Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_56.224436.26ON28028013490.0
KLTH0C11110g6.26ON28028010811e-149
SAKL0E01408g6.26ON3072088171e-109
TDEL0G044306.26ON3472257364e-96
KLLA0D01287g6.26ON3452127356e-96
ZYRO0C07634g6.26ON3822237152e-92
KNAG0I017506.26ON3242427092e-92
Kpol_1037.306.26ON3672367132e-92
CAGL0E02541g6.26ON3422187017e-91
Ecym_30296.26ON3512116957e-90
Skud_15.1616.26ON2932416802e-88
YOL001W (PHO80)6.26ON2932216777e-88
Smik_15.1696.26ON2912316723e-87
ACR001C6.26ON3462206765e-87
Suva_15.1746.26ON2952216699e-87
TPHA0J003806.26ON3562346722e-86
TBLA0A071606.26ON2682186234e-80
NCAS0D021506.26ON3692485281e-64
NDAI0C026406.26ON4272215164e-62
Skud_9.1197.240ON2851601984e-17
Smik_9.1407.240ON2851571914e-16
Suva_9.1497.240ON2861751897e-16
YIL050W (PCL7)7.240ON2851571792e-14
KNAG0D016307.240ON4381641672e-12
CAGL0M12342g7.240ON4571431653e-12
KLTH0A04268g7.240ON5801181653e-12
ADL075W7.240ON2071491594e-12
NCAS0E032207.240ON3412061616e-12
Ecym_43367.240ON3851241626e-12
Kwal_23.58077.240ON4651241619e-12
SAKL0F08602g7.240ON4741321556e-11
KAFR0I018407.240ON3251211537e-11
NCAS0A134807.240ON4481201539e-11
KAFR0L008807.240ON3131201511e-10
TPHA0C010907.240ON3851641502e-10
NDAI0A025607.240ON5031191484e-10
KNAG0L014707.240ON3541631431e-09
TDEL0H020207.240ON3631361371e-08
KLLA0C08305g7.240ON4091381352e-08
NDAI0E047707.240ON3031411305e-08
TBLA0D040707.240ON661601326e-08
ZYRO0C08118g7.240ON4051461316e-08
Kpol_1033.137.240ON250601287e-08
Suva_5.1677.240ON424601272e-07
Smik_5.1897.240ON415601272e-07
YER059W (PCL6)7.240ON420601253e-07
Skud_5.1737.240ON420601253e-07
TBLA0C048507.289ON3681281244e-07
Kpol_2000.147.289ON3101421217e-07
Skud_7.1396.236ON4341421093e-05
KNAG0A014903.70ON2621391058e-05
YDL127W (PCL2)7.289ON3081121041e-04
CAGL0E02233g3.70ON2661061031e-04
Smik_4.1107.289ON3081121031e-04
AFR159C7.289ON3081301022e-04
Suva_14.503.70ON2791041022e-04
Kpol_1020.87.289ON2961431022e-04
NCAS0A137707.289ON3121441022e-04
NCAS0D040706.236ON4731151032e-04
Ecym_80387.289ON3141111013e-04
SAKL0F09856g7.289ON3351101003e-04
YGL134W (PCL10)6.236ON4331111014e-04
TPHA0A005803.70ON289136994e-04
TBLA0J006507.289ON363131995e-04
Suva_4.687.289ON305136986e-04
Suva_4.1187.289ON309133979e-04
ZYRO0C09284g7.289ON311116979e-04
SAKL0A03938g6.236ON501116980.001
KNAG0B029307.289ON312129970.001
Smik_7.1386.236ON437113970.001
CAGL0J09328g7.289ON297130960.001
YNL289W (PCL1)3.70ON279104950.002
Smik_14.423.70ON279104950.002
KLTH0A05346g7.289ON301152940.002
TPHA0P008107.289ON24798940.002
Kwal_23.60067.289ON304111940.002
Skud_14.483.70ON279106930.002
TBLA0A078903.70ON361103940.002
TDEL0H015507.289ON309114930.003
KLLA0E13223g3.70ON282104910.004
Skud_4.1287.289ON308109910.005
ZYRO0C02068g3.70ON330113900.008
Skud_4.797.289ON309111880.011
ZYRO0E07326g6.236ON428112890.011
NDAI0A022707.289ON330105880.013
YDL179W (PCL9)7.289ON304128870.014
Kpol_1020.163.70ON282105860.022
TDEL0E007903.70ON25497830.042
KLLA0F05654g7.289ON31199830.043
Smik_4.607.289ON305126820.064
Ecym_12013.527ON44468810.093
SAKL0C12100g3.70ON314108800.11
KAFR0A082803.70ON241112780.20
NDAI0A060503.70ON28697770.26
NCAS0A098703.70ON29494770.30
CAGL0J06336g7.289ON314129760.34
NDAI0C019805.347ON226107750.37
Skud_16.4947.547ON655105760.40
Smik_16.4547.547ON656102760.44
KAFR0C015603.70ON26794740.58
TPHA0A032507.289ON289103740.60
Kwal_23.52313.70ON25690730.80
YPR190C (RPC82)7.547ON654102731.2
NDAI0F014806.236ON490108721.5
ZYRO0C14454g5.347ON176147691.9
KLTH0H13860g1.439ON272123702.0
Suva_16.5227.547ON652102702.2
CAGL0J07568g2.5ON46669702.5
AEL195W3.70ON237108682.8
KLTH0A01584g3.70ON28180674.8
ADR383C7.37ON71792668.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_56.22443
         (280 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_56.22443 s56 (131419..132261) [843 bp, 280 aa] {ON} YOL001W...   524   0.0  
KLTH0C11110g Chr3 complement(914257..915099) [843 bp, 280 aa] {O...   421   e-149
SAKL0E01408g Chr5 (106229..107152) [924 bp, 307 aa] {ON} similar...   319   e-109
TDEL0G04430 Chr7 (804428..805471) [1044 bp, 347 aa] {ON} Anc_6.2...   288   4e-96
KLLA0D01287g Chr4 (112866..113903) [1038 bp, 345 aa] {ON} simila...   287   6e-96
ZYRO0C07634g Chr3 (580486..581634) [1149 bp, 382 aa] {ON} simila...   280   2e-92
KNAG0I01750 Chr9 (344381..345355) [975 bp, 324 aa] {ON} Anc_6.26...   277   2e-92
Kpol_1037.30 s1037 complement(72024..73127) [1104 bp, 367 aa] {O...   279   2e-92
CAGL0E02541g Chr5 (244814..245842) [1029 bp, 342 aa] {ON} simila...   274   7e-91
Ecym_3029 Chr3 (56667..57722) [1056 bp, 351 aa] {ON} similar to ...   272   7e-90
Skud_15.161 Chr15 (284851..285732) [882 bp, 293 aa] {ON} YOL001W...   266   2e-88
YOL001W Chr15 (325249..326130) [882 bp, 293 aa] {ON}  PHO80Cycli...   265   7e-88
Smik_15.169 Chr15 (292553..293428) [876 bp, 291 aa] {ON} YOL001W...   263   3e-87
ACR001C Chr3 complement(357962..359002) [1041 bp, 346 aa] {ON} S...   265   5e-87
Suva_15.174 Chr15 (299761..300648) [888 bp, 295 aa] {ON} YOL001W...   262   9e-87
TPHA0J00380 Chr10 complement(84485..85555) [1071 bp, 356 aa] {ON...   263   2e-86
TBLA0A07160 Chr1 (1782941..1783747) [807 bp, 268 aa] {ON} Anc_6....   244   4e-80
NCAS0D02150 Chr4 (400750..401859) [1110 bp, 369 aa] {ON} Anc_6.26     207   1e-64
NDAI0C02640 Chr3 complement(611899..613182) [1284 bp, 427 aa] {O...   203   4e-62
Skud_9.119 Chr9 (227792..228649) [858 bp, 285 aa] {ON} YIL050W (...    81   4e-17
Smik_9.140 Chr9 (233007..233864) [858 bp, 285 aa] {ON} YIL050W (...    78   4e-16
Suva_9.149 Chr9 (247583..248443) [861 bp, 286 aa] {ON} YIL050W (...    77   7e-16
YIL050W Chr9 (258913..259770) [858 bp, 285 aa] {ON}  PCL7Pho85p ...    74   2e-14
KNAG0D01630 Chr4 (274260..275576) [1317 bp, 438 aa] {ON} Anc_7.2...    69   2e-12
CAGL0M12342g Chr13 complement(1234192..1235565) [1374 bp, 457 aa...    68   3e-12
KLTH0A04268g Chr1 (358035..359777) [1743 bp, 580 aa] {ON} simila...    68   3e-12
ADL075W Chr4 (550941..551564) [624 bp, 207 aa] {ON} Syntenic hom...    66   4e-12
NCAS0E03220 Chr5 complement(639650..640675) [1026 bp, 341 aa] {O...    67   6e-12
Ecym_4336 Chr4 complement(720123..721280) [1158 bp, 385 aa] {ON}...    67   6e-12
Kwal_23.5807 s23 (1326104..1327501) [1398 bp, 465 aa] {ON} YIL05...    67   9e-12
SAKL0F08602g Chr6 (657898..659322) [1425 bp, 474 aa] {ON} simila...    64   6e-11
KAFR0I01840 Chr9 (376802..377779) [978 bp, 325 aa] {ON} Anc_7.24...    64   7e-11
NCAS0A13480 Chr1 complement(2653843..2655189) [1347 bp, 448 aa] ...    64   9e-11
KAFR0L00880 Chr12 (163476..164417) [942 bp, 313 aa] {ON} Anc_7.2...    63   1e-10
TPHA0C01090 Chr3 complement(247987..249144) [1158 bp, 385 aa] {O...    62   2e-10
NDAI0A02560 Chr1 (571529..573040) [1512 bp, 503 aa] {ON} Anc_7.2...    62   4e-10
KNAG0L01470 Chr12 (259883..260947) [1065 bp, 354 aa] {ON} Anc_7....    60   1e-09
TDEL0H02020 Chr8 complement(346307..347398) [1092 bp, 363 aa] {O...    57   1e-08
KLLA0C08305g Chr3 complement(728996..730225) [1230 bp, 409 aa] {...    57   2e-08
NDAI0E04770 Chr5 (1073112..1074023) [912 bp, 303 aa] {ON} Anc_7....    55   5e-08
TBLA0D04070 Chr4 complement(1012284..1014269) [1986 bp, 661 aa] ...    55   6e-08
ZYRO0C08118g Chr3 (621320..622537) [1218 bp, 405 aa] {ON} simila...    55   6e-08
Kpol_1033.13 s1033 (30454..31206) [753 bp, 250 aa] {ON} (30454.....    54   7e-08
Suva_5.167 Chr5 (248778..250052) [1275 bp, 424 aa] {ON} YER059W ...    54   2e-07
Smik_5.189 Chr5 (276775..278022) [1248 bp, 415 aa] {ON} YER059W ...    54   2e-07
YER059W Chr5 (272624..273886) [1263 bp, 420 aa] {ON}  PCL6Pho85p...    53   3e-07
Skud_5.173 Chr5 (268792..270054) [1263 bp, 420 aa] {ON} YER059W ...    53   3e-07
TBLA0C04850 Chr3 complement(1175677..1176783) [1107 bp, 368 aa] ...    52   4e-07
Kpol_2000.14 s2000 (24019..24951) [933 bp, 310 aa] {ON} (24019.....    51   7e-07
Skud_7.139 Chr7 (260060..261364) [1305 bp, 434 aa] {ON} YGL134W ...    47   3e-05
KNAG0A01490 Chr1 (62182..62970) [789 bp, 262 aa] {ON} Anc_3.70 Y...    45   8e-05
YDL127W Chr4 (234927..235853) [927 bp, 308 aa] {ON}  PCL2Cyclin,...    45   1e-04
CAGL0E02233g Chr5 (215934..216734) [801 bp, 266 aa] {ON} similar...    44   1e-04
Smik_4.110 Chr4 (211556..212482) [927 bp, 308 aa] {ON} YDL127W (...    44   1e-04
AFR159C Chr6 complement(723082..724008) [927 bp, 308 aa] {ON} Sy...    44   2e-04
Suva_14.50 Chr14 (84601..85440) [840 bp, 279 aa] {ON} YNL289W (R...    44   2e-04
Kpol_1020.8 s1020 (18215..19105) [891 bp, 296 aa] {ON} (18215..1...    44   2e-04
NCAS0A13770 Chr1 complement(2704299..2705237) [939 bp, 312 aa] {...    44   2e-04
NCAS0D04070 Chr4 (764711..766132) [1422 bp, 473 aa] {ON} Anc_6.236     44   2e-04
Ecym_8038 Chr8 complement(87401..88345) [945 bp, 314 aa] {ON} si...    44   3e-04
SAKL0F09856g Chr6 complement(756909..757916) [1008 bp, 335 aa] {...    43   3e-04
YGL134W Chr7 (255663..256964) [1302 bp, 433 aa] {ON}  PCL10Pho85...    44   4e-04
TPHA0A00580 Chr1 (101866..102735) [870 bp, 289 aa] {ON} Anc_3.70...    43   4e-04
TBLA0J00650 Chr10 complement(152884..153975) [1092 bp, 363 aa] {...    43   5e-04
Suva_4.68 Chr4 (125518..126435) [918 bp, 305 aa] {ON} YDL179W (R...    42   6e-04
Suva_4.118 Chr4 (223497..224426) [930 bp, 309 aa] {ON} YDL127W (...    42   9e-04
ZYRO0C09284g Chr3 complement(706160..707095) [936 bp, 311 aa] {O...    42   9e-04
SAKL0A03938g Chr1 (367076..368581) [1506 bp, 501 aa] {ON} weakly...    42   0.001
KNAG0B02930 Chr2 (563319..564257) [939 bp, 312 aa] {ON} Anc_7.28...    42   0.001
Smik_7.138 Chr7 (249640..250953) [1314 bp, 437 aa] {ON} YGL134W ...    42   0.001
CAGL0J09328g Chr10 (920703..921596) [894 bp, 297 aa] {ON} simila...    42   0.001
YNL289W Chr14 (87897..88736) [840 bp, 279 aa] {ON}  PCL1Cyclin, ...    41   0.002
Smik_14.42 Chr14 (72224..73063) [840 bp, 279 aa] {ON} YNL289W (R...    41   0.002
KLTH0A05346g Chr1 complement(445174..446079) [906 bp, 301 aa] {O...    41   0.002
TPHA0P00810 Chr16 complement(165632..166375) [744 bp, 247 aa] {O...    41   0.002
Kwal_23.6006 s23 complement(1411337..1412251) [915 bp, 304 aa] {...    41   0.002
Skud_14.48 Chr14 (81435..82274) [840 bp, 279 aa] {ON} YNL289W (R...    40   0.002
TBLA0A07890 Chr1 (1943543..1944628) [1086 bp, 361 aa] {ON} Anc_3...    41   0.002
TDEL0H01550 Chr8 (266510..267439) [930 bp, 309 aa] {ON} Anc_7.28...    40   0.003
KLLA0E13223g Chr5 (1170139..1170987) [849 bp, 282 aa] {ON} simil...    40   0.004
Skud_4.128 Chr4 (230632..231558) [927 bp, 308 aa] {ON} YDL127W (...    40   0.005
ZYRO0C02068g Chr3 complement(163475..164467) [993 bp, 330 aa] {O...    39   0.008
Skud_4.79 Chr4 (134241..135170) [930 bp, 309 aa] {ON} YDL179W (R...    39   0.011
ZYRO0E07326g Chr5 complement(560064..561350) [1287 bp, 428 aa] {...    39   0.011
NDAI0A02270 Chr1 (511135..512127) [993 bp, 330 aa] {ON} Anc_7.289      39   0.013
YDL179W Chr4 (138291..139205) [915 bp, 304 aa] {ON}  PCL9Cyclin,...    38   0.014
Kpol_1020.16 s1020 complement(33477..34325) [849 bp, 282 aa] {ON...    38   0.022
TDEL0E00790 Chr5 (163333..164097) [765 bp, 254 aa] {ON} Anc_3.70...    37   0.042
KLLA0F05654g Chr6 (552056..552991) [936 bp, 311 aa] {ON} weakly ...    37   0.043
Smik_4.60 Chr4 (115068..115985) [918 bp, 305 aa] {ON} YDL179W (R...    36   0.064
Ecym_1201 Chr1 (406247..407581) [1335 bp, 444 aa] {ON} similar t...    36   0.093
SAKL0C12100g Chr3 complement(1083684..1084628) [945 bp, 314 aa] ...    35   0.11 
KAFR0A08280 Chr1 complement(1661106..1661831) [726 bp, 241 aa] {...    35   0.20 
NDAI0A06050 Chr1 complement(1372672..1373532) [861 bp, 286 aa] {...    34   0.26 
NCAS0A09870 Chr1 complement(1974028..1974912) [885 bp, 294 aa] {...    34   0.30 
CAGL0J06336g Chr10 complement(602954..603898) [945 bp, 314 aa] {...    34   0.34 
NDAI0C01980 Chr3 complement(445212..445892) [681 bp, 226 aa] {ON...    33   0.37 
Skud_16.494 Chr16 complement(859384..861351) [1968 bp, 655 aa] {...    34   0.40 
Smik_16.454 Chr16 complement(779609..781579) [1971 bp, 656 aa] {...    34   0.44 
KAFR0C01560 Chr3 complement(320148..320951) [804 bp, 267 aa] {ON...    33   0.58 
TPHA0A03250 Chr1 (717085..717954) [870 bp, 289 aa] {ON} Anc_7.28...    33   0.60 
Kwal_23.5231 s23 complement(1069167..1069937) [771 bp, 256 aa] {...    33   0.80 
YPR190C Chr16 complement(917077..919041) [1965 bp, 654 aa] {ON} ...    33   1.2  
NDAI0F01480 Chr6 (365467..366939) [1473 bp, 490 aa] {ON} Anc_6.2...    32   1.5  
ZYRO0C14454g Chr3 (1130631..1131161) [531 bp, 176 aa] {ON} some ...    31   1.9  
KLTH0H13860g Chr8 (1210300..1211118) [819 bp, 272 aa] {ON} simil...    32   2.0  
Suva_16.522 Chr16 complement(899518..901476) [1959 bp, 652 aa] {...    32   2.2  
CAGL0J07568g Chr10 complement(736677..738077) [1401 bp, 466 aa] ...    32   2.5  
AEL195W Chr5 (266347..267060) [714 bp, 237 aa] {ON} Syntenic hom...    31   2.8  
KLTH0A01584g Chr1 (141289..142134) [846 bp, 281 aa] {ON} similar...    30   4.8  
ADR383C Chr4 complement(1393399..1395552) [2154 bp, 717 aa] {ON}...    30   8.5  

>Kwal_56.22443 s56 (131419..132261) [843 bp, 280 aa] {ON} YOL001W
           (PHO80) - The Pho80p Cyclin [contig 185] FULL
          Length = 280

 Score =  524 bits (1349), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 258/280 (92%), Positives = 258/280 (92%)

Query: 1   MSDKESGCLSAKNPGSPKSPGERXXXXXXXXXXXXXDFSQCSRTDLVILISRMLSFLTRI 60
           MSDKESGCLSAKNPGSPKSPGER             DFSQCSRTDLVILISRMLSFLTRI
Sbjct: 1   MSDKESGCLSAKNPGSPKSPGERLEEAPVPEVALPEDFSQCSRTDLVILISRMLSFLTRI 60

Query: 61  NDSVPKDDAKELTRFHSRVPPQISVYDYMMRLTRYSSLEPAVLVASVYYIDLLSAMYPSF 120
           NDSVPKDDAKELTRFHSRVPPQISVYDYMMRLTRYSSLEPAVLVASVYYIDLLSAMYPSF
Sbjct: 61  NDSVPKDDAKELTRFHSRVPPQISVYDYMMRLTRYSSLEPAVLVASVYYIDLLSAMYPSF 120

Query: 121 SLNSLTVHRFLLTATTVASKGLCDSFCTNSHYAKVGGVQCSELHVLESEFLKKVNYRILP 180
           SLNSLTVHRFLLTATTVASKGLCDSFCTNSHYAKVGGVQCSELHVLESEFLKKVNYRILP
Sbjct: 121 SLNSLTVHRFLLTATTVASKGLCDSFCTNSHYAKVGGVQCSELHVLESEFLKKVNYRILP 180

Query: 181 RDDNISNCKAEKKAGLFVTPTYSKSCRGPNNGFNVLDTYYRKIIEIVGSFDSSPDKTKRA 240
           RDDNISNCKAEKKAGLFVTPTYSKSCRGPNNGFNVLDTYYRKIIEIVGSFDSSPDKTKRA
Sbjct: 181 RDDNISNCKAEKKAGLFVTPTYSKSCRGPNNGFNVLDTYYRKIIEIVGSFDSSPDKTKRA 240

Query: 241 HYVMINSNTRKDVELLQKKRTHEETDVXXXXXXXXXKRPA 280
           HYVMINSNTRKDVELLQKKRTHEETDV         KRPA
Sbjct: 241 HYVMINSNTRKDVELLQKKRTHEETDVPPCSSSPSSKRPA 280

>KLTH0C11110g Chr3 complement(914257..915099) [843 bp, 280 aa] {ON}
           similar to uniprot|P20052 Saccharomyces cerevisiae
           YOL001W PHO80 Cyclin negatively regulates phosphate
           metabolism Pho80p-Pho85p (cyclin-CDK complex)
           phosphorylates Pho4p and Swi5p deletion of PHO80 leads
           to aminoglycoside supersensitivity truncated form of
           PHO80 affects vacuole inheritance
          Length = 280

 Score =  421 bits (1081), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 207/280 (73%), Positives = 227/280 (81%)

Query: 1   MSDKESGCLSAKNPGSPKSPGERXXXXXXXXXXXXXDFSQCSRTDLVILISRMLSFLTRI 60
           MSDKESG  SAK+P   +                  DFSQC RTDLVILISRMLSFL RI
Sbjct: 1   MSDKESGGASAKHPDLTEDTKPDTGEDPVPEVALPNDFSQCPRTDLVILISRMLSFLIRI 60

Query: 61  NDSVPKDDAKELTRFHSRVPPQISVYDYMMRLTRYSSLEPAVLVASVYYIDLLSAMYPSF 120
           NDS+PKD++ ELTRFHSRVPPQISVYDY+MRLTRYSSLEPAVL+ASVYYIDLLSAMY +F
Sbjct: 61  NDSIPKDNSSELTRFHSRVPPQISVYDYLMRLTRYSSLEPAVLIASVYYIDLLSAMYTAF 120

Query: 121 SLNSLTVHRFLLTATTVASKGLCDSFCTNSHYAKVGGVQCSELHVLESEFLKKVNYRILP 180
           SLNSLTVHRFLLTATTV SKGLCDSFCTNSHYAKVGGVQCSELHVLESEFLK+VNYRILP
Sbjct: 121 SLNSLTVHRFLLTATTVGSKGLCDSFCTNSHYAKVGGVQCSELHVLESEFLKRVNYRILP 180

Query: 181 RDDNISNCKAEKKAGLFVTPTYSKSCRGPNNGFNVLDTYYRKIIEIVGSFDSSPDKTKRA 240
           RDDNI NCKAE++ GLFVT TY+K  RGPNNGFNVLDTYY+KIIEIVGS+DSSPDKTKRA
Sbjct: 181 RDDNILNCKAERREGLFVTATYAKENRGPNNGFNVLDTYYQKIIEIVGSYDSSPDKTKRA 240

Query: 241 HYVMINSNTRKDVELLQKKRTHEETDVXXXXXXXXXKRPA 280
           HYVM      ++ E  +KKR HEE++          K+PA
Sbjct: 241 HYVMKTPPAPREAEAPKKKRAHEESESAGSQASSSCKKPA 280

>SAKL0E01408g Chr5 (106229..107152) [924 bp, 307 aa] {ON} similar to
           uniprot|P20052 Saccharomyces cerevisiae YOL001W PHO80
           Cyclin negatively regulates phosphate metabolism
           Pho80p-Pho85p (cyclin-CDK complex) phosphorylates Pho4p
           and Swi5p deletion of PHO80 leads to aminoglycoside
           supersensitivity truncated form of PHO80 affects vacuole
           inheritance
          Length = 307

 Score =  319 bits (817), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 149/208 (71%), Positives = 181/208 (87%)

Query: 37  DFSQCSRTDLVILISRMLSFLTRINDSVPKDDAKELTRFHSRVPPQISVYDYMMRLTRYS 96
           +F +CSRT LV+LISRMLS L ++NDS+ KD   +LTRFHSRVPP ISVY+Y++RL +YS
Sbjct: 52  EFLKCSRTALVVLISRMLSSLIQMNDSMCKDKNLKLTRFHSRVPPGISVYNYLIRLAKYS 111

Query: 97  SLEPAVLVASVYYIDLLSAMYPSFSLNSLTVHRFLLTATTVASKGLCDSFCTNSHYAKVG 156
           SLEPAVL+A+VYYIDLLS++YPSF+LNSLTVHRFLLTATTVASKGL DSFCTN HYAKVG
Sbjct: 112 SLEPAVLIAAVYYIDLLSSVYPSFTLNSLTVHRFLLTATTVASKGLSDSFCTNVHYAKVG 171

Query: 157 GVQCSELHVLESEFLKKVNYRILPRDDNISNCKAEKKAGLFVTPTYSKSCRGPNNGFNVL 216
           GVQCSEL+VLE+EFLK+VNYRI+PRDDNI NCK E + G+F+T   +   +GPNNGFNVL
Sbjct: 172 GVQCSELNVLETEFLKRVNYRIIPRDDNIFNCKEEYQQGVFITFPLADKIKGPNNGFNVL 231

Query: 217 DTYYRKIIEIVGSFDSSPDKTKRAHYVM 244
           DTYY+K+I++VG  +SSPDKT +  YV+
Sbjct: 232 DTYYKKMIQLVGPSNSSPDKTSKVSYVL 259

>TDEL0G04430 Chr7 (804428..805471) [1044 bp, 347 aa] {ON} Anc_6.26
           YOL001W
          Length = 347

 Score =  288 bits (736), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 144/225 (64%), Positives = 181/225 (80%), Gaps = 10/225 (4%)

Query: 38  FSQCSRTDLVILISRMLSFLTRINDSVP---KDDAKELTRFHSRVPPQISVYDYMMRLTR 94
           FS+CSRTDL +LISRML+FL +INDS+     ++A+ LTRFHSRVPP ISVY+Y++RLT+
Sbjct: 39  FSKCSRTDLAVLISRMLTFLIQINDSLALSKPENARGLTRFHSRVPPGISVYNYLIRLTK 98

Query: 95  YSSLEPAVLVASVYYIDLLSAMYPSFSLNSLTVHRFLLTATTVASKGLCDSFCTNSHYAK 154
           YSSLE  VL+ +VYYIDLLS++YP F+L+SLTVHRFLLTATTVASKGLCDSFCTN+HYAK
Sbjct: 99  YSSLEHCVLLTAVYYIDLLSSVYPVFTLSSLTVHRFLLTATTVASKGLCDSFCTNTHYAK 158

Query: 155 VGGVQCSELHVLESEFLKKVNYRILPRDDNISNCKAE---KKAGLFVTPTYSKSCRGP-- 209
           VGGV  SEL++LE EFLK+VNYRILPRDDNI  CK E   +K  L+  P   ++ R    
Sbjct: 159 VGGVHSSELNILECEFLKRVNYRILPRDDNIDWCKLETKLQKFTLYEEPEMGQNSRPQNS 218

Query: 210 --NNGFNVLDTYYRKIIEIVGSFDSSPDKTKRAHYVMINSNTRKD 252
             N+G+NVLD Y+RKI+++VGS+ SSPDK+K  +YV+  S+  KD
Sbjct: 219 LKNSGYNVLDAYFRKIVQLVGSYASSPDKSKVVNYVLRPSSPIKD 263

>KLLA0D01287g Chr4 (112866..113903) [1038 bp, 345 aa] {ON} similar
           to uniprot|P20052 Saccharomyces cerevisiae YOL001W PHO80
           Cyclin negatively regulates phosphate metabolism
           Pho80p-Pho85p (cyclin-CDK complex) phosphorylates Pho4p
           and Swi5p deletion of PHO80 leads to aminoglycoside
           supersensitivity truncated form of PHO80 affects vacuole
           inheritance
          Length = 345

 Score =  287 bits (735), Expect = 6e-96,   Method: Compositional matrix adjust.
 Identities = 135/212 (63%), Positives = 175/212 (82%), Gaps = 2/212 (0%)

Query: 37  DFSQCSRTDLVILISRMLSFLTRINDSV-PKDDAKELTRFHSRVPPQISVYDYMMRLTRY 95
           ++ +CSRT LV++ISRMLSFL +IND+    +   ELTRFHS+  P I+VY Y++RLT+Y
Sbjct: 24  EYLRCSRTHLVVIISRMLSFLIQINDANNAGNQTMELTRFHSKAAPSITVYQYLIRLTKY 83

Query: 96  SSLEPAVLVASVYYIDLLSAMYPSFSLNSLTVHRFLLTATTVASKGLCDSFCTNSHYAKV 155
           SSLE +VL+++VYYIDLLSA+YP F+LNSLTVHRFLLTATT+ASKGLCDSFCTN+HY+KV
Sbjct: 84  SSLEHSVLLSAVYYIDLLSAVYPEFTLNSLTVHRFLLTATTIASKGLCDSFCTNTHYSKV 143

Query: 156 GGVQCSELHVLESEFLKKVNYRILPRDDNISNCKAEKKAGL-FVTPTYSKSCRGPNNGFN 214
           GGVQCSEL++LE+EFL++V YRI+PRDDNI NCK E+K G   + P  + S RGP+NGFN
Sbjct: 144 GGVQCSELNILENEFLERVRYRIIPRDDNIENCKIEQKLGSNMLIPMKNASQRGPDNGFN 203

Query: 215 VLDTYYRKIIEIVGSFDSSPDKTKRAHYVMIN 246
           VL  YYRKI+++VG+  +SPDKT    + M++
Sbjct: 204 VLQNYYRKIVQLVGNPLNSPDKTSTYFFKMVD 235

>ZYRO0C07634g Chr3 (580486..581634) [1149 bp, 382 aa] {ON} similar
           to uniprot|P20052 Saccharomyces cerevisiae YOL001W PHO80
           Cyclin negatively regulates phosphate metabolism
           Pho80p-Pho85p (cyclin-CDK complex) phosphorylates Pho4p
           and Swi5p deletion of PHO80 leads to aminoglycoside
           supersensitivity truncated form of PHO80 affects vacuole
           inheritance
          Length = 382

 Score =  280 bits (715), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 139/223 (62%), Positives = 172/223 (77%), Gaps = 13/223 (5%)

Query: 38  FSQCSRTDLVILISRMLSFLTRINDSVPK---DDAKELTRFHSRVPPQISVYDYMMRLTR 94
           FS+CSRTDLVILISRML+FL ++NDS      D    LT+FHS+VPP ISVY+Y+MRLT+
Sbjct: 51  FSECSRTDLVILISRMLTFLIQMNDSSSTSALDSVTNLTKFHSKVPPGISVYNYLMRLTK 110

Query: 95  YSSLEPAVLVASVYYIDLLSAMYPSFSLNSLTVHRFLLTATTVASKGLCDSFCTNSHYAK 154
           YSSL+  VL+A+VYYIDL+S++YP+F+LNSLTVHRFLLTATTVASKGLCDSFCTN+HYAK
Sbjct: 111 YSSLDHCVLMAAVYYIDLVSSVYPTFTLNSLTVHRFLLTATTVASKGLCDSFCTNTHYAK 170

Query: 155 VGGVQCSELHVLESEFLKKVNYRILPRDDNISNCKAEKKAGLFV---------TPTYSKS 205
           VGGV CSEL+VLE E L+++NYRI+PRDDNI+ C  E +   FV         TP  S  
Sbjct: 171 VGGVHCSELNVLECELLRRINYRIIPRDDNIAWCNLESQHRHFVLDTQDGDDWTPILSNL 230

Query: 206 CRGPNN-GFNVLDTYYRKIIEIVGSFDSSPDKTKRAHYVMINS 247
               NN G+NVLDTYY KI+++VGS  S+ DK+K  +Y   N+
Sbjct: 231 SGNRNNSGYNVLDTYYNKIVQLVGSLKSTQDKSKLVNYTFANT 273

>KNAG0I01750 Chr9 (344381..345355) [975 bp, 324 aa] {ON} Anc_6.26
           YOL001W
          Length = 324

 Score =  277 bits (709), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 141/242 (58%), Positives = 176/242 (72%), Gaps = 36/242 (14%)

Query: 37  DFSQCSRTDLVILISRMLSFLTRINDSVPK------DDAK---------------ELTRF 75
           +FS CSR DL+ LISRML FL +IND   +      D  K               +LTRF
Sbjct: 29  NFSLCSRYDLIALISRMLVFLIQINDDAAQKKTGLADSGKGEATDAADTDGSSETKLTRF 88

Query: 76  HSRVPPQISVYDYMMRLTRYSSLEPAVLVASVYYIDLLSAMYPSFSLNSLTVHRFLLTAT 135
           HS VPP ISVY+Y++RLT+YS+LEP+VL+ S+YYIDLLS++YP+F++NSLTVHRFLLTAT
Sbjct: 89  HSSVPPPISVYNYLIRLTKYSALEPSVLLTSIYYIDLLSSVYPAFTINSLTVHRFLLTAT 148

Query: 136 TVASKGLCDSFCTNSHYAKVGGVQCSELHVLESEFLKKVNYRILPRDDNISNCKAEKKAG 195
           TVASKGLCDSFCTN+HYAKVGGVQ SEL++LESEFLKK+NYR+LPRDDNI+ CK E +A 
Sbjct: 149 TVASKGLCDSFCTNAHYAKVGGVQGSELNILESEFLKKINYRVLPRDDNITWCKYEHRAH 208

Query: 196 LFVT-----------PTYSKSCRGPNNGFNVLDTYYRKIIEIVGSFDSSPDKTKRAHYVM 244
            F             PT+++     N+G+NVL  YY KII++VG F SS DK+K+A+YV 
Sbjct: 209 EFTIYNKAALTNVSKPTHTQR----NSGYNVLQMYYHKIIQLVGKFSSSLDKSKKANYVF 264

Query: 245 IN 246
            N
Sbjct: 265 EN 266

>Kpol_1037.30 s1037 complement(72024..73127) [1104 bp, 367 aa] {ON}
           complement(72024..73127) [1104 nt, 368 aa]
          Length = 367

 Score =  279 bits (713), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 136/236 (57%), Positives = 174/236 (73%), Gaps = 20/236 (8%)

Query: 38  FSQCSRTDLVILISRMLSFLTRINDSVPKD-----------DAKELTRFHSRVPPQISVY 86
           F  CSR+DLV LI+RMLSFL  +ND+ P +               LTRFHSRVPP ISVY
Sbjct: 52  FIDCSRSDLVALIARMLSFLIEMNDNDPANTNYLNEEPNNRSVMNLTRFHSRVPPNISVY 111

Query: 87  DYMMRLTRYSSLEPAVLVASVYYIDLLSAMYPSFSLNSLTVHRFLLTATTVASKGLCDSF 146
           +Y++RLT+YSSLE  VL+++VYYIDLLS++YP F +NSLTVHRFLLTATT+ASKGLCDSF
Sbjct: 112 NYLIRLTKYSSLEHCVLLSTVYYIDLLSSVYPEFKINSLTVHRFLLTATTIASKGLCDSF 171

Query: 147 CTNSHYAKVGGVQCSELHVLESEFLKKVNYRILPRDDNISNCKAEKKAGLFVTPTYSKSC 206
           CTNSHY+KVGGV CSEL++LE+EFL++VNYRI+PRDDNI  CK E +   F       S 
Sbjct: 172 CTNSHYSKVGGVHCSELNILETEFLRRVNYRIIPRDDNIKLCKIEHQQNKFTMDFSDLSM 231

Query: 207 RG-------PNNGFNVLDTYYRKIIEIVGSFDSSPDKTKRAHYVMI--NSNTRKDV 253
            G        N+GFN+LD YY KI+++VGSF +S DK+++A+Y ++   +N  K+V
Sbjct: 232 VGMTVQSNHQNSGFNILDIYYHKIVQLVGSFSASSDKSRKANYTLLLSGNNMEKEV 287

>CAGL0E02541g Chr5 (244814..245842) [1029 bp, 342 aa] {ON} similar
           to uniprot|P20052 Saccharomyces cerevisiae YOL001w PHO80
           cyclin
          Length = 342

 Score =  274 bits (701), Expect = 7e-91,   Method: Compositional matrix adjust.
 Identities = 131/218 (60%), Positives = 170/218 (77%), Gaps = 12/218 (5%)

Query: 37  DFSQCSRTDLVILISRMLSFLTRINDSVPKDDAKE--LTRFHSRVPPQISVYDYMMRLTR 94
           DF +C + DLVILI+RML F+ +INDS  K++ ++  LTRFHS++ P ISV++Y  RLT+
Sbjct: 22  DFLKCPKGDLVILIARMLQFIIQINDSNIKENERKYGLTRFHSKIAPNISVFNYFTRLTK 81

Query: 95  YSSLEPAVLVASVYYIDLLSAMYPSFSLNSLTVHRFLLTATTVASKGLCDSFCTNSHYAK 154
           YS LE +VL+++VYYIDLLS +YP+F+LNSLT HRFLLTATT+ASKGLCDSFCTN+HY+K
Sbjct: 82  YSLLEHSVLLSAVYYIDLLSNVYPAFNLNSLTAHRFLLTATTIASKGLCDSFCTNTHYSK 141

Query: 155 VGGVQCSELHVLESEFLKKVNYRILPRDDNISNCKAEKKAGLFVTPTYSKSCRGP----- 209
           VGGVQC+EL+VLE+EFL+KVNYRI+PRD+NI+ CK E +   F+ P   +S   P     
Sbjct: 142 VGGVQCNELNVLENEFLRKVNYRIIPRDNNITFCKMEVQKNFFILPESIESDLAPSLRQG 201

Query: 210 -----NNGFNVLDTYYRKIIEIVGSFDSSPDKTKRAHY 242
                N G+NVL  YY KIIE+VG + SSPDKTK+ +Y
Sbjct: 202 YSSISNAGYNVLTRYYYKIIEVVGKYSSSPDKTKKVNY 239

>Ecym_3029 Chr3 (56667..57722) [1056 bp, 351 aa] {ON} similar to
           Ashbya gossypii ACR001C
          Length = 351

 Score =  272 bits (695), Expect = 7e-90,   Method: Compositional matrix adjust.
 Identities = 129/211 (61%), Positives = 165/211 (78%), Gaps = 4/211 (1%)

Query: 38  FSQCSRTDLVILISRMLSFLTRINDSVPKDDAKELTRFHSRVPPQISVYDYMMRLTRYSS 97
           F  CSRT LV+LISRMLS L R+ND+  + +  +LTRFHSRVPP ISVYDY++RLT+YSS
Sbjct: 29  FLDCSRTHLVVLISRMLSSLIRLNDAYTESNTLQLTRFHSRVPPSISVYDYLIRLTKYSS 88

Query: 98  LEPAVLVASVYYIDLLSAMYPSFSLNSLTVHRFLLTATTVASKGLCDSFCTNSHYAKVGG 157
           LE  VL+ASVYYIDLLS+++P F L+SLTVHRFLLTATTVASKGLCDSFCTN+HYAKVGG
Sbjct: 89  LEHCVLLASVYYIDLLSSVFPEFRLDSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGG 148

Query: 158 VQCSELHVLESEFLKKVNYRILPRDDNISNCKAEKKAGLF----VTPTYSKSCRGPNNGF 213
           VQC+EL+VLE+EFL +VNYRILPRD+NI  C  E + G F    +     +  +   N F
Sbjct: 149 VQCNELNVLENEFLTRVNYRILPRDENIKRCSREHQEGTFSFANIPADAEQDQKSEENRF 208

Query: 214 NVLDTYYRKIIEIVGSFDSSPDKTKRAHYVM 244
           +VL+ YY ++I ++G+ D+SPDK+   ++ +
Sbjct: 209 DVLENYYHRMIHLIGNLDASPDKSYDLNFTL 239

>Skud_15.161 Chr15 (284851..285732) [882 bp, 293 aa] {ON} YOL001W
           (REAL)
          Length = 293

 Score =  266 bits (680), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 134/241 (55%), Positives = 178/241 (73%), Gaps = 17/241 (7%)

Query: 37  DFSQCSRTDLVILISRMLSFLTRINDSVPK---DDAKELTRFHSRVPPQISVYDYMMRLT 93
           +F +CSRTDLV+LISRML  L  IN++      DD   LTR+HS+VPP IS+++Y +RLT
Sbjct: 26  EFYKCSRTDLVVLISRMLVSLIAINENSTTKKPDDQITLTRYHSKVPPNISIFNYFIRLT 85

Query: 94  RYSSLEPAVLVASVYYIDLLSAMYPSFSLNSLTVHRFLLTATTVASKGLCDSFCTNSHYA 153
           ++SSLE  VL+ S+YYIDLL   YP F+LNSLT HRFLLTATTVA+KGLCDSF TN+HYA
Sbjct: 86  KFSSLEHCVLMTSLYYIDLLQTAYPDFTLNSLTAHRFLLTATTVAAKGLCDSFSTNAHYA 145

Query: 154 KVGGVQCSELHVLESEFLKKVNYRILPRDDNISNCKAEKKAGLFVT----------PTYS 203
           KVGGV+C EL++LE++FLK+VNYRI+PRD NI+ C  E+K   FV            +YS
Sbjct: 146 KVGGVRCHELNILENDFLKRVNYRIIPRDHNITLCSIEQKQKKFVADKNAPGSFDLDSYS 205

Query: 204 KSCRGPNNGFNVLDTYYRKIIEIVGSFDSSPDKTKRAHYVM---INSNTRKDVELLQKKR 260
              R P +G+NVLD YYR+I+++VGSF++SPDK+K+  YV+   I+ +T    ++ Q+K 
Sbjct: 206 YVSR-PKSGYNVLDKYYRRIVQLVGSFNASPDKSKKVDYVLPSNIDKDTESGPQIQQQKG 264

Query: 261 T 261
           T
Sbjct: 265 T 265

>YOL001W Chr15 (325249..326130) [882 bp, 293 aa] {ON}  PHO80Cyclin,
           interacts with cyclin-dependent kinase Pho85p; regulates
           the response to nutrient levels and environmental
           conditions, including the response to phosphate
           limitation and stress-dependent calcium signaling
          Length = 293

 Score =  265 bits (677), Expect = 7e-88,   Method: Compositional matrix adjust.
 Identities = 128/221 (57%), Positives = 170/221 (76%), Gaps = 14/221 (6%)

Query: 37  DFSQCSRTDLVILISRMLSFLTRINDSVP---KDDAKELTRFHSRVPPQISVYDYMMRLT 93
           DF++CSRTDLV+LISRML  L  IN++      DD   LTR+HS++PP IS+++Y +RLT
Sbjct: 26  DFNKCSRTDLVVLISRMLVSLIAINENSATKKSDDQITLTRYHSKIPPNISIFNYFIRLT 85

Query: 94  RYSSLEPAVLVASVYYIDLLSAMYPSFSLNSLTVHRFLLTATTVASKGLCDSFCTNSHYA 153
           ++SSLE  VL+ S+YYIDLL  +YP F+LNSLT HRFLLTATTVA+KGLCDSF TN+HYA
Sbjct: 86  KFSSLEHCVLMTSLYYIDLLQTVYPDFTLNSLTAHRFLLTATTVATKGLCDSFSTNAHYA 145

Query: 154 KVGGVQCSELHVLESEFLKKVNYRILPRDDNISNCKAEKKAGLFVT----------PTYS 203
           KVGGV+C EL++LE++FLK+VNYRI+PRD NI+ C  E+K   FV            +YS
Sbjct: 146 KVGGVRCHELNILENDFLKRVNYRIIPRDHNITLCSIEQKQKKFVIDKNALGSLDLDSYS 205

Query: 204 KSCRGPNNGFNVLDTYYRKIIEIVGSFDSSPDKTKRAHYVM 244
              R P +G+NVLD YYR+I+++VGSF++SPDK+++  YV+
Sbjct: 206 YVNR-PKSGYNVLDKYYRRIVQLVGSFNASPDKSRKVDYVL 245

>Smik_15.169 Chr15 (292553..293428) [876 bp, 291 aa] {ON} YOL001W
           (REAL)
          Length = 291

 Score =  263 bits (672), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 134/231 (58%), Positives = 176/231 (76%), Gaps = 15/231 (6%)

Query: 37  DFSQCSRTDLVILISRMLSFLTRIND-SVPK--DDAKELTRFHSRVPPQISVYDYMMRLT 93
           DF++CSRTDLV+LISRML  L  IN+ SV K  ++   LTR+HS++PP IS+++Y +RLT
Sbjct: 26  DFNKCSRTDLVVLISRMLVSLIAINENSVSKIPENQITLTRYHSKIPPNISIFNYFIRLT 85

Query: 94  RYSSLEPAVLVASVYYIDLLSAMYPSFSLNSLTVHRFLLTATTVASKGLCDSFCTNSHYA 153
           ++SSLE  VL+ S+YYIDLL   YP F+LNSLT HRFLLTATT+A+KGLCDSF TN+HYA
Sbjct: 86  KFSSLEHCVLMTSLYYIDLLQTAYPDFTLNSLTAHRFLLTATTIATKGLCDSFSTNAHYA 145

Query: 154 KVGGVQCSELHVLESEFLKKVNYRILPRDDNISNCKAEKKAGLFVT----------PTYS 203
           KVGGV+C EL++LE++FLK+VNYRI+PRD NI  C  E+K   FV            +YS
Sbjct: 146 KVGGVRCHELNILENDFLKRVNYRIIPRDHNIMLCSIEQKQKKFVIDKNALGSFDLDSYS 205

Query: 204 KSCRGPNNGFNVLDTYYRKIIEIVGSFDSSPDKTKRAHYVMINSNTRKDVE 254
            + R P +G+NVLD YYR+I+++VGSF++SPDK+K+  YV+  SN  KD E
Sbjct: 206 YTDR-PKSGYNVLDKYYRRIVQLVGSFNASPDKSKKIDYVL-PSNIDKDNE 254

>ACR001C Chr3 complement(357962..359002) [1041 bp, 346 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL001W
           (PHO80)
          Length = 346

 Score =  265 bits (676), Expect = 5e-87,   Method: Compositional matrix adjust.
 Identities = 136/220 (61%), Positives = 168/220 (76%), Gaps = 11/220 (5%)

Query: 38  FSQCSRTDLVILISRMLSFLTRINDSVP-KDDAKELTRFHSRVPPQISVYDYMMRLTRYS 96
           F  CSRT LV+LISRML+ L  +ND+   K    +LTRFHSRVPP ISVY+Y++RLT+YS
Sbjct: 22  FLSCSRTYLVVLISRMLTSLIGMNDAQGDKSKPIKLTRFHSRVPPAISVYNYLIRLTKYS 81

Query: 97  SLEPAVLVASVYYIDLLSAMYPSFSLNSLTVHRFLLTATTVASKGLCDSFCTNSHYAKVG 156
           SLE  VL+ASVYYIDLL+ +YP F L+SLTVHRFLLTATTVASKGLCDSFCTN+HYAKVG
Sbjct: 82  SLEHCVLLASVYYIDLLTNVYPEFRLDSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVG 141

Query: 157 GVQCSELHVLESEFLKKVNYRILPRDDNISNCKAEKKAGLFVTPTYS-----KSC--RGP 209
           GVQCSEL+VLE+EFL++VNYRILPRDDNI  C  E++  +F   +YS     K C  +  
Sbjct: 142 GVQCSELNVLENEFLERVNYRILPRDDNIRRCSLERQERIF---SYSNIPMDKDCALQDR 198

Query: 210 NNGFNVLDTYYRKIIEIVGSFDSSPDKTKRAHYVMINSNT 249
           NNGF VL+ YY ++I ++G F+ SPDK+    + +  S T
Sbjct: 199 NNGFGVLEKYYHRMIHLIGDFNMSPDKSCNLSFTLAESPT 238

>Suva_15.174 Chr15 (299761..300648) [888 bp, 295 aa] {ON} YOL001W
           (REAL)
          Length = 295

 Score =  262 bits (669), Expect = 9e-87,   Method: Compositional matrix adjust.
 Identities = 126/221 (57%), Positives = 168/221 (76%), Gaps = 14/221 (6%)

Query: 37  DFSQCSRTDLVILISRMLSFLTRINDSVPK---DDAKELTRFHSRVPPQISVYDYMMRLT 93
           +F +CSRTDLV+LISRML  L  IN++      DD   LTR+HS++PP IS+++Y +RLT
Sbjct: 26  EFKKCSRTDLVVLISRMLVSLIAINENSSTKRPDDQITLTRYHSKIPPNISIFNYFIRLT 85

Query: 94  RYSSLEPAVLVASVYYIDLLSAMYPSFSLNSLTVHRFLLTATTVASKGLCDSFCTNSHYA 153
           ++SSLE  VL+ S+YYIDLL   YP F+LNSLT HRFLLTATTVA+KGLCDSF TN+HY+
Sbjct: 86  KFSSLEHCVLITSLYYIDLLQTAYPDFTLNSLTAHRFLLTATTVAAKGLCDSFSTNAHYS 145

Query: 154 KVGGVQCSELHVLESEFLKKVNYRILPRDDNISNCKAEKKAGLFVTP----------TYS 203
           KVGGV+C EL++LE++FLK+VNYRILPRD NI+ C  E+K   FV            +YS
Sbjct: 146 KVGGVRCHELNILENDFLKRVNYRILPRDHNITLCSIEQKQKTFVIDKNALGSVDLGSYS 205

Query: 204 KSCRGPNNGFNVLDTYYRKIIEIVGSFDSSPDKTKRAHYVM 244
            + R   +G+NVLD YY++I+++VGSFD+SPDK++R +Y +
Sbjct: 206 YANRS-KSGYNVLDKYYQRIVQLVGSFDASPDKSRRVNYAL 245

>TPHA0J00380 Chr10 complement(84485..85555) [1071 bp, 356 aa] {ON}
           Anc_6.26 YOL001W
          Length = 356

 Score =  263 bits (672), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 129/234 (55%), Positives = 171/234 (73%), Gaps = 27/234 (11%)

Query: 38  FSQCSRTDLVILISRMLSFLTRINDS-----------VPKD---------DAKELTRFHS 77
           F +CSR+DLV+LISRML+FL +IND            +P           +   LTRFHS
Sbjct: 41  FLKCSRSDLVVLISRMLTFLIQINDRNEILTENNSAMIPTQTDVNNKNNNNMINLTRFHS 100

Query: 78  RVPPQISVYDYMMRLTRYSSLEPAVLVASVYYIDLLSAMYPSFSLNSLTVHRFLLTATTV 137
           RVPP ISV +Y++RLT+Y+SLE +VL++S+YYIDLLS++YP F +NSLTVHRFLL ATTV
Sbjct: 101 RVPPNISVNNYLIRLTKYASLEHSVLLSSLYYIDLLSSVYPEFKINSLTVHRFLLAATTV 160

Query: 138 ASKGLCDSFCTNSHYAKVGGVQCSELHVLESEFLKKVNYRILPRDDNISNCKAEKKAGLF 197
           ASKGL DSFCTNSHYAKVGGV+CSEL++LE++FL+++NYRI+PRDDNI  CK EKK+  F
Sbjct: 161 ASKGLSDSFCTNSHYAKVGGVRCSELNILETDFLRRINYRIIPRDDNIKLCKLEKKSSQF 220

Query: 198 -------VTPTYSKSCRGPNNGFNVLDTYYRKIIEIVGSFDSSPDKTKRAHYVM 244
                  +          PN+G+NVL+ YYRK+++IVG   +S DK+K+ +Y++
Sbjct: 221 TLDLGDLLAANIQPELTHPNSGYNVLNIYYRKMVQIVGLLKNSTDKSKKVNYII 274

>TBLA0A07160 Chr1 (1782941..1783747) [807 bp, 268 aa] {ON} Anc_6.26
           YOL001W
          Length = 268

 Score =  244 bits (623), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 122/218 (55%), Positives = 160/218 (73%), Gaps = 10/218 (4%)

Query: 37  DFSQCSRTDLVILISRMLSFLTRINDS------VPKDDAKEL--TRFHSRVPPQISVYDY 88
           +F +CS+ DL+ LISRMLSF   INDS      V  +    L  TRFHS+VPP IS++DY
Sbjct: 17  NFMKCSKIDLITLISRMLSFFIDINDSHNIHGNVTNNRLSPLFLTRFHSKVPPNISIFDY 76

Query: 89  MMRLTRYSSLEPAVLVASVYYIDLLSAMYPSFSLNSLTVHRFLLTATTVASKGLCDSFCT 148
           ++RLT+YSSLE +VL+ SVYYIDLLS +YP FSLNSLTVHR+LLTATT+ASKGLCDSFCT
Sbjct: 77  LIRLTKYSSLESSVLITSVYYIDLLSNVYPEFSLNSLTVHRYLLTATTIASKGLCDSFCT 136

Query: 149 NSHYAKVGGVQCSELHVLESEFLKKVNYRILPRDDNISNCKAEKKAGLF--VTPTYSKSC 206
           NSHYAKVGG++C+EL+VLE+EFL++V YR++PRD+ I  CK E K      +        
Sbjct: 137 NSHYAKVGGIRCNELNVLETEFLERVRYRVIPRDNTIKLCKLEYKYSPIEDINNDIHIPD 196

Query: 207 RGPNNGFNVLDTYYRKIIEIVGSFDSSPDKTKRAHYVM 244
              N+G+NVL TYY K++++VG+  SS +  +  +Y+ 
Sbjct: 197 ELQNSGYNVLSTYYNKMVQLVGNCKSSKNSFRNVNYIF 234

>NCAS0D02150 Chr4 (400750..401859) [1110 bp, 369 aa] {ON} Anc_6.26
          Length = 369

 Score =  207 bits (528), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 110/248 (44%), Positives = 153/248 (61%), Gaps = 17/248 (6%)

Query: 15  GSPKSPGERXXXXXXXXXXXXXDFSQCSRTDLVILISRMLSFLTRIND------SVPKDD 68
           GS +S  E              ++ +CSR+DLV+L+SRML  L + ND      +   D 
Sbjct: 12  GSKESTAESPMTSKIQVIEVPYEYIKCSRSDLVVLVSRMLVLLIQSNDMTSNTSNSSSDS 71

Query: 69  AKELTRFHSRVPPQISVYDYMMRLTRYSSLEPAVLVASVYYIDLLSAMYPSFSLNSLTVH 128
              LTRFHSR+PP IS+++Y+ RLT+Y  +E  VL++ +YYIDL +A YP+F+ NSLT H
Sbjct: 72  NMHLTRFHSRIPPNISIFNYLFRLTKYCYVEHCVLLSIIYYIDLFTAAYPTFTFNSLTAH 131

Query: 129 RFLLTATTVASKGLCDSFCTNSHYAKVGGVQCSELHVLESEFLKKVNYRILPRDDNISNC 188
           RFLLTA TVA KGLCDSFCT + YAK+GGVQ  EL++LE+ FL+ VNYRI+PR  N++  
Sbjct: 132 RFLLTAITVAGKGLCDSFCTTAQYAKIGGVQNEELNILETYFLRIVNYRIIPRSSNVTLI 191

Query: 189 KAEKKAGLFVTP---------TYSKSCRGPNNGFNVLDTYYRKIIEIVGSFDSSPDKTKR 239
           K E+   +F            ++      P+NG++VL+ YY+ I+ I G+  SS    KR
Sbjct: 192 KLERGNQVFTLDHLDMKDPKLSFLSYDYLPDNGYSVLNIYYQNIVRITGA--SSDLLFKR 249

Query: 240 AHYVMINS 247
             Y   N+
Sbjct: 250 VIYTFPNN 257

>NDAI0C02640 Chr3 complement(611899..613182) [1284 bp, 427 aa] {ON}
           Anc_6.26 YOL001W
          Length = 427

 Score =  203 bits (516), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 108/221 (48%), Positives = 143/221 (64%), Gaps = 14/221 (6%)

Query: 38  FSQCSRTDLVILISRMLSFLTRINDSVPKDD---AKELTRFHSRVPPQISVYDYMMRLTR 94
           F +C R DLV+LISRML  L +IND+   D+   +   TRFHSRV P IS+ +Y++RLT+
Sbjct: 63  FMECPRRDLVVLISRMLVTLIKINDTKANDNNLPSNYATRFHSRVIPGISIGNYLLRLTK 122

Query: 95  YSSLEPAVLVASVYYIDLLSAMYPSFSLNSLTVHRFLLTATTVASKGLCDSFCTNSHYAK 154
           +  L+P+VL+ +VYYIDLLSA++PSFS NSLT HRF+LTA  VASK LCDS  + +HYAK
Sbjct: 123 FCILQPSVLLTAVYYIDLLSAVFPSFSFNSLTAHRFILTAVIVASKSLCDSCLSITHYAK 182

Query: 155 VGGVQCSELHVLESEFLKKVNYRILPRDDNISNCKAEKKAGLFVTPTYSKSCRG------ 208
            GGVQ +EL +LE+ FLK + YR+LPRD N   C  E     F          G      
Sbjct: 183 YGGVQPNELLMLEAYFLKLIKYRVLPRDKNTDLCSMEYHFDTFALNDGQIKESGTSFSYR 242

Query: 209 --PNNGFNVLDTYYRKIIEIVG---SFDSSPDKTKRAHYVM 244
             P++G+NVL  YYR+II+I+G       SPD     +++M
Sbjct: 243 QLPHSGYNVLHMYYRRIIDIIGVQRPISPSPDAVTVDYFLM 283

>Skud_9.119 Chr9 (227792..228649) [858 bp, 285 aa] {ON} YIL050W
           (REAL)
          Length = 285

 Score = 80.9 bits (198), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 51/160 (31%), Positives = 83/160 (51%), Gaps = 22/160 (13%)

Query: 42  SRTDLVILISRMLSFLTRIND-------SVPKDDAKELTR----FHSRVPPQISVYDYMM 90
           S  +L+ +IS +L+ +   ND        V KD+  EL      F+ +  P+ISV  Y+ 
Sbjct: 106 STDELIQMISALLNRIVTANDEYAEISQQVSKDNQDELLAPILAFYGKSVPEISVVQYLE 165

Query: 91  RLTRYSSLEPAVLVASVYYIDLLSAMYPSFS-----------LNSLTVHRFLLTATTVAS 139
           R+ +Y      + ++ + Y D +S  Y  FS           ++S  +HR L+T  T+ +
Sbjct: 166 RIQKYCPTTNDIFLSLLVYFDRISKKYGHFSDRNAHTKQMFGMDSGNIHRLLITGITICT 225

Query: 140 KGLCDSFCTNSHYAKVGGVQCSELHVLESEFLKKVNYRIL 179
           K L D F +NS YAKVGG+   EL+ LE +FL   ++++L
Sbjct: 226 KFLSDFFYSNSRYAKVGGISLQELNHLELQFLVLCDFKLL 265

>Smik_9.140 Chr9 (233007..233864) [858 bp, 285 aa] {ON} YIL050W
           (REAL)
          Length = 285

 Score = 78.2 bits (191), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 49/157 (31%), Positives = 84/157 (53%), Gaps = 22/157 (14%)

Query: 45  DLVILISRMLSFLTRINDS-------VPKD-DAKELT---RFHSRVPPQISVYDYMMRLT 93
           +L+I++S +L+ +  +ND+       VP D + K LT    F+ +  P+I V  Y+ R+ 
Sbjct: 109 ELIIMVSALLNKIITVNDATTDISQQVPGDTEEKFLTPILAFYGKNVPEIDVVQYLERIQ 168

Query: 94  RYSSLEPAVLVASVYYIDLLSAMYPS-----------FSLNSLTVHRFLLTATTVASKGL 142
           +Y      + ++ + Y D +S  Y             F ++S  +HR L+T  T+ +K L
Sbjct: 169 KYCPTTNDIFLSLLVYFDRISKNYGHSPEENGHSKQLFVMDSGNIHRLLITGITICTKFL 228

Query: 143 CDSFCTNSHYAKVGGVQCSELHVLESEFLKKVNYRIL 179
            D F +NS YAKVGG+   EL+ LE +FL   ++++L
Sbjct: 229 SDFFYSNSRYAKVGGISLQELNHLELQFLVLCDFKLL 265

>Suva_9.149 Chr9 (247583..248443) [861 bp, 286 aa] {ON} YIL050W
           (REAL)
          Length = 286

 Score = 77.4 bits (189), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 50/175 (28%), Positives = 90/175 (51%), Gaps = 27/175 (15%)

Query: 45  DLVILISRMLSFLTRIND-------SVPKDDAKELTR----FHSRVPPQISVYDYMMRLT 93
           +L++++S +L+ + + ND        V +D   EL      F+ +  P+I+V  Y+ R+ 
Sbjct: 110 ELILMVSALLNKIVKANDETTDPSQQVVEDGEDELLAPVLAFYGKNVPEIAVVQYLERIQ 169

Query: 94  RYSSLEPAVLVASVYYIDLLSAMYPS-----------FSLNSLTVHRFLLTATTVASKGL 142
           +Y      + ++ + Y D +S  Y S           F ++S  +HR L+T  T+ +K +
Sbjct: 170 KYCPTTNDIFLSLLVYFDRISKNYGSSPDRNGHVRQIFVMDSGNIHRLLITGITICTKFM 229

Query: 143 CDSFCTNSHYAKVGGVQCSELHVLESEFLKKVNYRILPRDDNISNCKAEKKAGLF 197
            D F +NS YAKVGG+   EL+ LE +FL   ++++L     +S  + +K A L 
Sbjct: 230 SDFFYSNSRYAKVGGISLQELNHLELQFLVLCDFKLL-----VSREEMQKYADLL 279

>YIL050W Chr9 (258913..259770) [858 bp, 285 aa] {ON}  PCL7Pho85p
           cyclin of the Pho80p subfamily, forms a functional
           kinase complex with Pho85p which phosphorylates Mmr1p
           and is regulated by Pho81p; involved in glycogen
           metabolism, expression is cell-cycle regulated
          Length = 285

 Score = 73.6 bits (179), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 46/157 (29%), Positives = 80/157 (50%), Gaps = 22/157 (14%)

Query: 45  DLVILISRMLSFLTRIND-------SVPKDDAKELTR----FHSRVPPQISVYDYMMRLT 93
           +L+++IS +L+ +   ND        V  +   EL      F+ +  P+I+V  Y+ R+ 
Sbjct: 109 ELILMISALLNRIITANDETTDVSQQVSDETEDELLTPILAFYGKNVPEIAVVQYLERIQ 168

Query: 94  RYSSLEPAVLVASVYYIDLLSAMYPS-----------FSLNSLTVHRFLLTATTVASKGL 142
           +Y      + ++ + Y D +S  Y             F ++S  +HR L+T  T+ +K L
Sbjct: 169 KYCPTTNDIFLSLLVYFDRISKNYGHSSERNGCAKQLFVMDSGNIHRLLITGVTICTKFL 228

Query: 143 CDSFCTNSHYAKVGGVQCSELHVLESEFLKKVNYRIL 179
            D F +NS YAKVGG+   EL+ LE +FL   ++++L
Sbjct: 229 SDFFYSNSRYAKVGGISLQELNHLELQFLILCDFKLL 265

>KNAG0D01630 Chr4 (274260..275576) [1317 bp, 438 aa] {ON} Anc_7.240
           YIL050W
          Length = 438

 Score = 68.9 bits (167), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 39/164 (23%), Positives = 79/164 (48%), Gaps = 30/164 (18%)

Query: 46  LVILISRMLSFLTRINDSVP----------KDDAKELTRFHSRVPPQISVYDYMMRLTRY 95
           L  L+ +++S    +N+  P           D    +T F+ +  PQI++  Y++R+ +Y
Sbjct: 247 LTALLDKIVSSNDELNNGGPPAGCEDKQQDHDTINAITSFYGKHVPQITIEQYLLRIQKY 306

Query: 96  SSLEPAVLVASVYYIDLLS--------------------AMYPSFSLNSLTVHRFLLTAT 135
                 + ++ + + D +S                    A + +F ++S  +HR L+   
Sbjct: 307 CPTTNDIFLSLLVFFDRISKKFNIHQQKQQSNVSDSDEQAPHQTFVMDSYNIHRLLIAGV 366

Query: 136 TVASKGLCDSFCTNSHYAKVGGVQCSELHVLESEFLKKVNYRIL 179
           TV++K   D F +N+ YA+VGG+   E++ LE +FL   ++++L
Sbjct: 367 TVSTKFFSDFFYSNARYARVGGISLQEMNHLELQFLILCDFKLL 410

>CAGL0M12342g Chr13 complement(1234192..1235565) [1374 bp, 457 aa]
           {ON} weakly similar to uniprot|P40038 Saccharomyces
           cerevisiae YER059w PCL6 cyclin like protein interacting
           with PHO85P
          Length = 457

 Score = 68.2 bits (165), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 43/143 (30%), Positives = 70/143 (48%), Gaps = 19/143 (13%)

Query: 70  KELTRFHSRVPPQISVYDYMMRLTRYSSLEPAVLVASVYYIDLLSAMYPS---------- 119
           K +  F  +  PQI++Y Y  R+ +Y      V ++ + Y D +S    S          
Sbjct: 300 KSILSFKGKHVPQITLYQYFQRIQKYCPTTNDVFLSLLVYFDRISKKCNSSDSESADTSP 359

Query: 120 ----FSLNSLTVHRFLLTATTVASKGLCDSFCTNSHYAKVGGVQCSELHVLESEFLKKVN 175
               F ++S  +HR ++   TV +K   D F +NS YA+VGG+  SEL+ LE +FL   +
Sbjct: 360 ADQLFVMDSYNIHRLVIAGVTVCTKFFSDFFYSNSRYARVGGISLSELNHLELQFLVLCD 419

Query: 176 YRILPRDDNISNCKAEKKAGLFV 198
           + +L     IS  K ++ A L +
Sbjct: 420 FELL-----ISVDKLQRYANLLL 437

>KLTH0A04268g Chr1 (358035..359777) [1743 bp, 580 aa] {ON} similar
           to uniprot|P40186 Saccharomyces cerevisiae YIL050W PCL7
           Pho85p cyclin of the Pho80p subfamily forms a functional
           kinase complex with Pho85p which phosphorylates Mmr1p
           and is regulated by Pho81p involved in glycogen
           metabolism expression is cell-cycle regulated
          Length = 580

 Score = 68.2 bits (165), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 36/118 (30%), Positives = 65/118 (55%), Gaps = 5/118 (4%)

Query: 67  DDAKELTRFHSRVPPQISVYDYMMRLTRYSSLEPAVLVASVYYIDLLS-----AMYPSFS 121
           D A E+  F  +  P I+++ Y  R+ +Y      V ++ + Y D ++     A    F 
Sbjct: 427 DLAAEILSFRGKHVPAITLHQYFQRIQKYCPTTNDVFLSLLVYFDRIAKTCNHAKEQLFV 486

Query: 122 LNSLTVHRFLLTATTVASKGLCDSFCTNSHYAKVGGVQCSELHVLESEFLKKVNYRIL 179
           ++S  +HR +++A TV++K   D F +NS YA+VGG+   EL+ LE +FL   ++ ++
Sbjct: 487 MDSYNIHRLIISAVTVSTKFFSDFFYSNSRYARVGGISLKELNHLELQFLVLCDFELI 544

>ADL075W Chr4 (550941..551564) [624 bp, 207 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL050W (PCL7) and
           YER059W (PCL6)
          Length = 207

 Score = 65.9 bits (159), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 43/149 (28%), Positives = 77/149 (51%), Gaps = 15/149 (10%)

Query: 37  DFSQCSRTDLVILISRMLSFLTRINDSV-PKDDAKE---------LTRFHSRVPPQISVY 86
           D +Q     L+ +++ +L  + + ND + P D  K          +  F  +  P I++ 
Sbjct: 17  DIAQFPTDKLLEMLTGLLYKIIKSNDRLKPFDQEKHDINNKYVAHVLSFRGKHIPTITLG 76

Query: 87  DYMMRLTRYSSLEPAVLVASVYYIDLLS----AMYPS-FSLNSLTVHRFLLTATTVASKG 141
           DY  R+ +Y  +   V ++ + Y D ++    A+ P  F ++S  +HR ++ A TV++K 
Sbjct: 77  DYFARIQKYCPITNDVFLSLLVYFDRIAKRCNALDPQLFVMDSYNIHRLIIAAVTVSTKF 136

Query: 142 LCDSFCTNSHYAKVGGVQCSELHVLESEF 170
             D F +NS YA+VGG+   EL+ LE +F
Sbjct: 137 FSDFFYSNSRYARVGGISLEELNRLELQF 165

>NCAS0E03220 Chr5 complement(639650..640675) [1026 bp, 341 aa] {ON}
           Anc_7.240
          Length = 341

 Score = 66.6 bits (161), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 53/206 (25%), Positives = 90/206 (43%), Gaps = 50/206 (24%)

Query: 37  DFSQCSRTDLVILISRMLSFL------------TRINDSVPKDDAKE------LTRFHSR 78
           D ++ S   L+ +IS +L  L            T +ND    D++ E      +  F  +
Sbjct: 128 DITKLSTKKLIKMISTILEKLIKSNDELRERNETSLNDRTDDDNSDESKLVRSIKSFRGK 187

Query: 79  VPPQISVYDYMMRLTRYSSLEPAVLVASVYYIDLLSAMY--------------------- 117
             P I +  Y  R+ +Y      VL+A + Y D +S +                      
Sbjct: 188 HIPPIKLEQYFHRIQKYCPTNNLVLLAILIYFDRISKVLNGSKENESDPNISTHHHLLRN 247

Query: 118 ------PSFSLNSLTVHRFLLTATTVASKGLCDSFCTNSHYAKVGGVQCSELHVLESEFL 171
                   F L+S  +HR +++A TV++K   D F +NS YAKVGG+   E++ LE +FL
Sbjct: 248 YDCKIEDKFLLDSYNIHRLIISAITVSTKFWSDFFYSNSRYAKVGGISLDEMNYLELQFL 307

Query: 172 KKVNYRILPRDDNISNCKAEKKAGLF 197
              N+ ++     IS+ + ++ +GL 
Sbjct: 308 LISNFDLI-----ISSEEIQRYSGLL 328

>Ecym_4336 Chr4 complement(720123..721280) [1158 bp, 385 aa] {ON}
           similar to Ashbya gossypii ADL075W
          Length = 385

 Score = 67.0 bits (162), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 42/124 (33%), Positives = 68/124 (54%), Gaps = 6/124 (4%)

Query: 52  RMLSFLTRINDSVPKDDAKELTRFHSRVPPQISVYDYMMRLTRYSSLEPAVLVASVYYID 111
           R+ SF    +D   K  A  L+ F  +  P I++ DY  R+ +Y  +   V ++ + Y D
Sbjct: 212 RLKSFEQEKHDINSKYVAHVLS-FRGKHIPAITLGDYFARIQKYCPITNDVFLSLLVYFD 270

Query: 112 LLS----AMYPS-FSLNSLTVHRFLLTATTVASKGLCDSFCTNSHYAKVGGVQCSELHVL 166
            ++    AM P  F ++S  +HR ++ A TV++K   D F +NS YA+VGG+   EL+ L
Sbjct: 271 RIAKRCNAMDPQLFVMDSYNIHRLIIAAVTVSTKFFSDFFYSNSRYARVGGISLHELNRL 330

Query: 167 ESEF 170
           E +F
Sbjct: 331 ELQF 334

>Kwal_23.5807 s23 (1326104..1327501) [1398 bp, 465 aa] {ON} YIL050W
           (PCL7) - PHO85 cyclin [contig 11] FULL
          Length = 465

 Score = 66.6 bits (161), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 37/124 (29%), Positives = 67/124 (54%), Gaps = 6/124 (4%)

Query: 61  NDSVPKDDAKELTRFHSRVPPQISVYDYMMRLTRYSSLEPAVLVASVYYIDLLS-----A 115
           ND+ P + A E+  F  +  P I++  Y  R+ +Y      V ++ + Y D ++      
Sbjct: 311 NDTRP-NIASEILSFRGKHVPAITLQQYFQRIQKYCPTTNDVFLSLLVYFDRIAKTCNHG 369

Query: 116 MYPSFSLNSLTVHRFLLTATTVASKGLCDSFCTNSHYAKVGGVQCSELHVLESEFLKKVN 175
               F ++S  +HR +++A TV++K   D F +NS YA+VGG+   EL+ LE +FL   +
Sbjct: 370 KEQLFVMDSYNIHRLIISAVTVSTKFFSDFFYSNSRYARVGGISLKELNHLELQFLVLCD 429

Query: 176 YRIL 179
           + ++
Sbjct: 430 FELI 433

>SAKL0F08602g Chr6 (657898..659322) [1425 bp, 474 aa] {ON} similar
           to uniprot|P40186 Saccharomyces cerevisiae YIL050W PCL7
           Pho85p cyclin of the Pho80p subfamily forms a functional
           kinase complex with Pho85p which phosphorylates Mmr1p
           and is regulated by Pho81p involved in glycogen
           metabolism expression is cell-cycle regulated
          Length = 474

 Score = 64.3 bits (155), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 65/132 (49%), Gaps = 10/132 (7%)

Query: 58  TRINDSVPKDDAKELTRFHSRVPPQISVYDYMMRLTRYSSLEPAVLVASVYYIDLLSAM- 116
           T + +S   D   ++  F  +  P IS+  Y  R+ +Y      V ++ + Y D ++   
Sbjct: 320 TNVQESAFNDYTSQVLSFRGKHVPAISLDQYFQRIQKYCPTTNDVFLSLLVYFDRIAKRC 379

Query: 117 ---------YPSFSLNSLTVHRFLLTATTVASKGLCDSFCTNSHYAKVGGVQCSELHVLE 167
                       F ++S  +HR ++ A TV++K   D F +NS YA+VGG+   EL+ LE
Sbjct: 380 NINEEGEDGQQLFVMDSYNIHRLIIAAVTVSTKFFSDFFYSNSRYARVGGISLQELNRLE 439

Query: 168 SEFLKKVNYRIL 179
            +FL   ++ ++
Sbjct: 440 LQFLILCDFELI 451

>KAFR0I01840 Chr9 (376802..377779) [978 bp, 325 aa] {ON} Anc_7.240
           YIL050W
          Length = 325

 Score = 63.5 bits (153), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 35/121 (28%), Positives = 61/121 (50%), Gaps = 10/121 (8%)

Query: 69  AKELTRFHSRVPPQISVYDYMMRLTRYSSLEPAVLVASVYYIDLLSAMYPS--------- 119
           A  L  FH +  P I++  Y  R+ +Y      V +  +   D ++    +         
Sbjct: 175 ANSLLCFHGKHVPDITIEKYFNRIQKYCPTTNDVFLLLLIAFDRIAKRCNTDSFGNKSQQ 234

Query: 120 -FSLNSLTVHRFLLTATTVASKGLCDSFCTNSHYAKVGGVQCSELHVLESEFLKKVNYRI 178
            F ++S  +HRF++   TV +K L D F +NS YAKVGG+   E++ LE +FL   ++++
Sbjct: 235 LFVMDSYNIHRFIIAGVTVCTKFLSDFFYSNSRYAKVGGISVHEMNNLELQFLVLCDFKL 294

Query: 179 L 179
           +
Sbjct: 295 I 295

>NCAS0A13480 Chr1 complement(2653843..2655189) [1347 bp, 448 aa]
           {ON} Anc_7.240
          Length = 448

 Score = 63.5 bits (153), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 60/120 (50%), Gaps = 15/120 (12%)

Query: 75  FHSRVPPQISVYDYMMRLTRYSSLEPAVLVASVYYIDLLS----------AMYPS----- 119
           F  +  PQIS++ Y  R+ +Y      V ++ + Y D +S             P+     
Sbjct: 283 FRGKHVPQISLHQYFQRIQKYCPTTNDVFLSLLVYFDRISKRCNNSVTSQGDSPTNKSQL 342

Query: 120 FSLNSLTVHRFLLTATTVASKGLCDSFCTNSHYAKVGGVQCSELHVLESEFLKKVNYRIL 179
           F ++S  +HR ++   TV +K   D F +NS YA+VGGV   EL+ LE +FL   ++ ++
Sbjct: 343 FVMDSYNIHRLIIAGVTVCTKFFSDFFYSNSRYARVGGVSLQELNHLELQFLVLCDFELM 402

>KAFR0L00880 Chr12 (163476..164417) [942 bp, 313 aa] {ON} Anc_7.240
           YIL050W
          Length = 313

 Score = 62.8 bits (151), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 60/120 (50%), Gaps = 12/120 (10%)

Query: 72  LTRFHSRVPPQISVYDYMMRLTRYSSLEPAVLVASVYYIDLLSAMYPS------------ 119
           +  F  +  PQI++  Y  R+ +Y      V ++ + Y D +     S            
Sbjct: 172 MLSFKGKHIPQINLEQYFKRIQKYCPTTNDVFLSLLIYFDRIFNKCNSKFDNYGHDNPQI 231

Query: 120 FSLNSLTVHRFLLTATTVASKGLCDSFCTNSHYAKVGGVQCSELHVLESEFLKKVNYRIL 179
           F ++S  +HR ++   TV++K L D F +NS YAKVGG+   EL+ LE +FL   ++ +L
Sbjct: 232 FVMDSYNIHRLIIAGVTVSTKFLSDFFYSNSRYAKVGGISLKELNYLELQFLILCDFNLL 291

>TPHA0C01090 Chr3 complement(247987..249144) [1158 bp, 385 aa] {ON}
           Anc_7.240 YIL050W
          Length = 385

 Score = 62.4 bits (150), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 43/164 (26%), Positives = 75/164 (45%), Gaps = 41/164 (25%)

Query: 70  KELTRFHSRVPPQISVYDYMMRLTRYSSLEPAVLVASVYYIDLLSA-------------- 115
           K ++ F  +  PQIS+  Y  R+ +Y  +   V ++ + Y D +S               
Sbjct: 203 KPVSCFRGKHVPQISLEQYFQRIQKYCPITNDVFLSLLVYFDRISKKCNNINLEKENVIS 262

Query: 116 ---------------------MYPS-FSLNSLTVHRFLLTATTVASKGLCDSFCTNSHYA 153
                                + P  F ++S  +HR ++TA TV++K   D F +NS YA
Sbjct: 263 NDADESQNNVKQMKDENNSSIVKPQVFVMDSFNIHRLIITAVTVSTKFFSDLFYSNSRYA 322

Query: 154 KVGGVQCSELHVLESEFLKKVNYRILPRDDNISNCKAEKKAGLF 197
           +VGG+   EL+ LE +FL   +++++     IS  + ++ AGL 
Sbjct: 323 RVGGISLQELNHLELQFLILCDFQLM-----ISVEELQRYAGLL 361

>NDAI0A02560 Chr1 (571529..573040) [1512 bp, 503 aa] {ON} Anc_7.240
           YER059W
          Length = 503

 Score = 61.6 bits (148), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 34/119 (28%), Positives = 59/119 (49%), Gaps = 14/119 (11%)

Query: 75  FHSRVPPQISVYDYMMRLTRYSSLEPAVLVASVYYIDLLSAMYPS--------------F 120
           F  +  PQI+++ Y  R+ +Y      V ++ + Y D +S    S              F
Sbjct: 352 FKGKHVPQITLHQYFQRIQKYCPTTNDVFLSLLVYFDRISKRCNSTPTTNSINDNNSQMF 411

Query: 121 SLNSLTVHRFLLTATTVASKGLCDSFCTNSHYAKVGGVQCSELHVLESEFLKKVNYRIL 179
            ++S  +HR ++   TV +K   D F +NS YA+VGG+   EL+ LE +FL   ++ ++
Sbjct: 412 VMDSYNIHRLIIAGITVCTKFFSDFFYSNSRYARVGGISLQELNHLELQFLILCDFELM 470

>KNAG0L01470 Chr12 (259883..260947) [1065 bp, 354 aa] {ON} Anc_7.240
           YIL050W
          Length = 354

 Score = 59.7 bits (143), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 43/163 (26%), Positives = 72/163 (44%), Gaps = 27/163 (16%)

Query: 57  LTRINDSVPKDDA------KELTRFHSRVPPQISVYDYMMRLTRYSSLEPAVLVASVYYI 110
           L ++ND     D         +  F  +  PQI++  Y  R+ +Y      V ++ + Y 
Sbjct: 187 LLKVNDDARDTDGYYESAVNAILSFKGKHIPQITLEQYFHRIQKYCPTTNDVFLSLLIYF 246

Query: 111 DLLSAMYPS----------------FSLNSLTVHRFLLTATTVASKGLCDSFCTNSHYAK 154
           D +S    S                F +NS  +HR ++    V++K   D F +N+ YAK
Sbjct: 247 DRISEKCNSIPRGGDDDKVQDDTLLFVMNSYNIHRLIIAGVAVSTKFSSDFFYSNARYAK 306

Query: 155 VGGVQCSELHVLESEFLKKVNYRILPRDDNISNCKAEKKAGLF 197
           VGG+   E++ LE +FL   ++ +L     IS  + E+ A L 
Sbjct: 307 VGGISLREMNYLELQFLVLCDFSLL-----ISVEEMERYASLL 344

>TDEL0H02020 Chr8 complement(346307..347398) [1092 bp, 363 aa] {ON}
           Anc_7.240 YIL050W
          Length = 363

 Score = 57.4 bits (137), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 36/136 (26%), Positives = 59/136 (43%), Gaps = 31/136 (22%)

Query: 75  FHSRVPPQISVYDYMMRLTRYSSLEPAVLVASVYYIDLLS-------------------- 114
           F  +  PQIS+  Y  R+ +Y      V ++ + Y D +S                    
Sbjct: 196 FRGKHIPQISLEHYFQRIQKYCPTTNDVFLSLLVYFDRISKRCNSNNNDTTNDNDLQYDM 255

Query: 115 -----------AMYPSFSLNSLTVHRFLLTATTVASKGLCDSFCTNSHYAKVGGVQCSEL 163
                          +F ++S  +HR L+   TV++K   D F +NS YA+VGG+   EL
Sbjct: 256 PAKQQQQTQQTQQQQAFVMDSHNIHRLLIAGVTVSTKFFSDFFYSNSRYARVGGISLQEL 315

Query: 164 HVLESEFLKKVNYRIL 179
           + LE +FL   ++ +L
Sbjct: 316 NHLELQFLVLCDFELL 331

>KLLA0C08305g Chr3 complement(728996..730225) [1230 bp, 409 aa] {ON}
           similar to uniprot|P40186 Saccharomyces cerevisiae
           YIL050W PCL7 Pho85p cyclin of the Pho80p subfamily forms
           a functional kinase complex with Pho85p which
           phosphorylates Mmr1p and is regulated by Pho81p involved
           in glycogen metabolism expression is cell-cycle
           regulated and weakly similar to YER059W uniprot|P40038
           Saccharomyces cerevisiae YER059W PCL6 Pho85p cyclin of
           the Pho80p subfamily forms the major Glc8p kinase
           together with Pcl7p and Pho85p involved in the control
           of glycogen storage by Pho85p stabilized by Elongin C
           binding
          Length = 409

 Score = 56.6 bits (135), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 36/138 (26%), Positives = 66/138 (47%), Gaps = 28/138 (20%)

Query: 70  KELTRFHSRVPPQISVYDYMMRLTRYSSLEPAVLVASVYYIDLL---------------- 113
           +E+  F  +  P I++  Y  R+ +Y      VL++ + + D +                
Sbjct: 235 REILSFRGKQVPGITLKQYFQRIQKYCPTTNDVLLSLLVHFDRIAKKCNAIAQEYMVSVV 294

Query: 114 --------SAMYPS----FSLNSLTVHRFLLTATTVASKGLCDSFCTNSHYAKVGGVQCS 161
                   S  + S    F ++S  +HR ++ A TV++K + D F +NS YA+VGG+   
Sbjct: 295 STPDKTTASLAHQSSPQLFVMDSHNIHRLIIAAITVSTKFISDFFYSNSRYARVGGISLQ 354

Query: 162 ELHVLESEFLKKVNYRIL 179
           EL+ LE +FL   ++R++
Sbjct: 355 ELNHLELQFLILCDFRLI 372

>NDAI0E04770 Chr5 (1073112..1074023) [912 bp, 303 aa] {ON} Anc_7.240
           YER059W
          Length = 303

 Score = 54.7 bits (130), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 40/141 (28%), Positives = 66/141 (46%), Gaps = 25/141 (17%)

Query: 63  SVPKDDAKE-LTRFHSRVPPQISVYDYMMRLTRYSSLEPAVLVASVYYID-LLSAMY--- 117
           ++P DD K  L  F      +I + +Y+  L R+  +    L+A + Y+D ++  +Y   
Sbjct: 143 NIPADDIKHVLQSFLGNHRLKIELEEYLNTLQRHCPMNTIDLLALLIYLDRIIQNLYKYP 202

Query: 118 ----PSFS----------------LNSLTVHRFLLTATTVASKGLCDSFCTNSHYAKVGG 157
               P +                 +NS TVHR +L   TV+SK L D   +N  YA+  G
Sbjct: 203 LDKKPIYQFMASRFQHKQTCLSRIVNSCTVHRLILAGITVSSKFLSDFTYSNKRYAQASG 262

Query: 158 VQCSELHVLESEFLKKVNYRI 178
           +   EL+ LE +FL+  N+ +
Sbjct: 263 LTLEELNYLEFQFLRLTNFNL 283

>TBLA0D04070 Chr4 complement(1012284..1014269) [1986 bp, 661 aa]
           {ON} Anc_7.240 YIL050W
          Length = 661

 Score = 55.5 bits (132), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 39/60 (65%)

Query: 120 FSLNSLTVHRFLLTATTVASKGLCDSFCTNSHYAKVGGVQCSELHVLESEFLKKVNYRIL 179
           F ++S  +HR ++   TVA+K   D F +N+ YAKVGG+   EL+ LE +FL   ++++L
Sbjct: 578 FVMDSYNIHRLIIAGVTVATKFFSDYFYSNARYAKVGGITLQELNHLELQFLLLCDFKLL 637

>ZYRO0C08118g Chr3 (621320..622537) [1218 bp, 405 aa] {ON} similar
           to uniprot|P40186 Saccharomyces cerevisiae YIL050W PCL7
           Pho85p cyclin of the Pho80p subfamily forms a functional
           kinase complex with Pho85p which phosphorylates Mmr1p
           and is regulated by Pho81p involved in glycogen
           metabolism expression is cell-cycle regulated
          Length = 405

 Score = 55.1 bits (131), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 37/146 (25%), Positives = 60/146 (41%), Gaps = 41/146 (28%)

Query: 75  FHSRVPPQISVYDYMMRLTRYSSLEPAVLVASVYYIDLLSAMYPS--------------- 119
           F  +  PQIS+  Y  R+ +Y      V ++ + Y D +S    S               
Sbjct: 234 FRGKHIPQISLEHYFQRIQKYCPTSNDVFLSLLVYFDRISRKCNSSSRLHHENTSANDAG 293

Query: 120 --------------------------FSLNSLTVHRFLLTATTVASKGLCDSFCTNSHYA 153
                                     F ++S  +HR ++  TTV++K   D F +NS YA
Sbjct: 294 NNNNGHDNVKQQVHNNQQPIPAPQQQFVMDSHNIHRLIIAGTTVSTKFFSDFFYSNSRYA 353

Query: 154 KVGGVQCSELHVLESEFLKKVNYRIL 179
           +VGG+   EL+ LE +FL   ++ +L
Sbjct: 354 RVGGISLQELNYLELQFLILCDFELL 379

>Kpol_1033.13 s1033 (30454..31206) [753 bp, 250 aa] {ON}
           (30454..31206) [753 nt, 251 aa]
          Length = 250

 Score = 53.9 bits (128), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 38/60 (63%)

Query: 120 FSLNSLTVHRFLLTATTVASKGLCDSFCTNSHYAKVGGVQCSELHVLESEFLKKVNYRIL 179
           F ++S  +HR ++   TV++K   D F +NS YA+VGG+   EL+ LE +FL   ++ +L
Sbjct: 163 FVMDSYNIHRLIIAGVTVSTKFFSDLFYSNSRYARVGGISLQELNNLELQFLLMCDFHLL 222

 Score = 29.6 bits (65), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 13/46 (28%), Positives = 24/46 (52%)

Query: 69  AKELTRFHSRVPPQISVYDYMMRLTRYSSLEPAVLVASVYYIDLLS 114
           A+ +  F  +  PQIS+  Y  R+ +Y  +   V ++ + Y D +S
Sbjct: 36  AQSVLSFRGKHIPQISLEQYFQRIQKYCPITNDVFISLLVYFDRIS 81

>Suva_5.167 Chr5 (248778..250052) [1275 bp, 424 aa] {ON} YER059W
           (REAL)
          Length = 424

 Score = 53.5 bits (127), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 39/60 (65%)

Query: 120 FSLNSLTVHRFLLTATTVASKGLCDSFCTNSHYAKVGGVQCSELHVLESEFLKKVNYRIL 179
           F ++S  +HR ++   TV++K L D F +NS Y++VGG+   EL+ LE +FL   ++ +L
Sbjct: 334 FVMDSHNIHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFLVLCDFELL 393

>Smik_5.189 Chr5 (276775..278022) [1248 bp, 415 aa] {ON} YER059W
           (REAL)
          Length = 415

 Score = 53.5 bits (127), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 39/60 (65%)

Query: 120 FSLNSLTVHRFLLTATTVASKGLCDSFCTNSHYAKVGGVQCSELHVLESEFLKKVNYRIL 179
           F ++S  +HR ++   TV++K L D F +NS Y++VGG+   EL+ LE +FL   ++ +L
Sbjct: 325 FVMDSHNIHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFLVLCDFELL 384

>YER059W Chr5 (272624..273886) [1263 bp, 420 aa] {ON}  PCL6Pho85p
           cyclin of the Pho80p subfamily; forms the major Glc8p
           kinase together with Pcl7p and Pho85p; involved in the
           control of glycogen storage by Pho85p; stabilized by
           Elongin C binding
          Length = 420

 Score = 52.8 bits (125), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 39/60 (65%)

Query: 120 FSLNSLTVHRFLLTATTVASKGLCDSFCTNSHYAKVGGVQCSELHVLESEFLKKVNYRIL 179
           F ++S  +HR ++   TV++K L D F +NS Y++VGG+   EL+ LE +FL   ++ +L
Sbjct: 330 FVMDSHNIHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFLVLCDFELL 389

>Skud_5.173 Chr5 (268792..270054) [1263 bp, 420 aa] {ON} YER059W
           (REAL)
          Length = 420

 Score = 52.8 bits (125), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 39/60 (65%)

Query: 120 FSLNSLTVHRFLLTATTVASKGLCDSFCTNSHYAKVGGVQCSELHVLESEFLKKVNYRIL 179
           F ++S  +HR ++   TV++K L D F +NS Y++VGG+   EL+ LE +FL   ++ +L
Sbjct: 330 FVMDSHNIHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFLVLCDFELL 389

>TBLA0C04850 Chr3 complement(1175677..1176783) [1107 bp, 368 aa]
           {ON} Anc_7.289 YDL179W
          Length = 368

 Score = 52.4 bits (124), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 38/128 (29%), Positives = 63/128 (49%), Gaps = 12/128 (9%)

Query: 52  RMLSFLTRINDSV----PKDDAKELTRFHSRVPPQISVYDYMMRLTRYSSLEPAVLVASV 107
            M+ FL+    S     P  D+       S +PP   +Y ++  L  +S+++   L+ +V
Sbjct: 19  EMIQFLSNCAASAIQIRPTSDSNLTNESISNIPP---LYTFIKNLVAHSNVQTPTLMTTV 75

Query: 108 YYIDLLSAMYPS--FSLNSLTVHRFLLTATTVASKGLCDSFCTNSHYAKV--GGVQCSEL 163
            Y+  L A+ PS  + + + T HR  L    +A+K L DS   N H+AK   G +Q  E+
Sbjct: 76  VYLKKLKAIIPSNVYGIET-TRHRMFLGCLIIAAKTLNDSSPLNKHWAKYTNGLLQLREV 134

Query: 164 HVLESEFL 171
           + +E E L
Sbjct: 135 NTIEREIL 142

>Kpol_2000.14 s2000 (24019..24951) [933 bp, 310 aa] {ON}
           (24019..24951) [933 nt, 311 aa]
          Length = 310

 Score = 51.2 bits (121), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 36/142 (25%), Positives = 75/142 (52%), Gaps = 15/142 (10%)

Query: 53  MLSFLTRINDSVP--KDDAKELTRFHSRVPPQISVYDYMMRLTRYSSLEPAVLVASVYYI 110
           M+ FL    DS+   K  + E     + +P   S+++++  L ++S+++ + L+AS  Y+
Sbjct: 19  MICFLASTTDSIIQLKPSSNE-----ANIP---SIFEFIKGLIKHSNVQTSTLMASTVYL 70

Query: 111 DLLSAMYPS--FSLNSLTVHRFLLTATTVASKGLCDSFCTNSHYAKV--GGVQCSELHVL 166
             L ++ P+  + + S T HR  L    +A+K L DS   N H+ K   G +  ++++ +
Sbjct: 71  TKLRSILPANVYGIES-TKHRIFLGCLILAAKSLNDSSPLNKHWTKYTNGLLNLADVNTI 129

Query: 167 ESEFLKKVNYRILPRDDNISNC 188
           E E L  +N+  + + +++  C
Sbjct: 130 ERELLAYLNWDTIIKQEDLIGC 151

>Skud_7.139 Chr7 (260060..261364) [1305 bp, 434 aa] {ON} YGL134W
           (REAL)
          Length = 434

 Score = 46.6 bits (109), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 35/142 (24%), Positives = 66/142 (46%), Gaps = 15/142 (10%)

Query: 45  DLVILISRMLSFLTRIND----SVPKDDA--KELTRFHSRVPPQISVYDYMMRLTRYSSL 98
           D +   S  +  L +++D    ++ K+D   KE   F+ +  P +S  D++ R+      
Sbjct: 264 DALANFSETIELLLKLSDDEKCTISKNDVEKKEYANFYMKSKPSLSSVDFLRRIQDKCEY 323

Query: 99  EPAVLVASVYYIDLL---------SAMYPSFSLNSLTVHRFLLTATTVASKGLCDSFCTN 149
           EPAV + + + +D L         +A+     L    VHR ++ +  +++K L D   ++
Sbjct: 324 EPAVYLVATFLMDTLFLTRNERNNNALQLKLKLQEKEVHRVIIASVRLSTKLLEDFVHSH 383

Query: 150 SHYAKVGGVQCSELHVLESEFL 171
            +++KV GV    L  LE   L
Sbjct: 384 EYFSKVCGVSKRLLSKLEISLL 405

>KNAG0A01490 Chr1 (62182..62970) [789 bp, 262 aa] {ON} Anc_3.70
           YNL289W
          Length = 262

 Score = 45.1 bits (105), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 36/139 (25%), Positives = 67/139 (48%), Gaps = 19/139 (13%)

Query: 53  MLSFLTRINDSV-----------PKDDAKELTRFHSRVPPQISVYDYMMRLTRYSSLEPA 101
           M+ +LTR+   V           P     EL+    R+P   S+  ++ +L RY+++   
Sbjct: 20  MIQYLTRVTLKVLPNTPAQQYPSPPSSPTELSGKEPRLP---SLRTFITKLVRYTNVYTP 76

Query: 102 VLVASVYYIDLLSAMYP--SFSLNSLTVHRFLLTATTVASKGLCDSFCTNSHYAKV--GG 157
            L+ +V Y++ L  + P  +  L S T+HR  L    +++K   DS   N H+AK   G 
Sbjct: 77  TLLTTVCYLNKLKRILPKDAKGLPS-TIHRLFLACLILSAKYHNDSSPLNKHWAKYTDGL 135

Query: 158 VQCSELHVLESEFLKKVNY 176
               +++++E + L  +N+
Sbjct: 136 FSLEDINLMERQLLNLLNW 154

>YDL127W Chr4 (234927..235853) [927 bp, 308 aa] {ON}  PCL2Cyclin,
           interacts with cyclin-dependent kinase Pho85p; member of
           the Pcl1,2-like subfamily, involved in the regulation of
           polarized growth and morphogenesis and progression
           through the cell cycle; localizes to sites of polarized
           cell growth
          Length = 308

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 59/112 (52%), Gaps = 5/112 (4%)

Query: 81  PQISVYDYMMRLTRYSSLEPAVLVASVYYIDLLSAMYPS--FSLNSLTVHRFLLTATTVA 138
           P   +  ++ RL ++S+++   L+A+  Y+  L ++ PS  + + + T HR  L    +A
Sbjct: 45  PAPPLTKFINRLIKHSNVQTPTLMATSVYLAKLRSIIPSNVYGIET-TRHRIFLGCLILA 103

Query: 139 SKGLCDSFCTNSHYAKV--GGVQCSELHVLESEFLKKVNYRILPRDDNISNC 188
           +K L DS   N H+A+   G +   E++ +E E L+  ++ +    D++  C
Sbjct: 104 AKTLNDSSPLNKHWAEYTDGLLILREVNTIERELLEYFDWDVTISTDDLITC 155

>CAGL0E02233g Chr5 (215934..216734) [801 bp, 266 aa] {ON} similar to
           uniprot|P24867 Saccharomyces cerevisiae YNL289w PCL1
           cyclin
          Length = 266

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 59/106 (55%), Gaps = 5/106 (4%)

Query: 84  SVYDYMMRLTRYSSLEPAVLVASVYYIDLLSAMYP--SFSLNSLTVHRFLLTATTVASKG 141
           S+  ++ RL RY+++    L+A+V Y++ L  + P  +  L S T+HR  L    ++SK 
Sbjct: 54  SLMTFITRLVRYTNVYTPTLLATVCYLNKLKRILPKDATGLPS-TIHRLFLACLILSSKC 112

Query: 142 LCDSFCTNSHYAKV--GGVQCSELHVLESEFLKKVNYRILPRDDNI 185
             DS   N H+A+   G     +++++E + L+ +N+ I   +D++
Sbjct: 113 HNDSSPKNVHWARYTDGLFSLEDINLMERQLLQLLNWDINVSEDDL 158

>Smik_4.110 Chr4 (211556..212482) [927 bp, 308 aa] {ON} YDL127W
           (REAL)
          Length = 308

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 60/112 (53%), Gaps = 5/112 (4%)

Query: 81  PQISVYDYMMRLTRYSSLEPAVLVASVYYIDLLSAMYPS--FSLNSLTVHRFLLTATTVA 138
           P   + +++ RL ++S+++   L+A+  Y+  L ++ PS  + + + T HR  L    +A
Sbjct: 45  PAPPLTEFINRLIKHSNVQTPTLMATSVYLAKLRSLIPSKVYGIET-TRHRIFLGCLILA 103

Query: 139 SKGLCDSFCTNSHYAKV--GGVQCSELHVLESEFLKKVNYRILPRDDNISNC 188
           +K L DS   N H+A+   G +   E++ +E E L+  ++ +    +++  C
Sbjct: 104 AKTLNDSSPLNKHWAEYTDGLLLLREVNTIERELLEYFDWDVTISTEDLITC 155

>AFR159C Chr6 complement(723082..724008) [927 bp, 308 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL127W
           (PCL2) and YDL179W (PCL9)
          Length = 308

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/130 (23%), Positives = 66/130 (50%), Gaps = 10/130 (7%)

Query: 83  ISVYDYMMRLTRYSSLEPAVLVASVYYIDLLSAMYPS--FSLNSLTVHRFLLTATTVASK 140
           +S+ D++  L + S+++   L+++V Y+  L ++ P+  + + + + HR  L    +A+K
Sbjct: 43  LSLVDFIKGLVKRSNVQTPTLMSTVVYLARLRSIIPANVYGIET-SRHRMFLGCLILAAK 101

Query: 141 GLCDSFCTNSHYAKV--GGVQCSELHVLESEFLKKVNYRILPRDDNISNCKAEKKAGLFV 198
            L DS   N H+ +   G +   E++ +E E L+  N+ +   + ++ +C +      F+
Sbjct: 102 NLNDSSPMNKHWCRYTDGLLSLREVNTIERELLEYFNWNLRITNQDLISCLSH-----FL 156

Query: 199 TPTYSKSCRG 208
            P      RG
Sbjct: 157 NPIRDSFIRG 166

>Suva_14.50 Chr14 (84601..85440) [840 bp, 279 aa] {ON} YNL289W
           (REAL)
          Length = 279

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 57/104 (54%), Gaps = 8/104 (7%)

Query: 77  SRVPPQISVYDYMMRLTRYSSLEPAVLVASVYYIDLLSAMYP--SFSLNSLTVHRFLLTA 134
           +R+P   S+  ++ RL RY+++    L+ +V Y++ L  + P  +  L S T+HR  L  
Sbjct: 50  ARLP---SLMTFITRLVRYTNVYTPTLLTAVCYLNKLKRILPKDATGLPS-TIHRIFLAC 105

Query: 135 TTVASKGLCDSFCTNSHYAKV--GGVQCSELHVLESEFLKKVNY 176
             +++K   DS   N H+AK   G     +++++E + L+ +N+
Sbjct: 106 LILSAKFHNDSSPLNKHWAKYTDGLFTLEDINLMERQLLQLLNW 149

>Kpol_1020.8 s1020 (18215..19105) [891 bp, 296 aa] {ON}
           (18215..19105) [891 nt, 297 aa]
          Length = 296

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 37/143 (25%), Positives = 71/143 (49%), Gaps = 8/143 (5%)

Query: 52  RMLSFLTRINDSVPKDDAKELTRFHSRVPPQISVYDYMMRLTRYSSLEPAVLVASVYYID 111
            M+++L+ I +S+ +   +      S   P   +  ++  L   S+++   L+A+  Y+ 
Sbjct: 18  EMIAYLSNITESIIQ--VRRSNSMISIALPPPPLVKFITNLCLKSNVQTPTLMATTVYLK 75

Query: 112 LLSAMYPS--FSLNSLTVHRFLLTATTVASKGLCDSFCTNSHYAKV--GGVQCSELHVLE 167
            L  + P   + + S T HR  L    +ASK L DS   N H+A+   G +Q  E++ +E
Sbjct: 76  KLKNIIPPNVYGIES-TRHRIFLGCLILASKTLNDSSPLNKHWARYTSGILQLREVNTIE 134

Query: 168 SEFLKKVNYRI-LPRDDNISNCK 189
            E L+  ++ I +  DD +S+ +
Sbjct: 135 RELLEYFDWNIQITTDDLVSSLE 157

>NCAS0A13770 Chr1 complement(2704299..2705237) [939 bp, 312 aa] {ON}
           Anc_7.289
          Length = 312

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/144 (24%), Positives = 72/144 (50%), Gaps = 14/144 (9%)

Query: 53  MLSFLTRINDSV----PKDDAKELTRFHSRVPPQISVYDYMMRLTRYSSLEPAVLVASVY 108
           M+ FL     S+    P  + K  T   + + P +S  +++  L ++S+++   L+A+  
Sbjct: 19  MIQFLASTTASIIQVKPHSEPKTNT---AHIIPTLS--NFIKALIKHSNVQTPTLMATTV 73

Query: 109 YIDLLSAMYPS--FSLNSLTVHRFLLTATTVASKGLCDSFCTNSHYAKV--GGVQCSELH 164
           Y+  L ++ P   + + + T HR  L    +A+K L DS   N H+A+   G +Q  E++
Sbjct: 74  YLSKLKSIIPCNVYGIET-TRHRIFLGCLILAAKTLNDSSPMNKHWAQYTDGLLQIREVN 132

Query: 165 VLESEFLKKVNYRILPRDDNISNC 188
            +E E L+  ++ +  +  ++  C
Sbjct: 133 TIERELLEYFDWDVTIKTKDLIIC 156

>NCAS0D04070 Chr4 (764711..766132) [1422 bp, 473 aa] {ON} Anc_6.236
          Length = 473

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/115 (23%), Positives = 48/115 (41%), Gaps = 8/115 (6%)

Query: 65  PKDDAKELTRFHSRVPPQISVYDYMMRLTRYSSLEPAVLVASVYYIDLLSAMYPS----- 119
           P D+    + F  + PP +S  D++ R+      +P V + + Y +  L  +        
Sbjct: 330 PLDEMIAFSNFKMKSPPSLSYADFIQRIQNKCEYDPHVYLIATYLLQTLLLIREEHSRKL 389

Query: 120 ---FSLNSLTVHRFLLTATTVASKGLCDSFCTNSHYAKVGGVQCSELHVLESEFL 171
              F      VHR ++    +A+K L D   ++ ++ KV G+    L  LE   L
Sbjct: 390 KLRFKFEKSDVHRLIIATVRIATKLLEDHVHSHEYFCKVSGISKKLLSKLEVSLL 444

>Ecym_8038 Chr8 complement(87401..88345) [945 bp, 314 aa] {ON}
           similar to Ashbya gossypii AFR159C
          Length = 314

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 56/111 (50%), Gaps = 3/111 (2%)

Query: 81  PQISVYDYMMRLTRYSSLEPAVLVASVYYIDLL-SAMYPSFSLNSLTVHRFLLTATTVAS 139
           P +S+ D++  L   S+++   L+++V Y+  L S + P+      T HR  L    +AS
Sbjct: 41  PILSLVDFIKGLINKSNVQTPTLMSTVVYLTRLRSIIPPNVHGIETTRHRIFLGCLILAS 100

Query: 140 KGLCDSFCTNSHYAKVGGVQCS--ELHVLESEFLKKVNYRILPRDDNISNC 188
           K L DS   N H+ +      S  E++ +E E L+  N+ +L  + ++  C
Sbjct: 101 KNLNDSSPMNKHWCQYTNSLLSLREVNTVERELLEYFNWDLLITNKDLITC 151

>SAKL0F09856g Chr6 complement(756909..757916) [1008 bp, 335 aa] {ON}
           similar to uniprot|P25693 Saccharomyces cerevisiae
           YDL127W PCL2 G1 cyclin associates with Pho85p cyclin-
           dependent kinase (Cdk) to contribute to entry into the
           mitotic cell cycle essential for cell morphogenesis
           localizes to sites of polarized cell growth
          Length = 335

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 26/110 (23%), Positives = 60/110 (54%), Gaps = 5/110 (4%)

Query: 83  ISVYDYMMRLTRYSSLEPAVLVASVYYIDLLSAMYPS--FSLNSLTVHRFLLTATTVASK 140
           +S+ D++  L  +S+++   L+++V Y+  L ++ P+  + + + T HR  L    +A+K
Sbjct: 42  VSLVDFIKGLITHSNVQTPTLMSTVVYLTRLRSIIPATVYGIET-TRHRIFLGCLILAAK 100

Query: 141 GLCDSFCTNSHYAKV--GGVQCSELHVLESEFLKKVNYRILPRDDNISNC 188
            L DS   N H+++   G +   E++ +E E L+  ++++     ++  C
Sbjct: 101 NLNDSSPLNKHWSRYTNGLLDIREVNTIERELLEYFDWKLRIDTQDLITC 150

>YGL134W Chr7 (255663..256964) [1302 bp, 433 aa] {ON}  PCL10Pho85p
           cyclin; recruits, activates, and targets Pho85p
           cyclin-dependent protein kinase to its substrate
          Length = 433

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 27/111 (24%), Positives = 53/111 (47%), Gaps = 7/111 (6%)

Query: 68  DAKELTRFHSRVPPQISVYDYMMRLTRYSSLEPAVLVASVYYIDLL-------SAMYPSF 120
           + KE + F+ +  P +S  D++ R+      +P V + + + ID L       + +    
Sbjct: 293 EKKEYSNFYMKSKPTLSSADFLKRIQDKCEYQPTVYLVATFLIDTLFLTRDGNNILQLKL 352

Query: 121 SLNSLTVHRFLLTATTVASKGLCDSFCTNSHYAKVGGVQCSELHVLESEFL 171
           +L    VHR ++ A  +++K L D   ++ +++KV G+    L  LE   L
Sbjct: 353 NLQEKEVHRMIIAAVRLSTKLLEDFVHSHEYFSKVCGISKRLLTKLEVSLL 403

>TPHA0A00580 Chr1 (101866..102735) [870 bp, 289 aa] {ON} Anc_3.70
           YNL289W
          Length = 289

 Score = 42.7 bits (99), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 32/136 (23%), Positives = 69/136 (50%), Gaps = 8/136 (5%)

Query: 54  LSFLTRINDSVPKDDAKELTRFHSRVPPQISVYDYMMRLTRYSSLEPAVLVASVYYIDLL 113
           L+ L  IN+ +P           S++P   S+  ++ +L RY+++  + L+ +  Y+  L
Sbjct: 30  LNVLPNINNELPSPPVSPGNSKESKLP---SLKTFITKLVRYTNVYTSTLLTTACYLKKL 86

Query: 114 SAMYPSFSLNSL--TVHRFLLTATTVASKGLCDSFCTNSHYAKV--GGVQCSELHVLESE 169
             + P  + N L  T+HR  L    +++K   DS   N H+A+   G     +++++E +
Sbjct: 87  QRILPKDA-NGLPSTIHRIFLACLILSAKFHNDSSPLNKHWAEYTDGLFSLEDVNLMEVQ 145

Query: 170 FLKKVNYRILPRDDNI 185
            L  +N+ I  +++++
Sbjct: 146 LLALLNWDIRIKEEDL 161

>TBLA0J00650 Chr10 complement(152884..153975) [1092 bp, 363 aa] {ON}
           Anc_7.289 YDL179W
          Length = 363

 Score = 42.7 bits (99), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 31/131 (23%), Positives = 67/131 (51%), Gaps = 7/131 (5%)

Query: 51  SRMLSFLTRINDSVPKDDAKELTRFHSRVPPQISVYDYMMRLTRYSSLEPAVLVASVYYI 110
           + M+ FL    +S+ + ++ E +    ++P   S+  ++ RL  +S+++   L++++ Y+
Sbjct: 17  NEMIDFLVSTTNSIIQIES-ETSSTSQQIP---SLALFIKRLIVHSNVQTPTLMSTLVYL 72

Query: 111 DLLSAMYPSFSLN-SLTVHRFLLTATTVASKGLCDSFCTNSHYAKV--GGVQCSELHVLE 167
             L  + PS  +    T HR  +    +A+K L DS   N H+ +   G  +  E++ +E
Sbjct: 73  TKLREIIPSDVVGIETTRHRIFIGCLILAAKSLNDSSPLNRHWTQYTNGLFKIQEINTIE 132

Query: 168 SEFLKKVNYRI 178
            E L+  N+ +
Sbjct: 133 RELLEYFNWDV 143

>Suva_4.68 Chr4 (125518..126435) [918 bp, 305 aa] {ON} YDL179W
           (REAL)
          Length = 305

 Score = 42.4 bits (98), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 32/136 (23%), Positives = 64/136 (47%), Gaps = 12/136 (8%)

Query: 76  HSRVPPQISVYDYMMRLTRYSSLEPAVLVASVYYIDLLSAMYPS--FSLNSLTVHRFLLT 133
           H   PP++S++  + ++   S+++   L+A+  Y++ L ++ P   + + + T HR  L 
Sbjct: 41  HGCPPPELSIF--IKKVVVQSNVQTPTLMATTVYLNKLKSIIPKNVYGIET-TRHRIFLG 97

Query: 134 ATTVASKGLCDSFCTNSHYAKV--GGVQCSELHVLESEFLKKVNYRILPRDDNISNCKAE 191
              +A+K L DS   N H+     G ++  E++ +E E L+  N+     D  I+     
Sbjct: 98  CLILAAKTLNDSSPWNKHWTTYTEGLLKVREVNTIERELLEYFNW-----DVRITTSDLI 152

Query: 192 KKAGLFVTPTYSKSCR 207
                F+ P   +  R
Sbjct: 153 NSLAFFLVPIQEQLFR 168

>Suva_4.118 Chr4 (223497..224426) [930 bp, 309 aa] {ON} YDL127W
           (REAL)
          Length = 309

 Score = 42.0 bits (97), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 34/133 (25%), Positives = 63/133 (47%), Gaps = 10/133 (7%)

Query: 81  PQISVYDYMMRLTRYSSLE-PAVLVASVYYIDLLSAMYPSFSLNSLTVHRFLLTATTVAS 139
           P   +  ++ RL ++S+++ P ++  SVY + L S +  +      T HR  L    +A+
Sbjct: 45  PAPPLVKFINRLIKHSNVQTPTLMATSVYLVKLRSIIPSNVYGIETTRHRIFLGCLILAA 104

Query: 140 KGLCDSFCTNSHYAKV--GGVQCSELHVLESEFLKKVNYRI-LPRDDNISNCKAEKKAGL 196
           K L DS   N H+A+   G +   E++ +E E L   ++ + +  DD I++         
Sbjct: 105 KTLNDSSPLNKHWAEYTDGLLLLREVNTIERELLGYFDWDVTISTDDLITSLSP------ 158

Query: 197 FVTPTYSKSCRGP 209
           F+ P   +S   P
Sbjct: 159 FLQPMKEESVHKP 171

>ZYRO0C09284g Chr3 complement(706160..707095) [936 bp, 311 aa] {ON}
           some similarities with uniprot|P25693 Saccharomyces
           cerevisiae YDL127W PCL2 G1 cyclin associates with Pho85p
           cyclin-dependent kinase (Cdk) to contribute to entry
           into the mitotic cell cycle essential for cell
           morphogenesis localizes to sites of polarized cell
           growth
          Length = 311

 Score = 42.0 bits (97), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 30/116 (25%), Positives = 57/116 (49%), Gaps = 8/116 (6%)

Query: 77  SRVPPQISVYDYMMRLTRYSSLEPAVLVASVYYIDLLSAMYPS--FSLNSLTVHRFLLTA 134
           S  PP   +  ++  L  YS+++   L+A+  Y+  L ++ P+  F + + T HR  L  
Sbjct: 42  SPAPP---LMRFIKTLISYSNVQTPTLMATTVYLTKLRSIIPANVFGIET-TRHRIFLGC 97

Query: 135 TTVASKGLCDSFCTNSHYAKV--GGVQCSELHVLESEFLKKVNYRILPRDDNISNC 188
             +A+K L DS   N H+A    G +   E++ +E E L+  ++ +    + +  C
Sbjct: 98  LILAAKTLNDSSPLNKHWASYTDGLLHIREVNTIERELLEYFDWNVCITTEELVAC 153

>SAKL0A03938g Chr1 (367076..368581) [1506 bp, 501 aa] {ON} weakly
           similar to uniprot|Q6B153 Saccharomyces cerevisiae
           YPL219W PCL8 Cyclin interacts with Pho85p
           cyclin-dependent kinase (Cdk) to phosphorylate and
           regulate glycogen synthase also activates Pho85p for
           Glc8p phosphorylation
          Length = 501

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/116 (25%), Positives = 56/116 (48%), Gaps = 9/116 (7%)

Query: 50  ISRMLSFLTRINDSVPKDDAKELTRFHSRVPPQISVYDYMMRLTRYSSLEPAVLVASVYY 109
           IS +L   +++ D VP  D  +   F  +  P +S  +Y+ R+       P V + + Y 
Sbjct: 345 ISMLLKLSSKLQDPVP--DLPQHIPFIMKSSPSLSYEEYLERIHSKLMFSPVVYLTATYL 402

Query: 110 IDLL-------SAMYPSFSLNSLTVHRFLLTATTVASKGLCDSFCTNSHYAKVGGV 158
           +  L       S +  SF L    +HR ++ +  +A+K L D   ++++++KV GV
Sbjct: 403 LHELTLTRQQDSKLALSFPLKITQIHRIIIASIRLAAKLLEDFVHSHAYFSKVCGV 458

>KNAG0B02930 Chr2 (563319..564257) [939 bp, 312 aa] {ON} Anc_7.289
           YDL179W
          Length = 312

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/129 (23%), Positives = 63/129 (48%), Gaps = 5/129 (3%)

Query: 53  MLSFLTRINDSVPKDDAKELTRFHSRVPPQISVYDYMMRLTRYSSL-EPAVLVASVYYID 111
           M+ +L ++ +S+      E+    S  PP  ++ +++  L   S +  P ++ ++VY + 
Sbjct: 19  MIKYLAKVTESIVTHLRPEVR--SSDKPPIPTLVEFIAGLVTNSKVGTPTLMASTVYLVR 76

Query: 112 LLSAMYPSFSLNSLTVHRFLLTATTVASKGLCDSFCTNSHYAKVGG--VQCSELHVLESE 169
           L   + P+      T HR  L    +A+K L D+   N H++K     +   E++++E E
Sbjct: 77  LKDILPPNIIGIETTRHRLFLGCLIIAAKTLNDNSPLNKHWSKHTNNLLPNREINIIERE 136

Query: 170 FLKKVNYRI 178
            L  + +R+
Sbjct: 137 LLSYLRWRV 145

>Smik_7.138 Chr7 (249640..250953) [1314 bp, 437 aa] {ON} YGL134W
           (REAL)
          Length = 437

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/113 (23%), Positives = 52/113 (46%), Gaps = 9/113 (7%)

Query: 68  DAKELTRFHSRVPPQISVYDYMMRLTRYSSLEPAVLVASVYYIDLL---------SAMYP 118
           + KE   F+ +  P +S  D++ R+      EP V + +++ I++L           +  
Sbjct: 295 EKKEYANFYMKSKPSLSSVDFLKRIQDKCKYEPTVYLVAMFLIEMLFLTRNKNGDDGLQL 354

Query: 119 SFSLNSLTVHRFLLTATTVASKGLCDSFCTNSHYAKVGGVQCSELHVLESEFL 171
              L    VHR ++ A  +++K L D   ++ +++KV G+    L  LE   L
Sbjct: 355 KRKLKEKEVHRVIIAAVRLSTKLLEDYVHSHEYFSKVCGISKRLLTKLEVSLL 407

>CAGL0J09328g Chr10 (920703..921596) [894 bp, 297 aa] {ON} similar
           to uniprot|P25693 Saccharomyces cerevisiae YDL127w PCL2
           and similar to uniprot|Q12477 Saccharomyces cerevisiae
           YDL179w PCL9
          Length = 297

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/130 (22%), Positives = 67/130 (51%), Gaps = 7/130 (5%)

Query: 53  MLSFLTRINDSVPKDDAKELTRFHSRVPPQISVYDYMMRLTRYSSLEPAVLVASVYYIDL 112
           M+++L R  +S+ +   +E         P   +  ++ +L +YS+++   L+A+  ++  
Sbjct: 19  MITYLARSTESIIQ--VRETHSMIDVAIPAPKLELFIKKLVKYSNVQTPTLMATTVFLTK 76

Query: 113 LSAMYPS--FSLNSLTVHRFLLTATTVASKGLCDSFCTNSHYAKV--GGVQCSELHVLES 168
           L ++ P+  + + + T HR  L    +++K L DS   N H+A+   G +   E++ +E 
Sbjct: 77  LRSIIPANVYGIET-TRHRIFLGCLILSAKTLNDSSPLNKHWAQYTDGLLHLKEVNTIER 135

Query: 169 EFLKKVNYRI 178
           E L+  ++ +
Sbjct: 136 ELLEYFDWNL 145

>YNL289W Chr14 (87897..88736) [840 bp, 279 aa] {ON}  PCL1Cyclin,
           interacts with cyclin-dependent kinase Pho85p; member of
           the Pcl1,2-like subfamily, involved in the regulation of
           polarized growth and morphogenesis and progression
           through the cell cycle; localizes to sites of polarized
           cell growth
          Length = 279

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 56/104 (53%), Gaps = 8/104 (7%)

Query: 77  SRVPPQISVYDYMMRLTRYSSLEPAVLVASVYYIDLLSAMYP--SFSLNSLTVHRFLLTA 134
           +R+P   S+  ++ RL RY+++    L+ +  Y++ L  + P  +  L S T+HR  L  
Sbjct: 50  TRLP---SLMTFITRLVRYTNVYTPTLLTAACYLNKLKRILPRDATGLPS-TIHRIFLAC 105

Query: 135 TTVASKGLCDSFCTNSHYAKV--GGVQCSELHVLESEFLKKVNY 176
             +++K   DS   N H+A+   G     +++++E + L+ +N+
Sbjct: 106 LILSAKFHNDSSPLNKHWARYTDGLFTLEDINLMERQLLQLLNW 149

>Smik_14.42 Chr14 (72224..73063) [840 bp, 279 aa] {ON} YNL289W
           (REAL)
          Length = 279

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 56/104 (53%), Gaps = 8/104 (7%)

Query: 77  SRVPPQISVYDYMMRLTRYSSLEPAVLVASVYYIDLLSAMYP--SFSLNSLTVHRFLLTA 134
           +R+P   S+  ++ RL RY+++    L+ +  Y++ L  + P  +  L S T+HR  L  
Sbjct: 50  ARLP---SLMTFITRLVRYTNVYTPTLLTAACYLNKLKRILPKDATGLPS-TIHRIFLAC 105

Query: 135 TTVASKGLCDSFCTNSHYAKV--GGVQCSELHVLESEFLKKVNY 176
             +++K   DS   N H+A+   G     +++++E + L+ +N+
Sbjct: 106 LILSAKFHNDSSPLNKHWARYTDGLFTLEDINLMERQLLQLLNW 149

>KLTH0A05346g Chr1 complement(445174..446079) [906 bp, 301 aa] {ON}
           similar to uniprot|P25693 Saccharomyces cerevisiae
           YDL127W PCL2 G1 cyclin associates with Pho85p cyclin-
           dependent kinase (Cdk) to contribute to entry into the
           mitotic cell cycle essential for cell morphogenesis
           localizes to sites of polarized cell growth
          Length = 301

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 36/152 (23%), Positives = 76/152 (50%), Gaps = 16/152 (10%)

Query: 53  MLSFLTRINDSVPKDDAKELTRFHSRVPPQISVYDYMMRLTRYSSLEPAVLVASVYYIDL 112
           M+ FL   ++SV +    E +   ++V   +S+ D++  L   S+++   L+++  Y+  
Sbjct: 19  MIEFLASTSNSVIQVRTGESS---AKV---VSLVDFIKGLVVQSNVQTPTLMSTAVYLSK 72

Query: 113 LSAMYPSFSLNSL--TVHRFLLTATTVASKGLCDSFCTNSHYAKV--GGVQCSELHVLES 168
           L ++ P+ +++ +  T HR  L    +A+K L DS   N H+A    G +   E++ +E 
Sbjct: 73  LRSIIPA-NVHGMETTRHRVFLGCLIIAAKNLNDSSPMNKHWASYTNGLLNTREVNTIER 131

Query: 169 EFLKKVNYRILPRDDNISNCKAEKKAGLFVTP 200
           E L+  ++ +     ++  C +      F+TP
Sbjct: 132 ELLEYFDWNLRISTQDLVTCLSP-----FLTP 158

>TPHA0P00810 Chr16 complement(165632..166375) [744 bp, 247 aa] {ON}
           Anc_7.289 YDL179W
          Length = 247

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 50/98 (51%), Gaps = 3/98 (3%)

Query: 84  SVYDYMMRLTRYSSLEPAVLVASVYYIDLLSAMYPSFSLNSLTV-HRFLLTATTVASKGL 142
           S+  ++  + +YS ++   L+AS  +++ L  + P +     T  HR  L    +ASK L
Sbjct: 44  SLTSFICDVVKYSKVKTPTLMASTVFLNRLRCIIPGYVEGIATATHRLFLGCLILASKTL 103

Query: 143 CDSFCTNSHYAKV--GGVQCSELHVLESEFLKKVNYRI 178
            DS   N H+ K   G +   E++ +E E L+ +++ +
Sbjct: 104 NDSSPFNKHWEKYCRGLLSLMEINTIERELLEYMSWNV 141

>Kwal_23.6006 s23 complement(1411337..1412251) [915 bp, 304 aa] {ON}
           YDL127W (PCL2) - G1 cyclin [contig 12] FULL
          Length = 304

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/111 (24%), Positives = 55/111 (49%), Gaps = 3/111 (2%)

Query: 83  ISVYDYMMRLTRYSSLEPAVLVASVYYIDLLSAMYPSFSLN-SLTVHRFLLTATTVASKG 141
           +S+ +++  L   S+++   L+++  Y+  L ++ P+  L    T HR  L    +A+K 
Sbjct: 45  VSLENFIKGLVVQSNVQTPTLMSTAVYLAKLRSIIPANVLGIETTRHRMFLGCLIIAAKN 104

Query: 142 LCDSFCTNSHYAKV--GGVQCSELHVLESEFLKKVNYRILPRDDNISNCKA 190
           L DS   N H+A    G +   E++ +E E L+  ++ +      ++ C A
Sbjct: 105 LNDSSPMNKHWASYTNGLLDTREVNTIERELLEYFDWNLQFSTQELAICLA 155

>Skud_14.48 Chr14 (81435..82274) [840 bp, 279 aa] {ON} YNL289W
           (REAL)
          Length = 279

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 57/106 (53%), Gaps = 8/106 (7%)

Query: 77  SRVPPQISVYDYMMRLTRYSSLEPAVLVASVYYIDLLSAMYP--SFSLNSLTVHRFLLTA 134
           +R+P   S+  ++ RL RY+++    L+ +  Y++ L  + P  +  L S T+HR  L  
Sbjct: 50  ARLP---SLMTFITRLVRYTNVYTPTLLTAACYLNKLKRILPKDATGLPS-TIHRIFLAC 105

Query: 135 TTVASKGLCDSFCTNSHYAKV--GGVQCSELHVLESEFLKKVNYRI 178
             +++K   DS   N H+A+   G     +++++E + L+ +N+ +
Sbjct: 106 LILSAKFHNDSSPLNKHWARYTDGLFTLEDINLMERQLLQLLNWDL 151

>TBLA0A07890 Chr1 (1943543..1944628) [1086 bp, 361 aa] {ON} Anc_3.70
           YNL289W
          Length = 361

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/103 (22%), Positives = 56/103 (54%), Gaps = 3/103 (2%)

Query: 79  VPPQISVYDYMMRLTRYSSLEPAVLVASVYYIDLLSAMYPSFSLN-SLTVHRFLLTATTV 137
           +P   S+  ++ R+ RY++++ + L+ +V Y++ L  + P+ ++    T+HR  L    +
Sbjct: 55  IPKLPSLMTFITRIVRYTNVQVSTLLMTVCYLNKLKKLLPADAVGIPSTIHRLFLACLIL 114

Query: 138 ASKGLCDSFCTNSHYAKV--GGVQCSELHVLESEFLKKVNYRI 178
           ++K   DS   N H+A    G     +++++E + L  +++ +
Sbjct: 115 SAKFHNDSSPLNVHWANYTNGLFSVKDVNLMERQLLSLLDWNL 157

>TDEL0H01550 Chr8 (266510..267439) [930 bp, 309 aa] {ON} Anc_7.289
           YDL179W
          Length = 309

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/114 (24%), Positives = 57/114 (50%), Gaps = 5/114 (4%)

Query: 81  PQISVYDYMMRLTRYSSLEPAVLVASVYYIDLLSAMYPS--FSLNSLTVHRFLLTATTVA 138
           P  S+ +++  L  +S+++   L+A+  Y+  L ++ P   + + + T HR  L    +A
Sbjct: 45  PAPSLTNFIKGLVLHSNVQTPTLMATAVYLAKLRSIIPGNVYGIET-TRHRIFLGCLILA 103

Query: 139 SKGLCDSFCTNSHYAKV--GGVQCSELHVLESEFLKKVNYRILPRDDNISNCKA 190
           +K L DS   N H+A    G +   E++ +E E L+  ++ +     ++  C A
Sbjct: 104 AKTLNDSSPLNKHWALYTDGLLHIHEVNTIERELLEYFDWNVTVTTKDLITCLA 157

>KLLA0E13223g Chr5 (1170139..1170987) [849 bp, 282 aa] {ON} similar
           to uniprot|P24867 Saccharomyces cerevisiae YNL289W PCL1
           Pho85 cyclin of the Pcl1 2-like subfamily involved in
           entry into the mitotic cell cycle and regulation of
           morphogenesis localizes to sites of polarized cell
           growth
          Length = 282

 Score = 39.7 bits (91), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 53/104 (50%), Gaps = 6/104 (5%)

Query: 76  HSRVPPQISVYDYMMRLTRYSSLEPAVLVASVYYIDLLSAMYPSFSLN-SLTVHRFLLTA 134
           H+ VP   S+  ++ RL RY+++  + L+ +V Y++ L  + PS +     T HR  L  
Sbjct: 53  HNGVP---SLMTFISRLVRYTNVYTSTLLTTVVYLNRLRELLPSDAAGLPTTCHRIFLAC 109

Query: 135 TTVASKGLCDSFCTNSHYAKV--GGVQCSELHVLESEFLKKVNY 176
             +++K   DS   N H+ K   G     +++++E + L+   +
Sbjct: 110 LILSAKYHNDSSPLNKHWTKYTDGMFTLRDVNLMERQLLQLFEW 153

>Skud_4.128 Chr4 (230632..231558) [927 bp, 308 aa] {ON} YDL127W
           (REAL)
          Length = 308

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 27/109 (24%), Positives = 57/109 (52%), Gaps = 5/109 (4%)

Query: 81  PQISVYDYMMRLTRYSSLEPAVLVASVYYIDLLSAMYPS--FSLNSLTVHRFLLTATTVA 138
           P   +  ++  L ++S+++   L+A+  Y+  L ++ PS  + + + T HR  L    +A
Sbjct: 45  PAPPLTKFINGLIKHSNVQTPTLMATSVYLAKLRSIIPSNVYGIET-TRHRIFLGCLILA 103

Query: 139 SKGLCDSFCTNSHYAKV--GGVQCSELHVLESEFLKKVNYRILPRDDNI 185
           +K L DS   N H+A+   G +   E++ +E E L+  ++ +    D++
Sbjct: 104 AKTLNDSSPLNKHWAEYTDGLLVLREVNTIERELLEYFDWDVTISTDDL 152

>ZYRO0C02068g Chr3 complement(163475..164467) [993 bp, 330 aa] {ON}
           similar to uniprot|P24867 Saccharomyces cerevisiae
           YNL289W PCL1 Pho85 cyclin of the Pcl1 2-like subfamily
           involved in entry into the mitotic cell cycle and
           regulation of morphogenesis localizes to sites of
           polarized cell growth
          Length = 330

 Score = 39.3 bits (90), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 27/113 (23%), Positives = 62/113 (54%), Gaps = 8/113 (7%)

Query: 77  SRVPPQISVYDYMMRLTRYSSLEPAVLVASVYYIDLLSAMYP--SFSLNSLTVHRFLLTA 134
           S++P   S+  ++ RL R++++  + L+ +  Y++ L  + P  +  L S T+HR  L  
Sbjct: 83  SKLP---SLMSFISRLVRHTNVYTSTLLVTACYLNRLKCILPKDASGLPS-TIHRMFLAC 138

Query: 135 TTVASKGLCDSFCTNSHYAKV--GGVQCSELHVLESEFLKKVNYRILPRDDNI 185
             +++K   DS   N H+AK   G     +++++E + ++ +N+ +   +D++
Sbjct: 139 LILSAKFHNDSSPLNKHWAKYTDGLFSVEDVNLMERQLVQLLNWDLRVTNDDL 191

>Skud_4.79 Chr4 (134241..135170) [930 bp, 309 aa] {ON} YDL179W
           (REAL)
          Length = 309

 Score = 38.5 bits (88), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 25/111 (22%), Positives = 57/111 (51%), Gaps = 5/111 (4%)

Query: 85  VYDYMMRLTRYSSLEPAVLVASVYYIDLLSAMYPS--FSLNSLTVHRFLLTATTVASKGL 142
           ++ ++ ++   S+++   L+A+  Y++ L  + P+  + + + T HR  L    +A+K L
Sbjct: 48  LFTFIKKVVIQSNVQTPTLMATTVYLNKLKNIIPTNVYGIET-TRHRIFLGCLILAAKTL 106

Query: 143 CDSFCTNSHYAKV--GGVQCSELHVLESEFLKKVNYRILPRDDNISNCKAE 191
            DS   N H++    G ++  E++ +E E L+  N+ +     ++ N  A 
Sbjct: 107 NDSSPWNKHWSTYTEGLLKVREVNTIERELLEYFNWDVKITSSDLINALAH 157

>ZYRO0E07326g Chr5 complement(560064..561350) [1287 bp, 428 aa] {ON}
           weakly similar to uniprot|P53124 Saccharomyces
           cerevisiae YGL134W PCL10 Pho85p cyclin recruits
           activates and targets Pho85p cyclin-dependent protein
           kinase to its substrate
          Length = 428

 Score = 38.9 bits (89), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 24/112 (21%), Positives = 50/112 (44%), Gaps = 8/112 (7%)

Query: 64  VPKDDAKELTRFHSRVPPQISVYDYMMRLTRYSSLEPAVLVASVYYIDLLSAMYPSFS-- 121
           VP     +  +F  +  P ++  +++ R+    +  PAV +AS + +  L  M    +  
Sbjct: 280 VPNPRDWDFNQFSMKSMPTVTYQEFITRIQTKCTYSPAVFLASAFLLQTLCLMRNDNNGE 339

Query: 122 ------LNSLTVHRFLLTATTVASKGLCDSFCTNSHYAKVGGVQCSELHVLE 167
                 L    +HR ++    +A+K + D   ++ +++KV G+    L  LE
Sbjct: 340 LCLRHRLQDSQIHRLVIACVRIATKIMEDHVHSHQYFSKVCGISKRLLSRLE 391

>NDAI0A02270 Chr1 (511135..512127) [993 bp, 330 aa] {ON} Anc_7.289
          Length = 330

 Score = 38.5 bits (88), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 26/105 (24%), Positives = 52/105 (49%), Gaps = 8/105 (7%)

Query: 78  RVPPQISVYDYMMRLTRYSSLEPAVLVASVYYIDLLSAMYPS--FSLNSLTVHRFLLTAT 135
            +PP   + +++  L  +S+++   L+A+  Y+  L  + P   + + + T HR  L   
Sbjct: 49  EIPP---LSNFIKNLVMHSNVQTPTLMATSVYLSKLRLIIPKNVYGMET-TRHRIFLGCL 104

Query: 136 TVASKGLCDSFCTNSHYAKV--GGVQCSELHVLESEFLKKVNYRI 178
            +A+K L DS   N H+ K   G +   E++ +E E L+   + +
Sbjct: 105 ILAAKTLNDSSPLNKHWTKYTDGLLHIREVNTIERELLEYFEWNV 149

>YDL179W Chr4 (138291..139205) [915 bp, 304 aa] {ON}  PCL9Cyclin,
           forms a functional kinase complex with Pho85p
           cyclin-dependent kinase (Cdk), expressed in late M/early
           G1 phase, activated by Swi5p
          Length = 304

 Score = 38.1 bits (87), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 67/128 (52%), Gaps = 13/128 (10%)

Query: 80  PPQISVYDYMMRLTRYSSLE-PAVLVASVYYIDLLSAMYPS--FSLNSLTVHRFLLTATT 136
           PP +S++  +  +   S+++ P ++  SV Y++ L ++ P   + +N+ T HR  L    
Sbjct: 46  PPDLSIF--IKNVVIQSNVQTPTLMATSV-YLNKLKSVIPKNVYGINT-TRHRIFLGCLI 101

Query: 137 VASKGLCDSFCTNSHYAKV--GGVQCSELHVLESEFLKKVNY--RILPRD--DNISNCKA 190
           +A+K L DS   N H+     G ++  E++ +E E L+ +N+  RI   D  D++S    
Sbjct: 102 LAAKTLNDSSPWNKHWTTYTEGLLRIREVNTIERELLEYLNWDVRITTPDLIDSLSYFLG 161

Query: 191 EKKAGLFV 198
             K  LF+
Sbjct: 162 PIKEQLFL 169

>Kpol_1020.16 s1020 complement(33477..34325) [849 bp, 282 aa] {ON}
           complement(33477..34325) [849 nt, 283 aa]
          Length = 282

 Score = 37.7 bits (86), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 26/105 (24%), Positives = 54/105 (51%), Gaps = 8/105 (7%)

Query: 76  HSRVPPQISVYDYMMRLTRYSSLEPAVLVASVYYIDLLSAMYP--SFSLNSLTVHRFLLT 133
             R+P   S+  ++ +L RY+++  + L+ +  Y+  L  + P  +  L S T+HR  L 
Sbjct: 49  QQRLP---SLMTFITKLVRYTNVYTSTLLTTTCYLKKLQRILPKDATGLPS-TIHRMFLA 104

Query: 134 ATTVASKGLCDSFCTNSHYAKV--GGVQCSELHVLESEFLKKVNY 176
              +++K   DS   N H+A+   G     +++++E + L  +N+
Sbjct: 105 CLIISAKYHNDSSPLNKHWAEYTDGLFSLEDVNLMEMQLLALLNW 149

>TDEL0E00790 Chr5 (163333..164097) [765 bp, 254 aa] {ON} Anc_3.70
           YNL289W
          Length = 254

 Score = 36.6 bits (83), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 24/97 (24%), Positives = 52/97 (53%), Gaps = 5/97 (5%)

Query: 84  SVYDYMMRLTRYSSLEPAVLVASVYYIDLLSAMYP--SFSLNSLTVHRFLLTATTVASKG 141
           S+  ++ RL R++++  + L+ +  Y++ L  + P  +  L S TVHR  L    +++K 
Sbjct: 51  SLMSFISRLVRHTNVYTSTLLTTACYLNKLKCILPKDASGLPS-TVHRIFLACLILSAKF 109

Query: 142 LCDSFCTNSHYAKVGG--VQCSELHVLESEFLKKVNY 176
             DS   N H+AK         +++++E + ++ +N+
Sbjct: 110 HNDSSPLNRHWAKYTDELFTLEDINLMERQLIQLLNW 146

>KLLA0F05654g Chr6 (552056..552991) [936 bp, 311 aa] {ON} weakly
           similar to uniprot|P25693 Saccharomyces cerevisiae
           YDL127W PCL2 G1 cyclin associates with Pho85p
           cyclin-dependent kinase (Cdk) to contribute to entry
           into the mitotic cell cycle essential for cell
           morphogenesis localizes to sites of polarized cell
           growth
          Length = 311

 Score = 36.6 bits (83), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 24/99 (24%), Positives = 48/99 (48%), Gaps = 3/99 (3%)

Query: 83  ISVYDYMMRLTRYSSLEPAVLVASVYYIDLLSAMYPSFSLN-SLTVHRFLLTATTVASKG 141
           +S+ D++  L R+S+++   L+A+  Y+  L ++ P        T HR  +    +A+K 
Sbjct: 44  VSLVDFIKSLIRHSNVQTPTLMATTVYLTKLRSILPHDVCGIETTRHRIFIGCLILAAKN 103

Query: 142 LCDSFCTNSHYAKV--GGVQCSELHVLESEFLKKVNYRI 178
           L DS   N H+     G     +++ +E E L   ++ +
Sbjct: 104 LNDSSPLNKHWTNYTDGLFTLEDVNTIERELLSLFSWNL 142

>Smik_4.60 Chr4 (115068..115985) [918 bp, 305 aa] {ON} YDL179W
           (REAL)
          Length = 305

 Score = 36.2 bits (82), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 34/126 (26%), Positives = 60/126 (47%), Gaps = 11/126 (8%)

Query: 80  PPQISVYDYMMRLTRYSSLEPAVLVASVYYIDLLSAMYPS--FSLNSLTVHRFLLTATTV 137
           PP +S +  +  +   S+++   L+A+  Y++ L  + P   + + + T HR  L    +
Sbjct: 47  PPDLSTF--IKNVVIQSNVQTPTLMATSVYLNKLRNIIPRNVYGIET-TRHRIFLGCLIL 103

Query: 138 ASKGLCDSFCTNSHYAKV--GGVQCSELHVLESEFLKKVNY--RILPRD--DNISNCKAE 191
           A+K L DS   N H+     G ++  E++ +E E L+  N+  RI   D  D +S     
Sbjct: 104 AAKTLNDSSPWNKHWTTYTEGLLRVREVNTIERELLEYFNWDVRITTHDLVDALSYFLVP 163

Query: 192 KKAGLF 197
            K  LF
Sbjct: 164 IKEQLF 169

>Ecym_1201 Chr1 (406247..407581) [1335 bp, 444 aa] {ON} similar to
           Ashbya gossypii AER440C
          Length = 444

 Score = 35.8 bits (81), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 38/68 (55%), Gaps = 2/68 (2%)

Query: 127 VHRFLLTATTVASKGLCDSFCTNSHYAKVGGVQCSELHVLESEFLKKVNYRILPRDDNIS 186
           +++ L+ A  +A+K   D   TN  +++  G++CS ++  E E+L    +R+   +D   
Sbjct: 225 IYQNLMVAFVLANKFNDDKTFTNKSWSQATGMKCSVINTYEREWLAVFEWRLF--EDGFE 282

Query: 187 NCKAEKKA 194
           N +A ++A
Sbjct: 283 NYEAYREA 290

>SAKL0C12100g Chr3 complement(1083684..1084628) [945 bp, 314 aa]
           {ON} similar to gnl|GLV|CAGL0E02233g Candida glabrata
           CAGL0E02233g and some similarites with YNL289W
           uniprot|P24867 Saccharomyces cerevisiae YNL289W PCL1
           Pho85 cyclin of the Pcl1 2-like subfamily involved in
           entry into the mitotic cell cycle and regulation of
           morphogenesis localizes to sites of polarized cell
           growth
          Length = 314

 Score = 35.4 bits (80), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 24/108 (22%), Positives = 57/108 (52%), Gaps = 5/108 (4%)

Query: 84  SVYDYMMRLTRYSSLEPAVLVASVYYIDLLSAMYP--SFSLNSLTVHRFLLTATTVASKG 141
           S+  ++ +L RY+++  + L+ +V Y+  L  + P  +  L S T HR  L    +++K 
Sbjct: 55  SLMTFITKLVRYTNVYTSTLLTTVCYLSKLKTILPRDATGLPS-TTHRIFLACLILSAKF 113

Query: 142 LCDSFCTNSHYAKV--GGVQCSELHVLESEFLKKVNYRILPRDDNISN 187
             DS   N+H+++   G     +++++E + L+ +++ +    D ++ 
Sbjct: 114 HNDSSPLNAHWSRYTDGLFSLEDVNLMERQLLQLLHWDLRINQDALAQ 161

>KAFR0A08280 Chr1 complement(1661106..1661831) [726 bp, 241 aa] {ON}
           Anc_3.70 YNL289W
          Length = 241

 Score = 34.7 bits (78), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 24/112 (21%), Positives = 50/112 (44%), Gaps = 13/112 (11%)

Query: 80  PPQISVYD----------YMMRLTRYSSLEPAVLVASVYYIDLLSAMYPSFSLN-SLTVH 128
           PP   +YD          ++ +L  Y+ +    L+ ++ Y++ L  + P  +     T+H
Sbjct: 41  PPSSPLYDEEDELPTLREFICKLVEYTHVYTPTLLMTISYLNRLRRILPKGAAGIPSTLH 100

Query: 129 RFLLTATTVASKGLCDSFCTNSHYAKV--GGVQCSELHVLESEFLKKVNYRI 178
           R  L    +++K   DS   N H+ K   G     +++++E   L  +N+ +
Sbjct: 101 RIFLACLIISAKNHNDSSPLNRHWTKYTDGLFTLEDVNLMERHLLDLLNWNL 152

>NDAI0A06050 Chr1 complement(1372672..1373532) [861 bp, 286 aa] {ON}
           Anc_3.70
          Length = 286

 Score = 34.3 bits (77), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 49/97 (50%), Gaps = 8/97 (8%)

Query: 75  FHSRVPPQISVYDYMMRLTRYSSLEPAVLVASVYYIDLLSAMYP--SFSLNSLTVHRFLL 132
           +  R+P   S+  ++  L RY+++    L+ +V Y++ L  + P  +  L S T+HR  L
Sbjct: 48  YQPRLP---SLMTFITNLVRYTNVYTPTLLTTVCYLNKLKRLLPKDATGLPS-TIHRIFL 103

Query: 133 TATTVASKGLCDSFCTNSHYAKV--GGVQCSELHVLE 167
               +++K   DS   N H+ K   G     +++++E
Sbjct: 104 ACLILSAKFHNDSSPLNKHWVKYTDGLFTLEDVNLME 140

>NCAS0A09870 Chr1 complement(1974028..1974912) [885 bp, 294 aa] {ON}
           Anc_3.70
          Length = 294

 Score = 34.3 bits (77), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 49/94 (52%), Gaps = 8/94 (8%)

Query: 78  RVPPQISVYDYMMRLTRYSSLEPAVLVASVYYIDLLSAMYP--SFSLNSLTVHRFLLTAT 135
           R+P   S+  ++ RL RY+++    L+ +V Y++ L  + P  +  L S T+HR  L   
Sbjct: 51  RLP---SLMTFITRLVRYTNVYTPTLLTTVCYLNKLKRILPKDATGLPS-TIHRIFLACL 106

Query: 136 TVASKGLCDSFCTNSHYAKV--GGVQCSELHVLE 167
            +++K   DS   N H+ K   G     +++++E
Sbjct: 107 ILSAKFHNDSSPLNKHWVKYTDGLFTLEDVNLME 140

>CAGL0J06336g Chr10 complement(602954..603898) [945 bp, 314 aa] {ON}
           similar to uniprot|Q12477 Saccharomyces cerevisiae
           YDL179w PCL9 or uniprot|P25693 Saccharomyces cerevisiae
           YDL127w
          Length = 314

 Score = 33.9 bits (76), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 64/129 (49%), Gaps = 10/129 (7%)

Query: 53  MLSFLTRINDSVPKDDAKELTRFHSRVPPQISVYDYMMRLTRYSSLEPAVLVASVYYIDL 112
           ML+FL    +S+ K     + + +S  P ++S++  +  L   S ++ + L+A+  Y+D 
Sbjct: 30  MLTFLISKTNSMIK-----IKKTNSPKPVELSLF--VEELVASSKVQASTLMATAVYLDR 82

Query: 113 LSAMYPSFSLN-SLTVHRFLLTATTVASKGLCDSFCTNSHYAKV--GGVQCSELHVLESE 169
           LS + PS       T HR  L    ++SK L DS   N H+ K   G +   E++ +E E
Sbjct: 83  LSRIIPSNVCGIETTKHRMFLGCLILSSKSLDDSSLFNKHWTKYCNGLLTLKEVNSIERE 142

Query: 170 FLKKVNYRI 178
            L   N+ I
Sbjct: 143 LLSYFNWDI 151

>NDAI0C01980 Chr3 complement(445212..445892) [681 bp, 226 aa] {ON}
           Anc_5.347 YHR071W
          Length = 226

 Score = 33.5 bits (75), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 53/107 (49%), Gaps = 5/107 (4%)

Query: 78  RVP-PQISVYDYMMR-LTRYSSLEPAVLVASVYYIDLLSAMYPSFSLNSLTVH---RFLL 132
           +VP  + S+  Y+M  L R  S    V+VAS Y+  L +++  +   N   VH   R  L
Sbjct: 80  KVPNEKSSIKTYLMEILKRSQSSRNNVIVASFYFQKLYNSVQLNQDPNPEFVHCSKRIFL 139

Query: 133 TATTVASKGLCDSFCTNSHYAKVGGVQCSELHVLESEFLKKVNYRIL 179
           +   ++ K L D   +   ++ + G+   +L +LE   L ++NY ++
Sbjct: 140 SCLILSHKFLNDKTFSMKAWSLISGISKRDLSILERWCLMRLNYHLV 186

>Skud_16.494 Chr16 complement(859384..861351) [1968 bp, 655 aa] {ON}
           YPR190C (REAL)
          Length = 655

 Score = 33.9 bits (76), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 26/105 (24%), Positives = 47/105 (44%), Gaps = 5/105 (4%)

Query: 116 MYPSFSLNSLTVHRFLLTATTVASK----GLCDSFCTNSHYAKVGGVQCSELHVLESEFL 171
           M    SL SLTV  +L  AT+ + K     L    C   +  ++  +  + +  L  +FL
Sbjct: 160 MQNVISLGSLTVQDYLSNATSESMKYTISSLFVQLCEMGYLIEISKLHYTPIEDL-WQFL 218

Query: 172 KKVNYRILPRDDNISNCKAEKKAGLFVTPTYSKSCRGPNNGFNVL 216
              +Y+ +PR+  +S+ K   +A +     ++K    PN    +L
Sbjct: 219 YDKHYKAIPRNSPLSDLKKRSQAKMNAKTDFAKIMNKPNELSRIL 263

>Smik_16.454 Chr16 complement(779609..781579) [1971 bp, 656 aa] {ON}
           YPR190C (REAL)
          Length = 656

 Score = 33.9 bits (76), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 48/102 (47%), Gaps = 7/102 (6%)

Query: 120 FSLNSLTVHRFLLTATTVASKGLCDSFCTNSHYAKVG-GVQCSELHVLESE----FLKKV 174
            SL SLTV  +L + T+ ++K    S        ++G  +Q S+LH    E    FL   
Sbjct: 164 ISLGSLTVEDYLSSVTSDSTKYTISSLFV--QLCEMGYLIQISKLHYTPIEDLWQFLYDK 221

Query: 175 NYRILPRDDNISNCKAEKKAGLFVTPTYSKSCRGPNNGFNVL 216
           +Y+ +PR+  +S+ K   +A +     ++K    PN    +L
Sbjct: 222 HYKAIPRNSPLSDLKKRSQAKMNAKTDFAKIINKPNELSQIL 263

>KAFR0C01560 Chr3 complement(320148..320951) [804 bp, 267 aa] {ON}
           Anc_3.70 YNL289W
          Length = 267

 Score = 33.1 bits (74), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 25/94 (26%), Positives = 49/94 (52%), Gaps = 8/94 (8%)

Query: 78  RVPPQISVYDYMMRLTRYSSLEPAVLVASVYYIDLLSAMYP--SFSLNSLTVHRFLLTAT 135
           R+P   S+  ++ RL RY+++    L+ +V Y++ L  + P  +  L S T+HR  L   
Sbjct: 56  RLP---SLRTFITRLVRYTNVYTPTLLTTVCYLNKLKRILPKDAKGLPS-TIHRLFLACL 111

Query: 136 TVASKGLCDSFCTNSHYAKV--GGVQCSELHVLE 167
            +++K   DS   N H+ +   G     +++++E
Sbjct: 112 IISAKFHNDSSPLNKHWTRYTDGLFSLEDINLME 145

>TPHA0A03250 Chr1 (717085..717954) [870 bp, 289 aa] {ON} Anc_7.289
           YDL179W
          Length = 289

 Score = 33.1 bits (74), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 25/103 (24%), Positives = 51/103 (49%), Gaps = 7/103 (6%)

Query: 80  PPQISVYDYMMRLTRYSSLEPAVLVASVYYIDLLSAMYPS--FSLNSLTVHRFLLTATTV 137
           PP ++   ++  +   S+++   L+A+   ++ L  + PS  + + S T HR  L    +
Sbjct: 46  PPPLA--KFIKNICVKSNVQTPTLMATTVLLEKLKKIIPSNVYGIES-TRHRIFLGCLIL 102

Query: 138 ASKGLCDSFCTNSHYAKVGG--VQCSELHVLESEFLKKVNYRI 178
           ++K L DS   N H+AK     +   E++ +E E L   ++ +
Sbjct: 103 SAKSLNDSSPLNKHWAKYTESYIHLREVNTIERELLNYFDWNV 145

>Kwal_23.5231 s23 complement(1069167..1069937) [771 bp, 256 aa] {ON}
           YNL289W (PCL1) - G(sub)1 cyclin that associates with
           PHO85 [contig 8] FULL
          Length = 256

 Score = 32.7 bits (73), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 45/90 (50%), Gaps = 6/90 (6%)

Query: 76  HSRVPPQISVYDYMMRLTRYSSLEPAVLVASVYYIDLLSAMYP--SFSLNSLTVHRFLLT 133
           H R  P  S+  ++ RL RY+++  + L+ +  Y++ L  + P  +  L S T HR  L 
Sbjct: 53  HKRTLP--SLMTFVTRLVRYTNVYTSTLLTATCYLEKLRRLLPRDAHGLPS-TSHRIFLA 109

Query: 134 ATTVASKGLCDSFCTNSHYAK-VGGVQCSE 162
              +++K   DS   N H+A    G+ C E
Sbjct: 110 CLILSAKFHNDSSPQNKHWAAYTDGLFCLE 139

>YPR190C Chr16 complement(917077..919041) [1965 bp, 654 aa] {ON}
           RPC82RNA polymerase III subunit C82
          Length = 654

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 48/102 (47%), Gaps = 7/102 (6%)

Query: 120 FSLNSLTVHRFLLTATTVASKGLCDSFCTNSHYAKVG-GVQCSELHVLESE----FLKKV 174
            SL SLTV  +L + T+ + K    S        ++G  +Q S+LH    E    FL + 
Sbjct: 164 ISLGSLTVEDYLSSVTSDSMKYTISSLFV--QLCEMGYLIQISKLHYTPIEDLWQFLYEK 221

Query: 175 NYRILPRDDNISNCKAEKKAGLFVTPTYSKSCRGPNNGFNVL 216
           +Y+ +PR+  +S+ K   +A +     ++K    PN    +L
Sbjct: 222 HYKNIPRNSPLSDLKKRSQAKMNAKTDFAKIINKPNELSQIL 263

>NDAI0F01480 Chr6 (365467..366939) [1473 bp, 490 aa] {ON} Anc_6.236
           YGL134W
          Length = 490

 Score = 32.3 bits (72), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 23/108 (21%), Positives = 45/108 (41%), Gaps = 8/108 (7%)

Query: 68  DAKELTRFHSRVPPQISVYDYMMRLTRYSSLEPAVLVASVYYIDLL--------SAMYPS 119
           D K+   F  +  P +S  D++ R+         + +++ Y   +L          +   
Sbjct: 348 DTKDYVNFTMKNTPSLSYEDFLKRIQSKCMFGAIIYMSATYLFQILLLNRDDSKGPIKLK 407

Query: 120 FSLNSLTVHRFLLTATTVASKGLCDSFCTNSHYAKVGGVQCSELHVLE 167
             L  + +HR ++    VA+K + D   ++ ++ KV GV    L  LE
Sbjct: 408 NKLQEVEIHRMIIATIRVATKLVEDFVHSHQYFCKVCGVSKRLLSKLE 455

>ZYRO0C14454g Chr3 (1130631..1131161) [531 bp, 176 aa] {ON} some
           similarities with uniprot|P38794 Saccharomyces
           cerevisiae YHR071W PCL5 Cyclin interacts with Pho85p
           cyclin-dependent kinase (Cdk) induced by Gcn4p at level
           of transcription specifically required for Gcn4p
           degradation may be sensor of cellular protein
           biosynthetic capacity
          Length = 176

 Score = 31.2 bits (69), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 31/147 (21%), Positives = 61/147 (41%), Gaps = 13/147 (8%)

Query: 49  LISRMLSFLTRINDSVPKDDAKELTRFHSRVPPQISVYDYMMRLTRYSSLEPAVLVASVY 108
           L+ RM  FLT    +  KDD K + RF   +            L R      + L+A+ Y
Sbjct: 37  LVDRMALFLTLNTKTTAKDDYKSIRRFLKEL------------LRRSQCNRRSALLAAAY 84

Query: 109 YIDLLSAMYPSFSLN-SLTVHRFLLTATTVASKGLCDSFCTNSHYAKVGGVQCSELHVLE 167
             ++   M      + +    +  L+   +++K L D   +   +  V G+  +E+  +E
Sbjct: 85  VENIYQTMGDENGDDFAKCAKKVYLSCLIISNKFLNDKTLSFRTWRLVSGLTPAEMSTME 144

Query: 168 SEFLKKVNYRILPRDDNISNCKAEKKA 194
              L K++Y +  +D  + + +   +A
Sbjct: 145 RWCLDKLDYHLYIKDAELYDLEKRMRA 171

>KLTH0H13860g Chr8 (1210300..1211118) [819 bp, 272 aa] {ON} similar
           to uniprot|P25362 Saccharomyces cerevisiae YCR020C PET18
           Protein required for respiratory growth and stability of
           the mitochondrial genome
          Length = 272

 Score = 31.6 bits (70), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 30/123 (24%), Positives = 50/123 (40%), Gaps = 11/123 (8%)

Query: 57  LTRINDSVPKDDAKELTRFHSRVPPQISVYDYMMRLTRYSSLEPAVLVASVYYIDLLSAM 116
           L  I D++P  D     RF     PQ+  Y  ++  T  S    A L+  VY ++L+   
Sbjct: 149 LAHIADALPAADQ---ARFRESRLPQVDRYVQLLERTAKSETSYAKLITFVYCMELVYLQ 205

Query: 117 YPSFSLNSLTVHRFLLTATTVASKGLCDSFCT-------NSHYAKVGGVQCSELHVLESE 169
           +P     ++ +H    T   + +    +++C           YA+V G     L  LE E
Sbjct: 206 WPKNCTVAVGLHWKYQTWIDLHAGDHFETWCEFLQQEVDKCDYAEVSGTFAQVLQ-LELE 264

Query: 170 FLK 172
           F +
Sbjct: 265 FFE 267

>Suva_16.522 Chr16 complement(899518..901476) [1959 bp, 652 aa] {ON}
           YPR190C (REAL)
          Length = 652

 Score = 31.6 bits (70), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 47/102 (46%), Gaps = 7/102 (6%)

Query: 120 FSLNSLTVHRFLLTATTVASKGLCDSFCTNSHYAKVG-GVQCSELHVLESE----FLKKV 174
            SL SLTV  +L + T+ + K    S        ++G  +Q S+LH    E    FL   
Sbjct: 162 ISLGSLTVEDYLSSVTSESMKYTISSLFV--QLCEMGYLIQISKLHYTPIEDLWQFLFDK 219

Query: 175 NYRILPRDDNISNCKAEKKAGLFVTPTYSKSCRGPNNGFNVL 216
           +Y  +PR+  +S+ K   +A +     ++K    PN+   +L
Sbjct: 220 HYNTIPRNSPLSDLKKRSQAKMNAKTDFAKILSKPNDLSQIL 261

>CAGL0J07568g Chr10 complement(736677..738077) [1401 bp, 466 aa]
           {ON} highly similar to uniprot|Q01532 Saccharomyces
           cerevisiae YNL239w LAP3 member of the GAL regulon
          Length = 466

 Score = 31.6 bits (70), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 32/69 (46%), Gaps = 2/69 (2%)

Query: 124 SLTVHRFLLTATTVASKGLCDSFCTNSHYAKVGGVQCSELHVLESEFLKKVNYRILPRDD 183
           SL  H  L+TA  V   G    FC  + + K  G     ++V+  E+ ++  Y+I+   D
Sbjct: 380 SLMTHAMLITAAHVDDDGNPVRFCVENSWGKDSGKDG--MYVMTPEYFEEYCYQIVVDID 437

Query: 184 NISNCKAEK 192
            +    AEK
Sbjct: 438 ELPTDLAEK 446

>AEL195W Chr5 (266347..267060) [714 bp, 237 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL289W (PCL1)
          Length = 237

 Score = 30.8 bits (68), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 28/108 (25%), Positives = 52/108 (48%), Gaps = 9/108 (8%)

Query: 84  SVYDYMMRLTRYSSLEPA-VLVASVYYIDLLSAMYPSFSLNSLTVHRFLLTATTVASKGL 142
           S++ ++ RL RY+++  A +L  +VY   L   +    +    T HR  L    +++K  
Sbjct: 53  SIHMFITRLVRYTNVYTATLLTTAVYLERLRLLLPRDATGIPSTAHRIFLACLILSAKFH 112

Query: 143 CDSFCTNSHYAKV--GGVQCSELHVLESEFLK------KVNYRILPRD 182
            DS   N H+ K   G     +++++E + L+      +V +R L RD
Sbjct: 113 NDSSPLNKHWTKYTDGLFTTQDVNLMERQLLRLFDWNVRVGHRDLCRD 160

>KLTH0A01584g Chr1 (141289..142134) [846 bp, 281 aa] {ON} similar to
           uniprot|P24867 Saccharomyces cerevisiae YNL289W PCL1
           Pho85 cyclin of the Pcl1 2-like subfamily involved in
           entry into the mitotic cell cycle and regulation of
           morphogenesis localizes to sites of polarized cell
           growth
          Length = 281

 Score = 30.4 bits (67), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 41/80 (51%), Gaps = 4/80 (5%)

Query: 84  SVYDYMMRLTRYSSLEPAVLVASVYYIDLLSAMYP--SFSLNSLTVHRFLLTATTVASKG 141
           S+  ++ RL RY+++  + L+ +  Y++ L  + P  +  L S T HR  L    +++K 
Sbjct: 87  SLMTFITRLVRYTNVYTSTLLTATCYLEKLRRLLPRDAHGLPS-TGHRIFLACLILSAKY 145

Query: 142 LCDSFCTNSHYAK-VGGVQC 160
             DS   N H+A    G+ C
Sbjct: 146 HNDSSPQNKHWAAYTDGLFC 165

>ADR383C Chr4 complement(1393399..1395552) [2154 bp, 717 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR354C
           (MSC6)
          Length = 717

 Score = 30.0 bits (66), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 41/92 (44%), Gaps = 10/92 (10%)

Query: 77  SRVPPQISVYDYMMRLTRYSSL-----EPAVLVASVYYIDLLSAMYPSFSLNSLTVHRFL 131
           S    QI+V+  +  +  +S+L     EP+ L     Y  L S +Y +     L      
Sbjct: 552 SNAKSQINVHTLLPLIAGFSNLILRNNEPSFLSKLDTYWQLASRVYKTIPFEFLNK---- 607

Query: 132 LTATTVASKGLCDSFCTNSHYAKVGGVQCSEL 163
            TAT VAS  L ++  T+ HY  +  V  SEL
Sbjct: 608 -TATAVASLCLKEAKLTDEHYNFINAVVMSEL 638

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.132    0.383 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 27,064,851
Number of extensions: 1076008
Number of successful extensions: 2794
Number of sequences better than 10.0: 116
Number of HSP's gapped: 2794
Number of HSP's successfully gapped: 119
Length of query: 280
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 172
Effective length of database: 41,097,471
Effective search space: 7068765012
Effective search space used: 7068765012
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)