Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_56.224396.23ON32032017090.0
KLTH0C11154g6.23ON30529911471e-158
SAKL0E01342g6.23ON34130411111e-152
ZYRO0C07722g6.23ON37330010621e-144
NCAS0D021706.23ON31030110221e-139
CAGL0F01815gsingletonON31430010181e-138
TDEL0G044606.23ON36932010201e-138
KAFR0A050806.23ON31130110071e-137
KNAG0M011906.23ON38030110131e-137
KLLA0D01243g6.23ON31130310061e-137
NDAI0D008306.23ON37430610081e-136
KNAG0K01400singletonON3092979971e-135
TPHA0M002806.23ON3033019881e-134
NDAI0C026206.23ON3113069701e-131
NCAS0H008406.23ON3602949751e-131
KNAG0D02240singletonON3593019711e-131
Kpol_1061.27singletonON3062939571e-129
Kpol_385.5singletonON3062939471e-128
CAGL0I08151gsingletonON3822939411e-126
KAFR0G026806.23ON3832979001e-119
Skud_9.195.702ON168058712.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_56.22439
         (320 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_56.22439 s56 complement(129210..130172) [963 bp, 320 aa] {O...   662   0.0  
KLTH0C11154g Chr3 (916374..917291) [918 bp, 305 aa] {ON} conserv...   446   e-158
SAKL0E01342g Chr5 (101847..102872) [1026 bp, 341 aa] {ON} conser...   432   e-152
ZYRO0C07722g Chr3 (585947..587068) [1122 bp, 373 aa] {ON} conser...   413   e-144
NCAS0D02170 Chr4 complement(403949..404881) [933 bp, 310 aa] {ON...   398   e-139
CAGL0F01815g Chr6 complement(179470..180414) [945 bp, 314 aa] {O...   396   e-138
TDEL0G04460 Chr7 (809440..810549) [1110 bp, 369 aa] {ON}              397   e-138
KAFR0A05080 Chr1 complement(1009747..1010682) [936 bp, 311 aa] {...   392   e-137
KNAG0M01190 Chr13 complement(216456..217598) [1143 bp, 380 aa] {...   394   e-137
KLLA0D01243g Chr4 complement(108848..109783) [936 bp, 311 aa] {O...   392   e-137
NDAI0D00830 Chr4 complement(188085..189209) [1125 bp, 374 aa] {O...   392   e-136
KNAG0K01400 Chr11 complement(280379..281308) [930 bp, 309 aa] {O...   388   e-135
TPHA0M00280 Chr13 complement(55778..56689) [912 bp, 303 aa] {ON}...   385   e-134
NDAI0C02620 Chr3 (608649..609584) [936 bp, 311 aa] {ON} Anc_6.23      378   e-131
NCAS0H00840 Chr8 complement(153671..154753) [1083 bp, 360 aa] {O...   380   e-131
KNAG0D02240 Chr4 complement(385803..386882) [1080 bp, 359 aa] {O...   378   e-131
Kpol_1061.27 s1061 (79476..80396) [921 bp, 306 aa] {ON} (79476.....   373   e-129
Kpol_385.5 s385 (12788..13708) [921 bp, 306 aa] {ON} (12788..137...   369   e-128
CAGL0I08151g Chr9 (793917..795065) [1149 bp, 382 aa] {ON} highly...   367   e-126
KAFR0G02680 Chr7 (553335..554486) [1152 bp, 383 aa] {ON} Anc_6.23     351   e-119
Skud_9.19 Chr9 complement(40103..45145) [5043 bp, 1680 aa] {ON} ...    32   2.4  

>Kwal_56.22439 s56 complement(129210..130172) [963 bp, 320 aa] {ON}
           [contig 185] FULL
          Length = 320

 Score =  662 bits (1709), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/320 (100%), Positives = 320/320 (100%)

Query: 1   MFKSNITDIEHSELMKKARSILKYFTALEQSEGVGAKVRRSIGTQKLRNFTPFLMLDHFT 60
           MFKSNITDIEHSELMKKARSILKYFTALEQSEGVGAKVRRSIGTQKLRNFTPFLMLDHFT
Sbjct: 1   MFKSNITDIEHSELMKKARSILKYFTALEQSEGVGAKVRRSIGTQKLRNFTPFLMLDHFT 60

Query: 61  IAPPAGFPDHPHHGQETVTHILRGAVAHEDFTGSKGVLRAGDLQFMTAGKGTVHSEIPVQ 120
           IAPPAGFPDHPHHGQETVTHILRGAVAHEDFTGSKGVLRAGDLQFMTAGKGTVHSEIPVQ
Sbjct: 61  IAPPAGFPDHPHHGQETVTHILRGAVAHEDFTGSKGVLRAGDLQFMTAGKGTVHSEIPVQ 120

Query: 121 LESGDPTEGIQLWVDLPARLKDCQPRYRDLKRDRIPTARSKNGLNISVISGQSYGVDSIQ 180
           LESGDPTEGIQLWVDLPARLKDCQPRYRDLKRDRIPTARSKNGLNISVISGQSYGVDSIQ
Sbjct: 121 LESGDPTEGIQLWVDLPARLKDCQPRYRDLKRDRIPTARSKNGLNISVISGQSYGVDSIQ 180

Query: 181 ELAYTSVHYYHYVFSEANISFEQVFPTDFNVFLYVLKGRLNIAGQEFSKHSSIFFKTDGS 240
           ELAYTSVHYYHYVFSEANISFEQVFPTDFNVFLYVLKGRLNIAGQEFSKHSSIFFKTDGS
Sbjct: 181 ELAYTSVHYYHYVFSEANISFEQVFPTDFNVFLYVLKGRLNIAGQEFSKHSSIFFKTDGS 240

Query: 241 HVSGFSGSNDLEFILAGGQILDQPIVQYGPFVETSKERMMEVFQNYQSGTNGFEKAAGWT 300
           HVSGFSGSNDLEFILAGGQILDQPIVQYGPFVETSKERMMEVFQNYQSGTNGFEKAAGWT
Sbjct: 241 HVSGFSGSNDLEFILAGGQILDQPIVQYGPFVETSKERMMEVFQNYQSGTNGFEKAAGWT 300

Query: 301 SSIANGIVESDISDFVKSSG 320
           SSIANGIVESDISDFVKSSG
Sbjct: 301 SSIANGIVESDISDFVKSSG 320

>KLTH0C11154g Chr3 (916374..917291) [918 bp, 305 aa] {ON} conserved
           hypothetical protein
          Length = 305

 Score =  446 bits (1147), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 207/299 (69%), Positives = 251/299 (83%)

Query: 15  MKKARSILKYFTALEQSEGVGAKVRRSIGTQKLRNFTPFLMLDHFTIAPPAGFPDHPHHG 74
           M K RSILKYFTALEQSEGVGAKVRRSIG+Q+LRNFTPFLMLDHF ++PPAGFPDHPHHG
Sbjct: 1   MNKPRSILKYFTALEQSEGVGAKVRRSIGSQELRNFTPFLMLDHFNVSPPAGFPDHPHHG 60

Query: 75  QETVTHILRGAVAHEDFTGSKGVLRAGDLQFMTAGKGTVHSEIPVQLESGDPTEGIQLWV 134
           QET+T++L G +AHEDFTGS+GVLR GDLQFMTAGKG +HSEIPV+LESG P+ G+QLWV
Sbjct: 61  QETITYVLGGMIAHEDFTGSRGVLRPGDLQFMTAGKGIIHSEIPVELESGAPSVGLQLWV 120

Query: 135 DLPARLKDCQPRYRDLKRDRIPTARSKNGLNISVISGQSYGVDSIQELAYTSVHYYHYVF 194
           DLP  LKDC+PRYRDL  + IP+ + K GL + VISG+SYGV S+ ELAYT VH+YHY+ 
Sbjct: 121 DLPMHLKDCEPRYRDLLNNEIPSVQPKAGLEVRVISGESYGVGSMSELAYTPVHFYHYIT 180

Query: 195 SEANISFEQVFPTDFNVFLYVLKGRLNIAGQEFSKHSSIFFKTDGSHVSGFSGSNDLEFI 254
            +   +FEQ FP++FNVF+YVLKG + + G+ F+++SS+FF TDGS V G   S + EFI
Sbjct: 181 RKPGTTFEQHFPSNFNVFMYVLKGSVIVNGKTFAQYSSVFFNTDGSRVEGSGSSEESEFI 240

Query: 255 LAGGQILDQPIVQYGPFVETSKERMMEVFQNYQSGTNGFEKAAGWTSSIANGIVESDIS 313
           L GG++LDQPI+QYGPFVETSK+ M EV  NYQSGTNGFE+A GW+SSIA G+V SD++
Sbjct: 241 LIGGEVLDQPILQYGPFVETSKQNMYEVIGNYQSGTNGFERAQGWSSSIARGVVFSDVA 299

>SAKL0E01342g Chr5 (101847..102872) [1026 bp, 341 aa] {ON} conserved
           hypothetical protein
          Length = 341

 Score =  432 bits (1111), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 198/304 (65%), Positives = 241/304 (79%)

Query: 15  MKKARSILKYFTALEQSEGVGAKVRRSIGTQKLRNFTPFLMLDHFTIAPPAGFPDHPHHG 74
           M K R+I K+F A+EQSEGVGA+VRRSIGT +LRNFTPFLMLDHF + PPAGFPDHPHHG
Sbjct: 37  MSKVRTIYKHFVAVEQSEGVGARVRRSIGTTQLRNFTPFLMLDHFNVTPPAGFPDHPHHG 96

Query: 75  QETVTHILRGAVAHEDFTGSKGVLRAGDLQFMTAGKGTVHSEIPVQLESGDPTEGIQLWV 134
           QET+T++L G +AHEDFTGSKGVLR GDLQFMTAGKG VHSEIPV++ESG+PT G+QLWV
Sbjct: 97  QETITYVLGGMMAHEDFTGSKGVLRPGDLQFMTAGKGIVHSEIPVKMESGEPTVGLQLWV 156

Query: 135 DLPARLKDCQPRYRDLKRDRIPTARSKNGLNISVISGQSYGVDSIQELAYTSVHYYHYVF 194
           DLP RLK+C+PRYRDL+    P A     L + VISG+SYGV S  ELAYT VH+YH++ 
Sbjct: 157 DLPERLKNCEPRYRDLRGAETPIAEPHQNLKVRVISGESYGVQSRSELAYTPVHFYHFIS 216

Query: 195 SEANISFEQVFPTDFNVFLYVLKGRLNIAGQEFSKHSSIFFKTDGSHVSGFSGSNDLEFI 254
           S+    FEQ FP DFNVF+YVLKG L +  + F ++S+IFFK DG  V G + S+D EF 
Sbjct: 217 SKKGTPFEQKFPEDFNVFMYVLKGSLTLNSKNFPQYSAIFFKNDGEGVEGIAASDDTEFA 276

Query: 255 LAGGQILDQPIVQYGPFVETSKERMMEVFQNYQSGTNGFEKAAGWTSSIANGIVESDISD 314
           L GG IL+QP+VQ+GPFVETSKERM++VFQ+YQ G NGFE+A  W SSI++GI + +   
Sbjct: 277 LVGGSILEQPVVQHGPFVETSKERMIQVFQDYQFGMNGFERAHNWKSSISDGISQQNAEK 336

Query: 315 FVKS 318
            +KS
Sbjct: 337 QLKS 340

>ZYRO0C07722g Chr3 (585947..587068) [1122 bp, 373 aa] {ON} conserved
           hypothetical protein
          Length = 373

 Score =  413 bits (1062), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 189/300 (63%), Positives = 232/300 (77%)

Query: 18  ARSILKYFTALEQSEGVGAKVRRSIGTQKLRNFTPFLMLDHFTIAPPAGFPDHPHHGQET 77
            RS+LK F A+EQ EGVGA+VRRSIGT K+R F PFLMLD F + PPAGFPDHPHHGQET
Sbjct: 73  VRSVLKNFIAIEQEEGVGARVRRSIGTMKMRRFPPFLMLDDFFVKPPAGFPDHPHHGQET 132

Query: 78  VTHILRGAVAHEDFTGSKGVLRAGDLQFMTAGKGTVHSEIPVQLESGDPTEGIQLWVDLP 137
           +T+ L+G +AHEDFTGSKGVL  GDLQFMTAGKG VHSEIPV LE G  + G+QLWVDLP
Sbjct: 133 ITYNLKGMIAHEDFTGSKGVLFPGDLQFMTAGKGIVHSEIPVSLEDGSASNGLQLWVDLP 192

Query: 138 ARLKDCQPRYRDLKRDRIPTARSKNGLNISVISGQSYGVDSIQELAYTSVHYYHYVFSEA 197
           A LK+C+PRYRDL++ + P  +  + L + VISG+SYGVDS+QELAYT VH+YH++ S+ 
Sbjct: 193 AELKNCEPRYRDLRKKQTPEVKVNDNLTVRVISGKSYGVDSVQELAYTPVHFYHFITSKK 252

Query: 198 NISFEQVFPTDFNVFLYVLKGRLNIAGQEFSKHSSIFFKTDGSHVSGFSGSNDLEFILAG 257
              F Q FP DFNVF Y+LKG L +  Q F +HS++FF TDG  V+G S S+D EF+L G
Sbjct: 253 GTEFAQEFPKDFNVFFYILKGSLAVNDQVFPEHSAVFFDTDGEGVAGTSVSDDAEFVLIG 312

Query: 258 GQILDQPIVQYGPFVETSKERMMEVFQNYQSGTNGFEKAAGWTSSIANGIVESDISDFVK 317
           G+ILDQ ++Q+GPFVETS+ERM++VF+NYQ G NGFE A  W S IA GI E++     K
Sbjct: 313 GKILDQEVLQHGPFVETSRERMIDVFRNYQYGMNGFENAHSWDSKIAGGISEAEARKLYK 372

>NCAS0D02170 Chr4 complement(403949..404881) [933 bp, 310 aa] {ON}
           Anc_6.23
          Length = 310

 Score =  398 bits (1022), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 179/301 (59%), Positives = 232/301 (77%)

Query: 19  RSILKYFTALEQSEGVGAKVRRSIGTQKLRNFTPFLMLDHFTIAPPAGFPDHPHHGQETV 78
           RS+LK F A+EQ EGVGA VRRSIG+ K RNF+PFL++D+FT++ PAGFPDHPHHGQET+
Sbjct: 8   RSVLKSFVAIEQEEGVGAHVRRSIGSMKQRNFSPFLLMDNFTVSHPAGFPDHPHHGQETI 67

Query: 79  THILRGAVAHEDFTGSKGVLRAGDLQFMTAGKGTVHSEIPVQLESGDPTEGIQLWVDLPA 138
           T++L+G +AHEDFTGS+GVLR GDLQFMTAGK  +HSEIPVQ+ +GD   GIQLWVDLP 
Sbjct: 68  TYVLKGMIAHEDFTGSRGVLRPGDLQFMTAGKAIMHSEIPVQMNNGDAGIGIQLWVDLPK 127

Query: 139 RLKDCQPRYRDLKRDRIPTARSKNGLNISVISGQSYGVDSIQELAYTSVHYYHYVFSEAN 198
           +LK+C+PRYR+L+   IP  +  + L + V+SG+SYGV+S+++LAYT + YY     +  
Sbjct: 128 KLKNCEPRYRNLRATEIPIVKPNDDLTVRVVSGKSYGVESVKDLAYTPIDYYFMNTKKTG 187

Query: 199 ISFEQVFPTDFNVFLYVLKGRLNIAGQEFSKHSSIFFKTDGSHVSGFSGSNDLEFILAGG 258
             F Q FP DFNVFLY++KG + I      ++S+IFFKTDG  + G S S D EF+L GG
Sbjct: 188 TEFVQEFPADFNVFLYIIKGSVKINDTVHPQYSTIFFKTDGDAIKGCSASEDTEFVLVGG 247

Query: 259 QILDQPIVQYGPFVETSKERMMEVFQNYQSGTNGFEKAAGWTSSIANGIVESDISDFVKS 318
           QILDQPI+Q+GPFVE+ +E ++EVF+NYQ   NGFE+A GW S IA+GI E D+  F KS
Sbjct: 248 QILDQPIIQHGPFVESDRESLLEVFKNYQYCINGFERARGWRSRIADGIHEDDVEAFEKS 307

Query: 319 S 319
           +
Sbjct: 308 N 308

>CAGL0F01815g Chr6 complement(179470..180414) [945 bp, 314 aa] {ON}
           similar to KLLA0D01243g Kluyveromyces lactis and
           DEHA0E07447g Debaryomyces hansenii
          Length = 314

 Score =  396 bits (1018), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 178/300 (59%), Positives = 228/300 (76%)

Query: 15  MKKARSILKYFTALEQSEGVGAKVRRSIGTQKLRNFTPFLMLDHFTIAPPAGFPDHPHHG 74
           M   RSI K+F   EQ EGVGA+VRRS+GT K R F+PFLMLD F +  PAGFPDHPHHG
Sbjct: 1   MTTYRSIQKHFMTFEQEEGVGARVRRSVGTMKQRMFSPFLMLDDFYVKHPAGFPDHPHHG 60

Query: 75  QETVTHILRGAVAHEDFTGSKGVLRAGDLQFMTAGKGTVHSEIPVQLESGDPTEGIQLWV 134
           QET+T++L G VAHEDFTG+KGVL  GDLQFMTAGKG VHSEIPVQ+ESG+   G+Q WV
Sbjct: 61  QETITYVLNGMVAHEDFTGAKGVLGKGDLQFMTAGKGIVHSEIPVQMESGEACHGLQFWV 120

Query: 135 DLPARLKDCQPRYRDLKRDRIPTARSKNGLNISVISGQSYGVDSIQELAYTSVHYYHYVF 194
           DLP  LK C+PRYR+L+ D+IP  R    L + VISG+SYGVDS+++LAYT +H YHY+ 
Sbjct: 121 DLPKDLKWCEPRYRNLRGDKIPVVRPNENLTVKVISGKSYGVDSVRDLAYTPIHMYHYLT 180

Query: 195 SEANISFEQVFPTDFNVFLYVLKGRLNIAGQEFSKHSSIFFKTDGSHVSGFSGSNDLEFI 254
           ++A   +EQ FP +FNVF+YV+KG++++  Q F +H+++FF TDG  V G   ++D +F 
Sbjct: 181 NKAGTQWEQEFPKNFNVFMYVMKGKVSVGDQVFPEHTAVFFNTDGDAVKGEFATDDAQFA 240

Query: 255 LAGGQILDQPIVQYGPFVETSKERMMEVFQNYQSGTNGFEKAAGWTSSIANGIVESDISD 314
           + GGQILDQ  +Q+GPFVET +E +M+VF NYQ G NGFE+A GW SSI +GI E  + +
Sbjct: 241 IMGGQILDQQTIQHGPFVETDRESLMKVFMNYQYGINGFERAKGWQSSIIHGITEKQVRE 300

>TDEL0G04460 Chr7 (809440..810549) [1110 bp, 369 aa] {ON} 
          Length = 369

 Score =  397 bits (1020), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 187/320 (58%), Positives = 237/320 (74%), Gaps = 5/320 (1%)

Query: 6   ITD-IEHSELMKK---ARSILKYFTALEQSEGVGAKVRRSIGTQKLRNFTPFLMLDHFTI 61
           ITD I  SE M K    RSI+K F A +Q EGVGA VRRSIGT ++R F+PFLMLDHFT+
Sbjct: 48  ITDFISQSETMSKTLQVRSIIKNFVATQQEEGVGATVRRSIGTMQMRRFSPFLMLDHFTV 107

Query: 62  APPAGFPDHPHHGQETVTHILRGAVAHEDFTGSKGVLRAGDLQFMTAGKGTVHSEIPVQL 121
           +PPAGFPDHPHHGQET+T++L G +AHEDF+ SKG+L  GDLQFMTAGK  +HSEIPV++
Sbjct: 108 SPPAGFPDHPHHGQETITYMLGGMLAHEDFSNSKGILSPGDLQFMTAGKAIIHSEIPVKM 167

Query: 122 ESGDPTEGIQLWVDLPARLKDCQPRYRDLKRDRIPTARSKNGLNISVISGQSYGVDSIQE 181
           +SG P  G+QLWVDLP +LK+C+PRYRDLK   IP  +    L ++VISG SYGV S ++
Sbjct: 168 DSGQPAVGLQLWVDLPEKLKNCEPRYRDLKAKDIPVIKPSEHLKVTVISGTSYGVQSARD 227

Query: 182 LAYTSVHYYHYVFSEANISFEQVFPTDFNVFLYVLKGRLNIAGQEFSKHSSIFFKTDGSH 241
           LAYT VHYYH+  S+    F Q FP  FN F+Y+LKG + I  + F + S++FF TDG  
Sbjct: 228 LAYTPVHYYHFATSKKGTEFVQEFPRVFNAFMYILKGSIGIGEKLFPQFSTVFFDTDGDA 287

Query: 242 VSGFSGSNDLEFILAGGQILDQPIVQYGPFVETSKERMMEVFQNYQSGTNGFEKAAGWTS 301
           V GFS S++ EF+L GG+IL Q +VQ+GPFVET++ER++EVF NYQ+  NGF++   W S
Sbjct: 288 VEGFSASDNAEFVLIGGEILHQDVVQHGPFVETNRERLIEVFHNYQNSINGFDRGRNWRS 347

Query: 302 SIANGIVESDI-SDFVKSSG 320
           +IA GI ES+   DF  S G
Sbjct: 348 TIAGGITESEAKKDFRNSKG 367

>KAFR0A05080 Chr1 complement(1009747..1010682) [936 bp, 311 aa] {ON}
           Anc_6.23
          Length = 311

 Score =  392 bits (1007), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 173/301 (57%), Positives = 232/301 (77%)

Query: 19  RSILKYFTALEQSEGVGAKVRRSIGTQKLRNFTPFLMLDHFTIAPPAGFPDHPHHGQETV 78
           R+I K+F A+EQ EGVGA+VRRS+G+ + RNFTPFL+LDHFT++ PAGFPDHPHHGQET+
Sbjct: 11  RTINKHFVAVEQEEGVGARVRRSVGSMRQRNFTPFLLLDHFTVSHPAGFPDHPHHGQETI 70

Query: 79  THILRGAVAHEDFTGSKGVLRAGDLQFMTAGKGTVHSEIPVQLESGDPTEGIQLWVDLPA 138
           T++  G +AHEDFTGSKG+LR GDLQFMTAGKG +HSEIPV +E+GD   G+QLWVDLP 
Sbjct: 71  TYVRNGMIAHEDFTGSKGILRPGDLQFMTAGKGIMHSEIPVLMENGDAGVGLQLWVDLPQ 130

Query: 139 RLKDCQPRYRDLKRDRIPTARSKNGLNISVISGQSYGVDSIQELAYTSVHYYHYVFSEAN 198
            +KDC+PRYR+L+   IP       L + VISG+SYGV+S++ELAYT V +YH++ ++  
Sbjct: 131 EMKDCEPRYRNLRGGEIPIVEPNEHLKVKVISGRSYGVESVKELAYTPVDFYHFISNKKG 190

Query: 199 ISFEQVFPTDFNVFLYVLKGRLNIAGQEFSKHSSIFFKTDGSHVSGFSGSNDLEFILAGG 258
             F Q  P +FN FLYV+KG + I  + F ++S+IFF  DG+ + G    +D EF + GG
Sbjct: 191 TDFVQQTPENFNFFLYVMKGSVKIGDETFPQYSTIFFNADGNGIKGVVSDDDTEFAIIGG 250

Query: 259 QILDQPIVQYGPFVETSKERMMEVFQNYQSGTNGFEKAAGWTSSIANGIVESDISDFVKS 318
            ILDQP++Q+GPF+E+++E+++EVFQN+Q G NGFE+A GW SSI NGI+E D+  F  S
Sbjct: 251 LILDQPVIQHGPFIESTREKLIEVFQNFQYGINGFERAVGWKSSIRNGILEKDVPKFEGS 310

Query: 319 S 319
           +
Sbjct: 311 A 311

>KNAG0M01190 Chr13 complement(216456..217598) [1143 bp, 380 aa] {ON}
           Anc_6.23
          Length = 380

 Score =  394 bits (1013), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 177/301 (58%), Positives = 231/301 (76%)

Query: 15  MKKARSILKYFTALEQSEGVGAKVRRSIGTQKLRNFTPFLMLDHFTIAPPAGFPDHPHHG 74
           M + R+I K+F A EQ EGVGA+VRRS+G+ + RNF+PFL+LDHFT++ PAGFPDHPHHG
Sbjct: 72  MPEFRTIQKHFIAGEQEEGVGARVRRSVGSMRQRNFSPFLLLDHFTVSHPAGFPDHPHHG 131

Query: 75  QETVTHILRGAVAHEDFTGSKGVLRAGDLQFMTAGKGTVHSEIPVQLESGDPTEGIQLWV 134
           QET+T++  G +AHEDF GSKGVLR GDLQFMTAGKG +HSEIPV +E+GD   G+QLWV
Sbjct: 132 QETITYVREGMIAHEDFLGSKGVLRPGDLQFMTAGKGIMHSEIPVLMENGDAGVGLQLWV 191

Query: 135 DLPARLKDCQPRYRDLKRDRIPTARSKNGLNISVISGQSYGVDSIQELAYTSVHYYHYVF 194
           DLP  +KDC PRYR+L+   IP A     L I VISG+S+G+DS++ELAYT V +YHY+ 
Sbjct: 192 DLPKDMKDCAPRYRNLRGTEIPIAEPNEHLKIKVISGKSHGIDSVKELAYTPVDFYHYIS 251

Query: 195 SEANISFEQVFPTDFNVFLYVLKGRLNIAGQEFSKHSSIFFKTDGSHVSGFSGSNDLEFI 254
            +    F Q  PT+FNVFLYV+KG + I GQ F ++S++F+  +G  + G    +D EF 
Sbjct: 252 DKKGTGFVQEVPTNFNVFLYVMKGAVKIDGQVFPQYSTVFYNANGDAIRGMVDDDDTEFA 311

Query: 255 LAGGQILDQPIVQYGPFVETSKERMMEVFQNYQSGTNGFEKAAGWTSSIANGIVESDISD 314
           + GG ILDQP++Q+GPFVET++E+++EVFQN+Q G NGFE+A GW SSI NGI+E D+  
Sbjct: 312 IIGGLILDQPVIQHGPFVETTREKIIEVFQNFQYGINGFERAVGWKSSIRNGILEKDVPA 371

Query: 315 F 315
           F
Sbjct: 372 F 372

>KLLA0D01243g Chr4 complement(108848..109783) [936 bp, 311 aa] {ON}
           conserved hypothetical protein
          Length = 311

 Score =  392 bits (1006), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 170/303 (56%), Positives = 239/303 (78%)

Query: 14  LMKKARSILKYFTALEQSEGVGAKVRRSIGTQKLRNFTPFLMLDHFTIAPPAGFPDHPHH 73
           ++ K RS+LK+F A+EQSEG GA V+RSIGT ++RNF PFLMLD+F ++PPAGFP+HPHH
Sbjct: 5   VVSKVRSVLKHFVAIEQSEGAGALVKRSIGTIQMRNFPPFLMLDNFDVSPPAGFPEHPHH 64

Query: 74  GQETVTHILRGAVAHEDFTGSKGVLRAGDLQFMTAGKGTVHSEIPVQLESGDPTEGIQLW 133
           GQET+T++LRG +AHEDFTGSKGVLR+GDLQFMTAGK  VHSEIPV++++G+ T+G+QLW
Sbjct: 65  GQETITYVLRGMMAHEDFTGSKGVLRSGDLQFMTAGKAIVHSEIPVKMDNGESTQGLQLW 124

Query: 134 VDLPARLKDCQPRYRDLKRDRIPTARSKNGLNISVISGQSYGVDSIQELAYTSVHYYHYV 193
           VDLP  +K+ +PRYRDL+R+ IP A   + L + VISG+SYGV S+ ELAYT V +YH++
Sbjct: 125 VDLPNDIKNVEPRYRDLRREEIPLATPSDNLIVKVISGESYGVKSLTELAYTPVEFYHFI 184

Query: 194 FSEANISFEQVFPTDFNVFLYVLKGRLNIAGQEFSKHSSIFFKTDGSHVSGFSGSNDLEF 253
            ++ N  F Q F  DF+ F+Y++KG ++I+ QE+ + S+IFFK DG  + GF+ S++ EF
Sbjct: 185 ANKKNTEFAQPFSDDFSSFIYIMKGSISISDQEYPESSAIFFKNDGDGIRGFTTSDNAEF 244

Query: 254 ILAGGQILDQPIVQYGPFVETSKERMMEVFQNYQSGTNGFEKAAGWTSSIANGIVESDIS 313
            +  G+  +Q +VQYGPFVE+S+E +++V QNYQ+G NGFE A  W+  I NG+ E+++ 
Sbjct: 245 AIIAGKYFNQKVVQYGPFVESSRENIVDVIQNYQNGVNGFENARTWSPVIKNGVTEAEVQ 304

Query: 314 DFV 316
            ++
Sbjct: 305 QYL 307

>NDAI0D00830 Chr4 complement(188085..189209) [1125 bp, 374 aa] {ON}
           Anc_6.23
          Length = 374

 Score =  392 bits (1008), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 179/306 (58%), Positives = 232/306 (75%), Gaps = 3/306 (0%)

Query: 8   DIEHSELMKKARSILKYFTALEQSEGVGAKVRRSIGTQKLRNFTPFLMLDHFTIAPPA-G 66
           DI        AR+ILKYF   EQSEGVGA+VRR+IGT ++  F PFLMLDHF + PP  G
Sbjct: 62  DIARIATTDDARTILKYFIPDEQSEGVGARVRRAIGTNEMPRFPPFLMLDHFKVTPPEQG 121

Query: 67  FPDHPHHGQETVTHILRGAVAHEDFTGSKGVLRAGDLQFMTAGKGTVHSEIPVQLESGDP 126
           FPDHPHHGQET+T+IL G +AHEDFTGSKGVLR GDLQFMTAGKG VHSE+PV ++ G P
Sbjct: 122 FPDHPHHGQETITYILDGMIAHEDFTGSKGVLRPGDLQFMTAGKGIVHSEMPVLMKDGRP 181

Query: 127 TEGIQLWVDLPARLKDCQPRYRDLKRDRIPTARSKNG--LNISVISGQSYGVDSIQELAY 184
             G+QLWVDLP  LK+C+PRYR+L+++ IP   + +   + + VISG +YGVDS+++LAY
Sbjct: 182 GIGLQLWVDLPRELKNCEPRYRNLRKNEIPIVHTDDEKHMTVKVISGNAYGVDSVRDLAY 241

Query: 185 TSVHYYHYVFSEANISFEQVFPTDFNVFLYVLKGRLNIAGQEFSKHSSIFFKTDGSHVSG 244
           T +H+YHY+  +A + F+Q  P DFNVFLYV+KG + I  Q F +++++FF  DG  + G
Sbjct: 242 TPIHFYHYISDKAGVEFKQSVPDDFNVFLYVMKGAVVIDDQIFKQNTAVFFNVDGHSIKG 301

Query: 245 FSGSNDLEFILAGGQILDQPIVQYGPFVETSKERMMEVFQNYQSGTNGFEKAAGWTSSIA 304
            S +ND EF + GG+ILDQP+VQ+GPFVET++E + +VF+NYQ G NGFE+A  W SSIA
Sbjct: 302 QSATNDTEFAIIGGKILDQPLVQHGPFVETTREDLYKVFENYQQGINGFERAVNWRSSIA 361

Query: 305 NGIVES 310
           +GI E 
Sbjct: 362 DGIDED 367

>KNAG0K01400 Chr11 complement(280379..281308) [930 bp, 309 aa] {ON} 
          Length = 309

 Score =  388 bits (997), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 176/297 (59%), Positives = 227/297 (76%)

Query: 19  RSILKYFTALEQSEGVGAKVRRSIGTQKLRNFTPFLMLDHFTIAPPAGFPDHPHHGQETV 78
           RS+ K F ALEQ+EGVGA VRRSIG ++ RNF+PFL+LDHFT++ P+GFPDHPHHGQET+
Sbjct: 6   RSVQKAFRALEQAEGVGALVRRSIGVRRQRNFSPFLLLDHFTVSHPSGFPDHPHHGQETI 65

Query: 79  THILRGAVAHEDFTGSKGVLRAGDLQFMTAGKGTVHSEIPVQLESGDPTEGIQLWVDLPA 138
           T+I +G +AHEDFTGSKG+LR GDLQFMTAGKG VHSEIPV  +      G+QLWVDLP 
Sbjct: 66  TYIQQGMIAHEDFTGSKGILRPGDLQFMTAGKGIVHSEIPVLTKDAKAAVGLQLWVDLPK 125

Query: 139 RLKDCQPRYRDLKRDRIPTARSKNGLNISVISGQSYGVDSIQELAYTSVHYYHYVFSEAN 198
            +KDC PRYR+L+   IP A+    L + VISG+SYGV+S++ELAYT V +YHY+  +  
Sbjct: 126 NMKDCPPRYRNLRASEIPIAQPNEHLKVKVISGKSYGVESVKELAYTPVDFYHYISDKEG 185

Query: 199 ISFEQVFPTDFNVFLYVLKGRLNIAGQEFSKHSSIFFKTDGSHVSGFSGSNDLEFILAGG 258
           I+F Q  P ++N FLYV++G + + GQE+ ++S+IF+  +G+ + G +G  + EF +  G
Sbjct: 186 INFVQEIPENYNAFLYVMEGSVVVDGQEYPQYSTIFYNANGNAIKGVTGEKNTEFAIIAG 245

Query: 259 QILDQPIVQYGPFVETSKERMMEVFQNYQSGTNGFEKAAGWTSSIANGIVESDISDF 315
            ILDQ IVQ+GPFVETS E+M EVF+NYQ G NGFEKA  W SSI NGI E DI++F
Sbjct: 246 LILDQDIVQHGPFVETSPEKMKEVFRNYQWGINGFEKAINWESSIINGITEKDITNF 302

>TPHA0M00280 Chr13 complement(55778..56689) [912 bp, 303 aa] {ON}
           Anc_6.23
          Length = 303

 Score =  385 bits (988), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 177/301 (58%), Positives = 229/301 (76%)

Query: 14  LMKKARSILKYFTALEQSEGVGAKVRRSIGTQKLRNFTPFLMLDHFTIAPPAGFPDHPHH 73
           + +  RSILK+F A EQ+EGVGA+VRRSIGT K+R F+PFLMLDHF + PPAGFPDHPHH
Sbjct: 1   MSQNTRSILKHFIAQEQAEGVGARVRRSIGTAKMRKFSPFLMLDHFNVIPPAGFPDHPHH 60

Query: 74  GQETVTHILRGAVAHEDFTGSKGVLRAGDLQFMTAGKGTVHSEIPVQLESGDPTEGIQLW 133
           GQET+T++ +G VAHEDFTGSKG+LR GDLQFMTAGK   HSE+PV +E+G+  +G+QLW
Sbjct: 61  GQETITYVRKGMVAHEDFTGSKGILRPGDLQFMTAGKAVCHSEMPVLMENGEILDGLQLW 120

Query: 134 VDLPARLKDCQPRYRDLKRDRIPTARSKNGLNISVISGQSYGVDSIQELAYTSVHYYHYV 193
           VDLP  LK+ +PRYRDL ++ IP A+    L I VISG+SYG++S+++LAYT V +Y Y 
Sbjct: 121 VDLPTNLKNTEPRYRDLHKENIPIAKPDENLEIEVISGKSYGIESVKDLAYTPVDFYVYK 180

Query: 194 FSEANISFEQVFPTDFNVFLYVLKGRLNIAGQEFSKHSSIFFKTDGSHVSGFSGSNDLEF 253
             +   +F Q F  D+NVFLY++KG + I  + F +HSSIFF TDG +V G  GS+D EF
Sbjct: 181 ARKKGSAFTQDFSRDYNVFLYIVKGSVAIGNEVFPQHSSIFFNTDGDNVQGIVGSDDTEF 240

Query: 254 ILAGGQILDQPIVQYGPFVETSKERMMEVFQNYQSGTNGFEKAAGWTSSIANGIVESDIS 313
            + GGQIL Q  VQ+GPFVE + E++++VF NY+S T GFE+A  W SSI NGI ES  +
Sbjct: 241 AIIGGQILRQETVQHGPFVEETVEKLVKVFHNYESYTGGFERALNWRSSIRNGIDESQAA 300

Query: 314 D 314
           +
Sbjct: 301 N 301

>NDAI0C02620 Chr3 (608649..609584) [936 bp, 311 aa] {ON} Anc_6.23
          Length = 311

 Score =  378 bits (970), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 174/306 (56%), Positives = 232/306 (75%), Gaps = 1/306 (0%)

Query: 15  MKKARSILKYFTALEQSEGVGAKVRRSIGTQKLRNFTPFLMLDHFTIAPPAGFPDHPHHG 74
           + + RS+ K F A+EQ EGVGA VRRSIG+ K RNF+PFL++DHFT++ PAGFPDHPHHG
Sbjct: 4   VPQIRSVAKNFIAIEQEEGVGAHVRRSIGSMKQRNFSPFLLMDHFTVSHPAGFPDHPHHG 63

Query: 75  QETVTHILRGAVAHEDFTGSKGVLRAGDLQFMTAGKGTVHSEIPVQLESGDPTEGIQLWV 134
           QET+T++L G +AHEDFTGSKGVLR GDLQFMTAGK  +HSEIPV++E+G P  GIQLWV
Sbjct: 64  QETITYVLNGMIAHEDFTGSKGVLRPGDLQFMTAGKAIMHSEIPVKMENGTPGIGIQLWV 123

Query: 135 DLPARLKDCQPRYRDLKRDRIPTARSKNGLNISVISGQSYGVDSIQELAYTSVHYYHYVF 194
            LP  LK+ +PRYR+L+ D+IP  +    L + VISG+SYG +S+++LAYT + YY +  
Sbjct: 124 ALPIDLKNSEPRYRNLRGDKIPIIKPNENLTVRVISGKSYGTESVKDLAYTPIDYYIFNM 183

Query: 195 SEANISFEQVFPTDFNVFLYVLKGRLNIAGQEFSKHSSIFFKTDGSHVSGFSGSN-DLEF 253
           ++  + F Q  P +FN FLY+ KG + I G  + K+S++FF TDG  + G S ++ + EF
Sbjct: 184 NKKGVEFFQETPRNFNFFLYITKGAVEINGVVYPKYSTVFFDTDGDSIKGKSAADEETEF 243

Query: 254 ILAGGQILDQPIVQYGPFVETSKERMMEVFQNYQSGTNGFEKAAGWTSSIANGIVESDIS 313
            + GG ILDQPI+Q+GPFVET +E +++VF+NYQ   NGFE+A GW SSIA+GI+E D+ 
Sbjct: 244 AIIGGLILDQPILQHGPFVETDRESLLQVFKNYQYCINGFERARGWRSSIADGILEKDVP 303

Query: 314 DFVKSS 319
            F KSS
Sbjct: 304 AFEKSS 309

>NCAS0H00840 Chr8 complement(153671..154753) [1083 bp, 360 aa] {ON}
           Anc_6.23
          Length = 360

 Score =  380 bits (975), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 169/294 (57%), Positives = 226/294 (76%)

Query: 16  KKARSILKYFTALEQSEGVGAKVRRSIGTQKLRNFTPFLMLDHFTIAPPAGFPDHPHHGQ 75
           +K RSILK+F A EQSEG GA VRRS+G+ ++  F+PFLMLD F + PP GFPDHPHHGQ
Sbjct: 59  QKERSILKHFIAEEQSEGDGATVRRSVGSYQMTRFSPFLMLDDFKVTPPEGFPDHPHHGQ 118

Query: 76  ETVTHILRGAVAHEDFTGSKGVLRAGDLQFMTAGKGTVHSEIPVQLESGDPTEGIQLWVD 135
           ET+T++  G +AHEDFTGSKGVL  GDLQFMTAGKG VH E+PV +     + G+Q WVD
Sbjct: 119 ETITYVTGGILAHEDFTGSKGVLYPGDLQFMTAGKGIVHCEMPVTMNDSAVSTGLQFWVD 178

Query: 136 LPARLKDCQPRYRDLKRDRIPTARSKNGLNISVISGQSYGVDSIQELAYTSVHYYHYVFS 195
           LPA LK+C+PRYR+L+ D IP  +  + LN+ VISG+SY V+S+++LAYT + +Y+++ +
Sbjct: 179 LPADLKNCEPRYRNLRADTIPVVQVNDNLNVKVISGKSYDVESVKDLAYTPIDFYYFISN 238

Query: 196 EANISFEQVFPTDFNVFLYVLKGRLNIAGQEFSKHSSIFFKTDGSHVSGFSGSNDLEFIL 255
           +A   F Q  P DFN F+YV KG + I  + F  HSS+FF+TDG+ + GF+ S++ EF +
Sbjct: 239 KAGTEFAQEIPPDFNAFIYVTKGAITIGEEVFKVHSSVFFQTDGNFIRGFTASDNTEFAV 298

Query: 256 AGGQILDQPIVQYGPFVETSKERMMEVFQNYQSGTNGFEKAAGWTSSIANGIVE 309
            GG+ILDQ +VQ+GPFVET++E+++EVF NY++G NGFEKA GW SSI+NGI E
Sbjct: 299 IGGKILDQQVVQHGPFVETTREKLIEVFDNYRAGINGFEKALGWKSSISNGIDE 352

>KNAG0D02240 Chr4 complement(385803..386882) [1080 bp, 359 aa] {ON} 
          Length = 359

 Score =  378 bits (971), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 169/301 (56%), Positives = 228/301 (75%)

Query: 17  KARSILKYFTALEQSEGVGAKVRRSIGTQKLRNFTPFLMLDHFTIAPPAGFPDHPHHGQE 76
           K RSI  +F   E +EGVGA+V+RS+G+ + R FTPFLMLD FT+  P+GFPDHPHHGQE
Sbjct: 59  KLRSIANHFIPREVAEGVGARVKRSVGSMQQRRFTPFLMLDDFTVKSPSGFPDHPHHGQE 118

Query: 77  TVTHILRGAVAHEDFTGSKGVLRAGDLQFMTAGKGTVHSEIPVQLESGDPTEGIQLWVDL 136
           T+T+++ G +AHEDFTGSKGVLR GDLQFMTAGKG VHSE+PV++E G P  G+QLWVDL
Sbjct: 119 TITYVIDGLIAHEDFTGSKGVLRPGDLQFMTAGKGIVHSEMPVEMEDGRPARGLQLWVDL 178

Query: 137 PARLKDCQPRYRDLKRDRIPTARSKNGLNISVISGQSYGVDSIQELAYTSVHYYHYVFSE 196
           P  LK+C+PRYR+L+ + IP  +    L + VISG+SYG +S+++LAYT + +Y+ + S+
Sbjct: 179 PKDLKNCEPRYRNLRSEDIPVVKPHENLEVRVISGKSYGTESVKDLAYTPIDFYYMLASK 238

Query: 197 ANISFEQVFPTDFNVFLYVLKGRLNIAGQEFSKHSSIFFKTDGSHVSGFSGSNDLEFILA 256
           A   F Q  P+DFN FLYV+KG + I  + F ++++IFF TDG  V+G +GS+D EF + 
Sbjct: 239 AGTEFAQEIPSDFNAFLYVMKGSVVINEKVFKQNTAIFFDTDGEGVAGQAGSDDTEFAII 298

Query: 257 GGQILDQPIVQYGPFVETSKERMMEVFQNYQSGTNGFEKAAGWTSSIANGIVESDISDFV 316
           GG+ILDQP+VQ+GPFVET +E++ E F NY+  T GFE+A GW S IA+GI ES+    +
Sbjct: 299 GGKILDQPLVQHGPFVETDQEKLYEAFMNYEGYTKGFERAKGWRSDIASGINESEAKQLL 358

Query: 317 K 317
           +
Sbjct: 359 E 359

>Kpol_1061.27 s1061 (79476..80396) [921 bp, 306 aa] {ON}
           (79476..80396) [921 nt, 307 aa]
          Length = 306

 Score =  373 bits (957), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 176/293 (60%), Positives = 218/293 (74%)

Query: 19  RSILKYFTALEQSEGVGAKVRRSIGTQKLRNFTPFLMLDHFTIAPPAGFPDHPHHGQETV 78
           RSI K+F + EQSEGVGA+VRRSIGT  LR F+PFLMLDHF +AP AGFPDHPHHGQET+
Sbjct: 8   RSIFKHFISREQSEGVGARVRRSIGTMLLRKFSPFLMLDHFNVAPGAGFPDHPHHGQETI 67

Query: 79  THILRGAVAHEDFTGSKGVLRAGDLQFMTAGKGTVHSEIPVQLESGDPTEGIQLWVDLPA 138
           T++  G +AHEDFTG KGVL  GDLQFMTAGK   H+E+PVQ  SG+   G+QLWVDLP 
Sbjct: 68  TYVNEGMIAHEDFTGCKGVLGKGDLQFMTAGKAICHAEMPVQSNSGEHVVGLQLWVDLPT 127

Query: 139 RLKDCQPRYRDLKRDRIPTARSKNGLNISVISGQSYGVDSIQELAYTSVHYYHYVFSEAN 198
            +K+ +PRYRDL+   IP A   + L I VISG SYGVDS+++LAYT + +Y Y   +A 
Sbjct: 128 DMKNTEPRYRDLRNKDIPRANPTDDLEIEVISGNSYGVDSVKDLAYTPIDFYMYRGKKAG 187

Query: 199 ISFEQVFPTDFNVFLYVLKGRLNIAGQEFSKHSSIFFKTDGSHVSGFSGSNDLEFILAGG 258
             F Q F  DFNVF+YVLKG +NI  Q F ++SSIFF TDG  V G   ++D EF + GG
Sbjct: 188 TEFTQKFSRDFNVFIYVLKGAVNIGDQVFPQYSSIFFNTDGDAVGGTVAADDTEFAIIGG 247

Query: 259 QILDQPIVQYGPFVETSKERMMEVFQNYQSGTNGFEKAAGWTSSIANGIVESD 311
           +ILDQ  VQ+GPFVE +KE++++VF +YQS +NGFE+A  W SSI +GI E D
Sbjct: 248 KILDQETVQHGPFVEETKEKLIKVFYDYQSYSNGFERARNWRSSIRDGIKEDD 300

>Kpol_385.5 s385 (12788..13708) [921 bp, 306 aa] {ON} (12788..13708)
           [921 nt, 307 aa]
          Length = 306

 Score =  369 bits (947), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 173/293 (59%), Positives = 218/293 (74%)

Query: 19  RSILKYFTALEQSEGVGAKVRRSIGTQKLRNFTPFLMLDHFTIAPPAGFPDHPHHGQETV 78
           RSI K+F A EQ+EGVGA+VRRSIGT  LR F+PFLMLDHF +AP AGFPDHPHHGQET+
Sbjct: 8   RSIFKHFIAREQAEGVGARVRRSIGTMLLRKFSPFLMLDHFNVAPGAGFPDHPHHGQETI 67

Query: 79  THILRGAVAHEDFTGSKGVLRAGDLQFMTAGKGTVHSEIPVQLESGDPTEGIQLWVDLPA 138
           T++  G +AHEDFTG KGVL  GDLQFMTAGK   H+E+PVQ  SG+   G+QLWVDLP 
Sbjct: 68  TYVNEGMIAHEDFTGCKGVLYKGDLQFMTAGKAICHAEMPVQSNSGEHVVGLQLWVDLPT 127

Query: 139 RLKDCQPRYRDLKRDRIPTARSKNGLNISVISGQSYGVDSIQELAYTSVHYYHYVFSEAN 198
            +K+ +PRYRDLK   IP A   + L + VISG SYGVDS+++LAYT + +Y Y   +A 
Sbjct: 128 DMKNTEPRYRDLKNKEIPRANPTDDLEVEVISGNSYGVDSVKDLAYTPIDFYMYRGKKAG 187

Query: 199 ISFEQVFPTDFNVFLYVLKGRLNIAGQEFSKHSSIFFKTDGSHVSGFSGSNDLEFILAGG 258
             F Q F  DFNVF+YVL+G + I  Q F ++SSIFF TDG  V G   +++ EF + GG
Sbjct: 188 TEFTQNFSRDFNVFIYVLQGAITIGDQVFPQYSSIFFNTDGDAVGGTIAADNTEFAIIGG 247

Query: 259 QILDQPIVQYGPFVETSKERMMEVFQNYQSGTNGFEKAAGWTSSIANGIVESD 311
           +ILDQ  VQ+GPFVE +KE++++VF +YQS +NGFE+A  W SSI +GI E+D
Sbjct: 248 KILDQQTVQHGPFVEETKEKLIKVFYDYQSYSNGFERARNWKSSIRDGIKEND 300

>CAGL0I08151g Chr9 (793917..795065) [1149 bp, 382 aa] {ON} highly
           similar to KLLA0D01243g Kluyveromyces lactis and
           DEHA0E07447g Debaryomyces hansenii and YALI0E33297g
           Yarrowia lipolytica and CA2891|CaIFS4 Candida albicans
          Length = 382

 Score =  367 bits (941), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 167/293 (56%), Positives = 216/293 (73%)

Query: 19  RSILKYFTALEQSEGVGAKVRRSIGTQKLRNFTPFLMLDHFTIAPPAGFPDHPHHGQETV 78
           RSIL +F A EQ EGVGA+VRRS+GT ++R FTPFLMLD FT+APP GFPDHPHHGQET+
Sbjct: 83  RSILTHFIAGEQEEGVGARVRRSVGTYQMRRFTPFLMLDDFTVAPPNGFPDHPHHGQETI 142

Query: 79  THILRGAVAHEDFTGSKGVLRAGDLQFMTAGKGTVHSEIPVQLESGDPTEGIQLWVDLPA 138
           T++  G +AHED TGSKGVL  GDLQFMTAGKG VHSEIPV  + G P  G+QLWVDLP+
Sbjct: 143 TYVTDGMIAHEDITGSKGVLLKGDLQFMTAGKGIVHSEIPVTTKDGKPCRGLQLWVDLPS 202

Query: 139 RLKDCQPRYRDLKRDRIPTARSKNGLNISVISGQSYGVDSIQELAYTSVHYYHYVFSEAN 198
            +K+  PRYR+L+ +  P A     L + VISG+SYGV+S+++LAYT VH YH++ ++  
Sbjct: 203 DMKNIDPRYRNLRGNETPVAYPNENLEVRVISGKSYGVESLRDLAYTPVHLYHFLANKTG 262

Query: 199 ISFEQVFPTDFNVFLYVLKGRLNIAGQEFSKHSSIFFKTDGSHVSGFSGSNDLEFILAGG 258
             F Q  P DFNVF+YV+KG + +   E +  SS FF  DG+ + G + S D +F +  G
Sbjct: 263 TEFVQDIPEDFNVFIYVMKGSIQVNDVELTTFSSAFFDVDGNAIRGKALSEDAQFAIIAG 322

Query: 259 QILDQPIVQYGPFVETSKERMMEVFQNYQSGTNGFEKAAGWTSSIANGIVESD 311
           +ILDQ ++Q+GPFVET++E++MEVF+NYQ   NGFE A  W SSI +GI E +
Sbjct: 323 RILDQEVIQHGPFVETNREKLMEVFRNYQEEKNGFENAHSWRSSIHDGISEEE 375

>KAFR0G02680 Chr7 (553335..554486) [1152 bp, 383 aa] {ON} Anc_6.23
          Length = 383

 Score =  351 bits (900), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 162/297 (54%), Positives = 214/297 (72%)

Query: 19  RSILKYFTALEQSEGVGAKVRRSIGTQKLRNFTPFLMLDHFTIAPPAGFPDHPHHGQETV 78
           RSI+ +F   E  EG GA+V+RSIG+ + R F PFLMLD F + PPAGFPDHPHHGQET+
Sbjct: 85  RSIINHFIPNETFEGDGARVKRSIGSHEQRRFAPFLMLDDFDVTPPAGFPDHPHHGQETI 144

Query: 79  THILRGAVAHEDFTGSKGVLRAGDLQFMTAGKGTVHSEIPVQLESGDPTEGIQLWVDLPA 138
           T++L G +AHEDFTG  G+L  GDLQFMTAG+G VHSEIPV +E+G    G+QLWVDLP 
Sbjct: 145 TYVLSGMIAHEDFTGLNGILSPGDLQFMTAGRGIVHSEIPVTMENGGSCRGLQLWVDLPQ 204

Query: 139 RLKDCQPRYRDLKRDRIPTARSKNGLNISVISGQSYGVDSIQELAYTSVHYYHYVFSEAN 198
            LK  +PRYR+L+   IP A     L + VISG+SY V+S+ +LAYT VH YH+V  +A 
Sbjct: 205 DLKTIEPRYRNLRAADIPIAMPYENLKVYVISGKSYDVESLNDLAYTPVHLYHFVTIKAG 264

Query: 199 ISFEQVFPTDFNVFLYVLKGRLNIAGQEFSKHSSIFFKTDGSHVSGFSGSNDLEFILAGG 258
             F Q FP DFNVFLYV+KG + I  + F ++++IFF  DG  + G   ++D EF+L GG
Sbjct: 265 TPFIQEFPKDFNVFLYVIKGAVLINEKIFKENTAIFFDVDGESIEGQFATDDSEFVLVGG 324

Query: 259 QILDQPIVQYGPFVETSKERMMEVFQNYQSGTNGFEKAAGWTSSIANGIVESDISDF 315
           +IL+QP+VQ GPFVET K+++M+VF +++S  NGFE+A  W S+I  GI E++  + 
Sbjct: 325 EILNQPVVQQGPFVETDKQKLMQVFDDFESYRNGFERAENWESNIRKGIKEAEAREL 381

>Skud_9.19 Chr9 complement(40103..45145) [5043 bp, 1680 aa] {ON}
            YIL149C (REAL)
          Length = 1680

 Score = 32.0 bits (71), Expect = 2.4,   Method: Composition-based stats.
 Identities = 17/58 (29%), Positives = 28/58 (48%), Gaps = 2/58 (3%)

Query: 262  DQPIVQYGPFVET--SKERMMEVFQNYQSGTNGFEKAAGWTSSIANGIVESDISDFVK 317
            D   + + PFVE   S ++ ++VF+N    ++ FEK         N I++    DF K
Sbjct: 1353 DHDSIAFKPFVEEIESLKKELQVFRNANDASDAFEKIKNNMEEEKNKIIDEKTKDFEK 1410

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 33,684,745
Number of extensions: 1428202
Number of successful extensions: 3132
Number of sequences better than 10.0: 25
Number of HSP's gapped: 3175
Number of HSP's successfully gapped: 25
Length of query: 320
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 210
Effective length of database: 40,868,139
Effective search space: 8582309190
Effective search space used: 8582309190
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 66 (30.0 bits)