSLLYLHNESVNIYTHLIPGWCFLLMTLFNQLAIERYETTRMIDYIMIDLFFL 125
            S     KSL Y+HNESVNIY+HLIP   F  + L ++  I+ +ETT   D+++IDLF+ 
Sbjct: 74  CSFVETFKSLFYMHNESVNIYSHLIPALGFFTVLLLDKSTIKVFETTTWKDHMIIDLFYS 133

Query: 126 GGFTCLMMSSTFHCFKCHSLPVAVLGNKLDYLGIVALVVTSMVSILFYGFHDNNLYFYVF 185
           G F CL++SS+FHC K HSL +A LGNKLDYLGI  L+VTSM SIL+YG+++    F +F
Sbjct: 134 GAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMTSILYYGYYEKFSLFCLF 193

Query: 186 SGLTIMFGLACTIVSLSDKFRSRDWRPYRAALFVAFGLSALFPVIAGICHYGFKVTWTRI 245
           + +T+ FG+AC+IV+L DKFR R+WRPYRA LFV FGLS++ P+ +G+  Y F   WT+I
Sbjct: 194 ALITVSFGIACSIVTLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYCYTFSEIWTQI 253

Query: 246 QLKWVFLEGVFYILGALLYGVRFPERVAPGTFDIWGQSHQLFHVLVVIAASCHLRALLGA 305
           QL WV L GV YI+GA+LYG+RFPE+V PG FDIWG SHQLFH LVVIA+ CHLR LL +
Sbjct: 254 QLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIWGHSHQLFHFLVVIASFCHLRGLLNS 313

Query: 306 YKWVHSQM 313
           Y+ VH +M
Sbjct: 314 YELVHLKM 321

>Suva_15.173 Chr15 complement(297915..298898) [984 bp, 327 aa] {ON}
           YOL002C (REAL)
          Length = 327

 Score =  352 bits (903), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 165/279 (59%), Positives = 215/279 (77%)

Query: 35  ERTRRRLYKWDEIPEWQKDNEHILNGYILETKSVGACLKSLLYLHNESVNIYTHLIPGWC 94
           ++  +R+Y WDEIPEWQ+DN++IL+GY+ ET S     KSL Y+HNESVNIY+HLIP   
Sbjct: 43  KKVLKRVYSWDEIPEWQRDNDYILHGYVKETSSFVDTFKSLFYMHNESVNIYSHLIPAVG 102

Query: 95  FLLMTLFNQLAIERYETTRMIDYIMIDLFFLGGFTCLMMSSTFHCFKCHSLPVAVLGNKL 154
           FL + L ++  I  +ETT  +D++MIDLFF G F CL++SS+FHCFK HSL +A LGNKL
Sbjct: 103 FLTVLLLDKTTITVFETTTWLDHMMIDLFFTGAFACLILSSSFHCFKSHSLKIATLGNKL 162

Query: 155 DYLGIVALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLACTIVSLSDKFRSRDWRPYR 214
           DYLGI  L+VTSMVSIL+YG++D    F +F+ +T+ FG+AC+IVSL DKFR R+WRPYR
Sbjct: 163 DYLGICILIVTSMVSILYYGYYDKFPAFCLFALITVSFGIACSIVSLKDKFRKREWRPYR 222

Query: 215 AALFVAFGLSALFPVIAGICHYGFKVTWTRIQLKWVFLEGVFYILGALLYGVRFPERVAP 274
           A LFV FGLS++ P+ +G+ +Y F   W +IQL WV L G  YI+GA+LYG+RFPE+V P
Sbjct: 223 AGLFVCFGLSSIVPIFSGLYYYSFSEIWNQIQLFWVLLGGALYIIGAVLYGMRFPEKVYP 282

Query: 275 GTFDIWGQSHQLFHVLVVIAASCHLRALLGAYKWVHSQM 313
           G FDIWG SHQLFH LVVIA+ CH+R +L +Y+ VH +M
Sbjct: 283 GRFDIWGHSHQLFHFLVVIASLCHMRGVLNSYELVHIKM 321

>SAKL0C09218g Chr3 (839747..840691) [945 bp, 314 aa] {ON} similar to
           uniprot|Q6Q557 Saccharomyces cerevisiae YDR492W IZH1
           Membrane protein involved in zinc metabolism member of
           the four-protein IZH family transcription is regulated
           directly by Zap1p expression induced by zinc deficiency
           and fatty acids deletion increases sensitivity to
           elevated zinc
          Length = 314

 Score =  306 bits (784), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 140/278 (50%), Positives = 202/278 (72%), Gaps = 2/278 (0%)

Query: 36  RTRRRLYKWDEIPEWQKDNEHILNGYILETKSVGACLKSLLYLHNESVNIYTHLIPGWCF 95
           + R+RL  ++E+P+WQKDNE IL+GY+ ET+SV  C KSLLY HNE+VNIYTHL+PG  +
Sbjct: 26  KGRKRLCTFEELPDWQKDNELILDGYVRETRSVSECFKSLLYFHNETVNIYTHLVPGVTY 85

Query: 96  LLMTLF--NQLAIERYETTRMIDYIMIDLFFLGGFTCLMMSSTFHCFKCHSLPVAVLGNK 153
           LLM +F  + + I ++ ++ M DYI+I+ F LG F CLM SS FHC K HS   + + +K
Sbjct: 86  LLMLMFLTDFILIPKFPSSTMTDYIIINFFLLGAFVCLMCSSCFHCLKQHSEEHSDIWSK 145

Query: 154 LDYLGIVALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLACTIVSLSDKFRSRDWRPY 213
           +DY+GI+ L+  SMVSIL+YGFHD+  +F +F+ +T++ G  C    L+D+F S+++R +
Sbjct: 146 VDYMGIIVLISCSMVSILYYGFHDHLFHFKIFTVVTVILGSCCAAFVLNDRFNSKNFRVF 205

Query: 214 RAALFVAFGLSALFPVIAGICHYGFKVTWTRIQLKWVFLEGVFYILGALLYGVRFPERVA 273
           RA+ FV+FG S L P+I G+  +G   +  R+QLK+V LE VFYI GA+ YG R PE   
Sbjct: 206 RASFFVSFGFSGLVPIIFGLVKFGISESVHRVQLKYVGLEAVFYIGGAVFYGFRIPENFG 265

Query: 274 PGTFDIWGQSHQLFHVLVVIAASCHLRALLGAYKWVHS 311
           PG FD+ G SHQ+FHV+VV+ + CHLRA++G+Y ++H+
Sbjct: 266 PGKFDLVGHSHQIFHVMVVLGSLCHLRAVVGSYIFMHT 303

>ZYRO0B06556g Chr2 (526478..527434) [957 bp, 318 aa] {ON} similar to
           uniprot|Q6Q557 Saccharomyces cerevisiae YDR492W IZH1
           Membrane protein involved in zinc metabolism member of
           the four-protein IZH family transcription is regulated
           directly by Zap1p expression induced by zinc deficiency
           and fatty acids deletion increases sensitivity to
           elevated zinc
          Length = 318

 Score =  288 bits (736), Expect = 6e-96,   Method: Compositional matrix adjust.
 Identities = 140/283 (49%), Positives = 196/283 (69%), Gaps = 5/283 (1%)

Query: 33  IEERTRRRLYKWDEIPEWQKDNEHILNGYILETKSVGACLKSLLYLHNESVNIYTHLIPG 92
           +EE+T   LY + E+PEWQ+DN+ IL GYI ETKSV  C++SL   +NE+VNIYTHL+  
Sbjct: 27  LEEKT---LYDFHELPEWQQDNDKILTGYIRETKSVLKCVRSLFIWNNETVNIYTHLVSA 83

Query: 93  WCFLLMTL--FNQLAIERYETTRMIDYIMIDLFFLGGFTCLMMSSTFHCFKCHSLPVAVL 150
             + L+ L   + + +  + T+   DY +I+ + LG F CLM SS FH FK HS P +  
Sbjct: 84  VSYFLLMLGITDLVMVPHFPTSTFTDYSVINFYLLGAFGCLMCSSCFHTFKQHSGPHSDA 143

Query: 151 GNKLDYLGIVALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLACTIVSLSDKFRSRDW 210
            +K+DY+GI+ L+  SM+S+++YGF D+  YF +F+ LT+    ACT+  LSDKF  +D+
Sbjct: 144 WSKVDYMGIIVLITCSMISLIYYGFFDHMEYFRLFTVLTLTLATACTVCVLSDKFNHKDF 203

Query: 211 RPYRAALFVAFGLSALFPVIAGICHYGFKVTWTRIQLKWVFLEGVFYILGALLYGVRFPE 270
           RP RA  F+AFGLS +FPV AGI  +G +    R+QLK++ LE +FYI GAL+YG R PE
Sbjct: 204 RPLRAGFFIAFGLSGVFPVAAGIIKFGIQGGVQRVQLKYLGLEAIFYIAGALIYGFRIPE 263

Query: 271 RVAPGTFDIWGQSHQLFHVLVVIAASCHLRALLGAYKWVHSQM 313
            + PG FD WG SHQ+FHVLVVIA+  HL+A++G+Y + HS +
Sbjct: 264 TMFPGRFDFWGHSHQIFHVLVVIASFLHLKAVMGSYIFKHSHL 306

>TDEL0D05340 Chr4 (969608..970558) [951 bp, 316 aa] {ON} Anc_3.90
           YOL101C
          Length = 316

 Score =  286 bits (732), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 136/306 (44%), Positives = 204/306 (66%), Gaps = 12/306 (3%)

Query: 20  MTEETTTLLNGSRIEERTR----------RRLYKWDEIPEWQKDNEHILNGYILETKSVG 69
           M+  TT     + ++E  +          ++LY ++E+PEWQ+DN+ IL GY+ ETKSV 
Sbjct: 1   MSSTTTIRQRKTTVQETQKARDSKDGIMGKKLYHFNELPEWQQDNDKILTGYVRETKSVL 60

Query: 70  ACLKSLLYLHNESVNIYTHLIPGWCFLLMTLF--NQLAIERYETTRMIDYIMIDLFFLGG 127
            CL SL Y +NESVNIYTHL+    + ++ LF  + L I  + +T M DYI+I+ + LG 
Sbjct: 61  RCLDSLSYWNNESVNIYTHLLSAVAYFVLLLFFTDILLIPSFPSTTMTDYIIINFYLLGA 120

Query: 128 FTCLMMSSTFHCFKCHSLPVAVLGNKLDYLGIVALVVTSMVSILFYGFHDNNLYFYVFSG 187
           F CLM SS FHCFK HS   +   +K+DY+GI+ L+  S++S+L+YG+ D+  YF +FS 
Sbjct: 121 FVCLMCSSCFHCFKQHSNSQSDAWSKVDYMGIIGLISCSVISLLYYGYFDHVFYFKLFSV 180

Query: 188 LTIMFGLACTIVSLSDKFRSRDWRPYRAALFVAFGLSALFPVIAGICHYGFKVTWTRIQL 247
           +T++  +AC++  LSD+F + D RP RA+ F+ F  S++ P+  G+  +G+   + R+QL
Sbjct: 181 ITVVLAMACSVCVLSDRFNTSDMRPLRASFFITFAFSSVIPIATGMFKFGWTEVFHRVQL 240

Query: 248 KWVFLEGVFYILGALLYGVRFPERVAPGTFDIWGQSHQLFHVLVVIAASCHLRALLGAYK 307
           ++V  E  FY+ GALLYG R PE +APG FD  G SHQLFHVLVV+ + CHLRA++G+Y 
Sbjct: 241 RFVGWEAFFYLSGALLYGYRIPETIAPGKFDFIGSSHQLFHVLVVLGSFCHLRAVMGSYM 300

Query: 308 WVHSQM 313
           ++H+ +
Sbjct: 301 FMHAHI 306

>CAGL0G04631g Chr7 (441149..442099) [951 bp, 316 aa] {ON} similar to
           uniprot|Q03419 Saccharomyces cerevisiae YDR492w
          Length = 316

 Score =  284 bits (727), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 131/283 (46%), Positives = 196/283 (69%), Gaps = 2/283 (0%)

Query: 34  EERTRRRLYKWDEIPEWQKDNEHILNGYILETKSVGACLKSLLYLHNESVNIYTHLIPGW 93
           EE++ + L+ ++E+PEWQKDN+ IL GY+ ET S   CL+SLLYL+NESVNIYTHLIP  
Sbjct: 31  EEKSEKLLWHFNELPEWQKDNDKILRGYVRETNSFKRCLQSLLYLNNESVNIYTHLIPAV 90

Query: 94  CFLLMTLF--NQLAIERYETTRMIDYIMIDLFFLGGFTCLMMSSTFHCFKCHSLPVAVLG 151
            ++ ++L+  N   I  Y +T  +DY++I++FFLG F CL+ SS FHC K HS     + 
Sbjct: 91  FYISLSLYLANVFLIPVYPSTSSVDYVIINVFFLGAFFCLLCSSCFHCMKQHSESQCNVW 150

Query: 152 NKLDYLGIVALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLACTIVSLSDKFRSRDWR 211
           +KLDYLGI+ L+  S V +++YG+ D+   F +F+G+T++  + C++  L+DKF + ++R
Sbjct: 151 SKLDYLGIICLISCSTVPMIYYGYFDHISEFTIFTGITLLLAIGCSVFVLTDKFNTTEYR 210

Query: 212 PYRAALFVAFGLSALFPVIAGICHYGFKVTWTRIQLKWVFLEGVFYILGALLYGVRFPER 271
           P RA+ F  FG S + P+ AG   +G +    RI L ++ LE +FYI GA++YG RFPE 
Sbjct: 211 PIRASFFTLFGFSGIIPLGAGFLKFGAEGVLQRISLPFIGLEALFYISGAIIYGFRFPET 270

Query: 272 VAPGTFDIWGQSHQLFHVLVVIAASCHLRALLGAYKWVHSQML 314
           +APG FD +G SHQ+FH++VV+ + CHL A++ +Y  +HS  L
Sbjct: 271 IAPGKFDFFGSSHQIFHIMVVLGSICHLFAMVESYHLIHSNFL 313

>Kwal_56.22704 s56 (244431..245393) [963 bp, 320 aa] {ON} YDR492W -
           Hypothetical ORF [contig 184] FULL
          Length = 320

 Score =  284 bits (726), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 128/285 (44%), Positives = 191/285 (67%), Gaps = 2/285 (0%)

Query: 29  NGSRIEERTRRRLYKWDEIPEWQKDNEHILNGYILETKSVGACLKSLLYLHNESVNIYTH 88
           N    E+  +  L +++E+PEWQ+DNE IL GY+ ET+S+  CL+SL Y HNE++NIYTH
Sbjct: 23  NSKSAEQTKKSALCRFEELPEWQRDNEKILAGYVRETRSMRKCLESLTYFHNETLNIYTH 82

Query: 89  LIPGWCFLLMTLF--NQLAIERYETTRMIDYIMIDLFFLGGFTCLMMSSTFHCFKCHSLP 146
           LIP   +L++ +F  +   I  + +T M DYIMI+ + LG F CL+ S+ FHC K HS  
Sbjct: 83  LIPSGTYLVLLMFFTDVFLIPHFPSTTMSDYIMINFYLLGAFLCLLCSTCFHCLKQHSEA 142

Query: 147 VAVLGNKLDYLGIVALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLACTIVSLSDKFR 206
            + + +K+DY+GI+ L+  S VS+L+YGFHD   +F +F+   ++ G  C    L+D+F 
Sbjct: 143 QSNIWSKVDYMGIIVLISCSTVSLLYYGFHDYLFHFKIFTIAVVVLGSCCAAFVLNDRFN 202

Query: 207 SRDWRPYRAALFVAFGLSALFPVIAGICHYGFKVTWTRIQLKWVFLEGVFYILGALLYGV 266
           +++WR  RA  FV FG S + P+I G+  +G   +  R+QL++V LE  FYI GA++YG 
Sbjct: 203 AKNWRACRAGFFVTFGFSGIVPIIMGLVKFGVAESSKRVQLRFVLLEAFFYIGGAIIYGF 262

Query: 267 RFPERVAPGTFDIWGQSHQLFHVLVVIAASCHLRALLGAYKWVHS 311
           R PE + PG FD  G SHQ+FH+LVV+ + CH RAL+G+Y ++H+
Sbjct: 263 RIPETLIPGKFDFVGHSHQIFHILVVLGSLCHFRALIGSYFFMHT 307

>TPHA0A00640 Chr1 complement(115042..116025) [984 bp, 327 aa] {ON}
           Anc_3.90 YOL101C
          Length = 327

 Score =  283 bits (725), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 132/296 (44%), Positives = 199/296 (67%), Gaps = 2/296 (0%)

Query: 20  MTEETTTLLNGSRIEERTRRRLYKWDEIPEWQKDNEHILNGYILETKSVGACLKSLLYLH 79
           +++  T LL  + I E   ++LY + E+PEWQKDNE I+ GY+ ET S   C  SL Y H
Sbjct: 24  VSKNGTVLLESTEIVETYSKKLYSFHELPEWQKDNELIIQGYVRETNSWFKCFHSLSYFH 83

Query: 80  NESVNIYTHLIPGWCFLLMTLF--NQLAIERYETTRMIDYIMIDLFFLGGFTCLMMSSTF 137
           NES+NIYTHLIPG  + +M LF  + L +  + +T ++DYI+ID + LG F CL+ SS F
Sbjct: 84  NESINIYTHLIPGLVYFIMLLFYTDLLVVPSFPSTTIMDYIVIDFYLLGAFICLVGSSCF 143

Query: 138 HCFKCHSLPVAVLGNKLDYLGIVALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLACT 197
           HC K HS   +   +K+DY+GI+ L+  S++S+L+YG+ D+ +YF VF+ +T++    CT
Sbjct: 144 HCLKQHSEDQSNFWSKIDYVGIICLISCSLISLLYYGYFDHFIYFKVFTLITLILATICT 203

Query: 198 IVSLSDKFRSRDWRPYRAALFVAFGLSALFPVIAGICHYGFKVTWTRIQLKWVFLEGVFY 257
           +  L ++F ++++RP RA  FV F  SA+ P+  G+  + +     RIQL++V  E  FY
Sbjct: 204 VCVLDERFNAKNFRPIRAGFFVVFATSAVIPICTGLIKFDYVEVINRIQLRFVGWETFFY 263

Query: 258 ILGALLYGVRFPERVAPGTFDIWGQSHQLFHVLVVIAASCHLRALLGAYKWVHSQM 313
           ++GALLYG R PE  APG FD+ G SHQ+FHV+VVI +  HL+A++G+Y+++H  +
Sbjct: 264 VVGALLYGYRIPEIFAPGRFDLVGSSHQIFHVMVVIGSLFHLKAVIGSYEFMHKSL 319

>KLTH0C09504g Chr3 complement(788442..789401) [960 bp, 319 aa] {ON}
           similar to uniprot|Q6Q557 Saccharomyces cerevisiae
           YDR492W IZH1 Membrane protein involved in zinc
           metabolism member of the four-protein IZH family
           transcription is regulated directly by Zap1p expression
           induced by zinc deficiency and fatty acids deletion
           increases sensitivity to elevated zinc
          Length = 319

 Score =  277 bits (709), Expect = 7e-92,   Method: Compositional matrix adjust.
 Identities = 127/276 (46%), Positives = 187/276 (67%), Gaps = 2/276 (0%)

Query: 38  RRRLYKWDEIPEWQKDNEHILNGYILETKSVGACLKSLLYLHNESVNIYTHLIPGWCFLL 97
           +  L  ++E+P+WQ+DN+ IL GY+ ET S+  C +SL Y HNE+VNIYTHLIP   +L+
Sbjct: 31  KNGLCCFEELPDWQRDNDKILAGYVRETNSMKKCFESLTYFHNETVNIYTHLIPSGTYLV 90

Query: 98  MTLF--NQLAIERYETTRMIDYIMIDLFFLGGFTCLMMSSTFHCFKCHSLPVAVLGNKLD 155
           M +F  +   I ++ TT M DYIMI+ F LG F CLM S+ FHC K HS   + + +K+D
Sbjct: 91  MLMFFTDLFLIPQFPTTTMSDYIMINFFLLGAFLCLMCSTCFHCLKQHSEAQSNIWSKVD 150

Query: 156 YLGIVALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLACTIVSLSDKFRSRDWRPYRA 215
           Y+GI+ L+  S VS+L+YGF+D   +F +F+   ++ G  C    L+D+F +++WR  RA
Sbjct: 151 YMGIIVLISCSTVSLLYYGFYDYLFHFKMFTIAVVVLGSCCAAFVLNDRFNAKNWRACRA 210

Query: 216 ALFVAFGLSALFPVIAGICHYGFKVTWTRIQLKWVFLEGVFYILGALLYGVRFPERVAPG 275
             FV FG S + P++ G+  +G   +  R+QL++V LE +FYI GA++YG R PE + PG
Sbjct: 211 GFFVTFGFSGIVPIVVGLVKFGIAESSKRVQLRFVLLEALFYISGAVIYGFRIPETLLPG 270

Query: 276 TFDIWGQSHQLFHVLVVIAASCHLRALLGAYKWVHS 311
            FD  G SHQ+FH+LVV+ + CH RALLG+Y ++H+
Sbjct: 271 KFDFVGHSHQIFHILVVLGSLCHFRALLGSYFFMHT 306

>KLLA0C12441g Chr3 complement(1057427..1058374) [948 bp, 315 aa]
           {ON} similar to uniprot|Q6Q557 Saccharomyces cerevisiae
           YDR492W IZH1 Membrane protein involved in zinc
           metabolism member of the four-protein IZH family
           transcription is regulated directly by Zap1p expression
           induced by zinc deficiency and fatty acids deletion
           increases sensitivity to elevated zinc
          Length = 315

 Score =  276 bits (705), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 134/303 (44%), Positives = 199/303 (65%), Gaps = 13/303 (4%)

Query: 24  TTTLLNGSRIEER-----------TRRRLYKWDEIPEWQKDNEHILNGYILETKSVGACL 72
           TTT+ +   I E+           T +RLY++ E+PEWQ+DN+ I+ GYI ETKSV  C+
Sbjct: 4   TTTIRHRRSISEKLEQLTPVAISSTIKRLYRYSELPEWQQDNDKIITGYIRETKSVKECV 63

Query: 73  KSLLYLHNESVNIYTHLIPG--WCFLLMTLFNQLAIERYETTRMIDYIMIDLFFLGGFTC 130
           KSL   HNES+NIY+HL+P   +  LL+ L +   + ++  + M+  +MI  F LG   C
Sbjct: 64  KSLFLFHNESINIYSHLVPTITYLVLLVGLADMFLVPQFPNSTMMQSVMIHFFLLGSVLC 123

Query: 131 LMMSSTFHCFKCHSLPVAVLGNKLDYLGIVALVVTSMVSILFYGFHDNNLYFYVFSGLTI 190
           L  SS FHC K HS     + +K+DY+GI+ ++  S++S+L+YGFHD+  +F  F+  T+
Sbjct: 124 LGCSSFFHCLKQHSESHCHIWSKVDYMGIIIMITCSIISLLYYGFHDHIFHFKCFTVFTV 183

Query: 191 MFGLACTIVSLSDKFRSRDWRPYRAALFVAFGLSALFPVIAGICHYGFKVTWTRIQLKWV 250
           + G  CT+ +L DKF S+ +RP+RA  +V FGLS + P++ G   +G      R+QLK+V
Sbjct: 184 ILGTICTVFALHDKFNSKTFRPFRAMFYVTFGLSGIVPIVTGFWKFGAYEAIRRVQLKYV 243

Query: 251 FLEGVFYILGALLYGVRFPERVAPGTFDIWGQSHQLFHVLVVIAASCHLRALLGAYKWVH 310
            LE +FYI GA++YG RFPE +APG FD  G SHQ+FH++VV+ + CH RA+LG+Y ++H
Sbjct: 244 LLEAMFYIAGAVIYGFRFPEVLAPGKFDFVGHSHQIFHIMVVLGSICHFRAILGSYVFMH 303

Query: 311 SQM 313
           + M
Sbjct: 304 TGM 306

>Skud_4.766 Chr4 (1354630..1355580) [951 bp, 316 aa] {ON} YDR492W
           (REAL)
          Length = 316

 Score =  275 bits (704), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 132/313 (42%), Positives = 201/313 (64%), Gaps = 10/313 (3%)

Query: 7   TKRKAVGIEPEGVMTEETTTLLNGSRIEERT----RRRLYKWDEIPEWQKDNEHILNGYI 62
           T+R+      E V  + TT  +    ++ +T     + L+ +DE+PEWQKDN+ IL GY+
Sbjct: 6   TRRR----NQESVCCKATTASIKVEAVQSKTASEKEKLLHNFDELPEWQKDNDKILTGYV 61

Query: 63  LETKSVGACLKSLLYLHNESVNIYTHLIPGWCFLL--MTLFNQLAIERYETTRMIDYIMI 120
            ET S   CL+SL Y +NE+VNIYTHL+P   + L  +TL N   I  + +T   DY +I
Sbjct: 62  RETLSWKKCLRSLFYWNNETVNIYTHLVPAIIYFLFAITLTNYFLIPVFPSTSWSDYTVI 121

Query: 121 DLFFLGGFTCLMMSSTFHCFKCHSLPVAVLGNKLDYLGIVALVVTSMVSILFYGFHDNNL 180
           ++F +G F+CLM SS FHC K HS   +   +KLDYLGI++L+  SM+ I+++G+ D+  
Sbjct: 122 NIFLMGAFSCLMCSSCFHCLKQHSEEQSNFWSKLDYLGIISLISCSMIPIIYFGYFDHVS 181

Query: 181 YFYVFSGLTIMFGLACTIVSLSDKFRSRDWRPYRAALFVAFGLSALFPVIAGICHYGFKV 240
           YF +F+ +T++    CT+  L +KF +  +RP+RA  F+ FG S L P+  G   +G + 
Sbjct: 182 YFSLFTTVTLVLATFCTVCVLHEKFNTSTFRPFRAMFFILFGFSGLLPLTTGFFKFGIQG 241

Query: 241 TWTRIQLKWVFLEGVFYILGALLYGVRFPERVAPGTFDIWGQSHQLFHVLVVIAASCHLR 300
              RI++ +VF E +FYI GA++YG R PE +APG FD  G SHQ+FH++VV+ + CHL+
Sbjct: 242 VLNRIKVSFVFWEALFYISGAVIYGFRIPETIAPGKFDFLGSSHQIFHIMVVLGSLCHLK 301

Query: 301 ALLGAYKWVHSQM 313
           A++ +YK +HS +
Sbjct: 302 AIIDSYKLMHSHI 314

>AFR337W Chr6 (1051645..1052598) [954 bp, 317 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR492W (IZH1) and
           YOL101C (IZH4)
          Length = 317

 Score =  275 bits (702), Expect = 7e-91,   Method: Compositional matrix adjust.
 Identities = 136/273 (49%), Positives = 185/273 (67%), Gaps = 2/273 (0%)

Query: 39  RRLYKWDEIPEWQKDNEHILNGYILETKSVGACLKSLLYLHNESVNIYTHLIPGWCFLLM 98
           R+LY +DE+P WQKDNE IL+GY+ ET SV  CL+++ Y +NES+NIYTHLIPG  +L++
Sbjct: 32  RKLYTFDELPAWQKDNELILSGYVRETNSVKECLRAMTYFNNESINIYTHLIPGVAYLVL 91

Query: 99  TL-FNQLAIERY-ETTRMIDYIMIDLFFLGGFTCLMMSSTFHCFKCHSLPVAVLGNKLDY 156
            L F  L + +        ++ M+  + LG FTCL  SS FHC K HS P + L +K+DY
Sbjct: 92  FLIFADLVLAQLLPGLDAGEHRMLRFYLLGAFTCLACSSCFHCLKQHSEPHSRLWSKVDY 151

Query: 157 LGIVALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLACTIVSLSDKFRSRDWRPYRAA 216
           LGI+A +  S +S+L+YG+H    +F  FS LT+    AC ++ L+D F +  +RP RA 
Sbjct: 152 LGILAQITCSTISLLYYGYHSYPSHFVFFSTLTVALCSACAVLVLNDSFNTVAFRPLRAF 211

Query: 217 LFVAFGLSALFPVIAGICHYGFKVTWTRIQLKWVFLEGVFYILGALLYGVRFPERVAPGT 276
           LF+AFGLS + PV+AG   +GF     RIQLK+V  E VFYI GAL+YG R PER APG 
Sbjct: 212 LFMAFGLSGVIPVLAGSYQFGFAEWAARIQLKYVLYEAVFYITGALVYGFRIPERFAPGK 271

Query: 277 FDIWGQSHQLFHVLVVIAASCHLRALLGAYKWV 309
           FD+ G SHQ+FH+LVV+   CH RA+ G+Y ++
Sbjct: 272 FDMVGHSHQIFHLLVVLGTLCHFRAVTGSYIFI 304

>YDR492W Chr4 (1434924..1435874) [951 bp, 316 aa] {ON}  IZH1Membrane
           protein involved in zinc ion homeostasis, member of the
           four-protein IZH family; transcription is regulated
           directly by Zap1p, expression induced by zinc deficiency
           and fatty acids; deletion increases sensitivity to
           elevated zinc
          Length = 316

 Score =  271 bits (693), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 127/288 (44%), Positives = 194/288 (67%), Gaps = 3/288 (1%)

Query: 28  LNGSRIEERTRRRLYKWDEIPEWQKDNEHILNGYILETKSVGACLKSLLYLHNESVNIYT 87
           ++G  + E+ ++ L+ +DE+PEWQKDN+ IL GY+ ET S   CL SL Y +NE+VNIYT
Sbjct: 28  VSGQTVFEK-QKLLHNFDELPEWQKDNDKILTGYVRETLSWKKCLYSLFYWNNETVNIYT 86

Query: 88  HLIPGWCFLL--MTLFNQLAIERYETTRMIDYIMIDLFFLGGFTCLMMSSTFHCFKCHSL 145
           HL+P   + +  +TL N   I  + +T   DY +I++F +G F+CLM SS FHC K HS 
Sbjct: 87  HLVPAIVYFVFAITLTNYFLIPVFPSTSWSDYTVINIFLMGAFSCLMCSSCFHCMKQHSE 146

Query: 146 PVAVLGNKLDYLGIVALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLACTIVSLSDKF 205
             +   +KLDYLGI++L+  SM+ I+++G+ D+  YF +F+ +T++    CT+  L DKF
Sbjct: 147 KQSNFWSKLDYLGIISLISCSMIPIIYFGYFDHISYFSLFTIVTLVLATFCTVCVLHDKF 206

Query: 206 RSRDWRPYRAALFVAFGLSALFPVIAGICHYGFKVTWTRIQLKWVFLEGVFYILGALLYG 265
            +  +RP+RA  F+ FG S L P+  G   +G +    RI++ +VF E +FYI GA++YG
Sbjct: 207 NTSTFRPFRAMFFILFGFSGLLPLTTGFFKFGIQGVLNRIKVSFVFWEALFYISGAVIYG 266

Query: 266 VRFPERVAPGTFDIWGQSHQLFHVLVVIAASCHLRALLGAYKWVHSQM 313
            R PE +APG FD +G SHQ+FH++VV+ + CHL+A++ +YK +HS +
Sbjct: 267 FRIPETLAPGKFDFFGSSHQIFHIMVVLGSVCHLKAIIDSYKLMHSHI 314

>Smik_4.769 Chr4 (1356263..1357213) [951 bp, 316 aa] {ON} YDR492W
           (REAL)
          Length = 316

 Score =  271 bits (692), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 126/288 (43%), Positives = 194/288 (67%), Gaps = 3/288 (1%)

Query: 28  LNGSRIEERTRRRLYKWDEIPEWQKDNEHILNGYILETKSVGACLKSLLYLHNESVNIYT 87
           ++ + + E+ ++ L+ +DE+PEWQKDN+ IL GY+ ET S   CL SL Y +NE+VNIYT
Sbjct: 28  VSSTTVSEK-KKLLHNFDELPEWQKDNDKILTGYVRETLSWKKCLYSLFYWNNETVNIYT 86

Query: 88  HLIPGWCFLL--MTLFNQLAIERYETTRMIDYIMIDLFFLGGFTCLMMSSTFHCFKCHSL 145
           HL+P   + +  +TL N   I  + +T   DY +I++F +G F+CLM SS FHC K HS 
Sbjct: 87  HLVPAVIYFVFAITLTNYFLIPVFPSTSWSDYTVINIFLMGAFSCLMCSSCFHCMKQHSE 146

Query: 146 PVAVLGNKLDYLGIVALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLACTIVSLSDKF 205
             +   +KLDYLGI++L+  SM+ I+++G+ D+  YF +F+ +T++    CT+  L +KF
Sbjct: 147 KQSNFWSKLDYLGIISLISCSMIPIIYFGYFDHISYFSLFTIVTLVLATFCTVCVLHEKF 206

Query: 206 RSRDWRPYRAALFVAFGLSALFPVIAGICHYGFKVTWTRIQLKWVFLEGVFYILGALLYG 265
            +  +RP+RA  F+ FG S L P+  G   +G +    RI++ +VF E +FYI GA++YG
Sbjct: 207 NTSTFRPFRAMFFILFGFSGLLPLTTGFFKFGIQGVLNRIKVSFVFWEALFYISGAVIYG 266

Query: 266 VRFPERVAPGTFDIWGQSHQLFHVLVVIAASCHLRALLGAYKWVHSQM 313
            R PE +APG FD  G SHQ+FH++VV+ + CHL+A++G+YK +HS +
Sbjct: 267 FRIPETLAPGKFDFLGSSHQIFHIMVVLGSICHLKAIIGSYKLMHSHI 314

>Kpol_1053.26 s1053 complement(40099..41073) [975 bp, 324 aa] {ON}
           complement(40099..41073) [975 nt, 325 aa]
          Length = 324

 Score =  271 bits (692), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 125/276 (45%), Positives = 191/276 (69%), Gaps = 2/276 (0%)

Query: 40  RLYKWDEIPEWQKDNEHILNGYILETKSVGACLKSLLYLHNESVNIYTHLIPGWCFLLMT 99
           +L  + E+P+WQKDNE IL GY+ ET S+  CL+SL   +NES+NIY+HLI    + ++ 
Sbjct: 40  KLCHFHELPDWQKDNEFILTGYVRETNSIKKCLRSLGCFNNESINIYSHLIAAISYFVVL 99

Query: 100 LF--NQLAIERYETTRMIDYIMIDLFFLGGFTCLMMSSTFHCFKCHSLPVAVLGNKLDYL 157
           LF  + L I  + +T  +DY++IDL+ LG FTCL+ SS FHC K HS   + + +K+DY+
Sbjct: 100 LFYTDILCIPSFPSTTFVDYMVIDLYLLGAFTCLIGSSLFHCMKQHSESHSDMWSKVDYI 159

Query: 158 GIVALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLACTIVSLSDKFRSRDWRPYRAAL 217
           GI+ L+  S++S+L+YG+ D+ +YF VF+ +T++    CTI  L  +F S+++RP RA  
Sbjct: 160 GIICLITCSLISLLYYGYMDHFIYFKVFTVITLVLATICTICVLDQRFNSKNFRPIRAGF 219

Query: 218 FVAFGLSALFPVIAGICHYGFKVTWTRIQLKWVFLEGVFYILGALLYGVRFPERVAPGTF 277
           F+ F +SA+ P+ AG   +GF     RIQL++V  E  FY++GALLYG R PE + PG F
Sbjct: 220 FILFSMSAVIPIGAGFSKFGFTEVLQRIQLRFVAWETFFYVVGALLYGFRIPETLYPGNF 279

Query: 278 DIWGQSHQLFHVLVVIAASCHLRALLGAYKWVHSQM 313
           D+ G SHQ+FH++V++ +  HL+A+LG+Y ++HS +
Sbjct: 280 DLVGSSHQIFHIMVILGSVFHLKAVLGSYTFMHSNI 315

>Suva_2.668 Chr2 (1186763..1187710) [948 bp, 315 aa] {ON} YDR492W
           (REAL)
          Length = 315

 Score =  269 bits (688), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 126/284 (44%), Positives = 189/284 (66%), Gaps = 2/284 (0%)

Query: 31  SRIEERTRRRLYKWDEIPEWQKDNEHILNGYILETKSVGACLKSLLYLHNESVNIYTHLI 90
           S++  R  + L+ + E+P+WQ+DN+ IL GY+ ET S   CL SL Y +NE+VNIYTHL+
Sbjct: 29  SKVTLRKEKLLHDFHELPDWQRDNDKILTGYVRETLSWKKCLYSLFYWNNETVNIYTHLV 88

Query: 91  PGWCFLL--MTLFNQLAIERYETTRMIDYIMIDLFFLGGFTCLMMSSTFHCFKCHSLPVA 148
           P   + +  +TL N   I  + +T   DY +I++F +G F CLM SS FHC K HS   +
Sbjct: 89  PAIVYFVFGVTLTNYFLIPVFPSTTWSDYTVINIFLMGAFLCLMCSSCFHCMKQHSEKQS 148

Query: 149 VLGNKLDYLGIVALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLACTIVSLSDKFRSR 208
              +KLDYLGI++L+  SM+ I+++G+ D+  YF +F+ +T++    CTI  L DKF + 
Sbjct: 149 DFWSKLDYLGIISLISCSMIPIIYFGYFDHASYFSLFTIVTLVLATFCTICVLHDKFNTS 208

Query: 209 DWRPYRAALFVAFGLSALFPVIAGICHYGFKVTWTRIQLKWVFLEGVFYILGALLYGVRF 268
            +RP+RA  F+ FG S L P+  G+  +G +    RI++ +VF E +FYI GAL+YG R 
Sbjct: 209 TFRPFRAMFFILFGFSGLLPLTTGLFKFGLQGVLNRIRVSFVFWEALFYISGALIYGFRI 268

Query: 269 PERVAPGTFDIWGQSHQLFHVLVVIAASCHLRALLGAYKWVHSQ 312
           PE +APG FD +G SHQ+FH++VV+ + CHL+A++ +YK +HS 
Sbjct: 269 PETLAPGKFDFFGSSHQIFHIMVVLGSVCHLKAIIDSYKLMHSH 312

>NDAI0A07160 Chr1 complement(1630482..1631474) [993 bp, 330 aa] {ON}
           Anc_3.90
          Length = 330

 Score =  268 bits (684), Expect = 7e-88,   Method: Compositional matrix adjust.
 Identities = 135/291 (46%), Positives = 193/291 (66%), Gaps = 9/291 (3%)

Query: 29  NGSRIEERTRRR-----LYKWDEIPEWQKDNEHILNGYILETKSVGACLKSLLYLHNESV 83
           N +  + +T RR     L K+DE+PEWQKDN+ IL GY+ ET S   C +SL YL+NE++
Sbjct: 36  NDTSQKPKTNRRKRKIHLSKFDELPEWQKDNDKILTGYVRETNSFIHCFQSLFYLNNETI 95

Query: 84  NIYTHLIPGWCFLLMTL----FNQLAIERYETTRMIDYIMIDLFFLGGFTCLMMSSTFHC 139
           NIYTHLIP   +L+++L     N +AI ++ TT +IDYI+I++F LG FTCL++SS FHC
Sbjct: 96  NIYTHLIPSIIYLIVSLTFIFINFIAIPKFPTTSVIDYIVINIFILGAFTCLLLSSCFHC 155

Query: 140 FKCHSLPVAVLGNKLDYLGIVALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLACTIV 199
            K HS     L +KLDY+GI+ L+  S++ IL++G+ D   YF  F+ LT  F + C+I+
Sbjct: 156 LKQHSFKQCTLWSKLDYIGIIILISCSIIPILYFGYFDRLSYFKFFTILTFSFAIVCSII 215

Query: 200 SLSDKFRSRDWRPYRAALFVAFGLSALFPVIAGICHYGFKVTWTRIQLKWVFLEGVFYIL 259
            L++KF    +RP RA LF+ F  + L P+I G   +G+K    RI L +V LE +FYI+
Sbjct: 216 VLNEKFDLPSYRPLRAGLFMLFSFTGLIPMITGFYIFGYKGVMERISLNFVLLEAIFYII 275

Query: 260 GALLYGVRFPERVAPGTFDIWGQSHQLFHVLVVIAASCHLRALLGAYKWVH 310
           G LLYG R PE   PG FD++G SHQ+FH+ VV+ + CH  A++ +Y  +H
Sbjct: 276 GTLLYGFRIPETFKPGNFDMFGSSHQIFHIFVVLGSICHFGAVIKSYCLMH 326

>NCAS0I02570 Chr9 complement(480266..481210) [945 bp, 314 aa] {ON}
           Anc_3.90 YDR492W
          Length = 314

 Score =  265 bits (676), Expect = 6e-87,   Method: Compositional matrix adjust.
 Identities = 131/315 (41%), Positives = 197/315 (62%), Gaps = 4/315 (1%)

Query: 1   MVEAGLTKRKAVGIEPEGVMTEETTTLLNGSRIEERTRRRLYKWDEIPEWQKDNEHILNG 60
           M     T+RK   ++   V    +    +G + +   +RRL+ ++E+PEWQ+DN+ IL G
Sbjct: 1   MSRVTTTRRKPTKVQ--AVAVGSSNKHADGDKTKRNWKRRLFNFNELPEWQRDNDKILTG 58

Query: 61  YILETKSVGACLKSLLYLHNESVNIYTHLIPGWCFLLM--TLFNQLAIERYETTRMIDYI 118
           Y+ ETKS   CL+SLLY +NE++NIYTHLIP   +L +  TL N + +  + TT ++DY 
Sbjct: 59  YVRETKSFKQCLQSLLYWNNETINIYTHLIPALFYLTISVTLINYVVVPHFPTTSIMDYF 118

Query: 119 MIDLFFLGGFTCLMMSSTFHCFKCHSLPVAVLGNKLDYLGIVALVVTSMVSILFYGFHDN 178
           +I++F +G F CL++SS FHC K HS     L +KLDY+GI+ L+  S++ ++++G+ D+
Sbjct: 119 VINVFLMGAFVCLILSSCFHCLKQHSSRQCTLWSKLDYMGIIILISCSLIPMIYFGYFDH 178

Query: 179 NLYFYVFSGLTIMFGLACTIVSLSDKFRSRDWRPYRAALFVAFGLSALFPVIAGICHYGF 238
             Y   F  LT  F   C+I  L++KF    +RP+RA +F+ F  S   P++ G   +GF
Sbjct: 179 LYYVNFFIILTFSFATLCSICVLNEKFNVPHYRPFRAIVFMLFSFSGFIPILTGFYLFGF 238

Query: 239 KVTWTRIQLKWVFLEGVFYILGALLYGVRFPERVAPGTFDIWGQSHQLFHVLVVIAASCH 298
              + R+ LK+V  E +FYI GA LYG R PE   PG FD  G SHQ+FH+LVV+ + CH
Sbjct: 239 HGVFERVALKFVAWEALFYITGATLYGFRIPECFKPGDFDFLGSSHQIFHILVVLGSICH 298

Query: 299 LRALLGAYKWVHSQM 313
            RA++ +Y  +HS M
Sbjct: 299 FRAVIKSYILMHSSM 313

>TBLA0B02290 Chr2 complement(534472..535452) [981 bp, 326 aa] {ON}
           Anc_3.90 YOL101C
          Length = 326

 Score =  260 bits (665), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 126/284 (44%), Positives = 186/284 (65%), Gaps = 3/284 (1%)

Query: 34  EERTRRRLYKWDEIPEWQKDNEHILNGYILETKSVGACLKSLLYLHNESVNIYTHLIPGW 93
           ++ T   LY ++E+P WQ+DNE IL GYI ET S   CL+SL + HNE++NIY+H I   
Sbjct: 36  QKITDTLLYTYEELPSWQQDNEMILTGYIRETNSWKLCLRSLTFFHNETINIYSHGISAA 95

Query: 94  CFLLMTLF---NQLAIERYETTRMIDYIMIDLFFLGGFTCLMMSSTFHCFKCHSLPVAVL 150
            +LL+ +F   N + +  + TT + DY+++D++ LG  TCL +SS FHC K HS   + +
Sbjct: 96  IYLLLLVFFFTNLIYLPSFPTTTLHDYLVLDIYLLGAATCLTLSSCFHCLKQHSQSQSDI 155

Query: 151 GNKLDYLGIVALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLACTIVSLSDKFRSRDW 210
            +K+DY+GI+ L+  S +S+L++G+ D+  YF  F+  T +  + CT+    +KF +RDW
Sbjct: 156 WSKMDYIGIICLITCSTISLLYFGYRDHFNYFKFFAISTFILAITCTVFVTMEKFNTRDW 215

Query: 211 RPYRAALFVAFGLSALFPVIAGICHYGFKVTWTRIQLKWVFLEGVFYILGALLYGVRFPE 270
           +  RA  F+AF  S L P+I GI  +GF   W R+QL  + LE + Y++GALLYG R PE
Sbjct: 216 KHVRALFFIAFAGSGLIPLITGINIFGFPEVWQRVQLPSLTLELICYVIGALLYGYRIPE 275

Query: 271 RVAPGTFDIWGQSHQLFHVLVVIAASCHLRALLGAYKWVHSQML 314
             APG FD  G SHQ FH+ VV+ +  HLRAL+G+Y ++HS +L
Sbjct: 276 VFAPGKFDNIGNSHQWFHIFVVLGSLLHLRALVGSYYFMHSFLL 319

>Ecym_3588 Chr3 (1117646..1118563) [918 bp, 305 aa] {ON} similar to
           Ashbya gossypii AFR337W
          Length = 305

 Score =  255 bits (651), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 128/280 (45%), Positives = 179/280 (63%), Gaps = 2/280 (0%)

Query: 34  EERTRRRLYKWDEIPEWQKDNEHILNGYILETKSVGACLKSLLYLHNESVNIYTHLIPGW 93
           ++   RRLY +DE+PEWQKDNE I  GY+ ET S   CLKS+ Y +NESVNIYTHL+P  
Sbjct: 15  KKNFNRRLYSFDELPEWQKDNELIRMGYVRETNSFLECLKSMTYFNNESVNIYTHLVPSV 74

Query: 94  CFLLMTLFNQLAI--ERYETTRMIDYIMIDLFFLGGFTCLMMSSTFHCFKCHSLPVAVLG 151
            + ++ L     +    +  T M +YIMID +  G F CLM S+ FHC K HS     + 
Sbjct: 75  TYFILLLLFVDLVVTPMFPGTTMREYIMIDFYLFGVFVCLMCSTCFHCLKQHSESHNRIW 134

Query: 152 NKLDYLGIVALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLACTIVSLSDKFRSRDWR 211
           +K+DY+GI+  + +S+VSIL+YGF+D+  +    S LT+  G+ C    L+D+F + D+R
Sbjct: 135 SKVDYIGIIVQITSSIVSILYYGFYDHISHIKWLSVLTLTLGVCCVTFVLNDRFNAIDYR 194

Query: 212 PYRAALFVAFGLSALFPVIAGICHYGFKVTWTRIQLKWVFLEGVFYILGALLYGVRFPER 271
             RA  F  FG S + PV+ GI  +G      RIQLK+V    +FYI GAL+YG R PE 
Sbjct: 195 LLRAIFFTVFGFSGVVPVLIGIYQFGLIEWLARIQLKFVLAGTIFYIFGALIYGFRIPEA 254

Query: 272 VAPGTFDIWGQSHQLFHVLVVIAASCHLRALLGAYKWVHS 311
           +APG FD  G SHQ+FH+LVV+ + CH RA++G+Y ++ +
Sbjct: 255 LAPGKFDFIGHSHQIFHLLVVLGSICHFRAVIGSYVFMRT 294

>KAFR0A08130 Chr1 (1638153..1639112) [960 bp, 319 aa] {ON} Anc_3.90
           YOL101C
          Length = 319

 Score =  251 bits (642), Expect = 8e-82,   Method: Compositional matrix adjust.
 Identities = 121/281 (43%), Positives = 178/281 (63%), Gaps = 6/281 (2%)

Query: 38  RRRLYKWDEIPEWQKDNEHILNGYILETKSVGACLKSLLYLHNESVNIYTHLIPGWCFLL 97
           +R LY + E+P WQ+DN+ IL GY+ ET S   C++SL YL+NES+NIY+HLIP   +L 
Sbjct: 36  KRILYHFHELPTWQQDNDKILGGYVRETNSFTKCIESLFYLNNESINIYSHLIPSLIYLT 95

Query: 98  MTLFNQLAIER------YETTRMIDYIMIDLFFLGGFTCLMMSSTFHCFKCHSLPVAVLG 151
           + +   + I++      Y TT   D+I I++F +G F CL+ S  FH  K HS       
Sbjct: 96  IAVMLLIEIDQFLNIPIYPTTTKYDFIFINIFLVGAFLCLLGSGCFHLLKQHSELQCNFW 155

Query: 152 NKLDYLGIVALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLACTIVSLSDKFRSRDWR 211
           +++DY+GI+ L+  SM+ +L+YGF D+ + FY F  LT+ F   C+I+ +S+ F    +R
Sbjct: 156 SRIDYMGIIVLISCSMMPVLYYGFFDHIVLFYCFITLTLAFASVCSIIVMSETFNLSKYR 215

Query: 212 PYRAALFVAFGLSALFPVIAGICHYGFKVTWTRIQLKWVFLEGVFYILGALLYGVRFPER 271
             RA +F AFG S L P+I G   +G    + RI LK++F E VFY++GA LYG R PE 
Sbjct: 216 LLRACVFAAFGFSGLIPMIVGFSKFGLSGVFQRISLKFIFWESVFYLVGATLYGFRIPES 275

Query: 272 VAPGTFDIWGQSHQLFHVLVVIAASCHLRALLGAYKWVHSQ 312
           + PG FD++G SHQLFH  VVI +  H +A++ +Y  +HS+
Sbjct: 276 ILPGKFDLFGSSHQLFHCFVVIGSVLHFKAVIESYILMHSR 316

>KNAG0K02160 Chr11 (436744..437715) [972 bp, 323 aa] {ON} Anc_3.90
           YOL101C
          Length = 323

 Score =  225 bits (573), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 127/320 (39%), Positives = 191/320 (59%), Gaps = 17/320 (5%)

Query: 8   KRKAVGIEPEGVMTEETTTLLNGSR-----------IEERTRRRLYKWDEIPEWQKDNEH 56
           +++AV +   G    ET T+  GSR                R RL +++E+P WQ+DN+ 
Sbjct: 6   RKRAVSL---GETAIETATVSRGSRGKLLVTGTSSGAPSGQRGRLCRYEELPAWQQDNDC 62

Query: 57  ILNGYILETKSVGACLKSLLYLHNESVNIYTHLIPGWCFLL-MTL-FNQLAIERYETTRM 114
           I  GY+ ET SV  CL SLLY +NESVN+Y+HL+P   ++   TL  +Q  + R+ TT  
Sbjct: 63  IRTGYVRETLSVRRCLGSLLYWNNESVNMYSHLVPAVLYIAGATLALSQWGVPRFPTTTW 122

Query: 115 IDYIMIDLFFLGGFTCLMMSSTFHCFKCHSLPVAVLGNKLDYLGIVALVVTSMVSILFYG 174
            DY++I+ F +G   CL+ SS FHC K HS       +++DY+GI+ L+  S + ++++G
Sbjct: 123 SDYLIINTFLVGAGACLLCSSLFHCLKQHSERHCEAWSRMDYMGIILLIACSTIPMIYFG 182

Query: 175 FHDNNLYFYVFSGLTIMFGLACTIVSLSDK-FRSRDWRPYRAALFVAFGLSALFPVIAGI 233
           + D   +  +F+ +T+  G+AC+ V L +K F S  ++  RAA F+AF  + L P+  G 
Sbjct: 183 YFDYMGHCLLFTAVTVALGVACSGVVLFNKQFNSSSFKLVRAAFFIAFAFNGLIPMATGF 242

Query: 234 CHYGFKVTWTRIQLKWVFLEGVFYILGALLYGVRFPERVAPGTFDIWGQSHQLFHVLVVI 293
             +G      RI LK+V+ E VFYI GA+LYG R PE   PG  D+WG SHQ+FHV+VV 
Sbjct: 243 VKFGIPGVLDRISLKYVWFEAVFYIAGAMLYGFRVPEIWIPGKVDLWGNSHQMFHVMVVF 302

Query: 294 AASCHLRALLGAYKWVHSQM 313
            + CHL+A+L +Y  +H  +
Sbjct: 303 GSLCHLKAVLESYSLMHRHL 322

>TBLA0B08255 Chr2 (1973757..1974647) [891 bp, 296 aa] {ON}
          Length = 296

 Score =  159 bits (401), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 98/294 (33%), Positives = 150/294 (51%), Gaps = 28/294 (9%)

Query: 40  RLYKWDEIPEWQKDNEHILNGYILETKSVGACLKSLLYLHNESVNIYTHLIPGWCFLLMT 99
           +L  ++++P+WQKDN  I+N Y+ ET S+   L S+   H+ES+NI+THLIP    LL  
Sbjct: 7   QLCNFNDLPDWQKDNPLIVNYYVRETNSLFKSLCSIFLFHSESMNIFTHLIPA---LLYA 63

Query: 100 LFNQLAIERYETTRMIDYIMIDLFFLGGFTCLMMSSTFHCFKCHSLPVAVLGNKLDYLGI 159
            F   AI    T   + Y ++  + +    C ++SS FH FKC S+       KLDY+GI
Sbjct: 64  KFTYNAIT---TLEQVSYPIV-FYLISVIICFLLSSLFHLFKCTSVQSNEFWGKLDYVGI 119

Query: 160 VALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLACTIVSLSDKFRSRD---------- 209
             L+  ++VS+   GF+++       + +T    L   ++ L+ K   +           
Sbjct: 120 SLLINATIVSMALLGFNESRYTIMKNTFVTQTSCLTAYVIILAIKSHPKQGENEDDNDGT 179

Query: 210 -----------WRPYRAALFVAFGLSALFPVIAGICHYGFKVTWTRIQLKWVFLEGVFYI 258
                       +  RA LF + GLS L PVI G+  YG KV + +I +  V    + YI
Sbjct: 180 LSEDDDCCCDDHKGTRAKLFASLGLSGLIPVITGLYIYGPKVVYYKINIPMVIASVLCYI 239

Query: 259 LGALLYGVRFPERVAPGTFDIWGQSHQLFHVLVVIAASCHLRALLGAYKWVHSQ 312
           +G L+Y  + PE+  PG FD+ G SHQLFH+ +V    CH  A+  A  +  +Q
Sbjct: 240 VGTLIYVFKIPEKFYPGRFDLVGSSHQLFHIFIVFGTVCHYHAIQTAKNFALNQ 293

>NCAS0C04920 Chr3 complement(1003692..1004672) [981 bp, 326 aa] {ON}
           Anc_3.90
          Length = 326

 Score =  135 bits (339), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 90/319 (28%), Positives = 154/319 (48%), Gaps = 13/319 (4%)

Query: 1   MVEAGLTKRKAVGIEPEGVMTEETTTLLNGSRIEERTRRR---LYKWDEIPEWQKD--NE 55
           M     T +K    E   +   +  T  N  +      RR   L    E+P+WQK   N 
Sbjct: 1   MATLTSTTKKQTATE---IQDADKLTPFNAPKYSVTFPRRPKVLPILKELPQWQKQYSNS 57

Query: 56  HILNGYILETKSVGACLKSLLYLHNESVNIYTHLIPGWCFLLMTLF--NQLAIERYETTR 113
            I+NGY+ ET S+  CL ++ Y +N++VNI  + +    +  + LF  +   I     T 
Sbjct: 58  KIINGYVRETNSLIKCLHTVTYWNNQTVNIILNTVFSTVYFTLLLFFTDLYLIPSSPATT 117

Query: 114 MIDYIMIDLFFLGGFTCLMMSSTFHCFKCHSLPVAVLGNKLDYLGIVALVVTSMVSILFY 173
           M DYIM++ +  G F    ++S F+  + HSL    L  KL +L  +  + TS+++ L+Y
Sbjct: 118 MSDYIMVNFYLFGAFQYFALNSIFYLLESHSLAKCHLWFKLSHLAFINYISTSIITQLYY 177

Query: 174 GFHDNNLYFYVFSGLTIMFGLACTIVSLSDKFRSRDWRPYRAALFVAFGLSAL-FPVIAG 232
            F DN  YF   +  T++      I +LS++F  ++ R  R  + + F +S L  P  + 
Sbjct: 178 TFFDNVFYFKFLTISTLLISSIFAIFTLSEQFLRKN-RSQRNMVSITFIVSLLILPTASL 236

Query: 233 ICHYGFKVTWTRIQLKWVFLEGVFYILGALLYGVRFPERVAPGTFDIWGQSHQLFHVLVV 292
           +  +       R++ K + LE   Y+    L  V+ PER +   FD  G S  ++H+ ++
Sbjct: 237 MFKFNTFRILRRVEGKAILLELSLYLFSMTLKAVQVPERFSEN-FDFIGNSENIYHICII 295

Query: 293 IAASCHLRALLGAYKWVHS 311
           + +  H + LL +Y ++HS
Sbjct: 296 LGSLLHFKMLLNSYFFMHS 314

>NDAI0G04300 Chr7 (1035664..1036620) [957 bp, 318 aa] {ON} Anc_3.90
          Length = 318

 Score =  128 bits (322), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 82/284 (28%), Positives = 146/284 (51%), Gaps = 7/284 (2%)

Query: 33  IEERTRRRLYKWDEIPEWQK--DNEHILNGYILETKSVGACLKSLLYLHNESVNIYTHLI 90
           I + + R  YK  E+PEWQ+  ++  ++ G++ ET S   CL S +Y HN S+NI  + I
Sbjct: 25  ISKLSTRNHYKLKELPEWQREFNSGKVITGFLKETNSFKKCLWSTMYWHNSSINISLNGI 84

Query: 91  PGWCFLLMTLF--NQLAIERYETTRMIDYIMIDLFFLGGFTCLMMSSTFHCFKCHSLPVA 148
               + ++  F  +   I  + +T M DYI+++L+ L      M+ + F+  K HS   A
Sbjct: 85  AATVYFMLLFFFTDCYLIPSFPSTTMSDYIVLNLYLLTATQNFMVGTIFYIMKSHSKQQA 144

Query: 149 VLGNKLDYLGIVALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLACTIVSLSDKFRSR 208
            L  KL+ +G++  + +S+V++L+Y + D   YF  F+ +T++     T   +SD F ++
Sbjct: 145 FLWYKLNNIGLINHIASSVVTLLYYHYFDYVFYFKFFTIVTLLLITLFTCSIISDSF-NK 203

Query: 209 DWRPYRAALFVAF-GLSALFPVIAGICHYGFKVTWTRIQLKWVFLEGVFYILGALLYGVR 267
             R  +  L +A+  L  L P +  I  +G      RI L  + LE   Y  G  +   +
Sbjct: 204 MTRIRKNFLLLAYIILLTLMPSLFAILRFGLAKVLERISLNLIILEIFIYAFGLTIRTSQ 263

Query: 268 FPERVAPGTFDIWGQSHQLFHVLVVIAASCHLRALLGAYKWVHS 311
            PER    +FD  G S  ++ + +++ +  H + L+ +Y  +HS
Sbjct: 264 LPERFF-NSFDFLGNSENVYQLSIIVCSFIHFKILMNSYCLMHS 306

>CAGL0I07491g Chr9 complement(719539..720444) [906 bp, 301 aa] {ON}
           similar to uniprot|Q03419 Saccharomyces cerevisiae
           YDR492w
          Length = 301

 Score = 97.4 bits (241), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 81/296 (27%), Positives = 142/296 (47%), Gaps = 19/296 (6%)

Query: 33  IEERT-RRRLYKWDEIPEWQKD--NEHILNGYILETKSVG-ACLKSLLYLHNESVNIYTH 88
           +E++T + ++   +++P W +   N  I  GY   T +    CL+ L+  +N+S++IY +
Sbjct: 1   MEKKTVQSKIVTLEKLPVWYRRYGNSRIKTGYFYYTNATYLGCLQKLVKFNNDSISIYMN 60

Query: 89  LIPGWCFLLMTLF--NQLAIERYETTRMIDYIMIDLFFLGGFTCLMMSSTFHCFKCHSLP 146
           L+ G    +M LF  +   I  + +T M DYI+I+LF +   T     +     K HS  
Sbjct: 61  LVCGLISGVMLLFYTDVRLIPSHPSTTMTDYIIINLFLMATTTYFATMTLGQLLKGHSEY 120

Query: 147 VAVLGNKLDYLGIVALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLACTIVSLSDKFR 206
              L N+   L +V L+  S+V++L+Y F D+   F +F   T +     +IV ++D+++
Sbjct: 121 QGKLWNQAKQLALVLLLTCSIVTLLYYAFFDHVFLFKLFVIWTCLLMSITSIVIINDQYK 180

Query: 207 SRDWRPYRAALFVAFG-LSALFPVIAGICHYGFKVTW--TRIQLKWVFLEGVFYILGALL 263
               R  + +  V FG LS   P+   I  +G   ++   RI  + +  E V Y L A+L
Sbjct: 181 ----RVQKLSCVVIFGVLSISLPIAVSIIKFGLFDSYKKQRIPFQVLTWEIVLYSLSAML 236

Query: 264 YGVRFPERVAPG------TFDIWGQSHQLFHVLVVIAASCHLRALLGAYKWVHSQM 313
              R PE             D  G S Q+  ++ + A   H   ++ AY+ VH+ +
Sbjct: 237 QLTRLPELTLSTLGDSFWIVDYLGNSDQVSQLVTIFAIIVHFNTIIFAYEVVHASI 292

>Suva_15.64 Chr15 complement(100035..100973) [939 bp, 312 aa] {ON}
           YOL101C (REAL)
          Length = 312

 Score = 94.4 bits (233), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 82/318 (25%), Positives = 149/318 (46%), Gaps = 25/318 (7%)

Query: 4   AGLTKRKAVGIEPEGVM---TEETTTLLNGSRIEERTRRRLYKWDEIPEWQKDNEHILNG 60
           A LT  +   +EP+      ++ T  + + + +E +  ++ + + ++ +WQK  ++    
Sbjct: 2   ASLTTVEQSPVEPKTATEKYSDATGAVTSNADVETKETKKGFPFHDLAKWQKQYKN---- 57

Query: 61  YILETKSVGACLKSLLYLHNESVNIYTHLIPGWCFLLMTLFNQLAIERYETTRMIDYIMI 120
                 S    L +L+YL   S++ +  LI    F L+ LF         TT M DYI+ 
Sbjct: 58  ----KSSRSESLVALIYLLG-SMSSFCLLIFFTDFYLIPLFPT-------TTTMTDYIVF 105

Query: 121 DLFFLGGFTCLMMSSTFHCFKCHSLPVAV-LGNKLDYLGIVALVVTSMVSILFYGFHDNN 179
           + + L  F   M+   +H  K  SL   + +  K  YL  + L+++S ++IL+Y F+D  
Sbjct: 106 NFYLLNVFVFCMIHFIYHFIKNISLQQHIEIWQKFSYLANINLLISSQITILYYLFYDYV 165

Query: 180 LYFYVFSGLTIMFGLACTIVSLSDKFRSRDWRPYRAALFVAFGLSAL-FPVIAGICHY-G 237
            +F +F+ L    GLA   V L+DK  S   R  +   F++  +     P++  I  + G
Sbjct: 166 FFFKIFTLLMTFIGLAAYFVILTDKLNSYK-RFNKTVFFISVSVVCCSLPLLTAIITFDG 224

Query: 238 FKVTWTRIQLKWVFLEGVFYILGALLYGVRFPERVA--PGTFDIWGQSHQLFHVLVVIAA 295
            +    RI+L  +  E V  ++ +++Y  RFPE +       + W  S   FH+L+   A
Sbjct: 225 LENLKDRIKLNAITWELVTLVVASMIYVTRFPESLCRRNEKEEGWNHSEYFFHLLISGTA 284

Query: 296 SCHLRALLGAYKWVHSQM 313
             H   L+ +Y  +HS +
Sbjct: 285 FYHFFILIQSYILMHSSL 302

>Skud_15.53 Chr15 complement(86339..87277) [939 bp, 312 aa] {ON}
           YOL101C (REAL)
          Length = 312

 Score = 81.3 bits (199), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 83/319 (26%), Positives = 144/319 (45%), Gaps = 30/319 (9%)

Query: 2   VEAGLTKRKAVGIEPEGVMTEETTTLLNGSRIEERTR--RRLYKWDEIPEWQKDNEHILN 59
           VE    K K    +  G  T ETT     S ++  T+  ++ + + ++ +WQ+   +   
Sbjct: 7   VEQSPAKCKTTTEKGNG--TGETT----NSNVDAETKEIKKGFPFHDLAKWQQQYRN--- 57

Query: 60  GYILETKSVGACLKSLLYLHNESVNIYTHLIPGWCFLLMTLFNQLAIERYETTRMIDYIM 119
                  S    L +L+YL   S++ +  LI    F L+ LF         TT M DYI+
Sbjct: 58  -----KSSRNESLVALIYLLG-SMSSFCLLIFFTDFYLIPLFPT-------TTTMTDYIV 104

Query: 120 IDLFFLGGFTCLMMSSTFHCFKCHSLPVAVLG-NKLDYLGIVALVVTSMVSILFYGFHDN 178
            + + L  F   M+   +H  K  SL   +    K  YL  + L+++S ++IL+Y F+D 
Sbjct: 105 FNFYLLNVFVFCMVHFVYHFIKNISLQQHLEHWQKFSYLSNINLLISSQITILYYLFYDY 164

Query: 179 NLYFYVFSGLTIMFGLACTIVSLSDKFRSRDWRPYRAALFVAFGLSAL-FPVIAGICHY- 236
             +F +F+ L    GL      L+DK  S   R  +   F++  +     P++  I  + 
Sbjct: 165 VFFFKIFTLLMNFIGLVAYFFILTDKLNSSK-RFNKTVFFISVSVVCCSLPLLTAIITFD 223

Query: 237 GFKVTWTRIQLKWVFLEGVFYILGALLYGVRFPERV--APGTFDIWGQSHQLFHVLVVIA 294
           G +    RI++K +  E V  +  +++Y  RFPE +       + W  S  LFH+++   
Sbjct: 224 GLENLKERIKVKAITCELVALVAASIIYVTRFPESLFRRNKKEESWNHSEYLFHLVISGT 283

Query: 295 ASCHLRALLGAYKWVHSQM 313
           A  H   L+ +Y  +HS +
Sbjct: 284 AFYHFFILIQSYILMHSSL 302

>KLLA0F15510g Chr6 (1433494..1435362) [1869 bp, 622 aa] {ON} some
           similarities with uniprot|Q07959 Saccharomyces
           cerevisiae YLR023C IZH3 Membrane protein involved in
           zinc metabolism member of the four-protein IZH family
           expression induced by zinc deficiency deletion reduces
           sensitivity to elevated zinc and shortens lag phase
           overexpression reduces Zap1p activity
          Length = 622

 Score = 80.5 bits (197), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 81/292 (27%), Positives = 133/292 (45%), Gaps = 37/292 (12%)

Query: 38  RRRLYKWDEIPEWQKDNEHILNGYILETKSVGACLKSLLYL--HNESVNIYTHLIPGWCF 95
           R+R   + E+P   ++N +I++GY      V + L  + +   HNE++NI++HL  G  +
Sbjct: 295 RQRHLHFYELPFPWRENRYIIHGYRFYDSHVKSVLSVVNWYGWHNETLNIWSHLF-GAVY 353

Query: 96  LLMTLFNQLAIER---YETTRMIDYIMIDLFFLGGFTCLMMSSTFHCFK--CHSLPVAVL 150
           L   LF QL   +    +   +   ++I +F + G  CL+ SS +H     C  LP+   
Sbjct: 354 LAYLLFIQLPTTKVFMSQDVPLFGKLIIQVFLIAGVKCLLSSSVWHTLNGTC-CLPLRCK 412

Query: 151 GNKLDYLGIVALVVTSMVSILF---YGFHDNNLY--FYVFSGLTIMFGLACTIVSLSDKF 205
              +DY GI  L+  S++S  F   Y     +L     V+  L++  G+  + ++ S +F
Sbjct: 413 FACIDYTGITVLITASILSTEFVSVYNLATQSLSTSMTVYMSLSLCLGIFGSFMNWSPRF 472

Query: 206 RSRDWRPYRAALFVAFG----LSALFPVIA-GICHYG--FKVTWTRIQLKWVFLEGVFYI 258
              + RP+R A +V       +S L   I+ GI H    FK  W R  L W       Y+
Sbjct: 473 DRPESRPFRIAFYVLLAGLGMISFLHLTISRGIDHSSQFFKPVWNR-SLIW-------YL 524

Query: 259 LGALLYGVRFPERVAPGTFDIWGQSHQLFHVLVVIAASCHLRALLGAYKWVH 310
           +G + YG   PER        W    +L + +   A  C    +L  +K VH
Sbjct: 525 IGVVFYGSFIPER--------WRTDVELDYTIPTDAELCSNLDILTKHKHVH 568

>Smik_15.56 Chr15 complement(90083..91021) [939 bp, 312 aa] {ON}
           YOL101C (REAL)
          Length = 312

 Score = 75.5 bits (184), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 59/208 (28%), Positives = 100/208 (48%), Gaps = 6/208 (2%)

Query: 111 TTRMIDYIMIDLFFLGGFTCLMMSSTFHCFKCHSLPVAVLG-NKLDYLGIVALVVTSMVS 169
           TT M DYI+ + + L  F   M+   +H  K  SL   +    K  YL  + L+++S ++
Sbjct: 96  TTTMTDYIVFNFYLLNVFVFCMVHFIYHFIKNISLQQHLEHWQKFSYLSNINLLISSQIT 155

Query: 170 ILFYGFHDNNLYFYVFSGLTIMFGLACTIVSLSDKFRSRDWRPYRAALFVAFG-LSALFP 228
           IL+Y F+D   +F +F+ L    GL      L+DK  S   R  +   F++   +    P
Sbjct: 156 ILYYLFYDYVFFFKIFTLLMNFIGLVAYFFILTDKLISSK-RFNKTVFFISVSVICCSLP 214

Query: 229 VIAGICHY-GFKVTWTRIQLKWVFLEGVFYILGALLYGVRFPERVAPGTF--DIWGQSHQ 285
           ++  I  + G +    RI++  +  E V  +  +++Y  RFPE    G    + W  S  
Sbjct: 215 LLTAIITFDGLENLKERIKVNAITWELVALVAASIIYVTRFPELFLRGKKKEEGWNHSEY 274

Query: 286 LFHVLVVIAASCHLRALLGAYKWVHSQM 313
           LFH+++  AA  H   L+ +Y  +HS +
Sbjct: 275 LFHLIISGAAFYHFFILIQSYILMHSSL 302

>YOL101C Chr15 complement(126982..127920) [939 bp, 312 aa] {ON}
           IZH4Membrane protein involved in zinc ion homeostasis,
           member of the four-protein IZH family, expression
           induced by fatty acids and altered zinc levels; deletion
           reduces sensitivity to excess zinc; possible role in
           sterol metabolism
          Length = 312

 Score = 73.9 bits (180), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 58/208 (27%), Positives = 99/208 (47%), Gaps = 6/208 (2%)

Query: 111 TTRMIDYIMIDLFFLGGFTCLMMSSTFHCFKCHSLPVAVLG-NKLDYLGIVALVVTSMVS 169
           TT M DYI+ + + L  F   M+   +H  K  SL   +    K  YL  + L+++S ++
Sbjct: 96  TTTMTDYIVFNFYLLNVFVFCMVHFIYHFVKNISLQQHLEHWQKFSYLSNINLLISSQIT 155

Query: 170 ILFYGFHDNNLYFYVFSGLTIMFGLACTIVSLSDKFRSRDWRPYRAALFVAFGLSAL-FP 228
           IL+Y F+D   +F +F+ L    GL      L+DK  S   R  +   F++  +     P
Sbjct: 156 ILYYLFYDYVFFFKIFTLLMNFIGLVAYFFILTDKLISSK-RFNKTVFFISVSVVCCSLP 214

Query: 229 VIAGICHY-GFKVTWTRIQLKWVFLEGVFYILGALLYGVRFPERV--APGTFDIWGQSHQ 285
           ++  I  + G +    RI++  +  E V  +  +++Y  RFPE +       + W  S  
Sbjct: 215 LLTAIITFDGLENLKERIKVNAITWELVALVAASIIYVTRFPESLFRRNKKEEGWNHSEY 274

Query: 286 LFHVLVVIAASCHLRALLGAYKWVHSQM 313
           LFH+L+   A  H   L+ +Y  +HS +
Sbjct: 275 LFHLLISGTAFYHFFILIQSYILMHSSL 302

>AAL153C Chr1 complement(75086..76345) [1260 bp, 419 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR023C
          Length = 419

 Score = 72.8 bits (177), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 87/320 (27%), Positives = 134/320 (41%), Gaps = 59/320 (18%)

Query: 34  EERTR---RRLYKWDEIPEWQKDNEHILNG---YILETKSVGACLKSLLYLHNESVNIYT 87
           E R R   R L+ W E+P   ++N +I+ G   Y    KS+ + L +  + HNE++NI++
Sbjct: 95  ESRARGLARHLHYW-ELPYAWRENRYIIYGHRFYHSHRKSLLSVLNAYGW-HNETINIWS 152

Query: 88  HLIPG--WCFLLMTLFNQLAIERYETTRMIDYIMIDLFFLGGFTCLMMSSTFHCFK--CH 143
           HL+      +LL   + +  + R      +    I  F   G  C+  S  +H F   CH
Sbjct: 153 HLVGAAVLAYLLCWGWPRSDVYRAAQVPRLAKWAIGAFLACGVKCMASSVAWHTFNGTCH 212

Query: 144 SLPVAVLGNKLDYLGIVALVVTSM---VSILFYGFHDNNLYFYVFSGLTIMFGLACTIVS 200
            L +      +DY GI  LV  S+   V++  YG     +Y Y+ +  +I  G A  +++
Sbjct: 213 -LKLRSRFVCVDYTGITLLVTASVVTTVAVTLYGLSRPLMYAYMVA--SIGLGTAAGVMN 269

Query: 201 LSDKFRSRDWRPYRAALFVAFGLSALFPVIAGICHYGFKVTWTRIQL--KWVFLEGVFYI 258
            S  F   + RP R A++V  GL+AL   +    H   +V W    L    V+   V+Y 
Sbjct: 270 WSPHFDRPEARPLRIAVYV--GLAALG--LVSFVHVWMQVRWASAHLMAPLVYKSLVWYG 325

Query: 259 LGALLYGVRFPER---------------------------VAPGTFDIWG--------QS 283
           +G + Y    PER                           VA      W          S
Sbjct: 326 IGVVFYATLVPERWRSDVTLDCCSGPVHEAACRQFRDLPPVARKDRQFWSLWWVDYFCHS 385

Query: 284 HQLFHVLVVIAASCHLRALL 303
           H L+HV VV+    H RA+L
Sbjct: 386 HFLWHVFVVLGVVGHYRAVL 405

>Kpol_2002.94 s2002 (229517..231250) [1734 bp, 577 aa] {ON}
           (229517..231250) [1734 nt, 578 aa]
          Length = 577

 Score = 72.8 bits (177), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 66/238 (27%), Positives = 113/238 (47%), Gaps = 20/238 (8%)

Query: 46  EIPEWQKDNEHILNGYILETKSVGACLKSLLY--LHNESVNIYTHLIPGWCFLLMTLF-- 101
           ++P   ++N +I+NGY    K+    L    +   HNE+ NI++HL+    F  + LF  
Sbjct: 255 QLPFPWRENRYIINGYRFYHKNSKLLLSVFNWYGFHNETANIWSHLLGAIYFAYIVLFEF 314

Query: 102 -NQLAIERYETTRMIDYIMIDLFFLGGFTCLMMSSTFHCFK--CHSLPVAVLGNKLDYLG 158
                ++  E      YI+  LF L G  C++ S  +H F   C S+ +      +DY G
Sbjct: 315 PKSFIVQSPEVPPSAKYIVY-LFLLAGIKCMLASVFWHTFNGTC-SIKLRPKYCCVDYSG 372

Query: 159 IVALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLACTIVSLSDKFRSRDWRPYRAALF 218
           I  L+  S+++  F   +D+     V+  L+++FG     ++ S KF S + RP R   F
Sbjct: 373 ITILITASILTAEFVSLYDHRSIMTVYMSLSLLFGCFGLYLNWSPKFDSPEARPLRIKFF 432

Query: 219 V---AFGLSALFPV--IAGICHYGFKVTWTRIQLKWVFLEGVFYILGALLYGVRFPER 271
           +   A G  A F V  + G+ +  +   ++ +  K +    V+Y++G   YG   PER
Sbjct: 433 ILLAALGGLAFFHVAYLEGMAYAAW--LYSPVTSKSI----VWYLIGVFFYGSFIPER 484

>KAFR0J00670 Chr10 (120378..121907) [1530 bp, 509 aa] {ON} Anc_5.197
           YLR023C
          Length = 509

 Score = 70.5 bits (171), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 64/234 (27%), Positives = 109/234 (46%), Gaps = 14/234 (5%)

Query: 46  EIPEWQKDNEHILNGYILETKSVGACLKSLLYLHNESVNIYTHLIPGWCFLLMTLFNQLA 105
           ++P   ++N +I+N Y     S    L S+  LHNE+ NI++HL+ G  + L  LF+ L 
Sbjct: 197 QLPFPYRENRYIINNYRF-YDSHKKSLLSIFKLHNEATNIWSHLL-GAIYFLYVLFHDLP 254

Query: 106 IERYETTRMID---YIMIDLFFLGGFTCLMMSSTFHCFKCHSLPVAVLGNK---LDYLGI 159
                ++ M+     + + LF      C++ S+ +H F   S+    L  K   +DY GI
Sbjct: 255 NSIIVSSSMVPTTAKLFLYLFVFASLKCMLSSTFYHTFNGTSM--LKLRRKFMCVDYSGI 312

Query: 160 VALVVTSMVSILFYGFHD--NNLYFYVFSGLTIMFGLACTIVSLSDKFRSRDWRPYRAAL 217
             L+ +S++SI F   +D  N L FY+ +  + M G+    ++ S  F S + RP R   
Sbjct: 313 SILITSSILSIQFISLYDYPNILKFYMCA--SFMLGVLGIFMNWSPLFDSPEARPLRIKF 370

Query: 218 FVAFGLSALFPVIAGICHYGFKVTWTRIQLKWVFLEGVFYILGALLYGVRFPER 271
           F+       F ++  +           + L       V+Y++G + YG   PER
Sbjct: 371 FILLSSCGAFALLHLVFLEKSIFAAIDVLLPLTNKSIVWYLVGVVFYGSFIPER 424

>KLTH0B03498g Chr2 complement(281148..282788) [1641 bp, 546 aa] {ON}
           some similarities with uniprot|Q07959 Saccharomyces
           cerevisiae YLR023C IZH3 Membrane protein involved in
           zinc metabolism member of the four-protein IZH family
           expression induced by zinc deficiency deletion reduces
           sensitivity to elevated zinc and shortens lag phase
           overexpression reduces Zap1p activity
          Length = 546

 Score = 68.9 bits (167), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 68/250 (27%), Positives = 113/250 (45%), Gaps = 23/250 (9%)

Query: 38  RRRLYKWDEIPEWQKDNEHILNGYILETKSVGACLKSLLYL------HNESVNIYTHLIP 91
           ++R   + E+P   ++N  I++GY    +   +  KSLL +      HNE+VNI+THL  
Sbjct: 211 QQRHLHYYELPFPWRENRFIIHGY----RFYNSYSKSLLSIFNWYGWHNETVNIWTHLCG 266

Query: 92  G--WCFLLMTLFNQLAIERYETTRMIDYIMIDLFFLGGFTCLMMSSTFHCFK--CHSLPV 147
              + FL+   F+Q  + + E        M  +F   G  C + S  +H F   CH L  
Sbjct: 267 ALYFAFLIFKGFSQTTVYQSELVPTAAKFMAFVFLTAGLECFLFSVVWHTFNGICH-LKQ 325

Query: 148 AVLGNKLDYLGIVALVVTSMVSILF---YGFHDNNLYFYV--FSGLTIMFGLACTIVSLS 202
                 +DY GI  LV  S+++  F    G  D    + +  F+G +   G     ++ S
Sbjct: 326 RSNCACVDYTGITVLVTASILTTEFVTLSGSSDATFTWSLLFFTGASAALGAVGVFMNWS 385

Query: 203 DKFRSRDWRPYRAALFVAFGLSALFPVIAGICHYGFKVTWTRIQLKWVFLEGV-FYILGA 261
            KF   + RP R A ++       F  +     +   V  + + +K VF++ + +YI+G 
Sbjct: 386 PKFDRPESRPLRIAFYLLLASFGFFSYLHSRL-FNTAVDSSDL-IKPVFMKSLAWYIIGV 443

Query: 262 LLYGVRFPER 271
           + YG   PER
Sbjct: 444 VFYGTFIPER 453

>TPHA0E03120 Chr5 complement(654079..655788) [1710 bp, 569 aa] {ON}
           Anc_5.197 YLR023C
          Length = 569

 Score = 64.7 bits (156), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 65/247 (26%), Positives = 112/247 (45%), Gaps = 21/247 (8%)

Query: 38  RRRLYKWDEIPEWQKDNEHILNGYILETKSVGACLKSLLY--LHNESVNIYTHLIPGW-- 93
           + R   + E+P   ++N++I++GY    K     L    +  +HNE+ NI+TH++  +  
Sbjct: 240 KERHLHYYELPFPWRENKYIIHGYRFHDKFYQLILSVFNWYGVHNETTNIWTHMLAAFYL 299

Query: 94  CFLLMTLFNQ--LAIERYETTRMIDYIMIDLFFLGGFTCLMMSSTFHCFK-CHSLPVAVL 150
            +LL   F +  + ++         YI I +F   G  C+  S  +H F    S+ +   
Sbjct: 300 IYLLTVDFQKTFIVLDTEHVPATTKYI-IYMFLGAGIKCMFASVFWHTFNGTTSIRLRPK 358

Query: 151 GNKLDYLGIVALVVTSMVS---ILFYGFHDNNLYFYVFSGLTIMFGLACTIVSLSDKFRS 207
              +DY GI  L+  S++S   I  Y +     ++ + SG+  +FGL    ++ S KF S
Sbjct: 359 FCCVDYTGITLLISASIMSAEYITLYDYPKAMSFYMILSGIFAVFGL---YLNWSPKFDS 415

Query: 208 RDWRPYRAALFVAFGLSALFPVIAGICHYGF-KVTW--TRIQLKWVFLEGVFYILGALLY 264
            + RP R   FV          +  +C  G  +  W  + +  K V    ++YI+G   Y
Sbjct: 416 PEARPLRIKFFVLLAAVGGLSFVNLVCLEGLSRAIWLFSPVTNKSV----IYYIIGVFFY 471

Query: 265 GVRFPER 271
           G   PER
Sbjct: 472 GSFIPER 478

>Ecym_7109 Chr7 complement(210829..212535) [1707 bp, 568 aa] {ON}
           similar to Ashbya gossypii AAL153C
          Length = 568

 Score = 62.4 bits (150), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 62/245 (25%), Positives = 112/245 (45%), Gaps = 17/245 (6%)

Query: 38  RRRLYKWDEIPEWQKDNEHILNG---YILETKSVGACLKSLLYLHNESVNIYTHLIPGWC 94
           R R   + E+P+  ++N +I+ G   Y    KS+ + L ++   HNE++NI++H+     
Sbjct: 236 RARHLHYYELPQPWRENPYIIYGHRFYHSHKKSLLSIL-NVYGWHNETINIWSHIAGAII 294

Query: 95  FLLMTLFNQLAIERYETTRM--IDYIMIDLFFLGGFTCLMMSSTFHCFK--CHSLPVAVL 150
            L + L      + + +T++  +    I +F L G  C++ S  +H F   CH LP+   
Sbjct: 295 LLYIMLRGFPNSDVFNSTQVPKVAKGAIYVFLLCGIKCMVSSVMWHTFSGTCH-LPLRSR 353

Query: 151 GNKLDYLGIVALVVTS-MVSILFYGFHDNNLYFYVFSGLTIMFGLACTIVSLSDKFRSRD 209
            + +DY GI  L+  S M +  F  +       Y++ G+++  G+     + S +F   D
Sbjct: 354 FSCVDYTGITILITASVMTTEAFTLYRLAPKAMYLYMGISLCLGVFAAFTNWSRRFDGPD 413

Query: 210 WRPYRAALFVAFGLSALFPVIAGICHYGFKVTWTRIQLKWVFLEG---VFYILGALLYGV 266
            R +R A +V      L   +    H      W+  +L    L     V+Y++G + Y  
Sbjct: 414 SRIFRVAFYVILAGLGLISFV----HLTVHSDWSSSRLMITPLINKSIVWYLIGVVFYAT 469

Query: 267 RFPER 271
             PER
Sbjct: 470 LVPER 474

>Kwal_33.15122 s33 (968885..970585) [1701 bp, 566 aa] {ON} YLR023C -
           Hypothetical ORF [contig 94] FULL
          Length = 566

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 67/243 (27%), Positives = 109/243 (44%), Gaps = 25/243 (10%)

Query: 46  EIPEWQKDNEHILNGYILETKSVGACLKSLLYL------HNESVNIYTHLIPGW--CFLL 97
           E+P   ++N  I++GY    +   +  KSLL +      HNE+VNI+THL       +LL
Sbjct: 239 ELPFPWRENRFIIHGY----RFYNSYKKSLLSIFNWYGWHNETVNIWTHLGGALYLAYLL 294

Query: 98  MTLFNQLAIERYETTRMIDYIMIDLFFLGGFTCLMMSSTFHCFK--CHSLPVAVLGNKLD 155
              F+Q A+ + E        M  +F L G  C + S  +H F   CH L        +D
Sbjct: 295 FRGFSQTAVYQSELVPTAAKCMAFVFLLSGLECFLFSVVWHTFNGICH-LQQRSNCACVD 353

Query: 156 YLGIVALVVTSMVSILFYGFHDNNLYFYV-----FSGLTIMFGLACTIVSLSDKFRSRDW 210
           Y GI  LV  S+++  F          +      F+  + + G+    ++ S KF   + 
Sbjct: 354 YTGITILVTASILTTEFVTLSGAAEAPFTWSLLFFTTTSSILGVIGVYMNWSPKFDRPES 413

Query: 211 RPYRAALFVAFGLSALFPVIAGICHYGFKVTWTRIQL-KWVFLEGV-FYILGALLYGVRF 268
           RP R A ++   L A F   + +    F  + +  +L K V  + + +Y++G + YG   
Sbjct: 414 RPLRIAFYL---LLASFGFFSYLHSRIFHTSISSSELIKPVLSKSLAWYLIGVVFYGTFI 470

Query: 269 PER 271
           PER
Sbjct: 471 PER 473

>TBLA0C06050 Chr3 (1468152..1469465) [1314 bp, 437 aa] {ON}
           Anc_5.197 YLR023C
          Length = 437

 Score = 59.7 bits (143), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 51/233 (21%), Positives = 102/233 (43%), Gaps = 10/233 (4%)

Query: 46  EIPEWQKDNEHILNGYILETKSVGACLKSLLYL--HNESVNIYTHLIPGWCFLLMTLFNQ 103
           ++P   ++N +I+ GY     +V   L  + Y   HNE++NI++HL      L + +F  
Sbjct: 118 QLPFPWRENRYIIKGYRFYDSNVKCLLSVVNYYGWHNETLNIWSHLGGFLTLLYIAVFVY 177

Query: 104 LAIERYETTRM--IDYIMIDLFFLGGFTCLMMSSTFHCFK--CHSLPVAVLGNKLDYLGI 159
              E Y++  +     +++ +F + G  C++ S  +H F   C S  +      +DY GI
Sbjct: 178 PNTEVYQSELIPTTAKMLLFVFLIAGMKCMLASVFWHTFDGTC-SYTLRPKFCCVDYTGI 236

Query: 160 VALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLACTIVSLSDKFRSRDWRPYRAALFV 219
             L+  S+++  +       ++ +++  L++  G     ++ S KF   + RP R   FV
Sbjct: 237 TILITASILTAEYVSLSHAPIWMFIYMSLSLALGTFGVYINWSPKFDGPEARPLRIKFFV 296

Query: 220 AFGLSALFPVIAGICHYGFK-VTWTRIQLKWVFLEGVFYILGALLYGVRFPER 271
                     +  I     +   W    +  +    ++Y++G   YG   PE+
Sbjct: 297 TLSAMGCLSFVHLIFTTSLRHACWLLAPI--ISKSTIWYVIGVFFYGSFIPEK 347

>KNAG0B05100 Chr2 (976101..977717) [1617 bp, 538 aa] {ON} Anc_5.197
           YLR023C
          Length = 538

 Score = 58.5 bits (140), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 55/258 (21%), Positives = 116/258 (44%), Gaps = 12/258 (4%)

Query: 22  EETTTLLNGSRIEERTRRRLYKWDEIPEWQKDNEHILNGYILETKSVGACLKSLLYL--H 79
           E   T  N     +  R +L  + E+P   ++N +I++ Y     +V + L ++ +   H
Sbjct: 197 EALITAYNHDVAFQEGREKLLHYYELPFPWRENRYIIHNYRFYDSNVKSLLSAINWYGWH 256

Query: 80  NESVNIYTHLIPGW--CFLLMTLFNQLAIERYETTRMIDYIMIDLFFLGGFTCLMMSSTF 137
           NE+ NI++H +  +   +L +  F Q  + + +        ++ +F      CL+ S+ +
Sbjct: 257 NETSNIWSHFLGFFYVVYLAVYEFPQSVVFQSDRIPSSAKFVVYIFLFAAMKCLIASAFW 316

Query: 138 HCFKCHS-LPVAVLGNKLDYLGIVALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLAC 196
           H F   + L +      +DY GI  L+  S+++  F   +D+     ++  +++  G+  
Sbjct: 317 HTFNGTAFLKMRRRFACVDYSGISILITASILTAEFVTLNDHRPMMILYMTISLTLGIIG 376

Query: 197 TIVSLSDKFRSRDWRPYRAALFVAFGLSALFPVIAG--ICHYGFKVTW-TRIQLKWVFLE 253
             ++ S +F + + RP R   F+      +   I    +  + + V   + I  K +   
Sbjct: 377 VFLNCSPQFDTPEARPLRIRFFMLLAAMGVLSFINASYLESWAYAVDLLSPITNKSI--- 433

Query: 254 GVFYILGALLYGVRFPER 271
            V+Y++G + YG   PER
Sbjct: 434 -VWYLVGVVFYGSFIPER 450

>TDEL0E04320 Chr5 complement(804655..806007) [1353 bp, 450 aa] {ON}
           Anc_5.197 YLR023C
          Length = 450

 Score = 58.2 bits (139), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 62/256 (24%), Positives = 112/256 (43%), Gaps = 26/256 (10%)

Query: 31  SRIEERTRRRLYKWDEIPEWQKDNEHILNGYILETKSVGACLKSLLYL------HNESVN 84
           ++  E  R R   + ++P   ++N  I++GY    +   +  KSLL +      HNE+ N
Sbjct: 121 AQANELGRERHLHYYQLPFPWRENRFIIHGY----RFYDSHYKSLLSIVNWYGWHNETAN 176

Query: 85  IYTHLIPGWCFLLMTLFN--QLAIERYETTRMIDYIMIDLFFLGGFTCLMMSSTFHCFK- 141
           I+THL      L + +++  + ++   E   M+   ++ +F      C++ S   H F  
Sbjct: 177 IWTHLGGALYVLWLAVYDFPRTSVWESEQVPMVAKCIVYVFLAAALKCMLASVFGHTFNG 236

Query: 142 --CHSLPVAVLGNKLDYLGIVALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLACTIV 199
             C +L        +DY GI  L+  S+++  F   ++       +  ++ + G+   I+
Sbjct: 237 TCCLALRSKFAC--VDYSGITMLITASILTTEFVTMYNYPWSLRFYLAVSTVLGIFGVIM 294

Query: 200 SLSDKFRSRDWRPYRAALFVAF----GLSALFPVIAGICHYGFKVTWTRIQLKWVFLEGV 255
           + S KF   + RP R   F+      GLS +   + G   Y    +W    +    L  V
Sbjct: 295 NWSPKFDRPEARPLRIKFFILLAAMGGLSFMQLGLLGGWKYA---SWLMAPVTHKSL--V 349

Query: 256 FYILGALLYGVRFPER 271
           +Y+LG   YG   PER
Sbjct: 350 WYLLGVAFYGSFVPER 365

>SAKL0G12980g Chr7 complement(1108751..1110442) [1692 bp, 563 aa]
           {ON} some similarities with uniprot|Q07959 Saccharomyces
           cerevisiae YLR023C IZH3 Membrane protein involved in
           zinc metabolism member of the four-protein IZH family
           expression induced by zinc deficiency deletion reduces
           sensitivity to elevated zinc and shortens lag phase
           overexpression reduces Zap1p activity
          Length = 563

 Score = 55.8 bits (133), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 70/249 (28%), Positives = 108/249 (43%), Gaps = 34/249 (13%)

Query: 46  EIPEWQKDNEHILNGYILETKSVGACLKSLLYL--HNESVNIYTHLIPGW--CFLLMTLF 101
           E+P   ++N  I++GY        + L  L +   HNE+ NI+THL       +L    F
Sbjct: 236 ELPFPWRENRFIIHGYRFYHSHTKSLLSILNWYGWHNETTNIWTHLFGSLYIAYLAFYEF 295

Query: 102 NQLAIERYETTRMIDYIMIDLFFLGGFTCLMMSSTFHCFK--CHSLPVAVLGNKLDYLGI 159
            Q ++            M+ LF   GF CL+ S T+H F   C  L +      +DY GI
Sbjct: 296 PQSSVYLSGDVPQFAKYMVYLFLGAGFKCLVSSVTWHTFNGTC-KLHLRSKFACMDYTGI 354

Query: 160 VALVVTSMVSILF---YGFHDN-------NLYFYV-FSGLTIMFGLACTIVSLSDKFRSR 208
             L+  S+++  F   YG  DN       +L FY+  S +   FG+    ++ S +F   
Sbjct: 355 TVLITASIMTAEFVSLYGNGDNPNSPVTFSLIFYMAVSSVLCCFGV---FMNWSPRFDRP 411

Query: 209 DWRPYRAA---LFVAFGLSAL--FPVIAGICHYGFKVTWTRIQLKWVFLEGV-FYILGAL 262
           + RP R A   L    G  A     +I    H     +W    ++ V  + V +Y++G +
Sbjct: 412 ESRPLRIAFYLLLAGMGFLAFLHLTLITNFAH----SSWL---IRPVLDKSVCWYLIGVI 464

Query: 263 LYGVRFPER 271
            YG   PER
Sbjct: 465 FYGSFIPER 473

>NCAS0D02600 Chr4 (499689..501320) [1632 bp, 543 aa] {ON} Anc_5.197
           YLR023C
          Length = 543

 Score = 55.5 bits (132), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 58/239 (24%), Positives = 103/239 (43%), Gaps = 22/239 (9%)

Query: 46  EIPEWQKDNEHILNGYILETKSVGACLKSLLYL------HNESVNIYTHLIPGWCFLLMT 99
           ++P   ++N +I+  Y    +   +  KSLL +      HNE+ NI+THLI G   + M 
Sbjct: 220 QLPFPWRENRYIIYNY----RFYDSHKKSLLSIFNWYGWHNETSNIWTHLIGGLYLIYMA 275

Query: 100 LFNQLAIERYETTRM--IDYIMIDLFFLGGFTCLMMSSTFHCFK--CHSLPVAVLGNKLD 155
           +++    E + + ++     +++ LF      CL  S  +H F   C +L +      +D
Sbjct: 276 VYDFPRSEIFLSDKIPTTAKLIVYLFLFAAIKCLFASVFWHSFNGTC-TLKLRSKFACVD 334

Query: 156 YLGIVALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLACTIVSLSDKFRSRDWRPYRA 215
           Y GI  L+  S+++  F   + +     V+  +++  G+    ++ S KF   + RP R 
Sbjct: 335 YSGISILITASILTTEFVTLYSSYRAMCVYMAISLSLGIFGVFMNWSPKFDRPEARPLRI 394

Query: 216 ALFVAFGLSALFPVIAGICHYGFKVTW---TRIQLKWVFLEGVFYILGALLYGVRFPER 271
             FV          +    H  F   W   T +         V+Y +G + YG   PER
Sbjct: 395 KFFVLLASMG----VLSFLHLTFLTDWKYATWLLAPVTNKSIVWYCIGVVFYGSFIPER 449

>NDAI0I02330 Chr9 (532412..534148) [1737 bp, 578 aa] {ON} Anc_5.197
          Length = 578

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 58/241 (24%), Positives = 109/241 (45%), Gaps = 26/241 (10%)

Query: 46  EIPEWQKDNEHILNGYILETKSVGACLKSLLYL------HNESVNIYTHLIPGWCFLLMT 99
           ++P   ++N +I+  Y    +   +  KSLL +      HNES NI+THL+     + ++
Sbjct: 254 QLPFPWRENRYIIYNY----RFYDSHKKSLLSIFNWYGWHNESSNIWTHLLGAIYLIYLS 309

Query: 100 LFNQLAIERYETTRM--IDYIMIDLFFLGGFTCLMMSSTFHCFKCHS-LPVAVLGNKLDY 156
           +++    E +++ ++     +++ LF      CL+ S  +H F   S L +      +DY
Sbjct: 310 IYDFPNSEIFQSEKVPTTAKLIVYLFLFAAIKCLLASVFWHTFNGTSFLKLRSKFACVDY 369

Query: 157 LGIVALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLACTIVSLSDKFRSRDWRPYRAA 216
            GI  L+  S+++  F   + +     ++  +++  G+    ++ S KF   + RP R  
Sbjct: 370 SGITILITASILTTEFVTMYSSFFAMCIYMTISLSLGMFGVFMNWSPKFDRPEARPLRIK 429

Query: 217 LFVAFG----LSALFPVIAGICHYGFKVTW--TRIQLKWVFLEGVFYILGALLYGVRFPE 270
            F+       LS L         Y    TW  T +  K +    V+Y++G + YG   PE
Sbjct: 430 FFILLASMGVLSFLHLTYLTNLQYA---TWLLTPVTNKSI----VWYLVGVVFYGSFIPE 482

Query: 271 R 271
           R
Sbjct: 483 R 483

>YLR023C Chr12 complement(185498..187129) [1632 bp, 543 aa] {ON}
           IZH3Membrane protein involved in zinc ion homeostasis,
           member of the four-protein IZH family, expression
           induced by zinc deficiency; deletion reduces sensitivity
           to elevated zinc and shortens lag phase, overexpression
           reduces Zap1p activity
          Length = 543

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 54/239 (22%), Positives = 107/239 (44%), Gaps = 22/239 (9%)

Query: 46  EIPEWQKDNEHILNGYILETKSVGACLKSLLYL------HNESVNIYTHLIPGWCFLLMT 99
           ++P   ++N +I++GY    +      KSLL +      HNE+ NI++HL+     + + 
Sbjct: 220 QLPFPWRENRYIIHGY----RFYNTHSKSLLSIFNWYGWHNETSNIWSHLLGAIYIIYLA 275

Query: 100 LFNQLAIERYETTRMIDYI--MIDLFFLGGFTCLMMSSTFHCFKCHS-LPVAVLGNKLDY 156
           +++    E +  +++      ++ +F      C++ S  +H F   S L +      +DY
Sbjct: 276 IYDFPQSEVWRNSQVPPQARWIVFMFLAAALKCMLSSVFWHTFNGTSFLKLRSKFACVDY 335

Query: 157 LGIVALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLACTIVSLSDKFRSRDWRPYRAA 216
            GI  L+  S+++  F   +      Y +  +++  G+    ++ S +F   + RP R  
Sbjct: 336 SGITILITASILTTEFVTMYSCYWAMYTYMSISLALGVFGVFMNWSPRFDRPEARPLRIR 395

Query: 217 LFVAFG----LSALFPVIAGICHYGFKVTWTRIQLKWVFLEGVFYILGALLYGVRFPER 271
            F+       LS L  +     HY     ++ +  K V    V+Y++G + YG   PER
Sbjct: 396 FFILLATMGVLSFLHLIFLTDLHYA-ATLFSPVTYKSV----VWYLVGVVFYGSFIPER 449

>Skud_12.91 Chr12 complement(177334..178962) [1629 bp, 542 aa] {ON}
           YLR023C (REAL)
          Length = 542

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 58/281 (20%), Positives = 120/281 (42%), Gaps = 16/281 (5%)

Query: 2   VEAGLTKRKAVGIEPEGVMTEETTTL--LNGSRIEERTRRRLYKWDEIPEWQKDNEHILN 59
           ++A + KR+ +  EP    T+  + +   N S        +   + ++P   ++N +I++
Sbjct: 173 MKASMIKREILIEEPLNPTTDIKSFINSYNHSEAYSLGESQHLHYYQLPFPWRENRYIIH 232

Query: 60  GYILETKSVGACLKSLLYL--HNESVNIYTHLIPGWCFLLMTLFN--QLAIERYETTRMI 115
           GY        + L  + +   HNE+ NI++HL+     + + +++  Q  + R       
Sbjct: 233 GYRFYNTHSKSLLSIINWYGWHNETSNIWSHLLGAMYIIYLAIYDFPQSEVWRNPNVPQQ 292

Query: 116 DYIMIDLFFLGGFTCLMMSSTFHCFKCHS-LPVAVLGNKLDYLGIVALVVTSMVSILFYG 174
              ++ +F      C++ S  +H F   S L +      +DY GI  L+  S+++  F  
Sbjct: 293 ARWIVFMFLAAALKCMLSSVFWHTFNGTSFLRLRSKFACVDYSGITILITASILTTEFVT 352

Query: 175 FHDNNLYFYVFSGLTIMFGLACTIVSLSDKFRSRDWRPYRAALFVAFG----LSALFPVI 230
            +        + G+++  G+    ++ S +F   + RP R   F+       LS L  + 
Sbjct: 353 MYSCYWAMCTYMGISLALGVIGVFMNWSPRFDRPEARPLRIRFFILLATMGVLSFLHLIF 412

Query: 231 AGICHYGFKVTWTRIQLKWVFLEGVFYILGALLYGVRFPER 271
               +Y      +R+     +   V+Y++G + YG   PER
Sbjct: 413 LTDIYYA-----SRLFGPVTYKSVVWYLVGVVFYGSFIPER 448

>Smik_12.86 Chr12 complement(172288..173916) [1629 bp, 542 aa] {ON}
           YLR023C (REAL)
          Length = 542

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 49/235 (20%), Positives = 102/235 (43%), Gaps = 14/235 (5%)

Query: 46  EIPEWQKDNEHILNGYILETKSVGACLKSLLYL------HNESVNIYTHLIPGWCFLLMT 99
           ++P   ++N +I++GY    +      KSLL +      HNE+ NI++HL+     + + 
Sbjct: 219 QLPFPWRENRYIIHGY----RFYNTHSKSLLSIFNWYGWHNETSNIWSHLLGAMYLIYLA 274

Query: 100 LFNQLAIERYETTRMIDYI--MIDLFFLGGFTCLMMSSTFHCFKCHS-LPVAVLGNKLDY 156
           +++    E ++  ++      ++ +F      C++ S  +H F   S L +      +DY
Sbjct: 275 IYDFPQSEVWKNPKVPPQARWIVFMFLAAALKCMLSSVFWHTFNGTSFLKLRSKFACVDY 334

Query: 157 LGIVALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLACTIVSLSDKFRSRDWRPYRAA 216
            GI  L+  S+++  F   +        + G+++  G+    ++ S +F   + RP R  
Sbjct: 335 SGITILITASILTTEFVTMYSCYWAMCTYMGISLALGIFGVFMNWSPRFDRPEARPLRIR 394

Query: 217 LFVAFGLSALFPVIAGICHYGFKVTWTRIQLKWVFLEGVFYILGALLYGVRFPER 271
            F+      +   +  I     +    R+     +   V+Y++G   YG   PER
Sbjct: 395 FFILLATMGVLSFLHLIFLTDLRYA-ARLFSPVTYKSVVWYLVGVAFYGSFIPER 448

>Suva_10.104 Chr10 complement(191663..193288) [1626 bp, 541 aa] {ON}
           YLR023C (REAL)
          Length = 541

 Score = 48.9 bits (115), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 52/244 (21%), Positives = 101/244 (41%), Gaps = 32/244 (13%)

Query: 46  EIPEWQKDNEHILNGYILETKSVGACLKSLLYL--HNESVNIYTHLIPGWCFLLMTLFNQ 103
           ++P   ++N +I++GY        + L  + +   HNE+ NI+THL+     + + +++ 
Sbjct: 219 QLPFPWRENRYIIHGYRFYNTHYKSLLSVINWYGWHNETSNIWTHLLGAMYIVYLAVYDF 278

Query: 104 LAIERYETTRMIDYI--MIDLFFLGGFTCLMMSSTFHCFKCHSLPVAVLGNK-----LDY 156
              E ++   +      ++  F      C++ S  +H F   S     LG +     +DY
Sbjct: 279 PHSEVWQNPEVPQQARWIVFAFLAAALKCMLSSVFWHTFNGTSF----LGLRSKFACVDY 334

Query: 157 LGIVALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLACTIVSLSDKFRSRDWRPYRAA 216
            GI  L+  S+++  F   +        +  +++  G+    ++ S +F   + RP R  
Sbjct: 335 SGITILITASILTTEFVTMYSCYWAMCTYMTISLALGVFGVFMNWSPRFDRPEARPLRIR 394

Query: 217 LFVAFG----LSALFPVIAGICHYGFKVTWTRIQLKWVF-----LEGVFYILGALLYGVR 267
            F+       LS L  +     HY            W+F        V+Y++G + YG  
Sbjct: 395 FFILLATMGVLSFLHLIFLTDLHYAI----------WLFSPVTNKSVVWYLVGVVFYGSF 444

Query: 268 FPER 271
            PER
Sbjct: 445 IPER 448

>CAGL0D03322g Chr4 complement(340949..342586) [1638 bp, 545 aa] {ON}
           similar to uniprot|Q07959 Saccharomyces cerevisiae
           YLR023c
          Length = 545

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 64/246 (26%), Positives = 108/246 (43%), Gaps = 36/246 (14%)

Query: 46  EIPEWQKDNEHILNGYILETKSVGACLKSLLYL------HNESVNIYTHLIPGWCFLLMT 99
           E+P   ++N  I+NGY    +   +  KSLL +      HNE+ NI+THL+ G   L + 
Sbjct: 218 ELPFPWRENRCIINGY----RFYNSHKKSLLSIVNWYGWHNETSNIWTHLLGGLYILYLM 273

Query: 100 LFNQLAIERY------ETTRMIDYIMIDLFFLGGFTCLMMSSTFHCFKCHS-LPVAVLGN 152
            +   + E +      +  ++I Y+    F +    CL  S  +H F   S L +     
Sbjct: 274 FYQFPSSEVFMSEQVPKAAKLITYV----FLIAAAKCLFSSVFWHTFNGTSLLRLRCKFA 329

Query: 153 KLDYLGIVALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLACTIVSLSDKFRSRDWRP 212
            +DY GI  L+  S+++  F   +        +  L+   G+    ++ S KF   + RP
Sbjct: 330 CVDYSGISILITASILTTEFVTMYQCPWAMVSYMALSTALGIFGVFMNWSPKFDRPEARP 389

Query: 213 YRAALFV---AFGLSALFPV--IAGICHYGFKVTW--TRIQLKWVFLEGVFYILGALLYG 265
            R   F+   + G+ +   +  I  + H     TW  + I  K V    V+Y++G + YG
Sbjct: 390 LRIKFFILLASMGILSFLHLTFITSLSH----STWLLSPITKKSV----VWYLVGVVFYG 441

Query: 266 VRFPER 271
              PER
Sbjct: 442 SFIPER 447

>KNAG0K00670 Chr11 complement(119419..120384) [966 bp, 321 aa] {ON} 
          Length = 321

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/122 (24%), Positives = 59/122 (48%), Gaps = 15/122 (12%)

Query: 95  FLLMTLFNQLA-IERYETTRMIDYIMIDLFFLGGFTCLMMSSTFHCFKCHSLP--VAVLG 151
           F+L+  F  +  + R+ +T M DY+++++F         +++ F C  CH +       G
Sbjct: 107 FVLLVFFTDVYLVPRHVSTTMTDYVLLNVF---------LATAFQCAACHMVQCFTTTAG 157

Query: 152 NKLDYLGIVALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGL---ACTIVSLSDKFRSR 208
           + L  + ++     S V++L+Y ++DN  YF + +  T  + L   A T+ S +     R
Sbjct: 158 SVLSTITMLNHWACSAVTLLYYSYYDNVFYFKLLALFTANWTLVVAAVTVTSTASNSPKR 217

Query: 209 DW 210
            W
Sbjct: 218 QW 219

>ZYRO0B10538g Chr2 complement(830311..831906) [1596 bp, 531 aa] {ON}
           some similarities with uniprot|Q07959 Saccharomyces
           cerevisiae YLR023C IZH3 Membrane protein involved in
           zinc metabolism member of the four-protein IZH family
           expression induced by zinc deficiency deletion reduces
           sensitivity to elevated zinc and shortens lag phase
           overexpression reduces Zap1p activity
          Length = 531

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 54/241 (22%), Positives = 104/241 (43%), Gaps = 26/241 (10%)

Query: 46  EIPEWQKDNEHILNGYILETKSVGACLKSLLYL--HNESVNIYTHLIPGWCFLLMTLFNQ 103
           ++P   ++N++I++GY        + L  + +   HNE+ NI+THL+ G   + +  ++ 
Sbjct: 209 QLPFPYRENKYIIHGYRFYASHKKSFLSIINWYGWHNETSNIWTHLLGGLYLIYLAFYHF 268

Query: 104 LAIERYETTRMID--YIMIDLFFLGGFTCLMMSSTFHCFK-CHSLPVAVLGNKLDYLGIV 160
                + + R+      ++ +F      C+  S  +H F   H L +      +DY GI 
Sbjct: 269 PHSNIWLSDRVPKPAKCIVAVFLAAAIKCMFASVFWHTFNGTHLLRLRSKFACVDYTGIT 328

Query: 161 ALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLACTIVSLSDKFRSRDWRPYRAALFV- 219
            L+  S++++ F   +D  +    +   ++  G+    ++ S KF   + RP R   F+ 
Sbjct: 329 ILITASILTVEFVTMYDYKISLLFYMICSLALGIIGVSMNWSPKFDRPEARPLRIKFFIL 388

Query: 220 --AFGLSALFPVIAGICHYGFKVTW-------TRIQLKWVFLEGVFYILGALLYGVRFPE 270
               G S+   ++       F   W       T +  K V    V+Y++G   YG   PE
Sbjct: 389 LATVGCSSFIRLV-------FLTNWRYAADLLTPLTNKSV----VWYLIGVFFYGSFIPE 437

Query: 271 R 271
           R
Sbjct: 438 R 438

>Skud_14.42 Chr14 (70507..72081) [1575 bp, 524 aa] {ON} YNL295W
           (REAL)
          Length = 524

 Score = 37.7 bits (86), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 30/67 (44%), Gaps = 10/67 (14%)

Query: 85  IYTHLIPGWCFLLMTLFNQLAIERYET----------TRMIDYIMIDLFFLGGFTCLMMS 134
           I  H+ P +  +L TL N    +++ET          TR+ D I    FF  G  C++  
Sbjct: 395 IMDHIYPVYTTILSTLANSKDSKKFETKIKGYIEKIITRLSDEIPSTYFFQDGVDCIIQP 454

Query: 135 STFHCFK 141
           S  H FK
Sbjct: 455 SPVHNFK 461

>Smik_14.36 Chr14 (61288..62862) [1575 bp, 524 aa] {ON} YNL295W
           (REAL)
          Length = 524

 Score = 35.8 bits (81), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 22/91 (24%), Positives = 37/91 (40%), Gaps = 15/91 (16%)

Query: 61  YILETKSVGACLKSLLYLHNESVNIYTHLIPGWCFLLMTLFNQLAIERYETT-------- 112
           Y+ ++KS     +  L +      I  H+ P +  +L TL N     ++E          
Sbjct: 376 YVSKSKSTKKLFRRSLKM-----KIMDHIYPVYTTILSTLTNSKDSSKFENKIKGYIEKI 430

Query: 113 --RMIDYIMIDLFFLGGFTCLMMSSTFHCFK 141
             R+ D +    FF  G  C+++ S  H FK
Sbjct: 431 IARLSDEVPSTYFFQDGVDCIILPSPIHNFK 461

>YNL295W Chr14 (76946..78520) [1575 bp, 524 aa] {ON} Putative
           protein of unknown function
          Length = 524

 Score = 34.3 bits (77), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 24/98 (24%), Positives = 40/98 (40%), Gaps = 16/98 (16%)

Query: 55  EHI-LNGYILETKSVGACLKSLLYLHNESVNIYTHLIPGWCFLLMTLFNQLAIERYETT- 112
           EH+ L  Y+ ++K      +  L +      I  H+ P +  +L TL N    +++E   
Sbjct: 369 EHLPLAVYVSKSKGTKKLFRRSLKM-----KIMDHIYPVYTTILSTLTNSRDSKKFENKI 423

Query: 113 ---------RMIDYIMIDLFFLGGFTCLMMSSTFHCFK 141
                    R+ D +    FF  G  C++  S  H FK
Sbjct: 424 KAYIEKIIVRLSDEVPSTYFFQDGVDCIIQPSPIHNFK 461

>Suva_14.44 Chr14 (73757..75334) [1578 bp, 525 aa] {ON} YNL295W
           (REAL)
          Length = 525

 Score = 34.3 bits (77), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 18/69 (26%), Positives = 31/69 (44%), Gaps = 10/69 (14%)

Query: 83  VNIYTHLIPGWCFLLMTLFNQLAIERYET----------TRMIDYIMIDLFFLGGFTCLM 132
           + I  H+ P +  +L +L +   ++++E           TR+ D I    FF  G  C++
Sbjct: 394 MKIMDHIYPVYTTILSSLTHSKDLKKFENKIKESIEKIITRLSDEIPSTYFFQDGVDCII 453

Query: 133 MSSTFHCFK 141
             S  H FK
Sbjct: 454 QPSPIHNFK 462

>Smik_1.90 Chr1 (160467..161183) [717 bp, 238 aa] {ON} YAR033W
           (REAL)
          Length = 238

 Score = 32.0 bits (71), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 31/48 (64%), Gaps = 3/48 (6%)

Query: 159 IVALVVTSMVSILFYGFHDN--NLYFYVFSGLTIMFGLACTIVSLSDK 204
           ++ LV TS+VS+L + FHD+  + +FYVFS L   F L  T++   D+
Sbjct: 53  LMLLVTTSLVSLLVF-FHDSYRSTFFYVFSSLVSGFLLQGTLIVFCDE 99

>TPHA0H01830 Chr8 (420005..421891) [1887 bp, 628 aa] {ON} Anc_6.252
           YMR179W
          Length = 628

 Score = 31.2 bits (69), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 40/93 (43%), Gaps = 9/93 (9%)

Query: 8   KRKAVGIEPEGVMTEE-TTTLLNGSR-----IEERTRRRLYKWDEIPEWQKDNEHILNGY 61
           K+K+  I P  +      TT+ N SR     + +  ++ + + D I +  K    I    
Sbjct: 301 KKKSSNIRPTNITKSNIPTTINNESRRNSYKLNQPYKKNVERSDNIGKSSKSYNKIKKTN 360

Query: 62  ILETKSVGACLKSLLYLHNES---VNIYTHLIP 91
            LE K  G    S +Y HNES   VN  +  IP
Sbjct: 361 KLEVKLSGLDKNSQIYQHNESQFPVNDTSQTIP 393

>KNAG0I00420 Chr9 complement(62534..65791) [3258 bp, 1085 aa] {ON}
           Anc_1.459 YJR035W
          Length = 1085

 Score = 31.2 bits (69), Expect = 4.5,   Method: Composition-based stats.
 Identities = 16/51 (31%), Positives = 30/51 (58%), Gaps = 1/51 (1%)

Query: 33  IEERTRRRLY-KWDEIPEWQKDNEHILNGYILETKSVGACLKSLLYLHNES 82
           I++R+  R Y KW ++PEW+K +  I    + +T  V   + SLL+ + ++
Sbjct: 268 IKKRSVDRKYDKWPDLPEWRKPHPDIPTARLNDTFKVPGEIHSLLFNYQKT 318

>KAFR0C01460 Chr3 (300109..300768) [660 bp, 219 aa] {ON} Anc_3.90
           YOL101C
          Length = 219

 Score = 30.4 bits (67), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 47/97 (48%), Gaps = 14/97 (14%)

Query: 93  WCFLLMTLFNQLAIERYETT-RMIDYIMIDLFFLGGFTCLMMSSTFHCFKCHSLPVAVLG 151
           + FLL+   +   I RY++   M DYI+I+++      CL  S   +  K     +  L 
Sbjct: 48  YLFLLVFFTDVYLISRYKSVMTMTDYIIINVYIA---ICLKFS-ILNLLKKEKKIMKNLN 103

Query: 152 NKLDYLGIVALVVTSMVSILFYGFHDNNLYFYVFSGL 188
           N         L + S+VS+L+Y ++DN  YF V S L
Sbjct: 104 N---------LQIISIVSLLYYIYYDNIFYFKVLSLL 131

>Ecym_2743 Chr2 (1438180..1441914) [3735 bp, 1244 aa] {ON} similar
           to Ashbya gossypii AER194W
          Length = 1244

 Score = 30.4 bits (67), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 53/227 (23%), Positives = 97/227 (42%), Gaps = 32/227 (14%)

Query: 1   MVEA-GLTKRKAVGIEPEGVMTEETTTLL--NGSRIEERTRRRLY----KWDEIPEWQKD 53
           +VEA    +R    I P  V++  +   +  N   +    +R +Y    K  ++P+    
Sbjct: 93  LVEAFAFQQRLLQDIHPSNVLSVRSAFDMWDNSLDLLRADKRPMYTVNKKLRDLPQNLLL 152

Query: 54  NEHILNGYILETKSVGACL---KSLLYLHNESVNIYTHLIPGWCFLLMT---LFNQLAIE 107
               LNGYI+  + +   L     L    N++ ++  +L     F  +T   +F++L   
Sbjct: 153 GATRLNGYIVSARGIATVLLAPNDLAAKRNDNFSLSRNLKALKSFSNITHFYIFDELDSM 212

Query: 108 RYETTR-----------MIDYIMIDLFF--LGGFTCLMMSSTFHCFKCHSLPVAVLGNKL 154
            Y   R           +IDY  I   +  L G+    MSS  H   C  + +AV+    
Sbjct: 213 NYGKQRELLRFLVVPLTVIDYFWIVAIYAALIGYFIYSMSSLRHIKSCVGISIAVVCQ-- 270

Query: 155 DYLGIVALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLACTIVSL 201
             L +V +  +  ++ LFY  +D+N+ +++F    I+  L  +IV+L
Sbjct: 271 --LTLV-IAASRTITALFYKSNDDNVLWFLFYIPVIVISLT-SIVNL 313

>Ecym_5257 Chr5 complement(535932..536615) [684 bp, 227 aa] {ON}
           similar to Ashbya gossypii AER217W
          Length = 227

 Score = 29.6 bits (65), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 12/35 (34%), Positives = 20/35 (57%)

Query: 257 YILGALLYGVRFPERVAPGTFDIWGQSHQLFHVLV 291
           YILG L   + F    +P TF++W    + F+V++
Sbjct: 9   YILGGLAVWLPFCCEASPVTFELWADKEECFYVII 43

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.330    0.143    0.462 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 31,664,186
Number of extensions: 1315802
Number of successful extensions: 4137
Number of sequences better than 10.0: 89
Number of HSP's gapped: 4171
Number of HSP's successfully gapped: 89
Length of query: 315
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 206
Effective length of database: 40,982,805
Effective search space: 8442457830
Effective search space used: 8442457830
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 66 (30.0 bits)