Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_56.224476.25ON73573538270.0
KLTH0C11066g6.25ON73573521810.0
SAKL0E01452g6.25ON73773819370.0
ACL001C6.25ON74574417720.0
KLLA0D01309g6.25ON74475117700.0
Ecym_30306.25ON74775817210.0
ZYRO0C07678g6.25ON74175417110.0
KAFR0G026606.25ON73574217010.0
KNAG0M012306.25ON73874417000.0
TPHA0J003706.25ON74375916850.0
Suva_15.1766.25ON74573916640.0
NCAS0H008606.25ON75576016610.0
CAGL0E02585g6.25ON73775016470.0
Kpol_1037.296.25ON74675116420.0
TBLA0A071706.25ON77174916420.0
YOR001W (RRP6)6.25ON73373716240.0
TDEL0G044406.25ON73574816190.0
Smik_15.1706.25ON77374316170.0
Skud_15.1626.25ON73473315950.0
NDAI0D008506.25ON79051815660.0
SAKL0E00704g6.3ON87491743.1
TPHA0F035701.515ON246077743.3
CAGL0M03575g3.69ON33198715.3
Ecym_23708.702ON792106716.9
ADR400W7.21ON796154717.0
Suva_16.2708.493ON79869717.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_56.22447
         (735 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_56.22447 s56 (133578..135785) [2208 bp, 735 aa] {ON} YOR001...  1478   0.0  
KLTH0C11066g Chr3 complement(910359..912566) [2208 bp, 735 aa] {...   844   0.0  
SAKL0E01452g Chr5 (108911..111124) [2214 bp, 737 aa] {ON} simila...   750   0.0  
ACL001C Chr3 complement(354804..357041) [2238 bp, 745 aa] {ON} S...   687   0.0  
KLLA0D01309g Chr4 (114713..116947) [2235 bp, 744 aa] {ON} simila...   686   0.0  
Ecym_3030 Chr3 (58929..61172) [2244 bp, 747 aa] {ON} similar to ...   667   0.0  
ZYRO0C07678g Chr3 (582236..584461) [2226 bp, 741 aa] {ON} simila...   663   0.0  
KAFR0G02660 Chr7 (549718..551925) [2208 bp, 735 aa] {ON} Anc_6.2...   659   0.0  
KNAG0M01230 Chr13 complement(223471..225687) [2217 bp, 738 aa] {...   659   0.0  
TPHA0J00370 Chr10 complement(81371..83602) [2232 bp, 743 aa] {ON...   653   0.0  
Suva_15.176 Chr15 (301216..303453) [2238 bp, 745 aa] {ON} YOR001...   645   0.0  
NCAS0H00860 Chr8 complement(156180..158447) [2268 bp, 755 aa] {O...   644   0.0  
CAGL0E02585g Chr5 (246427..248640) [2214 bp, 737 aa] {ON} simila...   639   0.0  
Kpol_1037.29 s1037 complement(68981..71221) [2241 bp, 746 aa] {O...   637   0.0  
TBLA0A07170 Chr1 (1784984..1787299) [2316 bp, 771 aa] {ON} Anc_6...   637   0.0  
YOR001W Chr15 (326832..329033) [2202 bp, 733 aa] {ON}  RRP6Nucle...   630   0.0  
TDEL0G04440 Chr7 (805881..808088) [2208 bp, 735 aa] {ON} Anc_6.2...   628   0.0  
Smik_15.170 Chr15 (294013..296334) [2322 bp, 773 aa] {ON} YOR001...   627   0.0  
Skud_15.162 Chr15 (286822..289026) [2205 bp, 734 aa] {ON} YOR001...   619   0.0  
NDAI0D00850 Chr4 complement(190801..193173) [2373 bp, 790 aa] {O...   607   0.0  
SAKL0E00704g Chr5 complement(45027..47651) [2625 bp, 874 aa] {ON...    33   3.1  
TPHA0F03570 Chr6 (768648..776030) [7383 bp, 2460 aa] {ON} Anc_1....    33   3.3  
CAGL0M03575g Chr13 complement(403738..404733) [996 bp, 331 aa] {...    32   5.3  
Ecym_2370 Chr2 (719985..722363) [2379 bp, 792 aa] {ON} similar t...    32   6.9  
ADR400W Chr4 (1423238..1425628) [2391 bp, 796 aa] {ON} Syntenic ...    32   7.0  
Suva_16.270 Chr16 (470154..472550) [2397 bp, 798 aa] {ON} YPL045...    32   7.9  

>Kwal_56.22447 s56 (133578..135785) [2208 bp, 735 aa] {ON} YOR001W
           (RRP6) - involved in 5.8S rRNA processing [contig 185]
           FULL
          Length = 735

 Score = 1478 bits (3827), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 718/735 (97%), Positives = 718/735 (97%)

Query: 1   MAKTQEDKRSSILTQVVGTIRASSAISAQDVDFYKSLDSTISESLDETSAKLLXXXXXXX 60
           MAKTQEDKRSSILTQVVGTIRASSAISAQDVDFYKSLDSTISESLDETSAKLL       
Sbjct: 1   MAKTQEDKRSSILTQVVGTIRASSAISAQDVDFYKSLDSTISESLDETSAKLLSLINDVV 60

Query: 61  XXXXXXXXXXEPGRAGLENSWNNIGEVMDLLFEKSEHALAAMKKKGSNIIGNNLQYLDDS 120
                     EPGRAGLENSWNNIGEVMDLLFEKSEHALAAMKKKGSNIIGNNLQYLDDS
Sbjct: 61  ISIDDNNDLIEPGRAGLENSWNNIGEVMDLLFEKSEHALAAMKKKGSNIIGNNLQYLDDS 120

Query: 121 QPLTDTTLTKITKPQASFSRPVDNTESHPFKPLLVQKPNALRPLDDVLQLTVEEEGIPAH 180
           QPLTDTTLTKITKPQASFSRPVDNTESHPFKPLLVQKPNALRPLDDVLQLTVEEEGIPAH
Sbjct: 121 QPLTDTTLTKITKPQASFSRPVDNTESHPFKPLLVQKPNALRPLDDVLQLTVEEEGIPAH 180

Query: 181 YPHPYEYEIDHQEYDESVLEIRPPIPSKPWEETDATWVDNLGTLNDMIRELSKAKELAID 240
           YPHPYEYEIDHQEYDESVLEIRPPIPSKPWEETDATWVDNLGTLNDMIRELSKAKELAID
Sbjct: 181 YPHPYEYEIDHQEYDESVLEIRPPIPSKPWEETDATWVDNLGTLNDMIRELSKAKELAID 240

Query: 241 LEHHDYRTYYGITCLMQISTRENDWLVDTIALRDHLWVLNEIFTNPKVIKVFHGAFMDVI 300
           LEHHDYRTYYGITCLMQISTRENDWLVDTIALRDHLWVLNEIFTNPKVIKVFHGAFMDVI
Sbjct: 241 LEHHDYRTYYGITCLMQISTRENDWLVDTIALRDHLWVLNEIFTNPKVIKVFHGAFMDVI 300

Query: 301 WLQRDLGLYLVSLFDTFHASRLLGFPKHSLAYLLERYAHFKTSKKYQLADWRIRPLSKPL 360
           WLQRDLGLYLVSLFDTFHASRLLGFPKHSLAYLLERYAHFKTSKKYQLADWRIRPLSKPL
Sbjct: 301 WLQRDLGLYLVSLFDTFHASRLLGFPKHSLAYLLERYAHFKTSKKYQLADWRIRPLSKPL 360

Query: 361 KAYARADTHFLLNIYDQMRNSLIEQGKLAQSLHNSRGVAKRRFEYTKFRPTVMTSEVYSP 420
           KAYARADTHFLLNIYDQMRNSLIEQGKLAQSLHNSRGVAKRRFEYTKFRPTVMTSEVYSP
Sbjct: 361 KAYARADTHFLLNIYDQMRNSLIEQGKLAQSLHNSRGVAKRRFEYTKFRPTVMTSEVYSP 420

Query: 421 VEREDPWRSLIFHYNIPQSKSFLLKRLYEWRDTIARRDDESPRYVMPNQLLVALVMNAPT 480
           VEREDPWRSLIFHYNIPQSKSFLLKRLYEWRDTIARRDDESPRYVMPNQLLVALVMNAPT
Sbjct: 421 VEREDPWRSLIFHYNIPQSKSFLLKRLYEWRDTIARRDDESPRYVMPNQLLVALVMNAPT 480

Query: 481 DTYGLLSVTSFVTEHVRSNAKSLSQLIKKTLASPQDLFTDQINHMDSNKSMVDSKLSPGD 540
           DTYGLLSVTSFVTEHVRSNAKSLSQLIKKTLASPQDLFTDQINHMDSNKSMVDSKLSPGD
Sbjct: 481 DTYGLLSVTSFVTEHVRSNAKSLSQLIKKTLASPQDLFTDQINHMDSNKSMVDSKLSPGD 540

Query: 541 VKANHQNFDQYTRKSRELVIHGPTVVRGCSLFPGKPLPNEAYVSYQGTQVHHIEPTVLDD 600
           VKANHQNFDQYTRKSRELVIHGPTVVRGCSLFPGKPLPNEAYVSYQGTQVHHIEPTVLDD
Sbjct: 541 VKANHQNFDQYTRKSRELVIHGPTVVRGCSLFPGKPLPNEAYVSYQGTQVHHIEPTVLDD 600

Query: 601 RRELVAQNITTTANVTEKLQVAVEKTPAPEVSDELDEGEAKELSDDTVSQLKEDKDEIVV 660
           RRELVAQNITTTANVTEKLQVAVEKTPAPEVSDELDEGEAKELSDDTVSQLKEDKDEIVV
Sbjct: 601 RRELVAQNITTTANVTEKLQVAVEKTPAPEVSDELDEGEAKELSDDTVSQLKEDKDEIVV 660

Query: 661 LKRRKALPQSSSPPKNAEGNPKEILDFKNNKKIMTATASVPRKSTKRFDPYAIQASGPDG 720
           LKRRKALPQSSSPPKNAEGNPKEILDFKNNKKIMTATASVPRKSTKRFDPYAIQASGPDG
Sbjct: 661 LKRRKALPQSSSPPKNAEGNPKEILDFKNNKKIMTATASVPRKSTKRFDPYAIQASGPDG 720

Query: 721 VKRRKKTRGIQKSFK 735
           VKRRKKTRGIQKSFK
Sbjct: 721 VKRRKKTRGIQKSFK 735

>KLTH0C11066g Chr3 complement(910359..912566) [2208 bp, 735 aa] {ON}
           similar to uniprot|Q12149 Saccharomyces cerevisiae
           YOR001W RRP6 Exonuclease component of the nuclear
           exosome contributes to the quality-control system that
           retains and degrades aberrant mRNAs in the nucleus
          Length = 735

 Score =  844 bits (2181), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 415/735 (56%), Positives = 534/735 (72%), Gaps = 1/735 (0%)

Query: 1   MAKTQEDKRSSILTQVVGTIRASSAISAQDVDFYKSLDSTISESLDETSAKLLXXXXXXX 60
           MA+    +  S+L QV+ TIRASSA++AQDV FYK+LD +I+ S++  SA+LL       
Sbjct: 1   MAQAHGSEDGSVLNQVIATIRASSAVTAQDVSFYKNLDPSIATSVNNISARLLGLINDIL 60

Query: 61  XXXXXXXXXXEPGRAGLENSWNNIGEVMDLLFEKSEHALAAMKKKGSNIIGNNLQYLDDS 120
                     E G  GLE++W+N+GEVMDLLFEKSEHALAA +K+ +  +   +QYLDDS
Sbjct: 61  LSVDENNDIIEQGSEGLESAWSNVGEVMDLLFEKSEHALAAGEKRDNGELSKTVQYLDDS 120

Query: 121 QPLTDTTLTKITKPQASFSRPVDNTESHPFKPLLVQKPNALRPLDDVLQLTVEEEGIPAH 180
             L D    KI KPQ  F RP+DN+ESHPFKPLL +KP+ALR LD+ L+LT E+E +PAH
Sbjct: 121 PSLHDGAPKKILKPQLLFKRPIDNSESHPFKPLLKKKPHALRSLDESLRLTAEQEDVPAH 180

Query: 181 YPHPYEYEIDHQEYDESVLEIRPPIPSKPWEETDATWVDNLGTLNDMIRELSKAKELAID 240
           YP PYEYEIDHQEY+ESVL+I  P+PS PW+ET+A WVDN   L  M+ EL  A E+AID
Sbjct: 181 YPQPYEYEIDHQEYNESVLQISEPVPSLPWDETEAEWVDNTDALKLMLNELLLANEIAID 240

Query: 241 LEHHDYRTYYGITCLMQISTRENDWLVDTIALRDHLWVLNEIFTNPKVIKVFHGAFMDVI 300
           LEHHDYRTYYGITCLMQISTRE DWL+DTIALRD LW+LNE+FT+PK+ KV HGAFMD+I
Sbjct: 241 LEHHDYRTYYGITCLMQISTREKDWLIDTIALRDDLWILNEVFTDPKITKVLHGAFMDII 300

Query: 301 WLQRDLGLYLVSLFDTFHASRLLGFPKHSLAYLLERYAHFKTSKKYQLADWRIRPLSKPL 360
           WLQRDLGLY+VSLFDT+HASRLLG PKHSLAYLLERYAHFKTSKKYQL+DWR+RPL K L
Sbjct: 301 WLQRDLGLYIVSLFDTYHASRLLGSPKHSLAYLLERYAHFKTSKKYQLSDWRVRPLPKAL 360

Query: 361 KAYARADTHFLLNIYDQMRNSLIEQGKLAQSLHNSRGVAKRRFEYTKFRPTVMTSEVYSP 420
           KAYARADTHFLLNIYD MRNSLIEQ KL+Q LH+SR VAKRRFE+T FRP ++TS V+SP
Sbjct: 361 KAYARADTHFLLNIYDNMRNSLIEQNKLSQVLHDSRNVAKRRFEFTTFRPKIVTSHVFSP 420

Query: 421 VEREDPWRSLIFHYNIPQSKSFLLKRLYEWRDTIARRDDESPRYVMPNQLLVALVMNAPT 480
           +EREDPWR+L+F YNIPQSKS L++RLYEWRD +ARRDDESPRYV+PNQLLV+L +NAPT
Sbjct: 421 IEREDPWRTLMFQYNIPQSKSLLVRRLYEWRDMVARRDDESPRYVIPNQLLVSLAVNAPT 480

Query: 481 DTYGLLSVTSFVTEHVRSNAKSLSQLIKKTLASPQDLFTDQINHMDSNKSMVDSKLSPGD 540
               +++ ++FVTEH+R NAKSL+ LIKK+L S  + F   +N  ++ ++   +K+S  D
Sbjct: 481 TPALIMATSTFVTEHIRQNAKSLALLIKKSLESSSNEFGQLLNSANTVQNSSPTKMSSED 540

Query: 541 VKANHQNFDQYTRKSRELVIHGPTVVRGCSLFPGKPLPNEAYVSYQGTQVHHIEPTVLDD 600
           ++ N + F+++             +  G SLF  K +P E YVSYQ ++   ++   L++
Sbjct: 541 IEKNSRMFEKFLEDFSYEKAADCGISLGSSLFQKKFVPCEEYVSYQESRASLVDHNSLEN 600

Query: 601 RRELVAQNITTTANVTEKLQVAVEKTPAPEVSDELDEGEAKELSDDTVSQLKEDKDEIVV 660
           RR  V++      ++  + QV +    +  V D+    E  E +++     KE+ DE++V
Sbjct: 601 RRHQVSKKYEAERDIA-RPQVHIRAASSHAVCDKEAGAEDNESAEEENKARKEEMDEVIV 659

Query: 661 LKRRKALPQSSSPPKNAEGNPKEILDFKNNKKIMTATASVPRKSTKRFDPYAIQASGPDG 720
           LK+RK L        +      E LD ++ +KI+ A ++  R+  KRFDPYA  A+GP  
Sbjct: 660 LKQRKTLADKEQRAVDKATPSIEPLDLQSARKILEAPSNNVRRPKKRFDPYATLAAGPPS 719

Query: 721 VKRRKKTRGIQKSFK 735
           VK+RKKT+G+QKSF+
Sbjct: 720 VKKRKKTKGLQKSFR 734

>SAKL0E01452g Chr5 (108911..111124) [2214 bp, 737 aa] {ON} similar
           to uniprot|Q12149 Saccharomyces cerevisiae YOR001W RRP6
           Exonuclease component of the nuclear exosome contributes
           to the quality-control system that retains and degrades
           aberrant mRNAs in the nucleus
          Length = 737

 Score =  750 bits (1937), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/738 (52%), Positives = 516/738 (69%), Gaps = 14/738 (1%)

Query: 7   DKRSSILTQVVGTIRASSAISAQDVDFYKSLDSTISESLDETSAKLLXXXXXXXXXXXXX 66
           DK   +L+ +VGT+RA+SA+SAQD+DF+KSLDS IS+S++ +S+KLL             
Sbjct: 4   DKPDKLLSNLVGTVRAASALSAQDLDFFKSLDSGISKSVEGSSSKLLNLINEVLLSIDEN 63

Query: 67  XXXXEPGRAGLENSWNNIGEVMDLLFEKSEHALAAMKKKGSNIIGNNLQYLDDSQPLTDT 126
               E G+   + SW +IG++MD LFEKS+HA  A+K+   N   +N+QYLDDS      
Sbjct: 64  NDTIEYGKDNFQESWKDIGDIMDNLFEKSDHAFDALKRNSINQGNSNVQYLDDSSRSNLN 123

Query: 127 TLTKITKPQASFSRPVDNTESHPFKPLLVQKPNALRPLDDVLQLTVEEEGIPAHYPHPYE 186
              +I KPQ +F  P+DNTESHPFKPLL  KP+ALRPL ++L+ T E E IP+HYPHPY 
Sbjct: 124 PSKRIEKPQLNFKTPIDNTESHPFKPLLENKPHALRPLSEILKQTPETENIPSHYPHPYG 183

Query: 187 YEIDHQEYDESVLEIRPPIPSKPWEETDATWVDNLGTLNDMIRELSKAKELAIDLEHHDY 246
           YEID QEY+ES+L+IR PIPS+PWE+TD  WVD   +L  ++ EL  AKE+A+DLEHHDY
Sbjct: 184 YEIDTQEYNESILQIRDPIPSQPWEDTDPVWVDTKESLQKLLNELRSAKEIAVDLEHHDY 243

Query: 247 RTYYGITCLMQISTRENDWLVDTIALRDHLWVLNEIFTNPKVIKVFHGAFMDVIWLQRDL 306
           R+YYGI CLMQISTRE DWLVDTIALR+ L VLNEIFT+P V+KVFHGAFMD+IWLQRDL
Sbjct: 244 RSYYGIVCLMQISTRERDWLVDTIALREELHVLNEIFTDPSVLKVFHGAFMDIIWLQRDL 303

Query: 307 GLYLVSLFDTFHASRLLGFPKHSLAYLLERYAHFKTSKKYQLADWRIRPLSKPLKAYARA 366
           G+Y+VSLFDT+HASR LG P+HSLAYLLE++A FKTSKKYQLADWRIRPL+KP++AYARA
Sbjct: 304 GIYVVSLFDTYHASRSLGLPRHSLAYLLEKFAQFKTSKKYQLADWRIRPLTKPMRAYARA 363

Query: 367 DTHFLLNIYDQMRNSLIEQGKLAQSLHNSRGVAKRRFEYTKFRPTVMTSEVYSPVEREDP 426
           DTHFLLNIYDQ+RNSLIEQ KLA  LH+SR VAKRRFEYT FRP +++++V+SP+E+++P
Sbjct: 364 DTHFLLNIYDQLRNSLIEQNKLAAVLHDSRNVAKRRFEYTSFRPKIVSADVFSPIEKDEP 423

Query: 427 WRSLIFHYNIPQSKSFLLKRLYEWRDTIARRDDESPRYVMPNQLLVALVMNAPTDTYGLL 486
           WR+L++ YNIP S+  L+++LYEWRDTIARRDDESPRYVMPNQLLV+LV  APTD  G+L
Sbjct: 424 WRNLMYQYNIPLSREPLMRKLYEWRDTIARRDDESPRYVMPNQLLVSLVAIAPTDPAGVL 483

Query: 487 SVTSFVTEHVRSNAKSLSQLIKKTLASPQ--DLFTDQINHMDSNKSMVDSKLSPGDVKAN 544
           SV++F+T++VRSN+K LS LIKKTL S +  D+ T+        +  +   LS   ++  
Sbjct: 484 SVSNFITDYVRSNSKMLSNLIKKTLESLKNGDVSTNNAGSSQLEEKDLSQVLSISQIQNM 543

Query: 545 HQNFDQYTRKSRELVIHGPTVVRGCSLFPGKPL-PNEAYVSYQGTQVHHIEPTVLDDRRE 603
              F+    K ++      ++ +   LF G  +  N+  V Y       I+   L +R+ 
Sbjct: 544 CLQFNSLASKVKKANSATNSMPKVSILFDGDHIFSNDRAVLYSKNSKIVIDENQLQERKL 603

Query: 604 LVAQNITTTANVTEKLQVAVEKTPAPEVSDELDEGEAKELSDDTVSQLKEDKDEIVVLKR 663
            V++ +        +L V V      EVS ++ E +    + +T   L+ +KDEI+VLK+
Sbjct: 604 EVSEKLKEVQEPDFRLHVNVTTKETDEVSKDVSEKDDVNRASET-DPLETNKDEIIVLKK 662

Query: 664 RKAL-PQSSSPPKNAEGNPKEI--LDFKNNKKIM--TATASVPRKSTKRFDPYAIQASGP 718
           +K   PQ     +   GN  ++  +D+KN +K++  +  +S  + + +RFDPY  +  GP
Sbjct: 663 KKRHEPQD----RKKVGNSTDVEPMDYKNAEKLLGNSKKSSKQKTTKRRFDPYTSENVGP 718

Query: 719 DGVKRRKK-TRGIQKSFK 735
              K+RKK T G   SFK
Sbjct: 719 QSAKKRKKPTPGKNMSFK 736

>ACL001C Chr3 complement(354804..357041) [2238 bp, 745 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR001W
           (RRP6)
          Length = 745

 Score =  687 bits (1772), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/744 (49%), Positives = 492/744 (66%), Gaps = 37/744 (4%)

Query: 1   MAKTQEDKRSSILTQVVGTIRASSAISAQDVDFYKSLDSTISESLDETSAKLLXXXXXXX 60
           MA T ED    +  ++V TIRA++A+SAQD+DFY+SL  ++ + LD+TSA ++       
Sbjct: 1   MASTDEDP---LFKRIVSTIRAAAALSAQDIDFYRSLHPSVGQELDDTSATVVSLINELL 57

Query: 61  XXXXXXXXXXEPGRAGLENSWNNIGEVMDLLFEKSEHALAAMKKKGSNII-GNNLQYLDD 119
                     +PGR   E+SW  +  VMD +FEKS+HA  ++K   S+   G N+QYL D
Sbjct: 58  LSVDENNNELKPGRDNFEDSWKELSNVMDNIFEKSDHAFDSIKHGSSSRNEGVNMQYLAD 117

Query: 120 SQPLTDTTLTKITKPQASFSRPVDNTESHPFKPLLVQKPNALRPLDDVLQLTVEEEGIPA 179
           S     T   +I KPQ  F  PVDNTE HPFKPLL +KP+AL+PL++ L L  EEE +PA
Sbjct: 118 SSHDDSTPSKRIEKPQLLFKTPVDNTELHPFKPLLKEKPHALKPLEESLMLAPEEENVPA 177

Query: 180 HYPHPYEYEIDHQEYDESVLEIRPPIPSKPWEETDATWVDNLGTLNDMIRELSKAKELAI 239
           HYPHPYEYEID Q Y++SVLE+R  I  +PWE T+  WVDN+ +L+ M+ EL + KELA+
Sbjct: 178 HYPHPYEYEIDKQPYNDSVLEVRERIDPQPWEATEPIWVDNVESLSQMLDELKEVKELAV 237

Query: 240 DLEHHDYRTYYGITCLMQISTRENDWLVDTIALRDHLWVLNEIFTNPKVIKVFHGAFMDV 299
           DLEHHDYR+YYGI CLMQIS+R  DWLVDTIALRD L VLN I  +P V+KVFHGAFMD+
Sbjct: 238 DLEHHDYRSYYGIVCLMQISSRSKDWLVDTIALRDDLHVLNVILPDPTVVKVFHGAFMDM 297

Query: 300 IWLQRDLGLYLVSLFDTFHASRLLGFPKHSLAYLLERYAHFKTSKKYQLADWRIRPLSKP 359
           IWLQRDLGLY+VSLFDT+HASR LGFPKHSLAYLLE +A FKTSKKYQLADWR+RPL KP
Sbjct: 298 IWLQRDLGLYVVSLFDTYHASRALGFPKHSLAYLLETFAKFKTSKKYQLADWRVRPLPKP 357

Query: 360 LKAYARADTHFLLNIYDQMRNSLIEQGKLAQSLHNSRGVAKRRFEYTKFRPTVMTSEVYS 419
           L+ YAR+DTHFLL+IYD +RN+L++ GKLA+ L+ SR VAKRRFEYT FRP +  S VYS
Sbjct: 358 LRDYARSDTHFLLSIYDDLRNALVKAGKLAEVLNASRNVAKRRFEYTSFRPRIPDSNVYS 417

Query: 420 PVEREDPWRSLIFHYNIPQSKSFLLKRLYEWRDTIARRDDESPRYVMPNQLLVALVMNAP 479
           P+E  +PWR L++ YN+P SK  LLK+LYEWRDT+ARRDDES RYVMPNQLLV+LV  +P
Sbjct: 418 PIESTEPWRKLMYQYNLPPSKEPLLKKLYEWRDTVARRDDESVRYVMPNQLLVSLVSLSP 477

Query: 480 TDTYGLLSVTSFVTEHVRSNAKSLSQLIKKTLASPQDLFTDQINHMDSNKSMVDSKLSPG 539
           ++T G+LSV+++VT++VRSNA++L+ LIK+TL + +           S +++ +    P 
Sbjct: 478 SETAGVLSVSTYVTDYVRSNARTLANLIKRTLETIKAGTASVAEFSSSERALSN----PA 533

Query: 540 DVKANH--QNFDQYTRKSRELVIHGPTVVRG-CS------LFPGKPLPNEAYVSYQGTQV 590
              + H  QN D + R    L++         CS      LF        + V Y   Q 
Sbjct: 534 ATLSLHMIQNLDDHFRS---LLMEAQKQSGSICSQHSSSLLFNSDLATGPSAVEYTNGQK 590

Query: 591 HHIEPTVLDDRRELVAQNITT--TANVTEKLQVAVEKTPA--PEVSDELDEGEAKELSDD 646
           H I   VL  R+  + Q  T+     VT+ ++    ++ +  P+VS+++   E +E S +
Sbjct: 591 HVIGDNVLQTRKHALLQKFTSQPVEPVTD-IEAPSHQSSSENPQVSEDISPSEPQE-SQN 648

Query: 647 TVSQLKED--KDEIVVLKRRKALPQSSSPPKNAEGNPKEILDFKNNKKIM-TATASVPRK 703
            V + + D  K EIVVL+++K     +  PK    +P E +D+ N K+++   T+S  ++
Sbjct: 649 EVQKDEPDFEKSEIVVLRKKKK--AHAQKPKGTSSSPTETVDYSNAKEVLGKGTSSTAKR 706

Query: 704 STK------RFDPYAIQASGPDGV 721
             K      +FDPY    + P GV
Sbjct: 707 GDKDRPRKRKFDPYGQDNNAPSGV 730

>KLLA0D01309g Chr4 (114713..116947) [2235 bp, 744 aa] {ON} similar
           to uniprot|Q12149 Saccharomyces cerevisiae YOR001W RRP6
           Exonuclease component of the nuclear exosome contributes
           to the quality-control system that retains and degrades
           aberrant mRNAs in the nucleus
          Length = 744

 Score =  686 bits (1770), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/751 (47%), Positives = 501/751 (66%), Gaps = 57/751 (7%)

Query: 4   TQEDKRSSILTQVVGTIRASSAISAQDVDFYKSLDSTISESLDETSAKLLXXXXXXXXXX 63
           + EDK  ++L+ +V T+R+SSA++AQD+DFYKSLDS I+ SL++TS  +L          
Sbjct: 2   SSEDK-DTLLSSLVQTVRSSSALAAQDIDFYKSLDSNINASLEDTSTNILSLINDLLLSI 60

Query: 64  XXXXXXXEPGRAGLENSWNNIGEVMDLLFEKSEHALAAMKKKGSNIIGN-NLQYLDDSQP 122
                  + G+    +SW +I  +MD LFEKS+HAL  ++       G  +L+YL+D   
Sbjct: 61  DPNNDVIQQGKDSFVDSWKSISNIMDNLFEKSDHALDNIRAGNGGNAGGPSLKYLNDDDR 120

Query: 123 LTDTTLTKITKPQASFSRPVDNTESHPFKPLLVQKPNALRPLDDVLQLTVEEEGIPAHYP 182
             +    +I KPQ SF  PVDNTE HPFKPLL  KP++L+P +  L++  EEE IP+HYP
Sbjct: 121 SNNKPSKRIEKPQLSFKTPVDNTELHPFKPLLEYKPHSLQPFEISLKMVPEEESIPSHYP 180

Query: 183 HPYEYEIDHQEYDESVLEIRPPIPSKPWEETDATWVDNLGTLNDMIRELSKAKELAIDLE 242
           HPYEYEIDHQ+Y++S+L    PIPSK W+ET+A WVD +  LN M  ELSKA ELAIDLE
Sbjct: 181 HPYEYEIDHQKYNDSILVATEPIPSKDWDETEAIWVDTVEGLNKMKDELSKATELAIDLE 240

Query: 243 HHDYRTYYGITCLMQISTRENDWLVDTIALRDHLWVLNEIFTNPKVIKVFHGAFMDVIWL 302
           HHDYR+YYGI CLMQIS RE+DW+VDTIALR+ L++LN+IFT+P V KV HGAFMD+IWL
Sbjct: 241 HHDYRSYYGIVCLMQISDREHDWIVDTIALREELYILNDIFTDPNVTKVLHGAFMDIIWL 300

Query: 303 QRDLGLYLVSLFDTFHASRLLGFPKHSLAYLLERYAHFKTSKKYQLADWRIRPLSKPLKA 362
           QRDLGLY+V LFDT+HASR+LGFPKHSLAYLLER+A+FKTSKKYQLADWRIRPL+KP+ A
Sbjct: 301 QRDLGLYIVGLFDTYHASRMLGFPKHSLAYLLERFANFKTSKKYQLADWRIRPLTKPMLA 360

Query: 363 YARADTHFLLNIYDQMRNSLIEQGKLAQSLHNSRGVAKRRFEYTKFRPTVMTSEVYSPVE 422
           YARADTHFLLNI+D++RNSL+EQ K++  LH SR VAKRRFEY+ FRP V +S V+SP+E
Sbjct: 361 YARADTHFLLNIFDKLRNSLLEQNKMSDVLHESRKVAKRRFEYSSFRPKVPSSAVFSPIE 420

Query: 423 REDPWRSLIFHYNIPQSKSFLLKRLYEWRDTIARRDDESPRYVMPNQLLVALVMNAPTDT 482
           +++PW++++F YNIP SK  LL+RLYEWRDTIARRDDESPRYVMPNQLLV+LV  APT+ 
Sbjct: 421 KDEPWKNIMFQYNIPASKELLLRRLYEWRDTIARRDDESPRYVMPNQLLVSLVAGAPTEP 480

Query: 483 YGLLSVTSFVTEHVRSNAKSLSQLIKKTLASPQDLFTDQ-------INHMDSNKSMVDSK 535
             +LSV+S+V+EH+R+N+K ++ LIK+TL   +DL  +        +   +SN + + + 
Sbjct: 481 INVLSVSSYVSEHLRTNSKVIANLIKRTL---EDLKGNSNSSAIPLLESAESNGTDLANI 537

Query: 536 LSPGDVKA------------NHQNFDQYTRKSRELVIHGPTVVRGCSLFPGKP-----LP 578
           ++   +K+            N Q  +      + ++ +G + +   +     P     +P
Sbjct: 538 ITTSQIKSIQNIFHSLASEINSQKLNNEQNSEKSVLFNGISNLDVNTAVRYTPKTRTLIP 597

Query: 579 NEAYVSYQGTQVHHIEPTVLDDRRELVAQNITTTANVTEKLQVAVEKTPAP-EVSDELDE 637
               +  Q    H I  T+  +  +  AQ+I   +N  E          AP +VS++ + 
Sbjct: 598 QHELLKRQ----HEITRTLEQEYTDRQAQSIVLPSNEDE----------APTQVSNDENR 643

Query: 638 GEAKELSDDTVSQLKEDKDEIVVLKRRKALPQSS----SPPKNAEGNPKEILDFKNNKKI 693
            E    SD +  +++E+KDE++ L++R++   +     SPP +      EI+D+     +
Sbjct: 644 NEVI-TSDPSQEEIEENKDEVITLRKRQSQSNNKRKTISPPAS-----HEIMDYAAGSDL 697

Query: 694 MTAT---ASVPRKSTKRFDPYAIQASGPDGV 721
           + +T    +  +   +RFDPY+++  GP  +
Sbjct: 698 LNSTKNNTNSQKHKKRRFDPYSVEHVGPQPI 728

>Ecym_3030 Chr3 (58929..61172) [2244 bp, 747 aa] {ON} similar to
           Ashbya gossypii ACL001C
          Length = 747

 Score =  667 bits (1721), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/758 (47%), Positives = 489/758 (64%), Gaps = 44/758 (5%)

Query: 7   DKRSSILTQVVGTIRASSAISAQDVDFYKSLDSTISESLDETSAKLLXXXXXXXXXXXXX 66
           D + ++LT+++GT+RA+S+++AQD+DF + LD+++ E LDETS  ++             
Sbjct: 4   DNKDALLTKILGTVRAASSLAAQDIDFCRHLDASVGELLDETSQYIVSLLNEVILSTSKA 63

Query: 67  XXXXEPGRAGLENSWNNIGEVMDLLFEKSEHAL---AAMKKKGSNIIGNNLQYLD-DSQP 122
               E G+  LE +W ++  ++D LFEKS+H+L     +    S+ +  N+QYL+ DSQ 
Sbjct: 64  NNDLEVGKDNLEAAWKDLSNIIDNLFEKSDHSLDVLQKLLSSSSSQLDTNMQYLNVDSQ- 122

Query: 123 LTDTTLT-KITKPQASFSRPVDNTESHPFKPLLVQKPNALRPLDDVLQLTVEEEGIPAHY 181
             D  L+ +I KPQ  F  PVDN+E HPFKPLL  KP+AL+PL++V  LTVE E +PAHY
Sbjct: 123 -RDGKLSQRIVKPQLQFKIPVDNSECHPFKPLLKVKPHALKPLEEVSSLTVETECVPAHY 181

Query: 182 PHPYEYEIDHQEYDESVLEIRPPIPSKPWEETDATWVDNLGTLNDMIRELSKAKELAIDL 241
           PHPYEYEID+Q YD+SVL I+ PI    W+E +  WVDN+  LNDM+  L   KE+A+DL
Sbjct: 182 PHPYEYEIDNQPYDDSVLTIKEPIEPSNWDENEPIWVDNITALNDMLNGLKNVKEIAVDL 241

Query: 242 EHHDYRTYYGITCLMQISTRENDWLVDTIALRDHLWVLNEIFTNPKVIKVFHGAFMDVIW 301
           EHHDYR+YYG+ CLMQISTRE+DWLVDTIALR  L VLNEIFT+P ++KVFHGAFMD+IW
Sbjct: 242 EHHDYRSYYGLVCLMQISTRESDWLVDTIALRQDLQVLNEIFTDPSILKVFHGAFMDIIW 301

Query: 302 LQRDLGLYLVSLFDTFHASRLLGFPKHSLAYLLERYAHFKTSKKYQLADWRIRPLSKPLK 361
           LQRDLGLY+VSLFDT+HASR LGFPKHSLAYLLE +A+FKTSKKYQLADWRIRPLSKP+K
Sbjct: 302 LQRDLGLYVVSLFDTYHASRALGFPKHSLAYLLETFANFKTSKKYQLADWRIRPLSKPMK 361

Query: 362 AYARADTHFLLNIYDQMRNSLIEQGKLAQSLHNSRGVAKRRFEYTKFRPTVMTSEVYSPV 421
            YARADTHFLLNIYD++RNSLI++ KL+  LH SR VAKRRFEYT FRP V++  V+SP+
Sbjct: 362 TYARADTHFLLNIYDKLRNSLIKEDKLSGVLHASRNVAKRRFEYTSFRPKVLSPTVFSPI 421

Query: 422 EREDPWRSLIFHYNIPQSKSFLLKRLYEWRDTIARRDDESPRYVMPNQLLVALVMNAPTD 481
           E++DPWR+L+  YN+P  K  L+++LY+WRD +AR+DDES RYVMPNQLLV+LV  AP+D
Sbjct: 422 EKDDPWRTLMSQYNVPDIKEPLMRKLYKWRDMVARKDDESVRYVMPNQLLVSLVTLAPSD 481

Query: 482 TYGLLSVTSFVTEHVRSNAKSLSQLIKKTL----------ASPQDLFTDQINHMDSNKSM 531
             GLL+V S++ +HVR+NA+ L  +I KT+           S +++ T  +       S 
Sbjct: 482 PSGLLTVKSYIPDHVRANARVLCNIINKTMEEIKSGSHEGQSIENVTTTYV-------SA 534

Query: 532 VDSKLSPGDVKANHQNFDQYTRKSRELVIHGPTVVRGCSLFPGKPLPNEAYVSYQGTQVH 591
            D ++S   +K   ++F     + +   +   +V     LF G        V+Y      
Sbjct: 535 QDPEMSVSLIKTMDRHFKFLLDEVQSHAVEPSSVCEDSLLFKGFLFDKPKAVAYNSVGKR 594

Query: 592 HIEPTVLDDRRELVAQNIT--------TTANVTEKLQVAVEKTPAPEVSDELDEGEAKEL 643
            +    L DR+  ++Q  +           +  EKL    E  PA   S+   E  +KE 
Sbjct: 595 LVNDRELLDRKSDLSQKFSKVFKAAGIAIGSHIEKLSSNSE-LPADTTSNV--ESPSKEE 651

Query: 644 SDDTVSQLKEDKDEIVVLKRRKALPQSSSPPKNAEGNP-KEILDFKNNKKIMTATA---- 698
           S +    LKEDK EI+VLKR++      S  K+    P KE +D+ N   I+  T+    
Sbjct: 652 SKNNSDDLKEDKHEIIVLKRKR---DYGSNTKSTSKQPKKEHVDYNNVNSILDNTSQQDK 708

Query: 699 -SVPRKSTKRFDPYAIQASGPDGVKRRKKTRGIQKSFK 735
            +  R   KR     +Q S      ++ +++G   S+K
Sbjct: 709 PNSGRHVDKRKFHSDLQGSIGAAAIKKPRSKGKTVSYK 746

>ZYRO0C07678g Chr3 (582236..584461) [2226 bp, 741 aa] {ON} similar
           to uniprot|Q12149 Saccharomyces cerevisiae YOR001W RRP6
           Exonuclease component of the nuclear exosome contributes
           to the quality-control system that retains and degrades
           aberrant mRNAs in the nucleus
          Length = 741

 Score =  663 bits (1711), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/754 (46%), Positives = 479/754 (63%), Gaps = 40/754 (5%)

Query: 6   EDKRSSILTQVVGTIRASSAISAQDVDFYKSLDSTISESLDETSAKLLXXXXXXXXXXXX 65
           E+    +L +VVGT+RA++A++AQDVDFY+SLD  +++SLD+TS +L+            
Sbjct: 3   EESNEQLLPKVVGTVRAAAALAAQDVDFYRSLDKGVAKSLDKTSNELVSMINSTLLCIDQ 62

Query: 66  XXXXXEPGRAGLENSWNNIGEVMDLLFEKSEHALAAMKKKGSNIIGNNLQYLDDSQPLTD 125
                E G+  LE+S  +   +MD LFEKS+ +L  ++ +  +  G  L YLDD+     
Sbjct: 63  NSRLLEGGKEKLEDSRKDFSNLMDNLFEKSDRSLDILRGRAPDRKGAALMYLDDAARSDM 122

Query: 126 TTLTKITKPQASFSRPVDNTESHPFKPLLVQKPNALRPLDDVLQLTVEEEGIPAHYPHPY 185
               +I KPQ  F RP+DNTE+HPFKPLL  KP+ALRPL D ++L   +E IP HYP PY
Sbjct: 123 IPAKRILKPQVRFQRPIDNTETHPFKPLLENKPHALRPLSDCVRLVQADEDIPEHYPQPY 182

Query: 186 EYEIDHQEYDESVLEIRPPIPSKPWEETDATWVDNLGTLNDMIRELSKAKELAIDLEHHD 245
           EYEI++QEY+ES+L+I  PIPSKPW+ ++  WVDN  +L+ M+++L K+ E+A+DLEHHD
Sbjct: 183 EYEIENQEYNESILKIAEPIPSKPWDGSEPVWVDNKESLDSMLQDLKKSTEIAVDLEHHD 242

Query: 246 YRTYYGITCLMQISTRENDWLVDTIALRDHLWVLNEIFTNPKVIKVFHGAFMDVIWLQRD 305
           YR+YYGI CLMQ+STR+ D+LVDT+ALRD L VLNE+F NP ++KVFHGAFMD+IWLQRD
Sbjct: 243 YRSYYGIVCLMQVSTRQTDYLVDTLALRDDLVVLNEVFANPLIVKVFHGAFMDIIWLQRD 302

Query: 306 LGLYLVSLFDTFHASRLLGFPKHSLAYLLERYAHFKTSKKYQLADWRIRPLSKPLKAYAR 365
           LGLY+VSLFDT+HASR LGFP+HSLAYLLE +A FKTSKKYQLADWR+RPLSK + AYAR
Sbjct: 303 LGLYIVSLFDTYHASRALGFPRHSLAYLLETFASFKTSKKYQLADWRVRPLSKAMSAYAR 362

Query: 366 ADTHFLLNIYDQMRNSLIEQGKLAQSLHNSRGVAKRRFEYTKFRPTVMTSEVYSPVERED 425
           ADTHFLLNIYDQ+RN LI + KLA  L  SR VAKR F+Y+K+RP V  S VYSPV+R D
Sbjct: 363 ADTHFLLNIYDQLRNKLIIENKLAGVLAESRNVAKRSFQYSKYRPKVPNSSVYSPVDRAD 422

Query: 426 PWRSLIFHYNIPQSKSFLLKRLYEWRDTIARRDDESPRYVMPNQLLVALVMNAPTDTYGL 485
            W+ L+  YNIP  K  L+K LYEWRDTIARRDDESPRYVMPNQLL  LV   P D  G+
Sbjct: 423 GWKVLMNQYNIPLEKEILVKNLYEWRDTIARRDDESPRYVMPNQLLAYLVDYTPLDPTGV 482

Query: 486 LSVTSFVTEHVRSNAKSLSQLIKKTLASPQDLFTD----QINHMDSNKSMVDSKLSPGDV 541
           +SV+  VT+HVR+NAK+L+ LI K+L    D  +D     + H D +   +   L+ G +
Sbjct: 483 ISVSPTVTDHVRTNAKALANLIVKSLQQIADAGSDIKVESVQHKDQHD--LSQVLTVGQI 540

Query: 542 KANHQNFDQYTRKSREL-----------------VIHGPTVVRGCSLFPGKPLPNEAYVS 584
           ++    F   ++  + L                 ++H P    G      KP+ ++    
Sbjct: 541 ESQVSQFHDLSKAFKGLSQGTNSSNSSSSIIFGNILHAPCGFVGYGRSLKKPVTDK---- 596

Query: 585 YQGTQVHHIEPTVLDDRRELVAQNITTTANVTEKLQVAVEKTPAPEVSDELDEGEAKELS 644
                   IE   L+    L   +  T   + E+ +   E T  P    ++ E +  +  
Sbjct: 597 -------QIEKRKLELSEALEFIDAETATTIQEEDR-GSELTHEPADDKKVSENDESKKE 648

Query: 645 DDTVSQLKEDKDEIVVLKRRKALPQSSSPPKNAEGNPKEILDFKNNKKIMTATASVPRKS 704
           +   ++ +EDK+EI+ LK+ K   + S   ++ E  P+E +D+K +KKI+          
Sbjct: 649 EAKETEPEEDKNEIITLKKVKDRGKKSK--RSNESEPEEPIDYKKSKKILETEKKSKSTK 706

Query: 705 TKRFDPYAIQ---ASGPDGVKRRKKTRGIQKSFK 735
            + FDPYA      + P   K+R+  RG   SFK
Sbjct: 707 KRAFDPYAASNDAGNAPKPKKKRRMARGKSASFK 740

>KAFR0G02660 Chr7 (549718..551925) [2208 bp, 735 aa] {ON} Anc_6.25
           YOR001W
          Length = 735

 Score =  659 bits (1701), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/742 (46%), Positives = 471/742 (63%), Gaps = 23/742 (3%)

Query: 7   DKRSSILTQVVGTIRASSAISAQDVDFYKSLDSTISESLDETSAKLLXXXXXXXXXXXXX 66
           +++  +L+ VV T+RASS ++AQDVDFY+SLDS +S S++E + +L              
Sbjct: 4   EEQKKLLSDVVNTVRASSTLAAQDVDFYRSLDSEVSHSINEVTDELNDMVNSIILSIDEN 63

Query: 67  XXXXEPGRAGLENSWNNIGEVMDLLFEKSEHALAAMKKKGSNIIGNN-LQYLDDSQPLTD 125
               + G+  L  SW ++  ++D LFEKS+ +L  +K        N   +Y +++    +
Sbjct: 64  YETLDEGKEELTESWKSLSNIVDNLFEKSDRSLDILKTGAKKKPTNPPFEYFENATTTEN 123

Query: 126 TTLTKITKPQASFSRPVDNTESHPFKPLLVQKPNALRPLDDVLQLTVEEEGIPAHYPHPY 185
               +I KPQ  F  P+DN+ESHPF PLL +KPNAL+ +D+  +L   +E +P HY HPY
Sbjct: 124 IPQKRINKPQLKFVPPIDNSESHPFIPLLKEKPNALKTIDESTKLINSDENVPEHYAHPY 183

Query: 186 EYEIDHQEYDESVLEIRPPIPSKPWEETDATWVDNLGTLNDMIRELSKAKELAIDLEHHD 245
           EYEID+Q Y++S+L++R PIPSK W ET+  WVDN+ +LN M+ ++ K  E+AIDLEHHD
Sbjct: 184 EYEIDNQPYNDSILQVREPIPSKSWSETEGVWVDNVESLNHMLNDIKKYTEIAIDLEHHD 243

Query: 246 YRTYYGITCLMQISTRENDWLVDTIALRDHLWVLNEIFTNPKVIKVFHGAFMDVIWLQRD 305
           YRTYYGI CLMQISTRE D+LVDTIALR+ L VLNE+FT+P V+KV HGAFMD+IWLQRD
Sbjct: 244 YRTYYGIVCLMQISTRETDYLVDTIALRNDLKVLNEVFTDPSVVKVLHGAFMDIIWLQRD 303

Query: 306 LGLYLVSLFDTFHASRLLGFPKHSLAYLLERYAHFKTSKKYQLADWRIRPLSKPLKAYAR 365
           LGLY+VSLFDTFHASR LGFP+HSLAYLLE +A+FKTSKKYQLADWR+RPLSK + AYAR
Sbjct: 304 LGLYIVSLFDTFHASRALGFPRHSLAYLLEEFANFKTSKKYQLADWRVRPLSKAMTAYAR 363

Query: 366 ADTHFLLNIYDQMRNSLIEQGKLAQSLHNSRGVAKRRFEYTKFRPTVMTSEVYSPVERED 425
           ADTHFLLNIYDQ+RN L+E  KL   L+ SR VAKRRFEY+KFRP V +  VYS +E+ED
Sbjct: 364 ADTHFLLNIYDQLRNRLVETNKLVGVLNESRNVAKRRFEYSKFRPRVPSPNVYSALEKED 423

Query: 426 PWRSLIFHYNIPQSKSFLLKRLYEWRDTIARRDDESPRYVMPNQLLVALVMNAPTDTYGL 485
           PWR+L+F YNIP  +  LLK L+EWRD IARRDDESPRY+MPNQL+V LV   PTD  G+
Sbjct: 424 PWRTLMFQYNIPSEREDLLKGLFEWRDMIARRDDESPRYIMPNQLMVTLVAYTPTDPAGV 483

Query: 486 LSVTSFVTEHVRSNAKSLSQLIKKTLASPQD------LFTDQINHMDSNKSMVDSKLSPG 539
           +S +  VT++VRSN+K ++ LIK  L   +D         D  NH   +    D K++  
Sbjct: 484 ISASQVVTDYVRSNSKIIANLIKNALTRAKDQNRQLQFVAD--NHTRESYRSTD-KMTVS 540

Query: 540 DVKANHQNFDQYTRK---SRELVIHGPTVVRGCSLFPGKPLPNEAYVSYQGTQVHHIEPT 596
            +K     F Q   K            +  R  S + G        + Y+  + H ++  
Sbjct: 541 QIKETASVFIQIAEKLGTCNNDQQQSKSFAR--SNYFGSLSKKLDIIEYKNGEKHSVKQQ 598

Query: 597 VLDDRRELVAQNITTTANVTEKLQVAVEKTPAPEVSDELDEGEAKELSDDTVSQLKEDKD 656
            L  R     + +    NV  + ++ V K P     D+++E +   ++D   ++ + D D
Sbjct: 599 QLVSRFNTYTKQVNELTNV--RYELPVHKEPPQLQKDDVEEVKKTIIADSIPAKPEIDLD 656

Query: 657 EIVVLKRRKALPQSSSPPKNAEGNPKEILDFKNNKKIMTATASVPRKSTKR--FDPYAIQ 714
           E+VVLK+    P  +   K  E    + +D+  ++KI+       ++ +K+  FDP+A  
Sbjct: 657 EVVVLKKVNRQPNKT---KLEENEKIDFIDYSKSEKILKGDKQRKKRESKKRQFDPFAAS 713

Query: 715 ASGPDGVKRRKK-TRGIQKSFK 735
             GP   ++RK  TRG   S+K
Sbjct: 714 NEGPKAARKRKSGTRGRNLSYK 735

>KNAG0M01230 Chr13 complement(223471..225687) [2217 bp, 738 aa] {ON}
           Anc_6.25 YOR001W
          Length = 738

 Score =  659 bits (1700), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/744 (46%), Positives = 475/744 (63%), Gaps = 25/744 (3%)

Query: 7   DKRSSILTQVVGTIRASSAISAQDVDFYKSLDSTISESLDETSAKLLXXXXXXXXXXXXX 66
           +++  +L++ VGT+RASS++  QDV F+ +LD+ ++ S+ E   ++L             
Sbjct: 4   EEQKKLLSKAVGTVRASSSLVGQDVQFFSNLDANVASSVKELGNEVLEMINDILFSIDEN 63

Query: 67  XXXXEPGRAGLENSWNNIGEVMDLLFEKSEHAL--AAMKKKGSNIIGNNLQYLDDSQPLT 124
                     +  SW +   + D LFEKS+ ++   A   + +   G+ +QYLDD     
Sbjct: 64  SKPFAESAEQVGESWRDFTNLTDNLFEKSDRSMDIIAQGTRKNGQAGSEVQYLDDLVGND 123

Query: 125 DTTLTKITKPQASFSRPVDNTESHPFKPLLVQKPNALRPLDDVLQLTVEEEGIPAHYPHP 184
            ++  +ITKPQ  FSRPVDN+ES PFKPLL +KPNAL+PL + LQ+    E IP+HYP+P
Sbjct: 124 SSSGKRITKPQLHFSRPVDNSESQPFKPLLTEKPNALKPLKESLQMVPATENIPSHYPNP 183

Query: 185 YEYEIDHQEYDESVLEIRPPIPSKPWEETDATWVDNLGTLNDMIRELSKAKELAIDLEHH 244
           Y+YEI +QEY+  +LE R PIPS PW E++  WVD+   L  ++++L K KELAIDLEHH
Sbjct: 184 YDYEISNQEYNNDILETRAPIPSTPWHESEPVWVDSTEGLQSLLKDLKKYKELAIDLEHH 243

Query: 245 DYRTYYGITCLMQISTRENDWLVDTIALRDHLWVLNEIFTNPKVIKVFHGAFMDVIWLQR 304
           DYR+YYGI CLMQISTR+ D+LVDTIALRD L +LN++FT+P V KVFHGAFMD+IWLQR
Sbjct: 244 DYRSYYGIVCLMQISTRDTDYLVDTIALRDELHILNQVFTDPMVTKVFHGAFMDIIWLQR 303

Query: 305 DLGLYLVSLFDTFHASRLLGFPKHSLAYLLERYAHFKTSKKYQLADWRIRPLSKPLKAYA 364
           DLGLY+VSLFDTFHAS+ LGFPKHSLAYLLE  A+FKTSKKYQLADWRIRPLSKP+  YA
Sbjct: 304 DLGLYIVSLFDTFHASKALGFPKHSLAYLLETLANFKTSKKYQLADWRIRPLSKPMSVYA 363

Query: 365 RADTHFLLNIYDQMRNSLIEQGKLAQSLHNSRGVAKRRFEYTKFRPTVMTSEVYSPVERE 424
           RADTHFLLNI+DQMRN LI+  KLA  L  SR VAKRRFEY+KFRP +   +V++P+E+E
Sbjct: 364 RADTHFLLNIFDQMRNQLIKDNKLAGVLGESRKVAKRRFEYSKFRPKLAQPDVFTPIEKE 423

Query: 425 DPWRSLIFHYNIPQSKSFLLKRLYEWRDTIARRDDESPRYVMPNQLLVALVMNAPTDTYG 484
            PWR+L+F YN+   K  L+K LYEWRDTIARRDDESPRY+MPNQLL++L    PTD   
Sbjct: 424 SPWRTLMFQYNVTPEKEELVKALYEWRDTIARRDDESPRYIMPNQLLISLSAYTPTDPVS 483

Query: 485 LLSVTSFVTEHVRSNAKSLSQLIKKTLAS----PQDLFTDQINHMDSNKSMVDSKLSPGD 540
           L+SV S+VT+ VRSN+K L+ LIK  + S    PQ  +T   N  +++   V   L+   
Sbjct: 484 LVSVNSYVTDCVRSNSKVLANLIKSFVESSKLGPQSSYTP--NTENTSTPFV---LTLSQ 538

Query: 541 VKANHQNFDQYTRKSRELVIHGPTVVRGCSLFPGKPLPNEAYVSYQGTQVHHIEPTVLDD 600
           +K     F + T   +       + ++  S F G     +  VSY   +   +  +VL+ 
Sbjct: 539 IKDIGMRFTKLTENFQSSSCQKISPLQRSSFF-GDLSKGKVTVSYNDAKTTPVSQSVLES 597

Query: 601 RRELVAQNITTTANVTEKLQVAVEKT---PAPEVSDELDEGEAKELSDDTVSQLKEDKDE 657
           R +   + +    ++  K+   VE     P P  +   +  ++K + +     +KED DE
Sbjct: 598 RSKQFNEYMKAFGDIEYKIPSIVEPVMDLPIPSGTTSTESADSKTV-EKPPKNIKEDMDE 656

Query: 658 IVVLKR-RKALPQSSSPPKNAEGNPKEILDFKNNKKIMTA----TASVPRKSTKRFDPYA 712
           IVVLK+ ++ LP+   P  N E   +EI+D+    K++             + KRFDP++
Sbjct: 657 IVVLKKVKRELPK---PKGNDEDAEREIVDYSKEDKVLVQRQFDKKKKNNNNKKRFDPFS 713

Query: 713 IQASGPDGVKRRKK-TRGIQKSFK 735
             + GP   K+RK  T+G   SFK
Sbjct: 714 AISEGPKAPKKRKAVTKGKNASFK 737

>TPHA0J00370 Chr10 complement(81371..83602) [2232 bp, 743 aa] {ON}
           Anc_6.25 YOR001W
          Length = 743

 Score =  653 bits (1685), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/759 (46%), Positives = 479/759 (63%), Gaps = 57/759 (7%)

Query: 12  ILTQVVGTIRASSAISAQDVDFYKSLDSTISESLDETSAKLLXXXXXXXXXXXXXXXXXE 71
           +L  VV ++RA+SA++AQDVDFY+SLD  I+ SL  TS K+                   
Sbjct: 6   LLPLVVSSVRAASALAAQDVDFYRSLDKEIASSLTNTSQKVTDMINSIISSVDENSEGLV 65

Query: 72  PGRAGLENSWNNIGEVMDLLFEKSEHALAAMKK---KGSNIIGNNLQYLDDSQPLTDTTL 128
            G+  L+ SW +IG ++D LFE ++H++ A+ K   K SN     ++YL+DS       +
Sbjct: 66  EGKENLDESWKDIGNLLDSLFELADHSIDALSKASQKSSN--DPKMKYLNDSLNFESDNV 123

Query: 129 TKITKPQASFSRPVDNTESHPFKPLLVQKPNALRPLDDVLQLTVEEEGIPAHYPHPYEYE 188
           T+++KPQ +FS PVDN+E+HPF+PLL  KPNA+ PLD+VL++    E  P HYP PYE E
Sbjct: 124 TRLSKPQLNFSVPVDNSETHPFRPLLTDKPNAVVPLDEVLKIVDGTEDTPQHYPQPYETE 183

Query: 189 IDHQEYDESVLEIRPPIPSKPWEETDATWVDNLGTLNDMIRELSKAKELAIDLEHHDYRT 248
           ID QEY+E VL+   PIPSK WEET+A WVDN  +L  M+ EL  A ELA+DLEHHD+R+
Sbjct: 184 IDKQEYNEQVLQFSDPIPSKVWEETEAIWVDNEESLAAMLNELKTATELAVDLEHHDFRS 243

Query: 249 YYGITCLMQISTRENDWLVDTIALRDHLWVLNEIFTNPKVIKVFHGAFMDVIWLQRDLGL 308
           YYGITCLMQISTR  D+LVDTIALRD L VLN +FT+PK+ K+ HGAFMD+IWLQRDLGL
Sbjct: 244 YYGITCLMQISTRNTDYLVDTIALRDKLQVLNVVFTDPKITKILHGAFMDIIWLQRDLGL 303

Query: 309 YLVSLFDTFHASRLLGFPKHSLAYLLERYAHFKTSKKYQLADWRIRPLSKPLKAYARADT 368
           Y+VSLFDT+HASR LGFP+HSLAYLLER+AHFKTSK+YQLADWR RPLSK + AYARADT
Sbjct: 304 YIVSLFDTYHASRALGFPRHSLAYLLERFAHFKTSKQYQLADWRTRPLSKAMNAYARADT 363

Query: 369 HFLLNIYDQMRNSLIEQGKLAQSLHNSRGVAKRRFEYTKFRPTVMTSEVYSPVEREDPWR 428
           HFLLNI+DQ+RN LI++ KLA  LH SR VAKRRFEY+K++PT+ +S V+SP E + PWR
Sbjct: 364 HFLLNIFDQLRNMLIQEDKLASMLHESRKVAKRRFEYSKYKPTLPSSAVFSPTESDMPWR 423

Query: 429 SLIFHYNIPQSKSFLLKRLYEWRDTIARRDDESPRYVMPNQLLVALVMNAPTDTYGLLSV 488
           S+I+ YNIP  K  L+KRL+EWRDTIARRDDESPRY+MPNQL+ +LV   PT+  G++SV
Sbjct: 424 SMIYQYNIPSQKVELVKRLWEWRDTIARRDDESPRYIMPNQLIASLVEYVPTNPAGVISV 483

Query: 489 TSFVTEHVRSNAKSLSQLIKKTL---------------------ASPQDLFTDQINHMDS 527
              +T+ VRSNAK+++ LIK TL                      S  DL T QI  + S
Sbjct: 484 NRMMTDPVRSNAKAIANLIKSTLEDMKNNNISTTVVSTTAKDKETSSNDLSTSQIKFIVS 543

Query: 528 NKSMVDSKLSPGDVKANHQNFDQYTRKSRELVIHGPTVVRGCSLFPGKPLPNEAYVSYQG 587
               +  K S     +N+ N +  T K       G   +    +F  +    +  ++Y  
Sbjct: 544 QFENILEKYS-----SNNSNLNDVTSK------EGKDSLVFSKIFNSR----DDIITYDK 588

Query: 588 TQVHHIEPTVLDDRRELV------AQNITTTANVTEKLQVAVEKTPAPEVSDELDEGEAK 641
              H I    L DR++ V      A+ I  +  V +  + ++ K P PE  + + +    
Sbjct: 589 GTKHLITEQQLSDRQKEVDAAMKQAEEIAFSMEVQDTHKESM-KQPFPEPEEVISQSHLP 647

Query: 642 ELSDDTVSQLKEDKDEIVVLK--RRKALPQSSSPPKNAEGNPKEILDFKNNKKIMTATAS 699
              D    + +ED DEI+VLK  + +   Q     ++A+ +   ++D+    KI++    
Sbjct: 648 AFED---KEEQEDLDEIIVLKDTKDRRNRQHRGRGRSADSD-HTVIDYSKGDKILSQDNR 703

Query: 700 VPRKSTKRFDPYAI--QASGPDGVKRRKKT-RGIQKSFK 735
               + +++DP++     +   G KRR+ T +    SFK
Sbjct: 704 RRTPNKRKYDPFSADNNENALQGAKRRRPTAKNRNVSFK 742

>Suva_15.176 Chr15 (301216..303453) [2238 bp, 745 aa] {ON} YOR001W
           (REAL)
          Length = 745

 Score =  645 bits (1664), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/739 (46%), Positives = 475/739 (64%), Gaps = 36/739 (4%)

Query: 12  ILTQVVGTIRASSAISAQDVDFYKSLDSTISESLDETSAKLLXXXXXXXXXXXXXXXXXE 71
           +L++VV  IRA+S+++AQDVDFY++LD   S+ L   S+KL                  E
Sbjct: 27  LLSKVVNVIRAASSLAAQDVDFYRNLDRDFSKILQSKSSKLTEMVNGIVLSIDEHHDSLE 86

Query: 72  PGRAGLENSWNNIGEVMDLLFEKSEHALAAMKK-KGSNIIGNNLQYLDDSQPLTDTTLTK 130
                + + W + G +MD L EKS+H+L  + +   SN    +LQYL D          +
Sbjct: 87  LKEEEISDLWKDFGNIMDNLLEKSDHSLDNLNRTSNSNNSAADLQYLGDFSGKDSQPTKR 146

Query: 131 ITKPQASFSRPVDNTESHPFKPLLVQKPNALRPLDDVLQLTVEEEGIPAHYPHPYEYEID 190
           + KPQ  F  P+DN+ESHPF PLL +KPNAL+PL D L++   EE  P HYPHPYEYEID
Sbjct: 147 VEKPQLKFKTPIDNSESHPFIPLLKEKPNALKPLSDSLRMIETEENSPGHYPHPYEYEID 206

Query: 191 HQEYDESVLEIRPPIPSKPWEETDATWVDNLGTLNDMIRELSKAKELAIDLEHHDYRTYY 250
           HQEY+ ++L+I+P IPSKPW+ ++  W+++  TL  M+ +L  A E+A+DLEHHDYR+YY
Sbjct: 207 HQEYNPNILQIKPEIPSKPWDASEPIWINSKATLKSMLEDLKNAHEIAVDLEHHDYRSYY 266

Query: 251 GITCLMQISTRENDWLVDTIALRDHLWVLNEIFTNPKVIKVFHGAFMDVIWLQRDLGLYL 310
           G+ CLMQ+STRE D+LVDT+ LR+ L +LNE+FTNP ++KVFHGAFMD+IWLQRDLGLY+
Sbjct: 267 GVVCLMQVSTRERDYLVDTLELREDLHILNEVFTNPSIVKVFHGAFMDIIWLQRDLGLYV 326

Query: 311 VSLFDTFHASRLLGFPKHSLAYLLERYAHFKTSKKYQLADWRIRPLSKPLKAYARADTHF 370
           V LFDT+HAS+ +G P+HSLAYLLE +A+FKTSKKYQLADWRIRPLSKP+ AYARADTHF
Sbjct: 327 VGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMTAYARADTHF 386

Query: 371 LLNIYDQMRNSLIEQGKLAQSLHNSRGVAKRRFEYTKFRPTVMTSEVYSPVEREDPWRSL 430
           LLNIYDQ+RN LIE  KLA  L+ SR VAKRRFEY+K+RP   +S+VYSP E+E+PWR L
Sbjct: 387 LLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPITPSSKVYSPTEKENPWRVL 446

Query: 431 IFHYNIPQSKSFLLKRLYEWRDTIARRDDESPRYVMPNQLLVALVMNAPTDTYGLLSVTS 490
           ++ YNI   +  L+K LYEWRD IARRDDESPR++MPNQLL ALV   P D  G++S+++
Sbjct: 447 MYQYNIAPEREELVKDLYEWRDVIARRDDESPRFIMPNQLLAALVAYTPIDVIGVVSLSN 506

Query: 491 FVTEHVRSNAKSLSQLIKKTLASPQDLFTDQINHMDSNKSMVDSKLSPGDVKANHQN--- 547
            VT+HVR NAK L+ LIK  L S +D       H +S + +V SK     ++A   +   
Sbjct: 507 GVTDHVRQNAKILANLIKSALRSMKD------THKESAE-IVSSKFKSASLEAITVSQIR 559

Query: 548 --FDQYTRKSRELVIHGPTV-VRGCSLFPGKPLP-NEAYVSYQGTQV-HHIEPTVLDDRR 602
              D+++  S   V    ++     S+  GK LP  E  + Y+ + + H ++   + DR 
Sbjct: 560 DIMDRFSVFSSNSVTEDRSMDSTASSILFGKILPYEEGDIVYEDSGLPHKVKVEDMRDR- 618

Query: 603 ELVAQNITTTANVTEKLQVAVEKTPAPEVSDELDEGEAKELSDDTVSQLKEDKDEIVVLK 662
              AQ   +     E ++  VEK     V+ E  E    E + +  +++ ED DE+VVLK
Sbjct: 619 ---AQRFNSALVGLEDIKFEVEKP----VNVEKSEMVKIETTPEPPTKI-EDPDEVVVLK 670

Query: 663 RRKALPQSSSPPKNAEGNPKEILDFKNNKKIMTATASVPRKSTK-----RFDPYAIQASG 717
           +++   +  +  K ++   +E +D+    KI    +S P ++ K     RFDP    + G
Sbjct: 671 KKRIHKKQVA--KRSDVAAEEAVDY---SKIPNVLSSKPGQNNKQQRKRRFDPSFNDSEG 725

Query: 718 PDG-VKRRKKTRGIQKSFK 735
           P    K+R  TRG   SFK
Sbjct: 726 PRAPKKKRPTTRGKNVSFK 744

>NCAS0H00860 Chr8 complement(156180..158447) [2268 bp, 755 aa] {ON}
           Anc_6.25 YOR001W
          Length = 755

 Score =  644 bits (1661), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/760 (45%), Positives = 476/760 (62%), Gaps = 31/760 (4%)

Query: 1   MAKTQEDKRSSILTQVVGTIRASSAISAQDVDFYKSLDSTISESLDETSAKLLXXXXXXX 60
           M++  +++  ++L +VV T+RA+SA++AQDVDFY+S+D  I+ SL+++S ++        
Sbjct: 1   MSEQSQEQEKTLLPKVVNTVRAASALAAQDVDFYRSIDKDIAHSLEQSSNQIADMINSVL 60

Query: 61  XXXXXXXXXXEPGRAGLENSWNNIGEVMDLLFEKSEHALAAMKKKGSNIIG-NNLQYLDD 119
                     +  +  LE+ W + G +MD LFEKS+ ++  + +      G + +QY+D+
Sbjct: 61  LSIDENSEQVDGTKENLEDIWKDFGNLMDNLFEKSDRSIDIITRGHGGSNGQSGMQYIDE 120

Query: 120 SQPLTDTTLTKITKPQASFSRPVDNTESHPFKPLLVQKPNALRPLDDVLQLTVEEEGIPA 179
                 T   +I KPQ  F+ P+DNTESHPF PLL +KP AL+PL++ +Q+  E+E  P 
Sbjct: 121 FSGRDLTPGKQILKPQLKFTTPIDNTESHPFIPLLKEKPFALKPLEESMQMIPEDETSPM 180

Query: 180 HYPHPYEYEIDHQEYDESVLEIRPPIPSKPWEETDATWVDNLGTLNDMIRELSKAKELAI 239
           HYP PYEYEIDHQEY++ +L+ + PIPS  W + +  WVD +  L  ++ +L  + E+A+
Sbjct: 181 HYPQPYEYEIDHQEYNDLILQKKDPIPSTSWTDNEPIWVDTVSQLQSIMPDLEASTEIAV 240

Query: 240 DLEHHDYRTYYGITCLMQISTRENDWLVDTIALRDHLWVLNEIFTNPKVIKVFHGAFMDV 299
           DLEHHDYRTYYGITCLMQISTR+ND+L+DT+ALR+ L +LN +F NP + KVFHGAFMD+
Sbjct: 241 DLEHHDYRTYYGITCLMQISTRKNDYLIDTLALREDLQILNNVFANPMITKVFHGAFMDI 300

Query: 300 IWLQRDLGLYLVSLFDTFHASRLLGFPKHSLAYLLERYAHFKTSKKYQLADWRIRPLSKP 359
           IWLQRDLGLY+V LFDTFHASR +G PKHSLAYLLE++A FKTSKKYQLADWRIRPLSK 
Sbjct: 301 IWLQRDLGLYVVGLFDTFHASRAMGLPKHSLAYLLEKFAQFKTSKKYQLADWRIRPLSKA 360

Query: 360 LKAYARADTHFLLNIYDQMRNSLIEQGKLAQSLHNSRGVAKRRFEYTKFRPTVMTSE--V 417
           + AYARADTHFLLNI+DQMRNSLIEQ KLA  L  SR VAKRRFEY+ FRP V+ +   V
Sbjct: 361 MHAYARADTHFLLNIFDQMRNSLIEQNKLAGVLKESRNVAKRRFEYSSFRPKVLQTNGLV 420

Query: 418 YSPVEREDPWRSLIFHYNIPQSKSFLLKRLYEWRDTIARRDDESPRYVMPNQLLVALVMN 477
           YSP+E++DPW++++F YNIP  K  LLK LY+WRD IARRDDESPR+VMPNQLLV+LV  
Sbjct: 421 YSPIEKDDPWKTIMFQYNIPPQKEPLLKELYQWRDKIARRDDESPRFVMPNQLLVSLVAY 480

Query: 478 APTDTYGLLSVTSFVTEHVRSNAKSLSQLIKKTLASPQD-LFTDQINHMDSNKSMV---- 532
            P D  G++SV++ VT++VRSN+K L+ LIK  LA  +D  F D  N  +   S+V    
Sbjct: 481 TPIDAPGVVSVSNSVTDYVRSNSKILANLIKNCLAKMKDNKFLDN-NVAEEGISVVPETG 539

Query: 533 ---DSKLSPGDVKANHQNFDQYTRKSRELVIHGPTVVRGCSLFPGKPLPNEAYVSY---- 585
                KL+   ++     F   + K    V    +      LF G    ++  + Y    
Sbjct: 540 HDLSQKLTIHQLQNLKSKFQLLSDKFNNSVKTRLSNHDQLYLFDGISFADDVTIKYFADG 599

Query: 586 --QGTQVHHIEPT-VLDDRRELVAQNITTTANVTEKLQVAVEKTPAPEVSDELDEGEAKE 642
             Q T   + E +   DD  + + +       + E  Q   +    P       EG+  E
Sbjct: 600 KIQTTAEQYKERSEQFDDAMKQLEEVEYCIPVIEENKQTQDQDNIPPITVATNAEGQVNE 659

Query: 643 LSDDTVSQLKEDKDEIVVLKRRKALPQSSSPPKNAEGNPKEILDFKNNKKIMT--ATASV 700
           + +       ED DE++VL++        + PKN E    EI+D+    K++T    +  
Sbjct: 660 MIEKP-----EDLDEVIVLRKTNKNKSIKNKPKNREEPELEIIDYFKTAKVLTNDKNSRG 714

Query: 701 PRKST----KRFDPYAIQASGPDGVKRRKK-TRGIQKSFK 735
            R +     KRFDPY+    GP   K+RK  TRG   SFK
Sbjct: 715 GRNNNGNKRKRFDPYSAANEGPAAPKKRKNVTRGKNVSFK 754

>CAGL0E02585g Chr5 (246427..248640) [2214 bp, 737 aa] {ON} similar
           to uniprot|Q12149 Saccharomyces cerevisiae YOR001w RRP6
          Length = 737

 Score =  639 bits (1647), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/750 (45%), Positives = 480/750 (64%), Gaps = 38/750 (5%)

Query: 7   DKRSSILTQVVGTIRASSAISAQDVDFYKSLDSTISESLDETSAKLLXXXXXXXXXXXXX 66
           D   ++L +V+ T+RAS+A+++QDV+F+KS+D++++ SL+++   +              
Sbjct: 4   DSGDNVLKKVMETVRASNALASQDVEFHKSIDTSVANSLEKSMKSMASVMNNILLSIDNN 63

Query: 67  XXXXEPGRAGLENSWNNIGEVMDLLFEKSEHALAAMKKKGS-NIIGNNLQYLDDSQPLTD 125
               +     LE        VMD+LFEK++ +L  + +K S N    N+Q+LDD     +
Sbjct: 64  NEKLDGTNENLEEVCKEFSNVMDVLFEKADRSLDILNRKSSTNDNKKNMQFLDDVNVAEN 123

Query: 126 TTLTKITKPQASFSRPVDNTESHPFKPLLVQKPNALRPLDDVLQLTVEEEGIPAHYPHPY 185
               +I+KPQ +F  PVDN+ESHPFKPLL++KPNAL+ +++  QL +  E IP H+  PY
Sbjct: 124 DPSRRISKPQLNFKTPVDNSESHPFKPLLIEKPNALKSIEESTQLVLATEDIPEHFQQPY 183

Query: 186 EYEIDHQEYDESVLEIRPPIPSKPWEETDATWVDNLGTLNDMIRELSKAKELAIDLEHHD 245
           EYEI +QEY+  +LE + PIPS  W +T+A WVDN+ +L DM++EL K+ E+A+DLEHHD
Sbjct: 184 EYEILNQEYNNDILEKKEPIPSTSWVDTNAIWVDNINSLQDMMQELKKSSEIAVDLEHHD 243

Query: 246 YRTYYGITCLMQISTRENDWLVDTIALRDHLWVLNEIFTNPKVIKVFHGAFMDVIWLQRD 305
           +R+YYG+ CLMQISTR  D++VDTIALRD L +LNE+FTNP + KVFHGAFMD+IWLQRD
Sbjct: 244 FRSYYGLVCLMQISTRTQDYIVDTIALRDDLKMLNEVFTNPLITKVFHGAFMDIIWLQRD 303

Query: 306 LGLYLVSLFDTFHASRLLGFPKHSLAYLLERYAHFKTSKKYQLADWRIRPLSKPLKAYAR 365
           LGLY+VSLFDTFHAS+ LG PKHSLAYLLE+YA+FKTSKKYQLADWR RPLSK + AYAR
Sbjct: 304 LGLYIVSLFDTFHASKALGLPKHSLAYLLEKYANFKTSKKYQLADWRRRPLSKAMMAYAR 363

Query: 366 ADTHFLLNIYDQMRNSLIEQGKLAQSLHNSRGVAKRRFEYTKFRPTVMTSEVYSPVERED 425
           ADTHFLLNI+DQMRN LI  GKLA  L  SR VA RRFEY+K++P +  + +++PVE+E 
Sbjct: 364 ADTHFLLNIFDQMRNGLISSGKLAGVLRESRNVALRRFEYSKYKPKIPVANIFTPVEKES 423

Query: 426 PWRSLIFHYNIPQSKSFLLKRLYEWRDTIARRDDESPRYVMPNQLLVALVMNAPTDTYGL 485
           PWR+L++ YNIP  K  L++ LYEWRD +ARRDDESPRYVMPNQLLV+LV   P D   +
Sbjct: 424 PWRTLMYQYNIPVDKEPLIRELYEWRDMMARRDDESPRYVMPNQLLVSLVAYGPVDPISV 483

Query: 486 LSVTSFVTEHVRSNAKSLSQLIKKTLA---------------SPQDLFTDQINHMDSNKS 530
           +SV+S VT+HVR N+K+L+ LIKK L                S  D+  D++  + S+K 
Sbjct: 484 VSVSSVVTDHVRRNSKTLANLIKKKLEEIKLGEVKSINNRLPSSLDVSQDELQFLPSHK- 542

Query: 531 MVDSKLSPGDVKANHQNFDQYTRKSRELVIHGPTVVRGCSLFPGKPLPNEAYVSYQGTQV 590
               +L  G  K       Q T+  + +      V+    L P      E  V Y     
Sbjct: 543 ---IELMTGAFKEIENQLTQATKSKQAMT--SSVVLSEILLHP------EHAVKYHNGSA 591

Query: 591 HHIEPTVLDDR--RELVAQNITTTANVTEKLQVAVEKTPAPEVSDELDEGEAKELSDDTV 648
             +E + L DR    + A  +  + N+   L+ +   + AP  ++E    ++ ++    +
Sbjct: 592 CSVEESELKDRYLSYIKATLLAASKNINMVLETS--NSNAPLETEETHNKKSDQIQ--VI 647

Query: 649 SQLKEDKDEIVVLKRRKALPQSSSPPKNAEGN-PKEILDFKNNKKIMTATASVPRKSTKR 707
            + +ED DEIVVLK++K +  +    K+ +G+  +E +D+     + +    V +K  KR
Sbjct: 648 PEKQEDMDEIVVLKKKK-IHSNDQKAKHDDGDIVEEPVDYSKANILASDNREVKKKDKKR 706

Query: 708 -FDPYAIQASGPDGVKRRK-KTRGIQKSFK 735
            FDPY+    GP   K+R+  T+G + SFK
Sbjct: 707 VFDPYSSTGEGPKAAKKRRLVTKGKKISFK 736

>Kpol_1037.29 s1037 complement(68981..71221) [2241 bp, 746 aa] {ON}
           complement(68981..71221) [2241 nt, 747 aa]
          Length = 746

 Score =  637 bits (1642), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/751 (45%), Positives = 473/751 (62%), Gaps = 29/751 (3%)

Query: 6   EDKRSSILTQVVGTIRASSAISAQDVDFYKSLDSTISESLDETSAKLLXXXXXXXXXXXX 65
           ED    +L+ VV T+RA+S+++AQDVDFY++LD  IS SL+E+S ++             
Sbjct: 3   EDINKELLSSVVSTVRAASSLAAQDVDFYRNLDKEISTSLNESSKEITNMINTLLLSINE 62

Query: 66  XXXXXEPGRAGLENSWNNIGEVMDLLFEKSEHALAAM-KKKGSNIIGNNLQYLDDSQPLT 124
                E G+ GLE  W +   VMD LFEKS+ +L  + + K SN   +  QYL DS    
Sbjct: 63  NNEELESGKEGLEQYWKDFSNVMDNLFEKSDRSLDIITRSKTSNDNKSEFQYLSDSAQSD 122

Query: 125 DTTLTKITKPQASFSRPVDNTESHPFKPLLVQKPNALRPLDDVLQLTVEEEGIPAHYPHP 184
                ++TKPQ  FSRPVDN+ES PF PLL  KP++++   D L +  E E +P+HY HP
Sbjct: 123 SNPSKRVTKPQLQFSRPVDNSESKPFMPLLNDKPHSIKSFTDSLIIIPESEELPSHYAHP 182

Query: 185 YEYEIDHQEYDESVLEIRPPIPSKPWEETDATWVDNLGTLNDMIRELSKAKELAIDLEHH 244
           YE EID QEY+ SVL++  P+ S+PW  +++TWVD    L  M+ +L +  E+A+DLEHH
Sbjct: 183 YEVEIDKQEYNASVLQVAEPLKSQPWN-SESTWVDTSEALQSMLDKLKECTEIAVDLEHH 241

Query: 245 DYRTYYGITCLMQISTRENDWLVDTIALRDHLWVLNEIFTNPKVIKVFHGAFMDVIWLQR 304
           DYR+YYGI CLMQISTR+ D+LVDT+ALRD L +LNE+F +P ++KV HGAFMD+IWLQR
Sbjct: 242 DYRSYYGIVCLMQISTRKEDFLVDTLALRDELHILNEVFADPNILKVLHGAFMDIIWLQR 301

Query: 305 DLGLYLVSLFDTFHASRLLGFPKHSLAYLLERYAHFKTSKKYQLADWRIRPLSKPLKAYA 364
           DLGLY+VSLFDT+HASR LGFP+HSLAYLLE+YA+FKTSKKYQLADWR+RPLSKP+ AYA
Sbjct: 302 DLGLYVVSLFDTYHASRALGFPRHSLAYLLEKYANFKTSKKYQLADWRVRPLSKPMHAYA 361

Query: 365 RADTHFLLNIYDQMRNSLIEQGKLAQSLHNSRGVAKRRFEYTKFRPTVMTSEVYSPVERE 424
           RADTHFLLNIYDQ+RN LI + KLA+ L  SR VAKRRFEY++FRP V +  V++P+E+E
Sbjct: 362 RADTHFLLNIYDQIRNQLIRENKLAEVLFESRNVAKRRFEYSRFRPKVPSPAVFTPIEKE 421

Query: 425 DPWRSLIFHYNIPQSKSFLLKRLYEWRDTIARRDDESPRYVMPNQLLVALVMNAPTDTYG 484
           +PWR+L++ YN+P +K  LLKR++EWRD IARRDDESPRY+MPNQL+++LV   P D  G
Sbjct: 422 EPWRTLVYQYNVPSTKIELLKRIWEWRDMIARRDDESPRYIMPNQLMISLVEYTPIDPAG 481

Query: 485 LLSVTSFVTEHVRSNAKSLSQLIKKTLASPQDLFTDQINHMDSNKSMVDSKLSPGDVKAN 544
           ++SV++ +T+HVRSN+K ++ LIKK+L   + +    +    +    +  K +    K  
Sbjct: 482 VISVSNVMTDHVRSNSKVIANLIKKSLEDMKSVPAGALTAFQNIDYKIGQKFASD--KLT 539

Query: 545 HQNFDQYTRKSRELVIHGPTVVRGCS------LFPGKPLPNEAYVSYQGTQVHHIEPTVL 598
                  T   +E+  +   + +  S      LF    L     V Y   + H +    L
Sbjct: 540 ISQIQNMTALFKEIASNPSIIEKDVSKKIDPILFSNIFLSKNEIVLYDHDKRHVVTNEQL 599

Query: 599 DDRRELV------AQNITTTANVTEKLQVAVEKTPAPEVSDELDEGEAKELSDDTVSQLK 652
             R E V      A N T   N+    ++ VE+  A E  + L       + + + S   
Sbjct: 600 AGRAEEVEGFMNEANNTTLAINIESSAEMHVEEPEAKE-KNALFSPPISNVENASSSNTD 658

Query: 653 --EDKDEIVVLKRRKALPQSSSPPKNAEGNP-KEILDFKNNKKIMTATASVPRKSTK--R 707
             ED ++I+VLK  K         K  +G P KE++D+    K+ T  +   R+++K  +
Sbjct: 659 GFEDMNDIIVLKDVKKRTNIKD-HKKKQGMPNKEVIDY---SKLDTILSKEKRENSKKRK 714

Query: 708 FDPYAIQAS--GPDGVKRRKK-TRGIQKSFK 735
            DP+  +    GP   K+RK+  RG   SFK
Sbjct: 715 GDPFGEENGLEGPKAAKKRKQINRGKNVSFK 745

>TBLA0A07170 Chr1 (1784984..1787299) [2316 bp, 771 aa] {ON} Anc_6.25
           YOR001W
          Length = 771

 Score =  637 bits (1642), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/749 (46%), Positives = 469/749 (62%), Gaps = 25/749 (3%)

Query: 6   EDKRSSILTQVVGTIRASSAISAQDVDFYKSLDSTISESLDETSAKLLXXXXXXXXXXXX 65
           ED    +L  +VG +RAS+A++AQDVDFYKSLD  +S+SL++T+   L            
Sbjct: 28  EDNCEELLENIVGVVRASTALAAQDVDFYKSLDKKVSDSLNKTANDTLDIANSLLLSIDE 87

Query: 66  XXXXXEPGRAGLENSWNNIGEVMDLLFEKSEHALAAMKKKGS-NIIGNNLQYLDDSQPLT 124
                E G+  + + WN    +MD L EKS+H + A+ K  + N   N   +LD++    
Sbjct: 88  NCSPLEEGKDRIPDFWNGFSNIMDNLIEKSDHFIDALSKPNNFNGKYNETTFLDNNSRTN 147

Query: 125 DTTLTKITKPQASFSRPVDNTESHPFKPLLVQKPNALRPLDDVLQLTVEEEGIPAHYPHP 184
                +I KPQ  FS+PVDNT+S PFKPLLV+KPNAL+PL D L L  E   +P HY  P
Sbjct: 148 SNPSKRIEKPQLLFSKPVDNTDSRPFKPLLVEKPNALKPLKDSLVLVPESGIVPTHYLQP 207

Query: 185 YEYEIDHQEYDESVLEIRPPIPSKPWEETDATWVDNLGTLNDMIRELSKAKELAIDLEHH 244
           YEYEID+QEY+E V+EIR P P KPWE T A W+D   +L D++ +L K  E+A+DLEHH
Sbjct: 208 YEYEIDNQEYNEEVVEIRDPTPYKPWETTSAIWIDTKESLADLLMDLRKQSEIAVDLEHH 267

Query: 245 DYRTYYGITCLMQISTRENDWLVDTIALRDHLWVLNEIFTNPKVIKVFHGAFMDVIWLQR 304
           D R+YYGITCLMQISTRE D++VDTI+LRD L VLNEIFTNP + KVFHGA MD+IWLQR
Sbjct: 268 DLRSYYGITCLMQISTREQDYIVDTISLRDDLIVLNEIFTNPNITKVFHGASMDIIWLQR 327

Query: 305 DLGLYLVSLFDTFHASRLLGFPKHSLAYLLERYAHFKTSKKYQLADWRIRPLSKPLKAYA 364
           DLGLY+VSLFDTFHAS+ LG  +HSLAYLLE YA FKTSKKYQLADWR RPL+  + AYA
Sbjct: 328 DLGLYIVSLFDTFHASKALGLARHSLAYLLENYASFKTSKKYQLADWRRRPLTNNMLAYA 387

Query: 365 RADTHFLLNIYDQMRNSLIEQGKLAQSLHNSRGVAKRRFEYTKFRPTVMTSEVYSPVERE 424
           R+DTHFLLNI+DQ+RN+LI+Q KLA  LH SR VAKRRFEY KFRPTV    +Y+ +E+E
Sbjct: 388 RSDTHFLLNIFDQLRNTLIKQNKLAGVLHESRNVAKRRFEYLKFRPTVPLPNLYTLIEKE 447

Query: 425 DPWRSLIFHYNIPQSKSFLLKRLYEWRDTIARRDDESPRYVMPNQLLVALVMNAPTDTYG 484
            PW+SL+  YNI   K  L+++L+EWRD IARRDDESPRY+MP Q+L++L+   PTD+ G
Sbjct: 448 APWKSLLIQYNIQDEKEILVQKLWEWRDMIARRDDESPRYIMPTQVLISLISYTPTDSSG 507

Query: 485 LLSVTSFVTEHVRSNAKSLSQLIKKTLASPQDL-------FTDQINHMDSNKSMVDSKLS 537
           ++SV++ VTEHVRSN+ +L+ LIKK L S + +        T  ++  D+N + + S   
Sbjct: 508 VISVSNMVTEHVRSNSTTLANLIKKALESTKSIPNSSDSSSTFNMSRTDTNVASLISITE 567

Query: 538 PGDVKANHQNFDQYTRKSRELVIHGPTVVRGCSLFPGKPLPNEAYVS-YQGTQVHHIEPT 596
             ++     +  ++   S+ L     + +   SL     + +   +S Y   +    +  
Sbjct: 568 INNICLKFNSLSKHYNTSKFLT----SGIEVSSLLFSNIMTSSPKISDYSKDKTTSFKSE 623

Query: 597 VLDDRRELVAQNIT-TTANVTEKLQVAVEKTPAPEVSDE--LDEGEAKELSDDTVSQLKE 653
            +  R   +++ +   +AN +   Q  VE   + E++ E  +   E K     T  ++ E
Sbjct: 624 DMIARHIRLSEGLKGLSANNSFIYQPPVEDIKSIEITTENPIPTLEPKSTQKKTTKEINE 683

Query: 654 DKDEIVVLKRRKALPQSSSPPKNAEGNPKEILDFKNNKKIMTA---TASVPRKSTKRFDP 710
           D +EI+VLK+     Q     K+A+ +   ++D+   KKI      T +   K  K FDP
Sbjct: 684 DNEEIIVLKKVNRKYQKGK--KDADKDSTVVVDYSKAKKIFQKKDETINGNSKKRKSFDP 741

Query: 711 YAIQASG---PDGVKRRK-KTRGIQKSFK 735
           Y         P  +K+R+  TRG   S+K
Sbjct: 742 YNNDGDTDKVPRALKKRQTNTRGKNISYK 770

>YOR001W Chr15 (326832..329033) [2202 bp, 733 aa] {ON}  RRP6Nuclear
           exosome exonuclease component; has 3'-5' exonuclease
           activity; involved in RNA processing, maturation,
           surveillance, degradation, tethering, and export; has
           similarity to E. coli RNase D and to human PM-Sc1 100
           (EXOSC10); mutant displays reduced transcription
           elongation in the G-less-based run-on (GLRO) assay
          Length = 733

 Score =  630 bits (1624), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/737 (45%), Positives = 463/737 (62%), Gaps = 26/737 (3%)

Query: 12  ILTQVVGTIRASSAISAQDVDFYKSLDSTISESLDETSAKLLXXXXXXXXXXXXXXXXXE 71
           +L++V+  +RA+S++++QDVDFYK+LD   S+ L   + KL                  E
Sbjct: 9   LLSRVINVVRAASSLASQDVDFYKNLDRGFSKDLKSKADKLADMANEIILSIDEHHESFE 68

Query: 72  PGRAGLENSWNNIGEVMDLLFEKSEHALAAMKKK-GSNIIGNNLQYLDDSQPLTDTTLTK 130
                + + WNN G +MD L E S+H+L  +     S   G++LQYL +      +   +
Sbjct: 69  LKEEDISDLWNNFGNIMDNLLEMSDHSLDKLNCAINSKSRGSDLQYLGEFSGKNFSPTKR 128

Query: 131 ITKPQASFSRPVDNTESHPFKPLLVQKPNALRPLDDVLQLTVEEEGIPAHYPHPYEYEID 190
           + KPQ  F  P+DN+ESHPF PLL +KPNAL+PL + L+L  ++E  P+HYPHPYEYEID
Sbjct: 129 VEKPQLKFKSPIDNSESHPFIPLLKEKPNALKPLSESLRLVDDDENNPSHYPHPYEYEID 188

Query: 191 HQEYDESVLEIRPPIPSKPWEETDATWVDNLGTLNDMIRELSKAKELAIDLEHHDYRTYY 250
           HQEY   +L+IR  IPSK W+++   WVD    L  M+ +L   KE+A+DLEHHDYR+YY
Sbjct: 189 HQEYSPEILQIREEIPSKSWDDSVPIWVDTSTELESMLEDLKNTKEIAVDLEHHDYRSYY 248

Query: 251 GITCLMQISTRENDWLVDTIALRDHLWVLNEIFTNPKVIKVFHGAFMDVIWLQRDLGLYL 310
           GI CLMQISTRE D+LVDT+ LR++L +LNE+FTNP ++KVFHGAFMD+IWLQRDLGLY+
Sbjct: 249 GIVCLMQISTRERDYLVDTLKLRENLHILNEVFTNPSIVKVFHGAFMDIIWLQRDLGLYV 308

Query: 311 VSLFDTFHASRLLGFPKHSLAYLLERYAHFKTSKKYQLADWRIRPLSKPLKAYARADTHF 370
           V LFDT+HAS+ +G P+HSLAYLLE +A+FKTSKKYQLADWRIRPLSKP+ AYARADTHF
Sbjct: 309 VGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMTAYARADTHF 368

Query: 371 LLNIYDQMRNSLIEQGKLAQSLHNSRGVAKRRFEYTKFRPTVMTSEVYSPVEREDPWRSL 430
           LLNIYDQ+RN LIE  KLA  L+ SR VAKRRFEY+K+RP   +SEVYSP+E+E PW+ L
Sbjct: 369 LLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPLTPSSEVYSPIEKESPWKIL 428

Query: 431 IFHYNIPQSKSFLLKRLYEWRDTIARRDDESPRYVMPNQLLVALVMNAPTDTYGLLSVTS 490
           ++ YNIP  +  L++ LY+WRD IARRDDESPR+VMPNQLL ALV   PTD  G++S+T+
Sbjct: 429 MYQYNIPPEREVLVRELYQWRDLIARRDDESPRFVMPNQLLAALVAYTPTDVIGVVSLTN 488

Query: 491 FVTEHVRSNAKSLSQLIKKTLASPQDLFTDQINHMDSNKSMVDSKL----SPGDVKANHQ 546
            VTEHVR NAK L+ LI+  L + ++   ++   + S+++  D  L    S   ++   +
Sbjct: 489 GVTEHVRQNAKLLANLIRDALRNIKNT-NEEATPIPSSETKADGILLETISVPQIRDVME 547

Query: 547 NFDQYTRKSRELVIHGPTVVRGCSLFPGKPLPNEAY-VSYQGTQVHHIEPTVLDDRRELV 605
            F      +       P  V   S+  GK LP E + ++Y    + +   T  +D R + 
Sbjct: 548 RFSVLCNSNISKSRAKP--VTNSSILLGKILPREEHDIAYSKDGLPNKVKT--EDIR-IR 602

Query: 606 AQNITTTANVTEKLQVAVEKTPAPEVSDE----LDEGEAKELSDDTVSQLKEDKDEIVVL 661
           AQN  +     E +   +EK     V  E    +D   A   S +      ++ D++VVL
Sbjct: 603 AQNFKSALANLEDIIFEIEKPLVVPVKLEEIKTVDPASAPNHSPEI-----DNLDDLVVL 657

Query: 662 KRRKALPQSSSPPKNAEGNPKEILDFKNNKKIMTATASVPRKSTK--RFDPYAIQASGPD 719
           K++    Q   P K      K+ +D+     I++       +  K  RFDP +  ++GP 
Sbjct: 658 KKKNI--QKKQPAKEKGVTEKDAVDYSKIPNILSNKPGQNNRQQKKRRFDPSSSDSNGPR 715

Query: 720 GV-KRRKKTRGIQKSFK 735
              KRR   +G   SFK
Sbjct: 716 AAKKRRPAAKGKNLSFK 732

>TDEL0G04440 Chr7 (805881..808088) [2208 bp, 735 aa] {ON} Anc_6.25
           YOR001W
          Length = 735

 Score =  628 bits (1619), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/748 (47%), Positives = 465/748 (62%), Gaps = 27/748 (3%)

Query: 1   MAKTQEDKRSSILTQVVGTIRASSAISAQDVDFYKSLDSTISESLDETSAKLLXXXXXXX 60
           M   +ED+   +L +VV TIRASSA++AQDVDF++SL   I +SLDETS +++       
Sbjct: 1   MPPAEEDQ---LLRKVVDTIRASSALAAQDVDFHRSLSRPIGKSLDETSTRMVSLINSLL 57

Query: 61  XXXXXXXXXXEPGRAGLENSWNNIGEVMDLLFEKSEHALAAMKKK-GSNIIGNNLQYLDD 119
                       G+  L   W +   +MD LFE S+ +   + +  GS   G  L++LD+
Sbjct: 58  SSIDQNSEPLVEGKETLNEYWKDFSNMMDNLFELSDCSADILTRAPGSRKDGEKLKFLDN 117

Query: 120 SQPLTDTTLTKITKPQASFSRPVDNTESHPFKPLLVQKPNALRPLDDVLQLTVEEEGIPA 179
           S         +I+KPQ +F  PV+NTE  PF PLL +KP ALRPL  +  +    + +P 
Sbjct: 118 SSSNDSIPSKRISKPQLNFKNPVNNTEIQPFVPLLKEKPFALRPL--ISDIVPGNDAVPE 175

Query: 180 HYPHPYEYEIDHQEYDESVLEIRPPIPSKPWEETDATWVDNLGTLNDMIRELSKAKELAI 239
           HY  PYEYEI+HQEY ESV+    PIPSKPWE T+A WVDN+  L  MI +L    E+A+
Sbjct: 176 HYAQPYEYEIEHQEYGESVIVKSEPIPSKPWETTEALWVDNIEVLKTMISDLKSVTEIAV 235

Query: 240 DLEHHDYRTYYGITCLMQISTRENDWLVDTIALRDHLWVLNEIFTNPKVIKVFHGAFMDV 299
           DLEHHDYR+YYGI CLMQISTRE D+L+DTIALRD L +LNE+F NPK++KVFHGAFMD+
Sbjct: 236 DLEHHDYRSYYGIVCLMQISTRERDYLIDTIALRDDLQILNEVFANPKILKVFHGAFMDI 295

Query: 300 IWLQRDLGLYLVSLFDTFHASRLLGFPKHSLAYLLERYAHFKTSKKYQLADWRIRPLSKP 359
           IWLQRDLGLY+VSLFDTFHASR +G P+HSLAYLLE++A+FKTSKKYQLADWR+RPLSK 
Sbjct: 296 IWLQRDLGLYVVSLFDTFHASRAIGLPRHSLAYLLEKFANFKTSKKYQLADWRLRPLSKA 355

Query: 360 LKAYARADTHFLLNIYDQMRNSLIEQGKLAQSLHNSRGVAKRRFEYTKFRPTVMTSEVYS 419
           + AYARADTHFLLNIYDQ+RN+LIEQ KLA  L  SR VAKRRFEY+KFRP   +  VY 
Sbjct: 356 MNAYARADTHFLLNIYDQLRNTLIEQNKLAGVLAESRNVAKRRFEYSKFRPIAPSPTVYC 415

Query: 420 PVEREDPWRSLIFHYNIPQSKSFLLKRLYEWRDTIARRDDESPRYVMPNQLLVALVMNAP 479
           P+++ DPW+ L+F Y+I  ++  L+K+LY+WRDTIARRDDESPRYVMPNQLLV L   AP
Sbjct: 416 PIDKPDPWKVLMFQYSISPNREELVKKLYDWRDTIARRDDESPRYVMPNQLLVELARQAP 475

Query: 480 TDTYGLLSVTSFVTEHVRSNAKSLSQLIKKTLASPQDLFTDQINHMDSNKSMVDSKLSPG 539
           T+   ++SV S VT+HVRSN+  L+ LIK TLAS            D+N +   S L+  
Sbjct: 476 TEPINVISVNSIVTDHVRSNSLVLAHLIKNTLASSDKESDKGTFEADNNSTDAASLLTVP 535

Query: 540 DVKANHQNFDQYTRKSRELVIHGPTVVRGCSLFPGKPLPNEAYVSYQGTQVHHIEPTVLD 599
            ++     F   +R +  ++ +     R  S+F       +  V+Y G  + HI    L 
Sbjct: 536 QIQKLAACFAGVSR-AFTILQNEYKDGRSSSIFTDILTSEDDAVNYVGNNMDHITKKELG 594

Query: 600 DRRELVAQNITTTANVTEKLQVAVEKTPAPEVSDELDEGE-----AKELSDDTVSQLKED 654
            R     Q++      T          P PE++ E +  E     A E   ++ S  KED
Sbjct: 595 KRAAKALQSMEQFDEATSYYM------PIPEIAKESNTMEEIRPPAPEEVKESPSPPKED 648

Query: 655 KDEIVVLKRRKALPQSSSPPKNAEGNPKEI--LDFKNNKKIM-TATASVPRKSTKRFDPY 711
            DEI+ LK+ K   Q S  PK    + +EI  +D+   KK++ T       K  ++FDPY
Sbjct: 649 MDEIITLKKIKK--QKSQSPKELGISEREIPAVDYTKTKKVLATNQDKNKDKKKRKFDPY 706

Query: 712 AIQASGPDGVKRRKKTRGIQK----SFK 735
           A      D  +  KK + + +    SFK
Sbjct: 707 AASNHSSDAPRAPKKRKPVNRERNVSFK 734

>Smik_15.170 Chr15 (294013..296334) [2322 bp, 773 aa] {ON} YOR001W
           (REAL)
          Length = 773

 Score =  627 bits (1617), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/743 (45%), Positives = 463/743 (62%), Gaps = 38/743 (5%)

Query: 12  ILTQVVGTIRASSAISAQDVDFYKSLDSTISESLDETSAKLLXXXXXXXXXXXXXXXXXE 71
           +L++VV  IRA+S+++ QDVDFYK+LD    + L   S KL                  E
Sbjct: 49  LLSKVVNVIRAASSLAGQDVDFYKNLDREFGKVLKSKSDKLADMANEIILSIDEHHESFE 108

Query: 72  PGRAGLENSWNNIGEVMDLLFEKSEHALAAMKKK-GSNIIGNNLQYLDDSQPLTDTTLTK 130
                +   WN+ G +MD L E S+H+L  + +   S   G +LQYL D      +   +
Sbjct: 109 LKDEDISGLWNDFGNIMDNLLEMSDHSLDKLNRAVTSKPNGADLQYLGDFSEKNLSPAKR 168

Query: 131 ITKPQASFSRPVDNTESHPFKPLLVQKPNALRPLDDVLQLTVEEEGIPAHYPHPYEYEID 190
           + KPQ  F  P+DN+ESHPF PLL +KPNAL+PL D L+L  E++  P+HYPHPYEYEID
Sbjct: 169 VEKPQLKFKTPIDNSESHPFIPLLKEKPNALKPLSDSLRLIEEDDNTPSHYPHPYEYEID 228

Query: 191 HQEYDESVLEIRPPIPSKPWEETDATWVDNLGTLNDMIRELSKAKELAIDLEHHDYRTYY 250
           HQEY  ++L+IR  IPSK W +++  W+D +  L  M+ EL   +E+A+DLEHHDYR+YY
Sbjct: 229 HQEYGSNILQIRKEIPSKSWNDSEPIWIDTMPKLESMLEELKNVQEIAVDLEHHDYRSYY 288

Query: 251 GITCLMQISTRENDWLVDTIALRDHLWVLNEIFTNPKVIKVFHGAFMDVIWLQRDLGLYL 310
           GI CLMQISTRE D+LVDT+ LR+ L +LNE+FT+P ++KVFHGAFMD+IWLQRDLGLY+
Sbjct: 289 GIVCLMQISTREKDYLVDTLELRETLHILNEVFTDPSIVKVFHGAFMDIIWLQRDLGLYV 348

Query: 311 VSLFDTFHASRLLGFPKHSLAYLLERYAHFKTSKKYQLADWRIRPLSKPLKAYARADTHF 370
           V LFDT+HAS+ +G P+HSLAYLLE +A+FKTSKKYQLADWRIRPLSKP+ AYARADTHF
Sbjct: 349 VGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMIAYARADTHF 408

Query: 371 LLNIYDQMRNSLIEQGKLAQSLHNSRGVAKRRFEYTKFRPTVMTSEVYSPVEREDPWRSL 430
           LLNIYDQ+RN LIE  KLA  L+ SR VAKRRFEY+K+RP + +SEVYSP+E+E PWR L
Sbjct: 409 LLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPRIPSSEVYSPIEKEAPWRVL 468

Query: 431 IFHYNIPQSKSFLLKRLYEWRDTIARRDDESPRYVMPNQLLVALVMNAPTDTYGLLSVTS 490
           ++ YNI   K  L+K LY+WRD IARRDDESPR+VMPNQLL ALV   P D  G++S+T+
Sbjct: 469 MYQYNITSEKEELVKDLYQWRDVIARRDDESPRFVMPNQLLAALVAYTPIDVIGVISLTN 528

Query: 491 FVTEHVRSNAKSLSQLIKKTLASPQDLFTDQINHMDSNKSMVDSKLSPGDVKANHQNFDQ 550
            +TEHVR NAK L  LIK +L   +D + +            DS ++  +   N  + + 
Sbjct: 529 GITEHVRQNAKVLVNLIKNSLRHIKDTYKE------------DSPVTFSESMTNEVSLEA 576

Query: 551 YTRKSRELVIHGPTV-----VRGC--------SLFPGKPLP-NEAYVSYQGTQVHHIEPT 596
            T      ++   +V     V  C        S+  G+ LP  E  ++Y+   + +    
Sbjct: 577 ITIPQIRDIMERFSVLSNSNVSNCRAKNGATPSILLGRILPLEENDIAYKNNGLPN--RV 634

Query: 597 VLDDRRELVAQNITTTANVTEKLQVAVEKTPA-PEVSDELDEGEAKELSDDTVSQLKEDK 655
             +D R   AQ+  +  +  E   + VEK    P    +++    +++   + +   E+ 
Sbjct: 635 KFEDIRAR-AQSFNSALSNLEDCMLEVEKPHILPTNVKKIERINTEDVPKHSATI--ENP 691

Query: 656 DEIVVLKRRKALPQSSSPPKNAEGNPKEILDFKNNKKIMTATASVPRKSTK--RFDPYAI 713
           D+IVVLK++      S   K+  G  ++ +D+     ++++ +   R+  K  R DP   
Sbjct: 692 DDIVVLKKKNIHRTQSMNAKDTMG--EKAIDYSKIPNVLSSKSDQNRRQQKKRRSDPLFN 749

Query: 714 QASGPDGVKRRK-KTRGIQKSFK 735
            + GP   K+++  TRG   SFK
Sbjct: 750 DSDGPRAAKKKRPATRGRNVSFK 772

>Skud_15.162 Chr15 (286822..289026) [2205 bp, 734 aa] {ON} YOR001W
           (REAL)
          Length = 734

 Score =  619 bits (1595), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/733 (46%), Positives = 456/733 (62%), Gaps = 17/733 (2%)

Query: 12  ILTQVVGTIRASSAISAQDVDFYKSLDSTISESLDETSAKLLXXXXXXXXXXXXXXXXXE 71
           + +++V  +RA+S++++QDVDFYK+L+   S  L   S KL                  E
Sbjct: 9   LFSKIVKVVRAASSLASQDVDFYKNLEREFSNVLKSKSDKLTDMVNEIILSIDEHHESFE 68

Query: 72  PGRAGLENSWNNIGEVMDLLFEKSEHALAAMKKKG-SNIIGNNLQYLDDSQPLTDTTLTK 130
                +   W + G +MD L E S+H+L  +     S + G  LQYL D       +  +
Sbjct: 69  LKEDEISGLWKDFGNIMDNLLEMSDHSLDKLNHTANSKVSGAELQYLGDFSGKDSLSTKR 128

Query: 131 ITKPQASFSRPVDNTESHPFKPLLVQKPNALRPLDDVLQLTVEEEGIPAHYPHPYEYEID 190
           + KPQ  F + +DN+ESHPF PLL +KPNAL+PL + L+L   EE  P+HY HPY YEID
Sbjct: 129 LEKPQLKFKKSIDNSESHPFIPLLKEKPNALKPLSESLRLAEAEENNPSHYLHPYAYEID 188

Query: 191 HQEYDESVLEIRPPIPSKPWEETDATWVDNLGTLNDMIRELSKAKELAIDLEHHDYRTYY 250
           HQEY   VL+I+  IPSK W++++  W+D    L  M+ +L  A E+A+DLEHHDYR+YY
Sbjct: 189 HQEYSSDVLQIKKEIPSKSWDDSEPIWIDTKTKLGLMLEDLKNASEIAVDLEHHDYRSYY 248

Query: 251 GITCLMQISTRENDWLVDTIALRDHLWVLNEIFTNPKVIKVFHGAFMDVIWLQRDLGLYL 310
           GI CLMQ+STRE D+LVDTI LRD L +LNE+FT+P ++KVFHGAFMD+IWLQRDLGLY+
Sbjct: 249 GIVCLMQVSTRERDYLVDTIELRDALHILNEVFTDPLIVKVFHGAFMDIIWLQRDLGLYV 308

Query: 311 VSLFDTFHASRLLGFPKHSLAYLLERYAHFKTSKKYQLADWRIRPLSKPLKAYARADTHF 370
           V LFDT+HAS+ +G P+HSLAYLLE +A+FKTSKKYQLADWR RPLSKP+ AYARADTHF
Sbjct: 309 VGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRARPLSKPMTAYARADTHF 368

Query: 371 LLNIYDQMRNSLIEQGKLAQSLHNSRGVAKRRFEYTKFRPTVMTSEVYSPVEREDPWRSL 430
           LLNIYDQ+RN LIE  KLA  L+ SR VAKRRFEY+K RP   +SEVYSP+E+E+PWR L
Sbjct: 369 LLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKHRPRTPSSEVYSPIEKENPWRVL 428

Query: 431 IFHYNIPQSKSFLLKRLYEWRDTIARRDDESPRYVMPNQLLVALVMNAPTDTYGLLSVTS 490
           ++ YNI   K  L+K LY WRD IARRDDESPR+VMPNQLL ALV  AP D  G++S+T+
Sbjct: 429 MYQYNITSEKEELVKDLYLWRDFIARRDDESPRFVMPNQLLAALVAYAPIDVIGVVSLTN 488

Query: 491 FVTEHVRSNAKSLSQLIKKTLASPQDLFTDQINHMDSNKSMVDS-KLSPGDVKANHQNFD 549
            VTEHVR NAK L+ LI+  L + +D    +   + S++S  D   L    +       +
Sbjct: 489 GVTEHVRQNAKVLANLIENALGNIKDT-NKKTTSITSSESKPDGISLEVITISQIRDIME 547

Query: 550 QYTRKSRELVIHGPTVV--RGCSLFPGKPLP-NEAYVSYQGTQVHHIEPTVLDDRRELVA 606
           +++  S   VI+  T       S+  GK LP  E  +SY G +    +  V D +    A
Sbjct: 548 RFSLLSNSGVINNRTKTGDSTSSILLGKTLPFEECGISY-GKKGTPNKVKVEDIKAR--A 604

Query: 607 QNITTTANVTEKLQVAVEKTPAPEVSDELDEGEAKEL-SDDTVSQLKEDKDEIVVLKRRK 665
           Q   +     E +   +EK     V   +++GEA E+ S   +    E  D+I+VLK++K
Sbjct: 605 QKFNSALAGLENIMFELEKPVT--VPASVEKGEAVEIESAPELPSKAESFDDIIVLKKKK 662

Query: 666 ALPQSSSPPKNAEGNPKEILDFKNNKKIMTATASVPRKS--TKRFDPYAIQASGPDGVKR 723
                  P K  +   KE +D+     ++++     RK    +RFDP +  + GP   K+
Sbjct: 663 M--HKKQPAKGKDMTVKEAVDYSKMPSVLSSKPGQNRKQQRKRRFDPSSNDSEGPRAAKK 720

Query: 724 RKKT-RGIQKSFK 735
           ++   RG   SFK
Sbjct: 721 KRPAPRGKNMSFK 733

>NDAI0D00850 Chr4 complement(190801..193173) [2373 bp, 790 aa] {ON}
           Anc_6.25 YOR001W
          Length = 790

 Score =  607 bits (1566), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/518 (56%), Positives = 383/518 (73%), Gaps = 3/518 (0%)

Query: 2   AKTQEDKRSSILTQVVGTIRASSAISAQDVDFYKSLDSTISESLDETSAKLLXXXXXXXX 61
           A  ++  +  +L QVV T+RAS A++AQDVDFY+S+D T +++L ET+++L         
Sbjct: 18  ANEKQSPKDQLLPQVVQTVRASVALAAQDVDFYRSMDKTTAKTLKETTSQLADMINSVLL 77

Query: 62  XXXXXXXXXEPGRAGLENSWNNIGEVMDLLFEKSEHAL-AAMKKKGSNIIGNNLQYLDDS 120
                    +  +  LE++W +   +MD L EKS+ ++   ++ K +N   +N+QYLD+ 
Sbjct: 78  AVDENSETLDGTKENLEDNWKDFSNLMDNLLEKSDRSMDMLLRSKNTNTNNSNMQYLDEY 137

Query: 121 QPLTDTTLTK--ITKPQASFSRPVDNTESHPFKPLLVQKPNALRPLDDVLQLTVEEEGIP 178
               DT+  +  I KPQ  F  PVDNTE+HPF PLL  KPNAL+ LD+ +QL   +E +P
Sbjct: 138 SGRDDTSSKRRAIGKPQLEFDVPVDNTETHPFIPLLKSKPNALKSLDESIQLLPVDENVP 197

Query: 179 AHYPHPYEYEIDHQEYDESVLEIRPPIPSKPWEETDATWVDNLGTLNDMIRELSKAKELA 238
            HY  PYEYEID+Q Y++ +L++  PIPS+PW ET A WVD   +L  MI++L+   E A
Sbjct: 198 EHYAQPYEYEIDNQPYNDKILQLSDPIPSQPWMETTAIWVDTPESLQSMIKDLNNCTEFA 257

Query: 239 IDLEHHDYRTYYGITCLMQISTRENDWLVDTIALRDHLWVLNEIFTNPKVIKVFHGAFMD 298
           +DLEHHDYRTYYGI CLMQISTR  D++VDT+ LR HL  LNE FTNP++ KV HGAFMD
Sbjct: 258 VDLEHHDYRTYYGIVCLMQISTRTQDYIVDTLKLRSHLQPLNEPFTNPQITKVLHGAFMD 317

Query: 299 VIWLQRDLGLYLVSLFDTFHASRLLGFPKHSLAYLLERYAHFKTSKKYQLADWRIRPLSK 358
           +IWLQRDLGLY+VSLFDTFHASR LGFPK+SLAYLLE++++FKTSKKYQ+ADWRIRPLSK
Sbjct: 318 IIWLQRDLGLYIVSLFDTFHASRALGFPKNSLAYLLEKFSNFKTSKKYQMADWRIRPLSK 377

Query: 359 PLKAYARADTHFLLNIYDQMRNSLIEQGKLAQSLHNSRGVAKRRFEYTKFRPTVMTSEVY 418
            + +YAR+DTHFLLNI+DQMRN L++ GKLA  L  SR VAKRRFEY K+RP + +S VY
Sbjct: 378 AMNSYARSDTHFLLNIFDQMRNKLVQDGKLAGVLKESRNVAKRRFEYVKYRPLITSSAVY 437

Query: 419 SPVEREDPWRSLIFHYNIPQSKSFLLKRLYEWRDTIARRDDESPRYVMPNQLLVALVMNA 478
           SP+E+ DPW++L++ YNIP +K  LLK LY+WRD IARRDDESPRY+MPNQLLV+LV  A
Sbjct: 438 SPIEKIDPWKTLMYQYNIPLAKELLLKELYQWRDKIARRDDESPRYIMPNQLLVSLVAYA 497

Query: 479 PTDTYGLLSVTSFVTEHVRSNAKSLSQLIKKTLASPQD 516
           P +  G++SV++ VT+HVRSN+K L+ LIK  L   +D
Sbjct: 498 PVEPAGVVSVSNMVTDHVRSNSKILANLIKNCLTKIKD 535

 Score = 41.6 bits (96), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 61/139 (43%), Gaps = 20/139 (14%)

Query: 617 EKLQVAVEKTPAPEVSDELDEGEAKE---------LSDDTVSQLKEDKDEIVVLK---RR 664
           E+LQ      P PE    + E E +E         ++    S+ KED DEI+VLK   R 
Sbjct: 651 EQLQQVEYSIPIPENEIVVVESEQQEPSIPAANAEITTAVASRKKEDLDEIIVLKKTNRN 710

Query: 665 KALPQSSSPPKNAEGNPKEILDFKNNKKIMTATASVPRKSTKR-------FDPYAIQASG 717
           K   +      + +    E++D+   +K++  + +   ++          FDPY +   G
Sbjct: 711 KGKKRERKHSDDDDEGEIEVIDYSKMEKVLDNSNTKRNQNKNNNGNKRKRFDPYNVNNEG 770

Query: 718 PDGVKRRKK-TRGIQKSFK 735
           P   K+RK  TRG   SFK
Sbjct: 771 PRAPKKRKAMTRGKNVSFK 789

>SAKL0E00704g Chr5 complement(45027..47651) [2625 bp, 874 aa] {ON}
           some similarities with uniprot|P32383 Saccharomyces
           cerevisiae YPL268W PLC1 Phosphoinositide-specific
           phospholipase C hydrolyzes phosphatidylinositol 4 5-
           biphosphate (PIP2) to generate inositol 1 4
           5-triphosphate (IP3) and 1 2-diacylglycerol (DAG)
           involved in kinetochore function and pseudohyphal
           differentiation
          Length = 874

 Score = 33.1 bits (74), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 23/91 (25%), Positives = 47/91 (51%), Gaps = 11/91 (12%)

Query: 216 TWVDNLGTLNDMIRELSKAKELAIDLEHHDYRTYYGITCLMQISTRENDWLVDTIALRDH 275
           +W D+     DMI+++ +A E+A      +YR  Y I+     S+   +W+     + + 
Sbjct: 158 SWKDSRYVELDMIKDI-RAGEMA-----RNYREEYKIS-----SSYSENWITIVYNVSNK 206

Query: 276 LWVLNEIFTNPKVIKVFHGAFMDVIWLQRDL 306
           L  L+ I +N +  K+FH   ++++  +R+L
Sbjct: 207 LKALHVIASNHEDFKIFHSCVLNLVSSRREL 237

>TPHA0F03570 Chr6 (768648..776030) [7383 bp, 2460 aa] {ON} Anc_1.515
            YKL203C
          Length = 2460

 Score = 33.1 bits (74), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 38/77 (49%), Gaps = 9/77 (11%)

Query: 167  VLQLTVEEEGIPAHYPHPYEYEIDHQEYDESVLEIRPPIPSKPWEETDATWVDNLGTLND 226
            V+QL      +  H P  ++  +D Q++        P IP  P       WV N  TL+ 
Sbjct: 2125 VMQLFGLVNTLLQHDPDCFQRHLDIQKF--------PVIPLSP-RSGLIGWVSNSDTLHV 2175

Query: 227  MIRELSKAKELAIDLEH 243
            +IRE  +AK++ +++EH
Sbjct: 2176 LIREHREAKKVPLNIEH 2192

>CAGL0M03575g Chr13 complement(403738..404733) [996 bp, 331 aa] {ON}
           highly similar to uniprot|P38629 Saccharomyces
           cerevisiae YNL290w RFC3
          Length = 331

 Score = 32.0 bits (71), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 23/98 (23%), Positives = 45/98 (45%), Gaps = 11/98 (11%)

Query: 548 FDQYTRKSRELVIHG------PTVVRGCSLFPGKPLPNEAYVSYQGTQVHH----IEPTV 597
            ++YT+ +R  ++        P ++  C+ F  +PLPN+A        + H    I P  
Sbjct: 130 IEKYTKNTRFCILANYSHKITPALLSRCTRFRFQPLPNDAVEKRMANVLVHEHLRISPAA 189

Query: 598 LDDRRELVAQNITTTANVTEKLQVAVEKTPAPEVSDEL 635
            +   EL   ++    NV +  +  +E +P  E++DE+
Sbjct: 190 KEALLELSNGDMRRVLNVLQASKATLE-SPEDEITDEV 226

>Ecym_2370 Chr2 (719985..722363) [2379 bp, 792 aa] {ON} similar to
           Ashbya gossypii AAL107W
          Length = 792

 Score = 32.0 bits (71), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 46/106 (43%), Gaps = 13/106 (12%)

Query: 427 WRSLIFHYNIPQSKSFLLKRLYEWRD---TIARRDDESPRYVMPNQLLVALVMNAPT--- 480
           WR+L+   N     S L    + W      I+RR    P   +P ++L+  ++  P+   
Sbjct: 685 WRNLVNSENTQIEPSLLSVNRWTWNKKLTNISRRQLVDPG--IPGRMLLKNIIFGPSLYS 742

Query: 481 -----DTYGLLSVTSFVTEHVRSNAKSLSQLIKKTLASPQDLFTDQ 521
                D++   SV   +TE   + A+    LI K LAS  + F D+
Sbjct: 743 FDDDEDSWTFPSVRDAITEKNWAQAQDQINLIGKILASSAERFMDE 788

>ADR400W Chr4 (1423238..1425628) [2391 bp, 796 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YAL047C (SPC72)
          Length = 796

 Score = 32.0 bits (71), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 42/154 (27%), Positives = 70/154 (45%), Gaps = 22/154 (14%)

Query: 195 DESVLEIRPPIPSKPWEETDATWVDNLGTLNDMIRELSKAKELAIDLEHHDYRTYYGITC 254
           D +V++   P P +  E T+    D +G  ++M  E+    E+AI+  H +Y T+     
Sbjct: 346 DATVVKQELPAPLELDEHTEVAAKDMIGFNSEMTPEMDTQLEIAIESMHKEYHTFLQS-- 403

Query: 255 LMQISTRENDWLVDTIA--LRDHLWVLNEIFTNPKVIKVFHGAFMDVIWLQRDLGL---- 308
            +Q    +ND L + I   L     +LN++  +    + F+GA +         G     
Sbjct: 404 -IQAKMADNDHLGELIGTKLTKQKQLLNKLARSVTDAESFNGATLP--------GAKGDP 454

Query: 309 YLVSLFD-TFHASRLL--GFPKH--SLAYLLERY 337
           YL +L D T  ASR L   +  H  +L  +L+RY
Sbjct: 455 YLTALDDLTTRASRDLSRSYQDHIEALKNMLDRY 488

>Suva_16.270 Chr16 (470154..472550) [2397 bp, 798 aa] {ON} YPL045W
           (REAL)
          Length = 798

 Score = 32.0 bits (71), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 38/69 (55%), Gaps = 8/69 (11%)

Query: 363 YARADTHFLLNIYDQ------MRNSLIEQGKLAQSLHNSRGVAKRRFEYTKFRPTVMTSE 416
           Y R D  +L + Y Q      + + L++QGK  QSLH+   + + R  Y+K + + M S+
Sbjct: 568 YMRNDKAYLYDFYRQTDRFIDLAHVLLQQGKEQQSLHSF--LPQIRDLYSKIQNSEMASD 625

Query: 417 VYSPVERED 425
           V   ++R++
Sbjct: 626 VAGQLQRQE 634

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.131    0.380 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 78,489,444
Number of extensions: 3579082
Number of successful extensions: 13705
Number of sequences better than 10.0: 82
Number of HSP's gapped: 14298
Number of HSP's successfully gapped: 86
Length of query: 735
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 618
Effective length of database: 40,065,477
Effective search space: 24760464786
Effective search space used: 24760464786
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 70 (31.6 bits)