Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_56.224376.22ON53653628270.0
KLTH0C11176g6.22ON53653523760.0
SAKL0E01364g6.22ON54153420980.0
KLLA0D01221g6.22ON56653220140.0
Kpol_1037.276.22ON54654220000.0
KAFR0A050706.22ON56454019990.0
TDEL0G044706.22ON54253419860.0
CAGL0E02629g6.22ON54853919810.0
NCAS0D021606.22ON56354019760.0
KNAG0F028906.22ON56352819730.0
TPHA0J003506.22ON55952919710.0
ZYRO0C07744g6.22ON54754219660.0
Ecym_30276.22ON54953219640.0
Suva_15.1776.22ON54454019520.0
Skud_15.1636.22ON54454019450.0
ACR004W6.22ON56353319410.0
Smik_15.1716.22ON54454019390.0
TBLA0G009706.22ON55954419400.0
NDAI0C026306.22ON58054819350.0
YOR002W (ALG6)6.22ON54454018960.0
TBLA0A093105.669ON5464033172e-30
TPHA0J013805.669ON5754243164e-30
ZYRO0A11506g5.669ON5564173093e-29
KLTH0F17666g5.669ON5554183083e-29
Kwal_55.217425.669ON5554203074e-29
CAGL0L10450g5.669ON5504203074e-29
NDAI0F005105.669ON5704163084e-29
YOR067C (ALG8)5.669ON5774213075e-29
Kpol_1018.735.669ON6214163077e-29
Smik_15.2475.669ON5774173041e-28
Skud_15.2345.669ON5774172987e-28
NCAS0G004505.669ON5704202979e-28
Suva_8.1185.669ON5764162961e-27
KNAG0L019205.669ON5684162942e-27
KAFR0D024405.669ON5754192915e-27
KLLA0F16621g5.669ON5614202844e-26
TDEL0B025405.669ON5694142844e-26
ADR210C5.669ON5723862801e-25
SAKL0G00836g5.669ON5614232764e-25
Ecym_40515.669ON6044152623e-23
CAGL0A01914g5.402ON374385761.3
KAFR0B045902.158ON61692705.5
NDAI0F031202.111ON22753687.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_56.22437
         (536 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_56.22437 s56 complement(127493..129103) [1611 bp, 536 aa] {...  1093   0.0  
KLTH0C11176g Chr3 (917419..919029) [1611 bp, 536 aa] {ON} simila...   919   0.0  
SAKL0E01364g Chr5 (103009..104634) [1626 bp, 541 aa] {ON} simila...   812   0.0  
KLLA0D01221g Chr4 complement(106736..108436) [1701 bp, 566 aa] {...   780   0.0  
Kpol_1037.27 s1037 complement(65544..67184) [1641 bp, 546 aa] {O...   775   0.0  
KAFR0A05070 Chr1 complement(1007657..1009351) [1695 bp, 564 aa] ...   774   0.0  
TDEL0G04470 Chr7 (810734..812362) [1629 bp, 542 aa] {ON} Anc_6.2...   769   0.0  
CAGL0E02629g Chr5 (250010..251656) [1647 bp, 548 aa] {ON} highly...   767   0.0  
NCAS0D02160 Chr4 complement(401973..403664) [1692 bp, 563 aa] {O...   765   0.0  
KNAG0F02890 Chr6 complement(547204..548895) [1692 bp, 563 aa] {O...   764   0.0  
TPHA0J00350 Chr10 complement(77974..79653) [1680 bp, 559 aa] {ON...   763   0.0  
ZYRO0C07744g Chr3 (587374..589017) [1644 bp, 547 aa] {ON} highly...   761   0.0  
Ecym_3027 Chr3 complement(52360..54009) [1650 bp, 549 aa] {ON} s...   761   0.0  
Suva_15.177 Chr15 (303845..305479) [1635 bp, 544 aa] {ON} YOR002...   756   0.0  
Skud_15.163 Chr15 (289416..291050) [1635 bp, 544 aa] {ON} YOR002...   753   0.0  
ACR004W Chr3 (360904..362595) [1692 bp, 563 aa] {ON} Syntenic ho...   752   0.0  
Smik_15.171 Chr15 (296715..298349) [1635 bp, 544 aa] {ON} YOR002...   751   0.0  
TBLA0G00970 Chr7 (246516..248195) [1680 bp, 559 aa] {ON} Anc_6.2...   751   0.0  
NDAI0C02630 Chr3 (609993..611735) [1743 bp, 580 aa] {ON} Anc_6.2...   749   0.0  
YOR002W Chr15 (329417..331051) [1635 bp, 544 aa] {ON}  ALG6Alpha...   734   0.0  
TBLA0A09310 Chr1 (2297508..2299148) [1641 bp, 546 aa] {ON} Anc_5...   126   2e-30
TPHA0J01380 Chr10 complement(321431..323158) [1728 bp, 575 aa] {...   126   4e-30
ZYRO0A11506g Chr1 complement(925282..926952) [1671 bp, 556 aa] {...   123   3e-29
KLTH0F17666g Chr6 complement(1425802..1427469) [1668 bp, 555 aa]...   123   3e-29
Kwal_55.21742 s55 complement(960476..962143) [1668 bp, 555 aa] {...   122   4e-29
CAGL0L10450g Chr12 complement(1117959..1119611) [1653 bp, 550 aa...   122   4e-29
NDAI0F00510 Chr6 (118893..120605) [1713 bp, 570 aa] {ON} Anc_5.6...   123   4e-29
YOR067C Chr15 complement(451729..453462) [1734 bp, 577 aa] {ON} ...   122   5e-29
Kpol_1018.73 s1018 complement(205615..207480) [1866 bp, 621 aa] ...   122   7e-29
Smik_15.247 Chr15 complement(417710..419443) [1734 bp, 577 aa] {...   121   1e-28
Skud_15.234 Chr15 complement(413571..415304) [1734 bp, 577 aa] {...   119   7e-28
NCAS0G00450 Chr7 (77781..79493) [1713 bp, 570 aa] {ON} Anc_5.669...   119   9e-28
Suva_8.118 Chr8 complement(214797..216527) [1731 bp, 576 aa] {ON...   118   1e-27
KNAG0L01920 Chr12 complement(344454..346160) [1707 bp, 568 aa] {...   117   2e-27
KAFR0D02440 Chr4 (489816..491543) [1728 bp, 575 aa] {ON} Anc_5.6...   116   5e-27
KLLA0F16621g Chr6 complement(1531745..1533430) [1686 bp, 561 aa]...   114   4e-26
TDEL0B02540 Chr2 (459825..461534) [1710 bp, 569 aa] {ON} Anc_5.6...   114   4e-26
ADR210C Chr4 complement(1070234..1071952) [1719 bp, 572 aa] {ON}...   112   1e-25
SAKL0G00836g Chr7 (77387..79072) [1686 bp, 561 aa] {ON} highly s...   110   4e-25
Ecym_4051 Chr4 (109310..111124) [1815 bp, 604 aa] {ON} similar t...   105   3e-23
CAGL0A01914g Chr1 (195146..206377) [11232 bp, 3743 aa] {ON} high...    34   1.3  
KAFR0B04590 Chr2 (954347..956197) [1851 bp, 616 aa] {ON} Anc_2.1...    32   5.5  
NDAI0F03120 Chr6 (754315..754998) [684 bp, 227 aa] {ON} Anc_2.11...    31   7.7  

>Kwal_56.22437 s56 complement(127493..129103) [1611 bp, 536 aa] {ON}
           YOR002W (ALG6) - glucosyltransferase [contig 185] FULL
          Length = 536

 Score = 1093 bits (2827), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 536/536 (100%), Positives = 536/536 (100%)

Query: 1   MAGKKVSKNEPFFASPLYDFLSPFRPVANQYYAEYVIVIFALVIRCAVGLGSFSGENSGP 60
           MAGKKVSKNEPFFASPLYDFLSPFRPVANQYYAEYVIVIFALVIRCAVGLGSFSGENSGP
Sbjct: 1   MAGKKVSKNEPFFASPLYDFLSPFRPVANQYYAEYVIVIFALVIRCAVGLGSFSGENSGP 60

Query: 61  IHGDFEAQRHWMELTNHLPLSQWYWYDLQYWGLDYPPLTAYHSYVLGKLGSLLNSEWFAL 120
           IHGDFEAQRHWMELTNHLPLSQWYWYDLQYWGLDYPPLTAYHSYVLGKLGSLLNSEWFAL
Sbjct: 61  IHGDFEAQRHWMELTNHLPLSQWYWYDLQYWGLDYPPLTAYHSYVLGKLGSLLNSEWFAL 120

Query: 121 LSSRGIENPDIKAYMRFTVILSEAGLYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQP 180
           LSSRGIENPDIKAYMRFTVILSEAGLYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQP
Sbjct: 121 LSSRGIENPDIKAYMRFTVILSEAGLYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQP 180

Query: 181 SLILIDHGHFQYNSVMLGLTVYSINNLLDGYYGPAAICFVLSLCFKQMALYYSPVFFAYL 240
           SLILIDHGHFQYNSVMLGLTVYSINNLLDGYYGPAAICFVLSLCFKQMALYYSPVFFAYL
Sbjct: 181 SLILIDHGHFQYNSVMLGLTVYSINNLLDGYYGPAAICFVLSLCFKQMALYYSPVFFAYL 240

Query: 241 LSECLISPSLNVPRFLSVAFSTVISFCIIFSPLYVFGGTKNVLQSIHRIFPFSRGIFEDK 300
           LSECLISPSLNVPRFLSVAFSTVISFCIIFSPLYVFGGTKNVLQSIHRIFPFSRGIFEDK
Sbjct: 241 LSECLISPSLNVPRFLSVAFSTVISFCIIFSPLYVFGGTKNVLQSIHRIFPFSRGIFEDK 300

Query: 301 VANFWCVSNVLFKYAQNYTQQELQRFSIIATAAGFLPSFLVVLCYPKKHMIPFALAACSM 360
           VANFWCVSNVLFKYAQNYTQQELQRFSIIATAAGFLPSFLVVLCYPKKHMIPFALAACSM
Sbjct: 301 VANFWCVSNVLFKYAQNYTQQELQRFSIIATAAGFLPSFLVVLCYPKKHMIPFALAACSM 360

Query: 361 AFFLFSFQVHEKSILVPLLPITLLYCSTDWNVLSMVSWINNVALFTLWPLLKKDHLTLQY 420
           AFFLFSFQVHEKSILVPLLPITLLYCSTDWNVLSMVSWINNVALFTLWPLLKKDHLTLQY
Sbjct: 361 AFFLFSFQVHEKSILVPLLPITLLYCSTDWNVLSMVSWINNVALFTLWPLLKKDHLTLQY 420

Query: 421 GILMLLSNWLIGNFSFVTPRFLPKFITPGPSISVVSETYRRRSFLPDNNFWKLIIVASYL 480
           GILMLLSNWLIGNFSFVTPRFLPKFITPGPSISVVSETYRRRSFLPDNNFWKLIIVASYL
Sbjct: 421 GILMLLSNWLIGNFSFVTPRFLPKFITPGPSISVVSETYRRRSFLPDNNFWKLIIVASYL 480

Query: 481 IMAAIHILDFFVPTPEGLPDLWVLLNCALGFFCFTIFWLWMHYKLFTMRNTNLQDF 536
           IMAAIHILDFFVPTPEGLPDLWVLLNCALGFFCFTIFWLWMHYKLFTMRNTNLQDF
Sbjct: 481 IMAAIHILDFFVPTPEGLPDLWVLLNCALGFFCFTIFWLWMHYKLFTMRNTNLQDF 536

>KLTH0C11176g Chr3 (917419..919029) [1611 bp, 536 aa] {ON} similar
           to uniprot|Q12001 Saccharomyces cerevisiae YOR002W ALG6
           Glucosyltransferase involved in transfer of
           oligosaccharides from dolichyl pyrophosphate to
           asparagine residues of proteins during N-linked protein
           glycosylation mutations in human ortholog are associated
           with disease
          Length = 536

 Score =  919 bits (2376), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 439/535 (82%), Positives = 483/535 (90%)

Query: 1   MAGKKVSKNEPFFASPLYDFLSPFRPVANQYYAEYVIVIFALVIRCAVGLGSFSGENSGP 60
           M  +K    E FFASPLYDFLSPFRPVANQYYAEYVIVIFALVIRCAVGLGSFSGE + P
Sbjct: 1   MDARKSLPKESFFASPLYDFLSPFRPVANQYYAEYVIVIFALVIRCAVGLGSFSGEATVP 60

Query: 61  IHGDFEAQRHWMELTNHLPLSQWYWYDLQYWGLDYPPLTAYHSYVLGKLGSLLNSEWFAL 120
           +HGDFEAQRHWMELT +LPLSQWYW+DLQYWGLDYPPLTAYHSY LGKLGS+LN EWFAL
Sbjct: 61  MHGDFEAQRHWMELTTNLPLSQWYWFDLQYWGLDYPPLTAYHSYALGKLGSVLNPEWFAL 120

Query: 121 LSSRGIENPDIKAYMRFTVILSEAGLYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQP 180
            SSRG E P++KAYMRFTVILSEA LYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQP
Sbjct: 121 GSSRGNETPELKAYMRFTVILSEAALYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQP 180

Query: 181 SLILIDHGHFQYNSVMLGLTVYSINNLLDGYYGPAAICFVLSLCFKQMALYYSPVFFAYL 240
           SLILIDHGHFQYNSVMLGLTVY+INNLLDG++GPAAICF+LSLCFKQMAL+YSP+FFAYL
Sbjct: 181 SLILIDHGHFQYNSVMLGLTVYAINNLLDGFHGPAAICFMLSLCFKQMALFYSPIFFAYL 240

Query: 241 LSECLISPSLNVPRFLSVAFSTVISFCIIFSPLYVFGGTKNVLQSIHRIFPFSRGIFEDK 300
           LS  L SPS    RF+SVA STVI+FC++FSPLYVFGG KNVLQSIHRIFPFSRGIFEDK
Sbjct: 241 LSRSLFSPSFKFSRFMSVALSTVITFCLMFSPLYVFGGMKNVLQSIHRIFPFSRGIFEDK 300

Query: 301 VANFWCVSNVLFKYAQNYTQQELQRFSIIATAAGFLPSFLVVLCYPKKHMIPFALAACSM 360
           VANFWCVSNV+ KYA N+TQ +LQ+ S  ATAAGFLPSF +V+ YPKKHMIP+ LAACSM
Sbjct: 301 VANFWCVSNVIVKYADNFTQDQLQKLSTFATAAGFLPSFALVVLYPKKHMIPYGLAACSM 360

Query: 361 AFFLFSFQVHEKSILVPLLPITLLYCSTDWNVLSMVSWINNVALFTLWPLLKKDHLTLQY 420
           AFFLF FQVHEKSILVPLLPI+LL+CSTDWNVL++VSWINNVALFTLWPLLKKD L LQY
Sbjct: 361 AFFLFGFQVHEKSILVPLLPISLLFCSTDWNVLAIVSWINNVALFTLWPLLKKDKLALQY 420

Query: 421 GILMLLSNWLIGNFSFVTPRFLPKFITPGPSISVVSETYRRRSFLPDNNFWKLIIVASYL 480
           GI+MLLSNWLIGNFSFVTPRFLP FITPGPS+S V+ETYRRRSFLP+N  WK++I+ SY+
Sbjct: 421 GIMMLLSNWLIGNFSFVTPRFLPGFITPGPSMSNVAETYRRRSFLPNNIVWKILIITSYI 480

Query: 481 IMAAIHILDFFVPTPEGLPDLWVLLNCALGFFCFTIFWLWMHYKLFTMRNTNLQD 535
           +MA IHILD FV  P  LPDLWVL+NCALGF CF++FWLW +YKLFTMRN ++ D
Sbjct: 481 VMAVIHILDLFVQPPAKLPDLWVLMNCALGFTCFSVFWLWNNYKLFTMRNKSILD 535

>SAKL0E01364g Chr5 (103009..104634) [1626 bp, 541 aa] {ON} similar
           to uniprot|Q12001 Saccharomyces cerevisiae YOR002W ALG6
           Glucosyltransferase involved in transfer of
           oligosaccharides from dolichyl pyrophosphate to
           asparagine residues of proteins during N-linked protein
           glycosylation mutations in human ortholog are associated
           with disease
          Length = 541

 Score =  812 bits (2098), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/534 (74%), Positives = 456/534 (85%), Gaps = 1/534 (0%)

Query: 3   GKKVSKNEPFFASPLYDFLSPFRPVANQYYAEYVIVIFALVIRCAVGLGSFSGENSGPIH 62
            +K+ K E FFASPL+DFLSPFRPVANQ+ A+Y+IV+FAL+IRC VGLGSFSG N  P+H
Sbjct: 9   SRKIVK-ESFFASPLFDFLSPFRPVANQWCAKYIIVLFALIIRCGVGLGSFSGMNVPPMH 67

Query: 63  GDFEAQRHWMELTNHLPLSQWYWYDLQYWGLDYPPLTAYHSYVLGKLGSLLNSEWFALLS 122
           GDFEAQRHWMELT +LPLSQWYWYDL YWGLDYPPLTAYHSY+LGKLG + +  WF L  
Sbjct: 68  GDFEAQRHWMELTTNLPLSQWYWYDLPYWGLDYPPLTAYHSYILGKLGDIFDPTWFQLGV 127

Query: 123 SRGIENPDIKAYMRFTVILSEAGLYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQPSL 182
           SRG E+ D+K+YMRFTV+LSE  LYIP V+YF KW G  R Q+PIGQYIAAAAILFQPSL
Sbjct: 128 SRGQESMDLKSYMRFTVLLSELLLYIPGVIYFAKWIGKHRGQTPIGQYIAAAAILFQPSL 187

Query: 183 ILIDHGHFQYNSVMLGLTVYSINNLLDGYYGPAAICFVLSLCFKQMALYYSPVFFAYLLS 242
           ILIDHGHFQYNSVMLGLTVY+INNLLD YY PAAICFVLS+CFKQMALYY+P+FF+YLLS
Sbjct: 188 ILIDHGHFQYNSVMLGLTVYAINNLLDEYYAPAAICFVLSVCFKQMALYYAPIFFSYLLS 247

Query: 243 ECLISPSLNVPRFLSVAFSTVISFCIIFSPLYVFGGTKNVLQSIHRIFPFSRGIFEDKVA 302
           + L SP  N+PR L+VA +T+ISF  +F PLY++GG +NVLQSIHRIFPFSRGIFEDKVA
Sbjct: 248 KSLFSPLFNLPRLLAVAAATLISFAAMFFPLYMWGGIRNVLQSIHRIFPFSRGIFEDKVA 307

Query: 303 NFWCVSNVLFKYAQNYTQQELQRFSIIATAAGFLPSFLVVLCYPKKHMIPFALAACSMAF 362
           NFWC SN+  KY   YTQ +LQ +S+ ATA GFLP+F+++  YPKKH+IP+AL ACSM+F
Sbjct: 308 NFWCFSNIFIKYKVLYTQSQLQMYSLCATALGFLPAFILIFFYPKKHLIPYALTACSMSF 367

Query: 363 FLFSFQVHEKSILVPLLPITLLYCSTDWNVLSMVSWINNVALFTLWPLLKKDHLTLQYGI 422
           FLFSFQVHEK+ILVPLLPITLLY STDWNVLSMVSWINN+A FTLWPLLKKD L LQY  
Sbjct: 368 FLFSFQVHEKTILVPLLPITLLYTSTDWNVLSMVSWINNMAFFTLWPLLKKDGLVLQYAT 427

Query: 423 LMLLSNWLIGNFSFVTPRFLPKFITPGPSISVVSETYRRRSFLPDNNFWKLIIVASYLIM 482
           L+LLSNWLIGNFSFVTPRFLPKF+TPGPS S VSE YRRRS LPDN FWKLIIVASY+ M
Sbjct: 428 LLLLSNWLIGNFSFVTPRFLPKFLTPGPSTSDVSENYRRRSLLPDNIFWKLIIVASYISM 487

Query: 483 AAIHILDFFVPTPEGLPDLWVLLNCALGFFCFTIFWLWMHYKLFTMRNTNLQDF 536
             +H+LDF+V  P   PDLWVLLNC+LGFF F +FW+W +YK+FT+RN  L DF
Sbjct: 488 GILHLLDFYVQPPAKYPDLWVLLNCSLGFFSFFLFWVWNYYKMFTLRNKTLYDF 541

>KLLA0D01221g Chr4 complement(106736..108436) [1701 bp, 566 aa] {ON}
           similar to uniprot|Q12001 Saccharomyces cerevisiae
           YOR002W ALG6 Glucosyltransferase involved in transfer of
           oligosaccharides from dolichyl pyrophosphate to
           asparagine residues of proteins during N-linked protein
           glycosylation mutations in human ortholog are associated
           with disease,
          Length = 566

 Score =  780 bits (2014), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/532 (70%), Positives = 444/532 (83%)

Query: 4   KKVSKNEPFFASPLYDFLSPFRPVANQYYAEYVIVIFALVIRCAVGLGSFSGENSGPIHG 63
           KKV   E FFASP+YDFL+PFRPV NQ+ A+YVIVIFAL+IRCAVGLG +SG N+ P+ G
Sbjct: 34  KKVESVEAFFASPMYDFLTPFRPVGNQWCAKYVIVIFALIIRCAVGLGGYSGMNTPPMFG 93

Query: 64  DFEAQRHWMELTNHLPLSQWYWYDLQYWGLDYPPLTAYHSYVLGKLGSLLNSEWFALLSS 123
           DFEAQRHWME+T HLP+ +WYWYDLQYWGLDYPPLTAYHSY+LGKLGS     WF L SS
Sbjct: 94  DFEAQRHWMEITQHLPVREWYWYDLQYWGLDYPPLTAYHSYLLGKLGSFFREGWFDLESS 153

Query: 124 RGIENPDIKAYMRFTVILSEAGLYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQPSLI 183
           RG E+ ++K+YMRFTVI+SE  LYIPAV+YFTKW G  R QSPIGQYIAAAAILFQP+LI
Sbjct: 154 RGYESLNLKSYMRFTVIISELLLYIPAVIYFTKWVGKYRSQSPIGQYIAAAAILFQPALI 213

Query: 184 LIDHGHFQYNSVMLGLTVYSINNLLDGYYGPAAICFVLSLCFKQMALYYSPVFFAYLLSE 243
           L+DHGHFQYN VMLG+TVY++NNLLDG+Y   AICFVLSLCFKQMALYYSP+FFAYLLS+
Sbjct: 214 LVDHGHFQYNCVMLGMTVYTLNNLLDGFYAMGAICFVLSLCFKQMALYYSPIFFAYLLSK 273

Query: 244 CLISPSLNVPRFLSVAFSTVISFCIIFSPLYVFGGTKNVLQSIHRIFPFSRGIFEDKVAN 303
              SP +N+PR  +++ ST ++F   F P+Y+FGG KN++QS+HRIFPF+RGIFEDKVAN
Sbjct: 274 STYSPGINLPRLFAISVSTALAFIGSFGPIYIFGGYKNLVQSMHRIFPFARGIFEDKVAN 333

Query: 304 FWCVSNVLFKYAQNYTQQELQRFSIIATAAGFLPSFLVVLCYPKKHMIPFALAACSMAFF 363
           FWCVSN+  KY   +TQ++LQ +S++AT  G LPSF++   YPK+H++P+ALAACSM+FF
Sbjct: 334 FWCVSNIFIKYRNLFTQKDLQLYSLLATVIGLLPSFIITFLYPKRHLLPYALAACSMSFF 393

Query: 364 LFSFQVHEKSILVPLLPITLLYCSTDWNVLSMVSWINNVALFTLWPLLKKDHLTLQYGIL 423
           LFSFQVHEK+IL+PLLPITLLY S DWNVLS+V WINNVALFTLWPLLKKD+L LQYG++
Sbjct: 394 LFSFQVHEKTILLPLLPITLLYTSRDWNVLSLVCWINNVALFTLWPLLKKDNLVLQYGVM 453

Query: 424 MLLSNWLIGNFSFVTPRFLPKFITPGPSISVVSETYRRRSFLPDNNFWKLIIVASYLIMA 483
            + SNWLIGNFSFVTPRFLPKF+TPGPSIS +   YRR S LP +  W+LIIV SY+ M 
Sbjct: 454 FMFSNWLIGNFSFVTPRFLPKFLTPGPSISDIDVDYRRASLLPKSLIWRLIIVGSYIAMG 513

Query: 484 AIHILDFFVPTPEGLPDLWVLLNCALGFFCFTIFWLWMHYKLFTMRNTNLQD 535
            IH LD++V  P   PDLWVL NC+LGF CF  FW+W +YKLF MRN+ LQD
Sbjct: 514 IIHFLDYYVSPPSKYPDLWVLANCSLGFSCFVTFWIWNNYKLFEMRNSTLQD 565

>Kpol_1037.27 s1037 complement(65544..67184) [1641 bp, 546 aa] {ON}
           complement(65544..67184) [1641 nt, 547 aa]
          Length = 546

 Score =  775 bits (2000), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/542 (68%), Positives = 444/542 (81%), Gaps = 9/542 (1%)

Query: 2   AGKKVSK-----NEPFFASPLYDFLSPFRPVANQYYAEYVIVIFALVIRCAVGLGSFSGE 56
           + KK+S+      E FFASPLYDFLSPFRPV+NQ+  EY+IVIFAL++RCA+GLGS+SG 
Sbjct: 3   SKKKISRINKPVEESFFASPLYDFLSPFRPVSNQWLTEYIIVIFALIVRCAIGLGSYSGM 62

Query: 57  NSGPIHGDFEAQRHWMELTNHLPLSQWYWYDLQYWGLDYPPLTAYHSYVLGKLGSLLNSE 116
            + P+ GDFEAQRHWME+T HLP+S+WY++DL+YWGLDYPPLTAYHSYVLG +GS LN  
Sbjct: 63  GNPPMFGDFEAQRHWMEITQHLPISKWYFFDLEYWGLDYPPLTAYHSYVLGVIGSFLNKS 122

Query: 117 WFALLSSRGIE--NPDIKAYMRFTVILSEAGLYIPAVLYFTKWFGIKRRQSPIGQYIAAA 174
           WFAL  SRG E  N D+K YMR TVI+SE   YIP V+YFTKW G  R+QS IGQYIAAA
Sbjct: 123 WFALNDSRGYESENNDLKTYMRTTVIISEIIFYIPGVIYFTKWVGRHRQQSLIGQYIAAA 182

Query: 175 AILFQPSLILIDHGHFQYNSVMLGLTVYSINNLLDGYYGPAAICFVLSLCFKQMALYYSP 234
           AILFQPSL+LIDHGHFQYNSVMLGLTVY+INNLLD +Y PAA+CFVLS+CFKQMALYY+P
Sbjct: 183 AILFQPSLMLIDHGHFQYNSVMLGLTVYAINNLLDEFYAPAAMCFVLSICFKQMALYYAP 242

Query: 235 VFFAYLLSECLISPSL-NVPRFLSVAFSTVISFCIIFSPLYVFGGT-KNVLQSIHRIFPF 292
           +FF YLL   L S    N+ RFLS+A STV +F  +++PLYVFGG  +NV+QS+HRIFPF
Sbjct: 243 IFFGYLLGRSLFSRKFFNISRFLSIAISTVFAFFSMYAPLYVFGGGLRNVIQSVHRIFPF 302

Query: 293 SRGIFEDKVANFWCVSNVLFKYAQNYTQQELQRFSIIATAAGFLPSFLVVLCYPKKHMIP 352
           +RG+FEDKVANFWCV+N+  KY   YTQ+ELQ +S+IAT  GFLP+ + +L YPKKH++P
Sbjct: 303 ARGLFEDKVANFWCVTNIFIKYKILYTQKELQLYSLIATVVGFLPAVVTILFYPKKHLLP 362

Query: 353 FALAACSMAFFLFSFQVHEKSILVPLLPITLLYCSTDWNVLSMVSWINNVALFTLWPLLK 412
           +ALAACSM+F+LFSFQVHEK+ILVPLLPITLLY STDWNVLS VSW+NNV LFTLWPLLK
Sbjct: 363 YALAACSMSFYLFSFQVHEKTILVPLLPITLLYTSTDWNVLSFVSWVNNVGLFTLWPLLK 422

Query: 413 KDHLTLQYGILMLLSNWLIGNFSFVTPRFLPKFITPGPSISVVSETYRRRSFLPDNNFWK 472
           KD LTLQYG+   LSNWLIGNFSF+TP+FLPK +TPGP +    +TY RRS LP N  WK
Sbjct: 423 KDGLTLQYGVCFFLSNWLIGNFSFITPKFLPKMLTPGPPVQNTEDTYHRRSLLPHNILWK 482

Query: 473 LIIVASYLIMAAIHILDFFVPTPEGLPDLWVLLNCALGFFCFTIFWLWMHYKLFTMRNTN 532
           +IIV+SY++M  IH+ + FV  P   PD+WVL+NC LGF CF +FWLW +YK+FT+ N  
Sbjct: 483 IIIVSSYIVMLLIHLGEIFVSPPPEYPDIWVLMNCCLGFGCFVLFWLWNYYKIFTLANKT 542

Query: 533 LQ 534
           LQ
Sbjct: 543 LQ 544

>KAFR0A05070 Chr1 complement(1007657..1009351) [1695 bp, 564 aa]
           {ON} Anc_6.22 YOR002W
          Length = 564

 Score =  774 bits (1999), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/540 (67%), Positives = 438/540 (81%), Gaps = 8/540 (1%)

Query: 4   KKVSK------NEPFFASPLYDFLSPFRPVANQYYAEYVIVIFALVIRCAVGLGSFSGEN 57
           KK SK       E F+ASPLYDFL PFRP  NQ+ A+Y+IV FAL+IRCA+GLGS+SG  
Sbjct: 24  KKASKLNNEAIEEVFYASPLYDFLYPFRPAGNQWLAQYIIVTFALIIRCAIGLGSYSGMG 83

Query: 58  SGPIHGDFEAQRHWMELTNHLPLSQWYWYDLQYWGLDYPPLTAYHSYVLGKLGSLLNSEW 117
             P+ GDFEAQRHWME+T HLP+S+WYW+DLQYWGLDYPPLTAYHSY+LGK+GS +  +W
Sbjct: 84  HSPMFGDFEAQRHWMEITQHLPISKWYWFDLQYWGLDYPPLTAYHSYILGKIGSFIYPKW 143

Query: 118 FALLSSRGIENPDIKAYMRFTVILSEAGLYIPAVLYFTKWFGIKRRQSPIGQYIAAAAIL 177
           F L  SRGIE   IK+YMR TV++SEA  Y PA++YF+KWFG  R QSPIGQYIAA AIL
Sbjct: 144 FTLNDSRGIEMEGIKSYMRTTVLISEAVFYFPAIIYFSKWFGKHRNQSPIGQYIAATAIL 203

Query: 178 FQPSLILIDHGHFQYNSVMLGLTVYSINNLLDGYYGPAAICFVLSLCFKQMALYYSPVFF 237
           FQPSL+LIDHGHFQYNSVMLGLTVY+INNLLD +Y  A++CFVLS+CFKQM+LYY+P+FF
Sbjct: 204 FQPSLMLIDHGHFQYNSVMLGLTVYAINNLLDDFYSVASVCFVLSICFKQMSLYYAPIFF 263

Query: 238 AYLLSECLISPSL-NVPRFLSVAFSTVISFCIIFSPLYVFGGT-KNVLQSIHRIFPFSRG 295
            YLLS+ L  P L N+PR + +A  T+++F  ++SPLY+FGG  +N++QS+HRIFPF+RG
Sbjct: 264 GYLLSKSLFFPRLFNIPRLVGIAAVTIVTFVAMYSPLYIFGGGLENLIQSVHRIFPFARG 323

Query: 296 IFEDKVANFWCVSNVLFKYAQNYTQQELQRFSIIATAAGFLPSFLVVLCYPKKHMIPFAL 355
           IFEDKVANFWCV+N+L KY   +TQ +LQ +S+ AT  GFLP+ ++++ YPKKH++P+AL
Sbjct: 324 IFEDKVANFWCVTNILIKYKIKFTQDQLQLYSLAATVLGFLPALVIIVLYPKKHLLPYAL 383

Query: 356 AACSMAFFLFSFQVHEKSILVPLLPITLLYCSTDWNVLSMVSWINNVALFTLWPLLKKDH 415
           AACSM+FFLFSFQVHEK+ILVPLLPITLLY STDWNVLSMV WINNVALFTLWPLLKKD 
Sbjct: 384 AACSMSFFLFSFQVHEKTILVPLLPITLLYTSTDWNVLSMVCWINNVALFTLWPLLKKDG 443

Query: 416 LTLQYGILMLLSNWLIGNFSFVTPRFLPKFITPGPSISVVSETYRRRSFLPDNNFWKLII 475
           L LQY +   LSNWL+GNFSFVTP+FLPK +TPGPSIS + E Y RRS LP N  WK++I
Sbjct: 444 LILQYAVCFALSNWLLGNFSFVTPKFLPKMLTPGPSISAIHENYHRRSLLPHNILWKVVI 503

Query: 476 VASYLIMAAIHILDFFVPTPEGLPDLWVLLNCALGFFCFTIFWLWMHYKLFTMRNTNLQD 535
           V+SYL MA  H LDFFV  P   PD+W+ LNC +GF  F  FW+W +Y LFT+RN  L D
Sbjct: 504 VSSYLSMAVFHYLDFFVEPPTNYPDIWITLNCVIGFGSFVFFWMWTYYMLFTLRNKTLMD 563

>TDEL0G04470 Chr7 (810734..812362) [1629 bp, 542 aa] {ON} Anc_6.22
           YOR002W
          Length = 542

 Score =  769 bits (1986), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/534 (67%), Positives = 438/534 (82%), Gaps = 1/534 (0%)

Query: 3   GKKVSKNEPFFASPLYDFLSPFRPVANQYYAEYVIVIFALVIRCAVGLGSFSGENSGPIH 62
            K+ +  E F+ASPLYDFL PFRP  +Q+  EYVIV+FAL+I CAVG GS+SG+ S P+ 
Sbjct: 8   AKRNTVEESFYASPLYDFLYPFRPAGSQWLTEYVIVLFALIIGCAVGHGSYSGQFSPPMF 67

Query: 63  GDFEAQRHWMELTNHLPLSQWYWYDLQYWGLDYPPLTAYHSYVLGKLGSLLNSEWFALLS 122
           GDFEAQRHWME+T HL  SQWYW+DL+YWGLDYPPLTAYHSYVLGK+GS +  EWF L  
Sbjct: 68  GDFEAQRHWMEITQHLAPSQWYWFDLEYWGLDYPPLTAYHSYVLGKIGSFIKPEWFELNE 127

Query: 123 SRGIENPDIKAYMRFTVILSEAGLYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQPSL 182
           SRGIE PD+K +MRFTV+LSE   YIPAV+YFTKW G  R++SPIGQ+I+AAAILFQPSL
Sbjct: 128 SRGIETPDLKTFMRFTVLLSEGLFYIPAVVYFTKWLGKHRQKSPIGQFISAAAILFQPSL 187

Query: 183 ILIDHGHFQYNSVMLGLTVYSINNLLDGYYGPAAICFVLSLCFKQMALYYSPVFFAYLLS 242
           +LIDHGHFQYN VMLGLTVY+IN+L + +Y  AAICFVLS+CFKQMALYY+P+FFAYLLS
Sbjct: 188 MLIDHGHFQYNCVMLGLTVYAINSLFEEFYAVAAICFVLSICFKQMALYYAPIFFAYLLS 247

Query: 243 ECLISPSLNVPRFLSVAFSTVISFCIIFSPLYVFGGT-KNVLQSIHRIFPFSRGIFEDKV 301
           + L SP  N PR  ++A +TV+SF  +++PLY+FGG   NV+QS+HRIFPF+RGIFEDKV
Sbjct: 248 KSLFSPRFNFPRLFAIAVATVLSFAAMYAPLYIFGGGLANVIQSVHRIFPFARGIFEDKV 307

Query: 302 ANFWCVSNVLFKYAQNYTQQELQRFSIIATAAGFLPSFLVVLCYPKKHMIPFALAACSMA 361
           ANFWCV+NV FKY   + Q++LQ +S+IAT  GFLP+ +V+  YPKKH+I +ALA CSM+
Sbjct: 308 ANFWCVTNVFFKYKNIFPQEQLQLYSLIATMLGFLPAVIVIFLYPKKHIICYALATCSMS 367

Query: 362 FFLFSFQVHEKSILVPLLPITLLYCSTDWNVLSMVSWINNVALFTLWPLLKKDHLTLQYG 421
           F+LFSFQVHEK+ILVPLLPITLLY S++W+VLSM +WINNV LFTL+PLLKKD LTLQY 
Sbjct: 368 FYLFSFQVHEKTILVPLLPITLLYTSSNWDVLSMANWINNVGLFTLYPLLKKDGLTLQYF 427

Query: 422 ILMLLSNWLIGNFSFVTPRFLPKFITPGPSISVVSETYRRRSFLPDNNFWKLIIVASYLI 481
           +   LSNWL+GNFSFVTP+FLPKF+TPGPS+S V   YRRRSFLP N  WK+IIV+SY  
Sbjct: 428 VCFTLSNWLLGNFSFVTPKFLPKFLTPGPSVSSVDINYRRRSFLPSNVIWKIIIVSSYTA 487

Query: 482 MAAIHILDFFVPTPEGLPDLWVLLNCALGFFCFTIFWLWMHYKLFTMRNTNLQD 535
           M  +H++DF +  P   PDLWVLLNCALGF CFT+FWLW +Y LFTM    LQ 
Sbjct: 488 MGVLHVVDFVMGPPVSYPDLWVLLNCALGFGCFTLFWLWSYYMLFTMPRKTLQQ 541

>CAGL0E02629g Chr5 (250010..251656) [1647 bp, 548 aa] {ON} highly
           similar to uniprot|Q12001 Saccharomyces cerevisiae
           YOR002w ALG6 glucosyltransferase
          Length = 548

 Score =  767 bits (1981), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/539 (65%), Positives = 441/539 (81%), Gaps = 7/539 (1%)

Query: 4   KKVSK------NEPFFASPLYDFLSPFRPVANQYYAEYVIVIFALVIRCAVGLGSFSGEN 57
           K VSK       E F+ASPLYDFL PFRP  +Q+  E++I++FA++IRCA+GLG +SG  
Sbjct: 9   KAVSKFESEQGEESFYASPLYDFLFPFRPAGSQWLTEWIIIMFAMIIRCAIGLGPYSGYK 68

Query: 58  SGPIHGDFEAQRHWMELTNHLPLSQWYWYDLQYWGLDYPPLTAYHSYVLGKLGSLLNSEW 117
            GP+HGDFEAQRHWME+T HLP+S+WY+YDL+YWGLDYPPLTA+HSY+LGKLG+  N +W
Sbjct: 69  DGPMHGDFEAQRHWMEITQHLPISKWYYYDLKYWGLDYPPLTAFHSYLLGKLGTFCNPDW 128

Query: 118 FALLSSRGIENPDIKAYMRFTVILSEAGLYIPAVLYFTKWFGIKRRQSPIGQYIAAAAIL 177
           FAL SSRGIE   +K YMRFTV+LSEA  Y+PAV+YFTKW G +R QSPIGQ+IAAAAIL
Sbjct: 129 FALDSSRGIETQGLKNYMRFTVLLSEAIFYMPAVVYFTKWLGRRRNQSPIGQFIAAAAIL 188

Query: 178 FQPSLILIDHGHFQYNSVMLGLTVYSINNLLDGYYGPAAICFVLSLCFKQMALYYSPVFF 237
           FQPSL+LIDHGHFQYNS+MLG TVY+INNLLD +Y PAAICFVLS+CFKQM+LYY+P+FF
Sbjct: 189 FQPSLMLIDHGHFQYNSIMLGFTVYAINNLLDEFYAPAAICFVLSICFKQMSLYYAPIFF 248

Query: 238 AYLLSECLISPSL-NVPRFLSVAFSTVISFCIIFSPLYVFGGTKNVLQSIHRIFPFSRGI 296
           AYLL   +  P L N+PRF+S++ +T+++F  +FSP Y+FGG   + Q++ RIFPF+RGI
Sbjct: 249 AYLLGRSMFFPKLFNIPRFISISIATLVTFTAMFSPFYIFGGLDGLAQTVRRIFPFARGI 308

Query: 297 FEDKVANFWCVSNVLFKYAQNYTQQELQRFSIIATAAGFLPSFLVVLCYPKKHMIPFALA 356
           FEDKVANFWCV N + K+   +T  +L+ +S+I T  GF P+ ++++ YP+KH++P+ALA
Sbjct: 309 FEDKVANFWCVVNTIVKFKVLFTNDQLRMYSLILTVVGFAPAMILIILYPRKHLLPYALA 368

Query: 357 ACSMAFFLFSFQVHEKSILVPLLPITLLYCSTDWNVLSMVSWINNVALFTLWPLLKKDHL 416
           ACSM+F+LFSFQVHEK+ILVPLLPITLL+ S DWNVLSMVSWINNVALFTLWPLLK++ L
Sbjct: 369 ACSMSFYLFSFQVHEKTILVPLLPITLLFTSRDWNVLSMVSWINNVALFTLWPLLKREGL 428

Query: 417 TLQYGILMLLSNWLIGNFSFVTPRFLPKFITPGPSISVVSETYRRRSFLPDNNFWKLIIV 476
            LQY +   LSNWLIGNFSF+TPRFLPKFITPGPSIS VS+ YRRRS LP + FWKLIIV
Sbjct: 429 YLQYFVCFFLSNWLIGNFSFITPRFLPKFITPGPSISSVSDNYRRRSLLPHSIFWKLIIV 488

Query: 477 ASYLIMAAIHILDFFVPTPEGLPDLWVLLNCALGFFCFTIFWLWMHYKLFTMRNTNLQD 535
           +SY+ M A H LD F+  P   PDLWV+LNC +GF  F++FWLW +YK  T+   N+QD
Sbjct: 489 SSYIGMTAYHFLDLFIEAPPRFPDLWVILNCTIGFVSFSLFWLWTYYKFCTLLKKNIQD 547

>NCAS0D02160 Chr4 complement(401973..403664) [1692 bp, 563 aa] {ON}
           Anc_6.22 YOR002W
          Length = 563

 Score =  765 bits (1976), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/540 (67%), Positives = 439/540 (81%), Gaps = 9/540 (1%)

Query: 4   KKVSKN-----EPFFASPLYDFLSPFRPVANQYYAEYVIVIFALVIRCAVGLGSFSGENS 58
           K+ SK      E F+ASPLYD L PFRP  +Q+  EY IV+F+L+IRCAVGLG FSG   
Sbjct: 22  KETSKKHDIPEESFYASPLYDLLYPFRPAGSQWMTEYTIVLFSLIIRCAVGLGPFSGYGV 81

Query: 59  GPIHGDFEAQRHWMELTNHLPLSQWYWYDLQYWGLDYPPLTAYHSYVLGKLGSLLNSEWF 118
            P+ GDFEAQRHWME+T HLP+ +WYW+DL+YWGLDYPPLTAYHSY+ GK+GS  N  WF
Sbjct: 82  PPMFGDFEAQRHWMEITQHLPIHKWYWFDLKYWGLDYPPLTAYHSYICGKIGSFFNPNWF 141

Query: 119 ALLSSRGIENPDIKAYMRFTVILSEAGLYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILF 178
           AL SSRG E  D+K +MR TV++SEA  YIP V+YF KW G  RRQSPIGQ+IAAAAIL 
Sbjct: 142 ALDSSRGYEAQDLKTFMRLTVLVSEALFYIPGVVYFVKWLGKHRRQSPIGQFIAAAAILL 201

Query: 179 QPSLILIDHGHFQYNSVMLGLTVYSINNLLDGYYGPAAICFVLSLCFKQMALYYSPVFFA 238
           QPSLILIDHGHFQYNSV LGLTVY+INNLLD +Y  AA+CFVLS+CFKQM LYYSP+FFA
Sbjct: 202 QPSLILIDHGHFQYNSVALGLTVYAINNLLDEFYAMAAVCFVLSICFKQMTLYYSPIFFA 261

Query: 239 YLLSECLISPSL-NVPRFLSVAFSTVISFCIIFSPLYVFGGTK---NVLQSIHRIFPFSR 294
           YLLS+ L +P L N+PRFL++A +TV SF +++ PLYVFGG +   NVLQSIHRIFPF+R
Sbjct: 262 YLLSKSLFTPKLFNIPRFLAIAIATVCSFLLMYGPLYVFGGDQGLNNVLQSIHRIFPFAR 321

Query: 295 GIFEDKVANFWCVSNVLFKYAQNYTQQELQRFSIIATAAGFLPSFLVVLCYPKKHMIPFA 354
           GIFEDKVANFWCV+NV+FKY   +TQQELQ +S++ T  GFLP+ +++L YPKK+++P+A
Sbjct: 322 GIFEDKVANFWCVTNVIFKYKMLFTQQELQLYSLVLTVVGFLPAMMIILFYPKKYLLPYA 381

Query: 355 LAACSMAFFLFSFQVHEKSILVPLLPITLLYCSTDWNVLSMVSWINNVALFTLWPLLKKD 414
           L+ACSMAF+LFSFQVHEK+IL+PLLPITLLY STD NVLS VSW+NN+ LFTLWPLLKKD
Sbjct: 382 LSACSMAFYLFSFQVHEKTILMPLLPITLLYTSTDRNVLSRVSWMNNIGLFTLWPLLKKD 441

Query: 415 HLTLQYGILMLLSNWLIGNFSFVTPRFLPKFITPGPSISVVSETYRRRSFLPDNNFWKLI 474
            LTLQY + +LLSNWLIGNFSF+TP FLPK +TPGPS+S++ E Y  RS LP N FWK+I
Sbjct: 442 GLTLQYWVCLLLSNWLIGNFSFITPNFLPKVLTPGPSVSMIGENYHYRSLLPRNIFWKVI 501

Query: 475 IVASYLIMAAIHILDFFVPTPEGLPDLWVLLNCALGFFCFTIFWLWMHYKLFTMRNTNLQ 534
           IV SY+ M AIH+LD FV  P   PDLWV+LNC LGF CF +FW+W +YKLF+M   +L 
Sbjct: 502 IVLSYIAMGAIHVLDAFVNPPVAYPDLWVILNCTLGFGCFFLFWIWNYYKLFSMIKKSLH 561

>KNAG0F02890 Chr6 complement(547204..548895) [1692 bp, 563 aa] {ON}
           Anc_6.22 YOR002W
          Length = 563

 Score =  764 bits (1973), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/528 (66%), Positives = 438/528 (82%), Gaps = 1/528 (0%)

Query: 9   NEPFFASPLYDFLSPFRPVANQYYAEYVIVIFALVIRCAVGLGSFSGENSGPIHGDFEAQ 68
            E F+ASP+YDFL PFR   +Q+  EY+IV+F L+I+ A+GLGS+SG  + P+ GDFEAQ
Sbjct: 35  EECFYASPIYDFLYPFRSPGSQWVTEYIIVVFLLIIKSAIGLGSYSGFQTPPMFGDFEAQ 94

Query: 69  RHWMELTNHLPLSQWYWYDLQYWGLDYPPLTAYHSYVLGKLGSLLNSEWFALLSSRGIEN 128
           RHWME+T HLP+SQWYW+DLQYWGLDYPP TAYHSY+LGK+G+ +   WF L +SRG+E 
Sbjct: 95  RHWMEITQHLPVSQWYWFDLQYWGLDYPPFTAYHSYLLGKIGTFIYPPWFELDASRGMET 154

Query: 129 PDIKAYMRFTVILSEAGLYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQPSLILIDHG 188
             IK+YMRFTV+LSE   YIPA++YFTKW G +++QSPIGQ++AAAAILFQP+L+LIDHG
Sbjct: 155 DGIKSYMRFTVLLSECIFYIPAIVYFTKWVGRRKKQSPIGQFVAAAAILFQPTLMLIDHG 214

Query: 189 HFQYNSVMLGLTVYSINNLLDGYYGPAAICFVLSLCFKQMALYYSPVFFAYLLSECLISP 248
           HFQYN VMLGLTVY+INNLLDG+Y  AA+CFVLS+CFKQMALYY+P+FFA LLS+ L  P
Sbjct: 215 HFQYNCVMLGLTVYAINNLLDGFYAMAAVCFVLSICFKQMALYYAPIFFAVLLSKSLFFP 274

Query: 249 SL-NVPRFLSVAFSTVISFCIIFSPLYVFGGTKNVLQSIHRIFPFSRGIFEDKVANFWCV 307
            L N+PRFLSVAF+T+ S  ++F+PLY+FGG  NVLQSIHRIFPF+RGIFEDKVANFWCV
Sbjct: 275 RLFNIPRFLSVAFATLASLFVMFAPLYIFGGVGNVLQSIHRIFPFARGIFEDKVANFWCV 334

Query: 308 SNVLFKYAQNYTQQELQRFSIIATAAGFLPSFLVVLCYPKKHMIPFALAACSMAFFLFSF 367
           +NV FKY   +TQ ELQ +S++AT  GF P+F++++ YPKK +IP+ LAACSMAFFLFSF
Sbjct: 335 TNVFFKYKTMFTQSELQFYSLVATVVGFFPAFMIMIFYPKKFLIPYGLAACSMAFFLFSF 394

Query: 368 QVHEKSILVPLLPITLLYCSTDWNVLSMVSWINNVALFTLWPLLKKDHLTLQYGILMLLS 427
           QVHEK+ILVPLLP TLL+ ST+WN LSMV W+NNVALFTLWPLLKKD L LQY + +++ 
Sbjct: 395 QVHEKTILVPLLPATLLFTSTNWNNLSMVFWVNNVALFTLWPLLKKDGLWLQYCVCLVMY 454

Query: 428 NWLIGNFSFVTPRFLPKFITPGPSISVVSETYRRRSFLPDNNFWKLIIVASYLIMAAIHI 487
           NWL+GNFSF+TPRFLPK +TPGPSIS ++E YRRRS LP N  WK+II+ SYL M  IH+
Sbjct: 455 NWLLGNFSFITPRFLPKILTPGPSISNIAENYRRRSLLPHNIIWKIIILVSYLCMLMIHV 514

Query: 488 LDFFVPTPEGLPDLWVLLNCALGFFCFTIFWLWMHYKLFTMRNTNLQD 535
           L++ +  P   PDLWV LNC +GF CF +FW+W +YKL T+RN  +Q+
Sbjct: 515 LEYTIAAPSQYPDLWVQLNCTVGFGCFVLFWMWTYYKLITLRNKTIQE 562

>TPHA0J00350 Chr10 complement(77974..79653) [1680 bp, 559 aa] {ON}
           Anc_6.22 YOR002W
          Length = 559

 Score =  763 bits (1971), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/529 (67%), Positives = 433/529 (81%), Gaps = 2/529 (0%)

Query: 8   KNEPFFASPLYDFLSPFRPVANQYYAEYVIVIFALVIRCAVGLGSFSGENSGPIHGDFEA 67
             EPF+ASPLY FLSPF+   NQ+ + Y+IV+FAL+IRCA+GLG +SG N  P+ GDFEA
Sbjct: 29  DTEPFYASPLYTFLSPFKSTTNQWLSVYIIVLFALIIRCAIGLGPYSGMNEAPMFGDFEA 88

Query: 68  QRHWMELTNHLPLSQWYWYDLQYWGLDYPPLTAYHSYVLGKLGSLLNSEWFALLSSRGIE 127
           QRHWME+T HLP+SQWY+YDLQYWGLDYPPLTAYHSY+ G +G   N  WF L +SRG+E
Sbjct: 89  QRHWMEITQHLPISQWYFYDLQYWGLDYPPLTAYHSYICGLIGKFFNPAWFELETSRGME 148

Query: 128 NPDIKAYMRFTVILSEAGLYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQPSLILIDH 187
             ++K +MR T I+SE   YIPA++YFT W G +R+QSP+GQYIAAAAILFQP L+LIDH
Sbjct: 149 MKELKTFMRLTAIVSEVIFYIPAIIYFTTWVGKQRKQSPMGQYIAAAAILFQPCLMLIDH 208

Query: 188 GHFQYNSVMLGLTVYSINNLLDGYYGPAAICFVLSLCFKQMALYYSPVFFAYLLSECLIS 247
           GHFQYNSVMLGLTVY+INNLLD  Y PAAI FV+S+CFKQM+LYY+P+FFAYLL   L  
Sbjct: 209 GHFQYNSVMLGLTVYAINNLLDDMYAPAAISFVMSICFKQMSLYYAPIFFAYLLGRSLFK 268

Query: 248 PSL-NVPRFLSVAFSTVISFCIIFSPLYVFGGTK-NVLQSIHRIFPFSRGIFEDKVANFW 305
               NV RFL++A +T++SF  +F+PLYVFGG K N++QS+HRIFPF+RGIFEDKVANFW
Sbjct: 269 KQFFNVSRFLNIAIATMVSFFTVFAPLYVFGGGKRNIIQSVHRIFPFARGIFEDKVANFW 328

Query: 306 CVSNVLFKYAQNYTQQELQRFSIIATAAGFLPSFLVVLCYPKKHMIPFALAACSMAFFLF 365
           CV+NV+ KY  NYTQ ELQ +S+I T  GFLP+ + +L +PKKH++P++LAAC+M+FFLF
Sbjct: 329 CVTNVIMKYKVNYTQDELQLYSLILTVVGFLPAMVTILWFPKKHLLPYSLAACAMSFFLF 388

Query: 366 SFQVHEKSILVPLLPITLLYCSTDWNVLSMVSWINNVALFTLWPLLKKDHLTLQYGILML 425
           SFQVHEK+ILVPLLPITLLY STDWNVLS+VSWINNVALFTLWPLLKKD + LQYG+  +
Sbjct: 389 SFQVHEKTILVPLLPITLLYTSTDWNVLSLVSWINNVALFTLWPLLKKDGVVLQYGVCFI 448

Query: 426 LSNWLIGNFSFVTPRFLPKFITPGPSISVVSETYRRRSFLPDNNFWKLIIVASYLIMAAI 485
           LSNWLIGNFSF TPRFLPK +TPGP I  V+  YRRRS LP+N  WK+IIV SY++M AI
Sbjct: 449 LSNWLIGNFSFFTPRFLPKILTPGPPIQNVNTHYRRRSLLPNNIIWKIIIVLSYIVMVAI 508

Query: 486 HILDFFVPTPEGLPDLWVLLNCALGFFCFTIFWLWMHYKLFTMRNTNLQ 534
             L+ FV  P   PD++VLLNC LGF CFT FWLW +YKLFT+ + NLQ
Sbjct: 509 QGLELFVEPPPQYPDIFVLLNCTLGFCCFTSFWLWNYYKLFTLTSKNLQ 557

>ZYRO0C07744g Chr3 (587374..589017) [1644 bp, 547 aa] {ON} highly
           similar to uniprot|Q12001 Saccharomyces cerevisiae
           YOR002W ALG6 Glucosyltransferase involved in transfer of
           oligosaccharides from dolichyl pyrophosphate to
           asparagine residues of proteins during N-linked protein
           glycosylation mutations in human ortholog are associated
           with disease
          Length = 547

 Score =  761 bits (1966), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/542 (67%), Positives = 446/542 (82%), Gaps = 8/542 (1%)

Query: 2   AGKKVSK-------NEPFFASPLYDFLSPFRPVANQYYAEYVIVIFALVIRCAVGLGSFS 54
             KKV K        E F+ASPLYDFL PF+PV +Q+  EY+I++FA++IRCA+GLG +S
Sbjct: 5   TSKKVEKAQADNTAEESFYASPLYDFLYPFKPVGSQWLPEYIIILFAVIIRCAIGLGPYS 64

Query: 55  GENSGPIHGDFEAQRHWMELTNHLPLSQWYWYDLQYWGLDYPPLTAYHSYVLGKLGSLLN 114
           G++  P+HGDFEAQRHW+E+T HLP+SQWY++DL+YWGLDYPPLTAYHSY+LGKLGSL+N
Sbjct: 65  GQSVKPMHGDFEAQRHWLEITQHLPISQWYYFDLEYWGLDYPPLTAYHSYILGKLGSLIN 124

Query: 115 SEWFALLSSRGIENPDIKAYMRFTVILSEAGLYIPAVLYFTKWFGIKRRQSPIGQYIAAA 174
            +WFAL  SRG+E+ D+K YMRFTVILSE   YIPAV+YFTKW G  R  SP+GQ+IAAA
Sbjct: 125 PDWFALNVSRGLESNDLKTYMRFTVILSEVIFYIPAVVYFTKWVGRHRGLSPVGQFIAAA 184

Query: 175 AILFQPSLILIDHGHFQYNSVMLGLTVYSINNLLDGYYGPAAICFVLSLCFKQMALYYSP 234
           AILFQP+L+LIDHGHFQYN VMLG TVY+IN+L+D +Y PAA CFVLS+CFKQMALYYSP
Sbjct: 185 AILFQPALMLIDHGHFQYNCVMLGFTVYAINSLMDEFYAPAAACFVLSICFKQMALYYSP 244

Query: 235 VFFAYLLSECLISPSLNVPRFLSVAFSTVISFCIIFSPLYVFG-GTKNVLQSIHRIFPFS 293
           +FFAYLL  C+    +  PRFLS+A +T+ +F +++ PLY+ G G++NVLQS+HRIFPF+
Sbjct: 245 IFFAYLLGRCVFKTGIRFPRFLSIAMATIATFLVMYIPLYIMGSGSQNVLQSVHRIFPFA 304

Query: 294 RGIFEDKVANFWCVSNVLFKYAQNYTQQELQRFSIIATAAGFLPSFLVVLCYPKKHMIPF 353
           RGIFEDKVANFWCV+N+  KY Q +TQQ+LQ +S++ATA GFLP+ ++VL YPKKH++PF
Sbjct: 305 RGIFEDKVANFWCVTNIFVKYKQLFTQQQLQLYSLLATALGFLPAVVLVLLYPKKHLVPF 364

Query: 354 ALAACSMAFFLFSFQVHEKSILVPLLPITLLYCSTDWNVLSMVSWINNVALFTLWPLLKK 413
           ALAACSM+FFLFSFQVHEK+ILVPLLPITLLY ST+W+VLS+VSWINNV LFTLWPLLKK
Sbjct: 365 ALAACSMSFFLFSFQVHEKTILVPLLPITLLYTSTNWDVLSLVSWINNVGLFTLWPLLKK 424

Query: 414 DHLTLQYGILMLLSNWLIGNFSFVTPRFLPKFITPGPSISVVSETYRRRSFLPDNNFWKL 473
           D L LQY +     NWLIGNFSFVTP FLPKF+TPGPS+S V   YRRRS LP +  WKL
Sbjct: 425 DGLALQYCVCFAFCNWLIGNFSFVTPTFLPKFLTPGPSVSSVDSNYRRRSLLPKSIIWKL 484

Query: 474 IIVASYLIMAAIHILDFFVPTPEGLPDLWVLLNCALGFFCFTIFWLWMHYKLFTMRNTNL 533
           IIV SY+ M AIH+LD FV  P   PDLWV+LNC LGF CF +FWLW +YKLF++   +L
Sbjct: 485 IIVGSYISMGAIHVLDMFVAPPLNYPDLWVILNCTLGFGCFMLFWLWNYYKLFSLAGQSL 544

Query: 534 QD 535
           Q 
Sbjct: 545 QQ 546

>Ecym_3027 Chr3 complement(52360..54009) [1650 bp, 549 aa] {ON}
           similar to Ashbya gossypii ACR004W
          Length = 549

 Score =  761 bits (1964), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/532 (66%), Positives = 440/532 (82%)

Query: 4   KKVSKNEPFFASPLYDFLSPFRPVANQYYAEYVIVIFALVIRCAVGLGSFSGENSGPIHG 63
           ++    E FFASPLYDFL P RPVANQ+ A+Y+I+IFAL++R AVGLG +SG+  GP+ G
Sbjct: 17  RRSCVEESFFASPLYDFLYPLRPVANQWSAKYIILIFALIVRLAVGLGGYSGKGKGPLFG 76

Query: 64  DFEAQRHWMELTNHLPLSQWYWYDLQYWGLDYPPLTAYHSYVLGKLGSLLNSEWFALLSS 123
           DFEAQRHWME+T  LP+S+WY+YDL+YWGLDYPPLTAYHSY+LG+LGS +N+ WF L +S
Sbjct: 77  DFEAQRHWMEITTCLPISRWYFYDLEYWGLDYPPLTAYHSYILGRLGSFVNATWFKLNTS 136

Query: 124 RGIENPDIKAYMRFTVILSEAGLYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQPSLI 183
           RG E+ D+K++MR TV+LSE   YIPAV+YFT+W G  R QSPIGQY+A AAILFQPSLI
Sbjct: 137 RGFESIDLKSFMRITVLLSELVCYIPAVMYFTRWIGRHRNQSPIGQYVACAAILFQPSLI 196

Query: 184 LIDHGHFQYNSVMLGLTVYSINNLLDGYYGPAAICFVLSLCFKQMALYYSPVFFAYLLSE 243
           LIDHGHFQYN VMLGL VY+INNLLD +YG AAICFVLSL FKQMALYYSPV FAYL S 
Sbjct: 197 LIDHGHFQYNCVMLGLVVYTINNLLDEFYGFAAICFVLSLGFKQMALYYSPVIFAYLFSR 256

Query: 244 CLISPSLNVPRFLSVAFSTVISFCIIFSPLYVFGGTKNVLQSIHRIFPFSRGIFEDKVAN 303
               P  N PRF  +A +T+++F  +++PL +FG  +N++QS++R+FPFSRGIFEDKVAN
Sbjct: 257 SAYYPRFNFPRFAGIAIATLLTFGALYAPLCLFGDFRNIIQSVYRVFPFSRGIFEDKVAN 316

Query: 304 FWCVSNVLFKYAQNYTQQELQRFSIIATAAGFLPSFLVVLCYPKKHMIPFALAACSMAFF 363
           FWCV+NV+ KY + YTQ++LQ + ++ TA    P+F+++  YPKK ++P+ALAACSMAFF
Sbjct: 317 FWCVTNVIIKYRELYTQKQLQFYCLLTTAIAQFPAFIIIFLYPKKFLLPYALAACSMAFF 376

Query: 364 LFSFQVHEKSILVPLLPITLLYCSTDWNVLSMVSWINNVALFTLWPLLKKDHLTLQYGIL 423
           LFSFQVHEK+ILVPLLPITLL+ ST+W+VLSMV+WINNVALFTLWPLLKKD L LQY I+
Sbjct: 377 LFSFQVHEKTILVPLLPITLLHISTNWDVLSMVAWINNVALFTLWPLLKKDGLLLQYAIM 436

Query: 424 MLLSNWLIGNFSFVTPRFLPKFITPGPSISVVSETYRRRSFLPDNNFWKLIIVASYLIMA 483
            LLSNWL+GNFSFVTP FLPKF+TPGPS+S V++ YRRRS LP N FW++IIV+SY+ MA
Sbjct: 437 FLLSNWLLGNFSFVTPTFLPKFLTPGPSVSDVADDYRRRSLLPKNIFWRIIIVSSYVCMA 496

Query: 484 AIHILDFFVPTPEGLPDLWVLLNCALGFFCFTIFWLWMHYKLFTMRNTNLQD 535
            IH+LD +V  P   PD+WVL  CALGF CFT FWLW +Y+L+ MRN++L +
Sbjct: 497 FIHLLDLYVQPPRNYPDIWVLATCALGFACFTAFWLWNYYQLYRMRNSSLNE 548

>Suva_15.177 Chr15 (303845..305479) [1635 bp, 544 aa] {ON} YOR002W
           (REAL)
          Length = 544

 Score =  756 bits (1952), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/540 (65%), Positives = 436/540 (80%), Gaps = 7/540 (1%)

Query: 3   GKKVSKNEP----FFASPLYDFLSPFRPVANQYYAEYVIVIFALVIRCAVGLGSFSGENS 58
           GK++  N+P    F+ASP+YDFL PFRPV NQ+  EY+I + A+++RCA+GLG +SG+ +
Sbjct: 4   GKRLLVNKPAEESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVIVRCAIGLGPYSGKAT 63

Query: 59  GPIHGDFEAQRHWMELTNHLPLSQWYWYDLQYWGLDYPPLTAYHSYVLGKLGSLLNSEWF 118
            P+HGDFEAQRHWME+T HLPLS+WYWYDLQYWGLDYPPLTA+HSY+LG +G+  N  WF
Sbjct: 64  PPLHGDFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSYLLGLIGTFFNPSWF 123

Query: 119 ALLSSRGIENPD--IKAYMRFTVILSEAGLYIPAVLYFTKWFGIKRRQSPIGQYIAAAAI 176
           AL  SRG E+PD  +K YMR TVI+S+   Y PAV+YFTKW G  R QSPIGQ IAAAAI
Sbjct: 124 ALDKSRGFESPDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAAAAI 183

Query: 177 LFQPSLILIDHGHFQYNSVMLGLTVYSINNLLDGYYGPAAICFVLSLCFKQMALYYSPVF 236
           LFQPSL+LIDHGHFQYNSVMLGLT Y+INNLLD YY  AA+CFVLS+CFKQMALYY+P+F
Sbjct: 184 LFQPSLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAMCFVLSICFKQMALYYAPIF 243

Query: 237 FAYLLSECLISPSLNVPRFLSVAFSTVISFCIIFSPLYVFGGT-KNVLQSIHRIFPFSRG 295
           FAYLLS  L  P  N+ R   +AF+T+ +F ++F+PLY  GG  +N+ Q IHR+FPF+RG
Sbjct: 244 FAYLLSRSLFFPKFNIARLTVIAFATLATFSLMFAPLYFLGGGLRNIYQCIHRMFPFARG 303

Query: 296 IFEDKVANFWCVSNVLFKYAQNYTQQELQRFSIIATAAGFLPSFLVVLCYPKKHMIPFAL 355
           IFEDKVANFWCVSN+  KY + ++ Q+LQ +S++AT  GFLP+ ++ L +PKKH++P+ L
Sbjct: 304 IFEDKVANFWCVSNIFVKYKERFSIQQLQLYSLVATVLGFLPAMMMTLLHPKKHLLPYVL 363

Query: 356 AACSMAFFLFSFQVHEKSILVPLLPITLLYCSTDWNVLSMVSWINNVALFTLWPLLKKDH 415
            ACSM+FFLFSFQVHEK+ILVPLLPITLLY STDWNVLS+VSWINNVALFTLWPLLKKD 
Sbjct: 364 IACSMSFFLFSFQVHEKTILVPLLPITLLYSSTDWNVLSLVSWINNVALFTLWPLLKKDG 423

Query: 416 LTLQYGILMLLSNWLIGNFSFVTPRFLPKFITPGPSISVVSETYRRRSFLPDNNFWKLII 475
           L LQY +  LL+NWLIGNFSF+TPRFLPK +TPGPSIS ++  YRRRS LP N  WK  I
Sbjct: 424 LHLQYVVSFLLTNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWKSFI 483

Query: 476 VASYLIMAAIHILDFFVPTPEGLPDLWVLLNCALGFFCFTIFWLWMHYKLFTMRNTNLQD 535
           + +Y+ M   H LD FV  P+  PDLWVLLNCA+GF CF+IFW+W +YK+FT  N +++D
Sbjct: 484 IGTYIAMGLYHFLDLFVAPPKKYPDLWVLLNCAVGFICFSIFWIWSYYKIFTSGNKSMKD 543

>Skud_15.163 Chr15 (289416..291050) [1635 bp, 544 aa] {ON} YOR002W
           (REAL)
          Length = 544

 Score =  753 bits (1945), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/540 (65%), Positives = 434/540 (80%), Gaps = 7/540 (1%)

Query: 3   GKKVSKNEP----FFASPLYDFLSPFRPVANQYYAEYVIVIFALVIRCAVGLGSFSGENS 58
           GK++  N+P    F+ASP+YDFL PFRPV NQ+  EY+I + A+++RCA+GLG +SG++S
Sbjct: 4   GKRLLVNKPAEESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVIVRCAIGLGPYSGKDS 63

Query: 59  GPIHGDFEAQRHWMELTNHLPLSQWYWYDLQYWGLDYPPLTAYHSYVLGKLGSLLNSEWF 118
            P+HGDFEAQRHWME+T HLPLS+WYWYDLQYWGLDYPPLTA+HS + G +G+  N  WF
Sbjct: 64  PPLHGDFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSCLFGLIGTFFNPSWF 123

Query: 119 ALLSSRGIENPD--IKAYMRFTVILSEAGLYIPAVLYFTKWFGIKRRQSPIGQYIAAAAI 176
           AL  SRG E+PD  +K YMR TVI+S+   Y PAV+YFTKW G  R QSPIGQ IAAAAI
Sbjct: 124 ALDKSRGFESPDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAAAAI 183

Query: 177 LFQPSLILIDHGHFQYNSVMLGLTVYSINNLLDGYYGPAAICFVLSLCFKQMALYYSPVF 236
           LFQPSL+LIDHGHFQYNSVMLGLT Y+INNLLD YY  AA+CFVLS+CFKQMALYY+P+F
Sbjct: 184 LFQPSLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYAPIF 243

Query: 237 FAYLLSECLISPSLNVPRFLSVAFSTVISFCIIFSPLYVFGGT-KNVLQSIHRIFPFSRG 295
           FAYLLS  L+ P  N+ R   +AF+T+ +F +I +PLY  GG  +N+ Q I+RIFPFSRG
Sbjct: 244 FAYLLSRSLLFPKFNIARLTVIAFATLATFSVILAPLYFLGGGLRNIHQCIYRIFPFSRG 303

Query: 296 IFEDKVANFWCVSNVLFKYAQNYTQQELQRFSIIATAAGFLPSFLVVLCYPKKHMIPFAL 355
           IFEDKVANFWCV+N+  KY   +T Q+LQ +S++AT  GFLP+ ++ L +PKKH++P+ L
Sbjct: 304 IFEDKVANFWCVTNIFVKYKDRFTIQQLQLYSLVATVIGFLPAMIMTLLHPKKHLLPYVL 363

Query: 356 AACSMAFFLFSFQVHEKSILVPLLPITLLYCSTDWNVLSMVSWINNVALFTLWPLLKKDH 415
            ACSM+FFLFSFQVHEK+ILVPLLPITLLY STDWNVLS+VSWINNVALFTLWPLLKKD 
Sbjct: 364 IACSMSFFLFSFQVHEKTILVPLLPITLLYSSTDWNVLSLVSWINNVALFTLWPLLKKDG 423

Query: 416 LTLQYGILMLLSNWLIGNFSFVTPRFLPKFITPGPSISVVSETYRRRSFLPDNNFWKLII 475
           L LQY +  LLSNWLIGNFSF+TPRFLPK +TPGPSIS ++  YRRRS LP N  WK  I
Sbjct: 424 LHLQYTVSFLLSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWKSFI 483

Query: 476 VASYLIMAAIHILDFFVPTPEGLPDLWVLLNCALGFFCFTIFWLWMHYKLFTMRNTNLQD 535
           + +Y+ M   H+LD FV  P   PDLWVLLNCA+GF CF+IFW+W +YK+FT  N +++D
Sbjct: 484 IGTYIAMGVYHLLDLFVVPPSKYPDLWVLLNCAVGFTCFSIFWIWSYYKIFTSGNKSVKD 543

>ACR004W Chr3 (360904..362595) [1692 bp, 563 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR002W (ALG6)
          Length = 563

 Score =  752 bits (1941), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/533 (66%), Positives = 431/533 (80%)

Query: 3   GKKVSKNEPFFASPLYDFLSPFRPVANQYYAEYVIVIFALVIRCAVGLGSFSGENSGPIH 62
            KK    E FFASPLYDFL P RPV NQ+ A+Y+IVIFAL+IR AVGLG +SG    P+ 
Sbjct: 30  AKKPGLKEAFFASPLYDFLYPLRPVTNQWAAKYIIVIFALIIRLAVGLGGYSGMGKPPMF 89

Query: 63  GDFEAQRHWMELTNHLPLSQWYWYDLQYWGLDYPPLTAYHSYVLGKLGSLLNSEWFALLS 122
           GDFEAQRHWME+T H+P+S+WY++ LQYWGLDYPPLTAYHSY+LGKLGS ++ EWF+L +
Sbjct: 90  GDFEAQRHWMEVTQHIPVSKWYFHQLQYWGLDYPPLTAYHSYLLGKLGSYISPEWFSLHA 149

Query: 123 SRGIENPDIKAYMRFTVILSEAGLYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQPSL 182
           SRG E+ D+K+YMR TVILSE   YIPAVLYFT+W G +R+QSPIGQYIA AAILFQP+L
Sbjct: 150 SRGYESEDLKSYMRLTVILSELCFYIPAVLYFTRWIGRRRQQSPIGQYIAGAAILFQPAL 209

Query: 183 ILIDHGHFQYNSVMLGLTVYSINNLLDGYYGPAAICFVLSLCFKQMALYYSPVFFAYLLS 242
           ILIDHGHFQYN VMLGLTV +INNLLD YY  AA+ FV SL FKQMALYY+PV F YLLS
Sbjct: 210 ILIDHGHFQYNCVMLGLTVCAINNLLDQYYALAAVNFVFSLGFKQMALYYAPVMFVYLLS 269

Query: 243 ECLISPSLNVPRFLSVAFSTVISFCIIFSPLYVFGGTKNVLQSIHRIFPFSRGIFEDKVA 302
             +  P LN+PRF++VA +T+I+F ++++PLY+ G    + QSIHR+FPF RG+FEDKVA
Sbjct: 270 RSIYYPRLNIPRFVAVAVATLIAFGVLYAPLYLLGNISAIFQSIHRVFPFERGLFEDKVA 329

Query: 303 NFWCVSNVLFKYAQNYTQQELQRFSIIATAAGFLPSFLVVLCYPKKHMIPFALAACSMAF 362
           NFWCV+NVL KY   YT  +L+ FS++ T+A  LPS ++   YPKK M+P+ALAACSM+F
Sbjct: 330 NFWCVTNVLVKYKTKYTTSQLKFFSLVLTSAAMLPSLIITFLYPKKFMLPYALAACSMSF 389

Query: 363 FLFSFQVHEKSILVPLLPITLLYCSTDWNVLSMVSWINNVALFTLWPLLKKDHLTLQYGI 422
           FLF FQVHEK+ILVPLLPITLLY STDWNVLSMV+WINN+ALFTLWPLLKKD L+LQY I
Sbjct: 390 FLFGFQVHEKTILVPLLPITLLYTSTDWNVLSMVAWINNIALFTLWPLLKKDGLSLQYAI 449

Query: 423 LMLLSNWLIGNFSFVTPRFLPKFITPGPSISVVSETYRRRSFLPDNNFWKLIIVASYLIM 482
           + LLSNWLIGNFSF+TP FLPK +TPGPS+S V++ YRRRS LP N  W++IIV SY+ +
Sbjct: 450 MFLLSNWLIGNFSFITPTFLPKVLTPGPSVSDVADGYRRRSLLPSNIIWRIIIVVSYICV 509

Query: 483 AAIHILDFFVPTPEGLPDLWVLLNCALGFFCFTIFWLWMHYKLFTMRNTNLQD 535
            AIHI + + P  + LPD+WVL NC +G   F +FW+W +YK+F MRN+ + D
Sbjct: 510 GAIHIAELWYPPSQRLPDIWVLANCLVGCSSFALFWMWNNYKMFAMRNSTISD 562

>Smik_15.171 Chr15 (296715..298349) [1635 bp, 544 aa] {ON} YOR002W
           (REAL)
          Length = 544

 Score =  751 bits (1939), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/540 (65%), Positives = 433/540 (80%), Gaps = 7/540 (1%)

Query: 3   GKKVSKNEP----FFASPLYDFLSPFRPVANQYYAEYVIVIFALVIRCAVGLGSFSGENS 58
           GK++  N+P    F+ASP+YDFL PFRPV NQ+  EY+I + A+++RC +GLG +SG+ S
Sbjct: 4   GKRLLVNKPAEESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVIVRCTIGLGPYSGKGS 63

Query: 59  GPIHGDFEAQRHWMELTNHLPLSQWYWYDLQYWGLDYPPLTAYHSYVLGKLGSLLNSEWF 118
            P+HGDFEAQRHWME+T HLPLS+WYWYDLQYWGLDYPPLTA+HSY+LG +GS  N  WF
Sbjct: 64  PPLHGDFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSYLLGLIGSFFNPSWF 123

Query: 119 ALLSSRGIENPD--IKAYMRFTVILSEAGLYIPAVLYFTKWFGIKRRQSPIGQYIAAAAI 176
           AL  SRG E+PD  +K YMR TVI+S+   Y PAV+YFTKW G  R QSPIGQ IAA+AI
Sbjct: 124 ALDKSRGFESPDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAASAI 183

Query: 177 LFQPSLILIDHGHFQYNSVMLGLTVYSINNLLDGYYGPAAICFVLSLCFKQMALYYSPVF 236
           LFQPSL+LIDHGHFQYNSVMLGLT Y+INNLLD YY  AA+CFVLS+CFKQMALYY+P+F
Sbjct: 184 LFQPSLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAMCFVLSICFKQMALYYAPIF 243

Query: 237 FAYLLSECLISPSLNVPRFLSVAFSTVISFCIIFSPLYVFGGT-KNVLQSIHRIFPFSRG 295
           FAYLLS  L+ P  N+ R   ++F+T+ +F ++ +PLY  GG  KN+ Q IHRIFPF+RG
Sbjct: 244 FAYLLSRSLLFPKFNIARLTVISFATLATFALMLAPLYFLGGGLKNIYQCIHRIFPFARG 303

Query: 296 IFEDKVANFWCVSNVLFKYAQNYTQQELQRFSIIATAAGFLPSFLVVLCYPKKHMIPFAL 355
           IFEDKVANFWCV+NV  KY + ++ Q+LQ +S++AT  GFLP+ ++ L +PKKH++P+ L
Sbjct: 304 IFEDKVANFWCVTNVFVKYKERFSVQQLQLYSLVATVIGFLPAMVMTLLHPKKHLLPYVL 363

Query: 356 AACSMAFFLFSFQVHEKSILVPLLPITLLYCSTDWNVLSMVSWINNVALFTLWPLLKKDH 415
            ACSM+FFLFSFQVHEK+ILVPLLPITLLY STDWNVLS+VSWINNVALFTLWPLLK+D 
Sbjct: 364 IACSMSFFLFSFQVHEKTILVPLLPITLLYSSTDWNVLSLVSWINNVALFTLWPLLKRDG 423

Query: 416 LTLQYGILMLLSNWLIGNFSFVTPRFLPKFITPGPSISVVSETYRRRSFLPDNNFWKLII 475
           L LQY +  LLSNWLIGNFSF+TPRFLPK +TPGPSIS ++  YRRRS LP N  WK  I
Sbjct: 424 LHLQYAVSFLLSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWKSFI 483

Query: 476 VASYLIMAAIHILDFFVPTPEGLPDLWVLLNCALGFFCFTIFWLWMHYKLFTMRNTNLQD 535
           + +Y+ M   H LD FV  P   PDLWVLLNC +GF CF+IFW+W +YK+FT  + +++D
Sbjct: 484 IGTYIAMGLYHFLDLFVAPPSKYPDLWVLLNCTVGFTCFSIFWVWSYYKIFTSGSKSMKD 543

>TBLA0G00970 Chr7 (246516..248195) [1680 bp, 559 aa] {ON} Anc_6.22
           YOR002W
          Length = 559

 Score =  751 bits (1940), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/544 (67%), Positives = 441/544 (81%), Gaps = 15/544 (2%)

Query: 7   SKNEPFFASPLYDFLSPFRPVANQYYAEYVIVIFALVIRCAVGLGSFSGENSGPIHGDFE 66
            + E F+ASPL+DFL PFRPV +Q+  EYVI+IFA++IRCA+ LGS+SG+ + P+ GDFE
Sbjct: 15  GEEEAFYASPLFDFLYPFRPVGSQWLTEYVIIIFAIIIRCAISLGSYSGKGTPPMFGDFE 74

Query: 67  AQRHWMELTNHLPLSQWYWYDLQYWGLDYPPLTAYHSYVLGKLGSLLNSEWFALLSSRGI 126
           AQRHWME+T HLP+S+WYW+DLQYWGLDYPP TAYHSY  GKLGS  N +WFAL SSRG 
Sbjct: 75  AQRHWMEITQHLPISKWYWFDLQYWGLDYPPFTAYHSYFFGKLGSFFNPDWFALNSSRGY 134

Query: 127 ENPD--IKAYMRFTVILSEAGLYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQPSLIL 184
           E+ D  +K YMRFTVILSEA  YIPAV+YFTKW G  R QSPIGQ+IAAAAILFQPSL+L
Sbjct: 135 ESDDNGLKTYMRFTVILSEAVFYIPAVVYFTKWLGKHRNQSPIGQFIAAAAILFQPSLML 194

Query: 185 IDHGHFQYNSVMLGLTVYSINNLLDGYYGPAAICFVLSLCFKQMALYYSPVFFAYLLSEC 244
           IDHGHFQYNSVMLGLTVY+INNLLD +YGPAAICFVLSLCFKQMALYYSP+FF YLLS+ 
Sbjct: 195 IDHGHFQYNSVMLGLTVYAINNLLDEFYGPAAICFVLSLCFKQMALYYSPIFFGYLLSKS 254

Query: 245 LISPSLNVPRFLSVAFSTVISFCIIFSPLYVFG-------------GTKNVLQSIHRIFP 291
           L+ PS N+ RF+ VA STV+SF ++F P+Y+FG             G  N++Q I RIFP
Sbjct: 255 LVHPSCNISRFIIVAISTVVSFVVMFGPIYLFGSSSSDDEIIADVSGLNNLIQCIRRIFP 314

Query: 292 FSRGIFEDKVANFWCVSNVLFKYAQNYTQQELQRFSIIATAAGFLPSFLVVLCYPKKHMI 351
           F+RGIFEDKVANFWCV+NV+ KY + +TQ++LQ +S++AT  GFLPS + +  YP+K +I
Sbjct: 315 FARGIFEDKVANFWCVTNVVIKYRELFTQEQLQFYSLVATLIGFLPSMITIFLYPRKFLI 374

Query: 352 PFALAACSMAFFLFSFQVHEKSILVPLLPITLLYCSTDWNVLSMVSWINNVALFTLWPLL 411
           P+ALAACSM+FFLFSFQVHEKSIL+PL+PITLLY STDWNVLS+V WINNVALFTLWPLL
Sbjct: 375 PYALAACSMSFFLFSFQVHEKSILLPLMPITLLYTSTDWNVLSLVCWINNVALFTLWPLL 434

Query: 412 KKDHLTLQYGILMLLSNWLIGNFSFVTPRFLPKFITPGPSISVVSETYRRRSFLPDNNFW 471
           +KD L LQY +   LSNWLIGNFSF+TP+FLP F+TPGPSIS + + YRR S LP N  W
Sbjct: 435 RKDGLVLQYFVCYFLSNWLIGNFSFITPKFLPSFLTPGPSISNIDDDYRRGSLLPHNILW 494

Query: 472 KLIIVASYLIMAAIHILDFFVPTPEGLPDLWVLLNCALGFFCFTIFWLWMHYKLFTMRNT 531
           K+II++SY++M A+ ILD F   P   PDLW++LNC +GF CF +FWLW +YK+  MRN 
Sbjct: 495 KIIIISSYIVMGAVQILDLFFQPPTNYPDLWIILNCTVGFGCFMLFWLWNNYKIIQMRNK 554

Query: 532 NLQD 535
            L D
Sbjct: 555 TLND 558

>NDAI0C02630 Chr3 (609993..611735) [1743 bp, 580 aa] {ON} Anc_6.22
           YOR002W
          Length = 580

 Score =  749 bits (1935), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/548 (64%), Positives = 439/548 (80%), Gaps = 14/548 (2%)

Query: 2   AGKKVSKNEP---------FFASPLYDFLSPFRPVANQYYAEYVIVIFALVIRCAVGLGS 52
             KK++ N+P         F+ASPLYDFL PFRP  +Q+  EY+IV+FA++IRCAVGLG 
Sbjct: 32  KSKKMNNNQPLETETSKESFYASPLYDFLYPFRPAGSQWMTEYIIVLFAIIIRCAVGLGP 91

Query: 53  FSGENSGPIHGDFEAQRHWMELTNHLPLSQWYWYDLQYWGLDYPPLTAYHSYVLGKLGSL 112
           +SG N+ P+ GDFEAQRHWME+T +LP+SQWYW+DLQYWGLDYPPLTA+HSY+ GK+GS 
Sbjct: 92  YSGFNTPPMFGDFEAQRHWMEITQYLPISQWYWFDLQYWGLDYPPLTAFHSYLCGKIGSF 151

Query: 113 LNSEWFALLSSRGIENPDIKAYMRFTVILSEAGLYIPAVLYFTKWFGIKRRQSPIGQYIA 172
               WF L  SRG E  D+K +MR TV+ SE+  YIPAV+YFTKW G +R QSPIGQ+IA
Sbjct: 152 FQPNWFTLGDSRGYEGQDLKTFMRLTVLASESLCYIPAVVYFTKWLGKRRNQSPIGQFIA 211

Query: 173 AAAILFQPSLILIDHGHFQYNSVMLGLTVYSINNLLDGYYGPAAICFVLSLCFKQMALYY 232
            AAILFQPSLILIDHGHFQ+NSVMLGLTVY++NNLLD +Y  AA+CFVLS+CFKQMALYY
Sbjct: 212 VAAILFQPSLILIDHGHFQFNSVMLGLTVYTLNNLLDEFYAFAAVCFVLSICFKQMALYY 271

Query: 233 SPVFFAYLLSECLISPSL-NVPRFLSVAFSTVISFCIIFSPLYVFGGTK----NVLQSIH 287
           SP+FFAYLLS+ L  P L N+PRF +++F+T+ +F  +F P+Y FGG      N+LQSI 
Sbjct: 272 SPIFFAYLLSKSLFHPRLFNIPRFAAISFATICTFASMFGPIYFFGGENGGITNLLQSIK 331

Query: 288 RIFPFSRGIFEDKVANFWCVSNVLFKYAQNYTQQELQRFSIIATAAGFLPSFLVVLCYPK 347
           RIFPF+RGIFEDKVANFWCV+NV+FKY  N+TQ++LQ +S+I T   FLP+ LV+L YP+
Sbjct: 332 RIFPFARGIFEDKVANFWCVTNVIFKYKANFTQEQLQLYSLILTIIAFLPAMLVILLYPR 391

Query: 348 KHMIPFALAACSMAFFLFSFQVHEKSILVPLLPITLLYCSTDWNVLSMVSWINNVALFTL 407
           K+++ +AL+ACSM+F+LFSFQVHEK+IL+PLLPITLLY STD NVLS VSW+NN+ LFTL
Sbjct: 392 KYLLLYALSACSMSFYLFSFQVHEKTILMPLLPITLLYTSTDRNVLSRVSWMNNIGLFTL 451

Query: 408 WPLLKKDHLTLQYGILMLLSNWLIGNFSFVTPRFLPKFITPGPSISVVSETYRRRSFLPD 467
           WPLLKKD L+LQY + ++LSNWLIGNFSF+TPRFLPK +TPGPSI  + E YRR + LP 
Sbjct: 452 WPLLKKDGLSLQYWVCLILSNWLIGNFSFITPRFLPKVLTPGPSIIQLGENYRRPTLLPS 511

Query: 468 NNFWKLIIVASYLIMAAIHILDFFVPTPEGLPDLWVLLNCALGFFCFTIFWLWMHYKLFT 527
           N  WK+IIV SY++M  IH +D+F+  P   PDLWV+LNC LGF CF +FWLW +YKLF+
Sbjct: 512 NWIWKVIIVLSYVMMGVIHFVDYFIEPPSAYPDLWVILNCTLGFGCFVLFWLWNYYKLFS 571

Query: 528 MRNTNLQD 535
           M   N+  
Sbjct: 572 MTKKNIHQ 579

>YOR002W Chr15 (329417..331051) [1635 bp, 544 aa] {ON}  ALG6Alpha
           1,3 glucosyltransferase, involved in transfer of
           oligosaccharides from dolichyl pyrophosphate to
           asparagine residues of proteins during N-linked protein
           glycosylation; mutations in human ortholog are
           associated with disease
          Length = 544

 Score =  734 bits (1896), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/540 (66%), Positives = 435/540 (80%), Gaps = 7/540 (1%)

Query: 3   GKKVSKNEP----FFASPLYDFLSPFRPVANQYYAEYVIVIFALVIRCAVGLGSFSGENS 58
           GK++  N+P    F+ASP+YDFL PFRPV NQ+  EY+I + A+++RC +GLG +SG+ S
Sbjct: 4   GKRLLVNKPAEESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVILRCTIGLGPYSGKGS 63

Query: 59  GPIHGDFEAQRHWMELTNHLPLSQWYWYDLQYWGLDYPPLTAYHSYVLGKLGSLLNSEWF 118
            P++GDFEAQRHWME+T HLPLS+WYWYDLQYWGLDYPPLTA+HSY+LG +GS  N  WF
Sbjct: 64  PPLYGDFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSYLLGLIGSFFNPSWF 123

Query: 119 ALLSSRGIENPD--IKAYMRFTVILSEAGLYIPAVLYFTKWFGIKRRQSPIGQYIAAAAI 176
           AL  SRG E+PD  +K YMR TVI+S+   Y PAV+YFTKW G  R QSPIGQ IAA+AI
Sbjct: 124 ALEKSRGFESPDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAASAI 183

Query: 177 LFQPSLILIDHGHFQYNSVMLGLTVYSINNLLDGYYGPAAICFVLSLCFKQMALYYSPVF 236
           LFQPSL+LIDHGHFQYNSVMLGLT Y+INNLLD YY  AA+CFVLS+CFKQMALYY+P+F
Sbjct: 184 LFQPSLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYAPIF 243

Query: 237 FAYLLSECLISPSLNVPRFLSVAFSTVISFCIIFSPLYVFGGT-KNVLQSIHRIFPFSRG 295
           FAYLLS  L+ P  N+ R   +AF+T+ +F IIF+PLY  GG  KN+ Q IHRIFPF+RG
Sbjct: 244 FAYLLSRSLLFPKFNIARLTVIAFATLATFAIIFAPLYFLGGGLKNIHQCIHRIFPFARG 303

Query: 296 IFEDKVANFWCVSNVLFKYAQNYTQQELQRFSIIATAAGFLPSFLVVLCYPKKHMIPFAL 355
           IFEDKVANFWCV+NV  KY + +T Q+LQ +S+IAT  GFLP+ ++ L +PKKH++P+ L
Sbjct: 304 IFEDKVANFWCVTNVFVKYKERFTIQQLQLYSLIATVIGFLPAMIMTLLHPKKHLLPYVL 363

Query: 356 AACSMAFFLFSFQVHEKSILVPLLPITLLYCSTDWNVLSMVSWINNVALFTLWPLLKKDH 415
            ACSM+FFLFSFQVHEK+IL+PLLPITLLY STDWNVLS+VSWINNVALFTLWPLLKKD 
Sbjct: 364 IACSMSFFLFSFQVHEKTILIPLLPITLLYSSTDWNVLSLVSWINNVALFTLWPLLKKDG 423

Query: 416 LTLQYGILMLLSNWLIGNFSFVTPRFLPKFITPGPSISVVSETYRRRSFLPDNNFWKLII 475
           L LQY +  LLSNWLIGNFSF+TPRFLPK +TPGPSIS ++  YRRRS LP N  WK  I
Sbjct: 424 LHLQYAVSFLLSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWKSFI 483

Query: 476 VASYLIMAAIHILDFFVPTPEGLPDLWVLLNCALGFFCFTIFWLWMHYKLFTMRNTNLQD 535
           + +Y+ M   H LD FV  P   PDLWVLLNCA+GF CF+IFWLW +YK+FT  + +++D
Sbjct: 484 IGTYIAMGFYHFLDQFVAPPSKYPDLWVLLNCAVGFICFSIFWLWSYYKIFTSGSKSMKD 543

>TBLA0A09310 Chr1 (2297508..2299148) [1641 bp, 546 aa] {ON}
           Anc_5.669 YOR067C
          Length = 546

 Score =  126 bits (317), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 109/403 (27%), Positives = 182/403 (45%), Gaps = 61/403 (15%)

Query: 64  DFEAQRHWMELTNHLPLSQWYWYDLQYWGLDYPPLTAYHSYVLGKLGSLLNSEWFAL-LS 122
           DF+  R+W+ +TN LPL +WY+ +   W LDYPP  AY  + L +       E   L + 
Sbjct: 43  DFDVHRNWLAITNKLPLREWYYENTSQWTLDYPPFFAYFEWFLSQFVPKFVKEDGCLDIL 102

Query: 123 SRGIENPDIKAYMRFTVILSEAGLYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQPSL 182
             G        + R TVI+SE  L++   ++       ++ QS    ++ A++I+  P  
Sbjct: 103 PEGEFGWSTIVFQRLTVIISEILLFVVLQVFINNSGSNEKTQS----FVVASSIILSPGF 158

Query: 183 ILIDHGHFQYNSVMLGLTVYSINNLLDGYYGPAAICFVLSLCFKQMALYYSPVFFAYLLS 242
           ++IDH HFQYN  + G+ + SI    +  Y    + + ++LCFK + LY +P +F +LL 
Sbjct: 159 LMIDHIHFQYNGFLFGILIASIVAAKNKRYLLCGLFYSIALCFKHIFLYLAPCYFVFLLR 218

Query: 243 ECLISPSLNVPRFLSVAFSTVISFCIIFSPLYVFGGT-------------KNVLQSIHRI 289
             +    LN   F   ++  +I   + +  L   GG              +++ Q + R+
Sbjct: 219 AYV----LNFQDFKFKSYKDLI-LVVQWGNLMKLGGIVVCVMGVCFGPFWRDMNQLLSRL 273

Query: 290 FPFSRGIFEDKVA-NFWCVS-------NVLF------KYAQNYTQQELQR---------- 325
           FPFSRG+     A NFW +        ++LF      K+      +E +R          
Sbjct: 274 FPFSRGLTHAYWAPNFWAIYSFVDKMLSILFVRVPFNKFINLDKIEERKRWNNGSRGLVE 333

Query: 326 --FSIIATAAGFLPSFLVVLCYPKKHMIPF-----------ALAACSMAFFLFSFQVHEK 372
             F +I        +F++ L Y    ++P            +L  C  A FLF + VHEK
Sbjct: 334 DVFFVILPQIQPNLTFVLTLFYQVLAVVPVLFDPSFKRFIGSLTLCGFASFLFGWHVHEK 393

Query: 373 SILVPLLPITLLYCSTDWNVLSMVSWINNVALFTLWPLLKKDH 415
           +IL+ ++P + L    D  +LS    + +    +L+PLL K  
Sbjct: 394 AILLVIIPFSFL-VVCDRRLLSSFMLVGSAGYVSLFPLLFKGQ 435

>TPHA0J01380 Chr10 complement(321431..323158) [1728 bp, 575 aa] {ON}
           Anc_5.669 YOR067C
          Length = 575

 Score =  126 bits (316), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 118/424 (27%), Positives = 189/424 (44%), Gaps = 80/424 (18%)

Query: 59  GPIHGDFEAQRHWMELTNHLPLSQWYWYDLQYWGLDYPPLTAYHSYVLGKLGSLL--NSE 116
           G    DF+  R+W+ +T++LP+S+WY+ +   W LDYPP  AY  +VL +    +  N  
Sbjct: 59  GYYSTDFDVHRNWLAITSNLPISKWYYENTSEWTLDYPPFFAYFEWVLSRFAPEIVKNDG 118

Query: 117 WFALLSSRGIENPDIKAYMRFTVILSEAGLYIPAVL-YFTKWFGIKRRQSPIGQ-YIAAA 174
              ++       P I  + R TVI+SE  L+  AVL Y+      K R    GQ ++ A+
Sbjct: 119 CLDIVEVGQFGLPTI-VFQRLTVIISEILLF--AVLQYYINTSNSKER----GQCFVVAS 171

Query: 175 AILFQPSLILIDHGHFQYNSVMLGLTVYSINNLLDGYYGPAAICFVLSLCFKQMALYYSP 234
           +I+  P  ++IDH HFQYN  +  + + SI       Y   A+ + +SLCFK + LY +P
Sbjct: 172 SIVLSPGFLIIDHIHFQYNGFLFAIFIASIVAAKQKKYLACAVFYSISLCFKHIFLYLAP 231

Query: 235 VFFAYLLSECLIS-------------PSLNVPRFLSVAFSTVISFCIIFSPLYVFGGTKN 281
            +F +LL   +++               +   R   +A      F I F+P ++F     
Sbjct: 232 CYFVFLLRAYVLNFENFKFKSYMDLQSVIQWKRLFKLAGIVSGIFTICFAP-FIF----Q 286

Query: 282 VLQSIHRIFPFSRGI--------------FEDKVANF--------------WCVSNVLFK 313
           + Q + R+FPFSRG+              F DKV  F              +  S +L K
Sbjct: 287 LPQVLSRLFPFSRGLTHAYWAPNFWAMYSFIDKVLTFVMLRFPYVHKLMLSFTSSPILPK 346

Query: 314 YAQNYTQQELQR-----------FSIIATAAGFLPSFLVVLCYPKKHMIPF--------- 353
            A    ++  Q            F +I        +FL+ L Y    +IP          
Sbjct: 347 TAAEIRERMAQNNNGTKGLVQDYFFVILPQITPKLTFLLTLFYQILAVIPLLFDPSYKRF 406

Query: 354 --ALAACSMAFFLFSFQVHEKSILVPLLPITLLYCSTDWNVLSMVSWINNVALFTLWPLL 411
             +L  C MA +LF + VHEK+I++ ++P + L  S D  +L     +      +L+PLL
Sbjct: 407 IGSLTLCGMASYLFGWHVHEKAIMLVIIPFSFLVVS-DRRLLISFMLVTAAGYVSLFPLL 465

Query: 412 KKDH 415
            ++ 
Sbjct: 466 FENQ 469

>ZYRO0A11506g Chr1 complement(925282..926952) [1671 bp, 556 aa] {ON}
           highly similar to uniprot|P40351 Saccharomyces
           cerevisiae YOR067C ALG8 adds glucose to the dolichol-
           linked oligosaccharide precursor prior to transfer to
           protein glycosyl transferase
          Length = 556

 Score =  123 bits (309), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 110/417 (26%), Positives = 183/417 (43%), Gaps = 76/417 (18%)

Query: 64  DFEAQRHWMELTNHLPLSQWYWYDLQYWGLDYPPLTAYHSYVLGKL--GSLLNSEWFALL 121
           DF+  R+W+ +T++LPL QWY+     W LDYPP  AY  + L +   G++       ++
Sbjct: 45  DFDVHRNWLAITHNLPLRQWYYEATSQWTLDYPPFFAYFEWFLSQFVPGTVKQDGCLEIV 104

Query: 122 SSRGIENPDIKAYMRFTVILSEAGLYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQPS 181
             +G        + R TVILSE  L++   ++       +R QS    ++ A++I+  P+
Sbjct: 105 D-KGQFGWSTLVFQRSTVILSEILLFVVLQVFINTSSVTERTQS----FVIASSIVLSPA 159

Query: 182 LILIDHGHFQYNSVMLGLTVYSINNLLDGYYGPAAICFVLSLCFKQMALYYSPVFFAYLL 241
            +++DH HFQYN  +  + + SI     G Y   A  + ++LCFK + LY +P +F +LL
Sbjct: 160 FLIVDHIHFQYNGFLFAILIASIVAAKRGKYLWCATFYSVALCFKHIFLYLAPCYFVFLL 219

Query: 242 SE-CLISPSLNVPRFLSVAF-----------STVIS-FCIIFSPLYVFGGTKNVLQSIHR 288
              CL         +  + F           S VI  F + F P       K++ Q + R
Sbjct: 220 RAYCLNFQDFKFKSYKDLIFIVKWRHLFQLGSIVIGVFALCFGPF-----VKDLPQVLTR 274

Query: 289 IFPFSRGIFEDKVA-NFWCVSNVLFK----------YAQNYTQQELQRFSIIAT------ 331
           +FPFSRG+     A NFW + + L K          Y   +T + +Q   I +T      
Sbjct: 275 LFPFSRGLTHAYWAPNFWALYSFLDKILTVVMLKLPYVHQFTSKFIQPPLIPSTIDEIKQ 334

Query: 332 --------AAGFLPSFLVVLCYPKKHMIPFALAA-------------------------C 358
                     G +     V+       + FAL A                         C
Sbjct: 335 RIAQNNNGTKGLVQDVFFVILPQITPKLTFALTAFYQVLAVIPVLFDPSYKRFIGSLTLC 394

Query: 359 SMAFFLFSFQVHEKSILVPLLPITLLYCSTDWNVLSMVSWINNVALFTLWPLLKKDH 415
            +A +LF + VHEK+I++ ++P + L  + D  +L+    +      +L+PLL ++ 
Sbjct: 395 GLASYLFGWHVHEKAIMLAIVPFSFL-VACDRRLLTSYMLLAASGYVSLFPLLYENQ 450

>KLTH0F17666g Chr6 complement(1425802..1427469) [1668 bp, 555 aa]
           {ON} highly similar to uniprot|P40351 Saccharomyces
           cerevisiae YOR067C ALG8 adds glucose to the dolichol-
           linked oligosaccharide precursor prior to transfer to
           protein glycosyl transferase
          Length = 555

 Score =  123 bits (308), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 111/418 (26%), Positives = 188/418 (44%), Gaps = 76/418 (18%)

Query: 61  IHGDFEAQRHWMELTNHLPLSQWYWYDLQYWGLDYPPLTAYHSYVLGKL--GSLLNSEWF 118
           +  DF+  R+W+ +TN LPL +WY+     W LDYPP  AY  ++L +     + +    
Sbjct: 41  VSTDFDVHRNWLAITNKLPLHKWYYESTSQWTLDYPPFFAYFEWLLSQFVPQRVQDDGCL 100

Query: 119 ALLSSRGIENPDIKAYMRFTVILSEAGLYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILF 178
            +++      P I  + R TVI+SE  L++   +Y  K     R       ++ A++I+ 
Sbjct: 101 DIVAVGQFGLPTI-VFQRVTVIVSEILLFVVLQVYINKSHISDRS----ANFVVASSIVL 155

Query: 179 QPSLILIDHGHFQYNSVMLGLTVYSINNLLDGYYGPAAICFVLSLCFKQMALYYSPVFFA 238
            P  ++IDH HFQYN  +  + + SI       Y      F  +LCFK + LY +P FFA
Sbjct: 156 SPGFLIIDHIHFQYNGFLFAILIASIVAAKHQRYLLCGFFFSTALCFKHIFLYLAPSFFA 215

Query: 239 YLLSECLISPS----------LNVPRFLSV-AFSTVI--SFCIIFSPLYVFGGTKNVLQS 285
           +LL   ++  S          +++ R+ ++    TV+   F + F+P         + Q 
Sbjct: 216 FLLRVYILDFSNFRFRTYNDLISMVRWKNLFKLGTVVLSVFAVCFAPF-----IYQLPQL 270

Query: 286 IHRIFPFSRGIFEDKVA-NFWCVSNVLFK----------YAQNYTQQ------------- 321
           + R+FPFSRG+     A NFW + + L K          Y   +  Q             
Sbjct: 271 MSRLFPFSRGLTHAYWAPNFWALYSALDKVLTLFFLKVPYVHKFLTQVVSPPLIPVTIDE 330

Query: 322 ---ELQRFSIIATAA------GFLP------SFLVVLCYPKKHMIPF-----------AL 355
              +LQ++++             LP      +F++ L Y    +IP            +L
Sbjct: 331 IKTKLQQYNVGTKGLVQDVYFVILPQIQPKLTFILTLFYQILAVIPVLFSPSFERFVGSL 390

Query: 356 AACSMAFFLFSFQVHEKSILVPLLPITLLYCSTDWNVLSMVSWINNVALFTLWPLLKK 413
             C  A FLF + VHEK++L+ ++P + L  +TD  +L+    + +    +L+PLL +
Sbjct: 391 TLCGFASFLFGWHVHEKAVLLIIIPFSFL-VTTDRRLLTPFHLVASAGYVSLFPLLHE 447

>Kwal_55.21742 s55 complement(960476..962143) [1668 bp, 555 aa] {ON}
           YOR067C (ALG8) - glycosyl transferase [contig 126] FULL
          Length = 555

 Score =  122 bits (307), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 113/420 (26%), Positives = 187/420 (44%), Gaps = 72/420 (17%)

Query: 59  GPIHGDFEAQRHWMELTNHLPLSQWYWYDLQYWGLDYPPLTAYHSYVLGKL-GSLLNSEW 117
           G +  DF+  R+W+ +TN LPL QWY+ +   W LDYPP  AY  + L +L  +++  + 
Sbjct: 39  GYLSTDFDVHRNWLAITNKLPLKQWYFENTSQWTLDYPPFFAYFEWALSQLVPNIVRQDG 98

Query: 118 FALLSSRGIENPDIKAYMRFTVILSEAGLYIPAVLYFTKWFGIKRRQSPIGQYIAAAAIL 177
              +   G        + R TVI SE  L++   +Y  K    +R       ++ A++I+
Sbjct: 99  CLDIVKVGQFGMPTIVFQRLTVIASEILLFVVLQVYINKSHISERS----ANFVVASSIV 154

Query: 178 FQPSLILIDHGHFQYNSVMLGLTVYSINNLLDGYYGPAAICFVLSLCFKQMALYYSPVFF 237
             P  ++IDH HFQYN  +  + + SI    +  Y    + F +++CFK + LY +P FF
Sbjct: 155 LSPGFLIIDHIHFQYNGFLFAILIASIVAAKEQRYLLCGLFFSIAICFKHIFLYLAPSFF 214

Query: 238 AYLLSECLISPSLNVPRFLSVAFSTVIS-------FCIIFSPLYVFGG-----TKNVLQS 285
            +LL   +    L+   F   +++ +IS       F +    L VFG           Q 
Sbjct: 215 VFLLRVYV----LDFSNFHFKSYNDLISIVQWRNLFKLGSVVLCVFGVCFAPFISQWPQL 270

Query: 286 IHRIFPFSRGIFEDKVA-NFWCVSNVLFK----------YAQNYTQQELQRFSIIATAAG 334
           + R+FPFSRG+     A NFW + ++L K          Y   +  Q +    I AT   
Sbjct: 271 LSRLFPFSRGLTHAYWAPNFWAMYSLLDKVLTLIILKVPYVHKFLTQFIAPPLIPATIGE 330

Query: 335 ----------------------FLP------SFLVVLCYPKKHMIPF-----------AL 355
                                  LP      +F++ L Y    +IP            +L
Sbjct: 331 IKQKLLQYNVGTKGLVQDVYFVILPQIQPRLTFILTLFYQILAIIPVLFSPSFKRFVGSL 390

Query: 356 AACSMAFFLFSFQVHEKSILVPLLPITLLYCSTDWNVLSMVSWINNVALFTLWPLLKKDH 415
             C  A FLF + VHEK+I++ ++P + L  ++D  +L+  + + +    +L+PLL +  
Sbjct: 391 TLCGFASFLFGWHVHEKAIMLIIIPFSFL-VTSDRRLLTPFNLLASAGYVSLFPLLHETQ 449

>CAGL0L10450g Chr12 complement(1117959..1119611) [1653 bp, 550 aa]
           {ON} similar to uniprot|P40351 Saccharomyces cerevisiae
           YOR067c ALG8 Glucosyltransferase
          Length = 550

 Score =  122 bits (307), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 113/420 (26%), Positives = 185/420 (44%), Gaps = 82/420 (19%)

Query: 64  DFEAQRHWMELTNHLPLSQWYWYDLQYWGLDYPPLTAYHSYVLGK-LGSLLNSEWFALLS 122
           DF+  R+W+ +TN LPL QWY+     W LDYPP  AY  + L + + S + S+    + 
Sbjct: 36  DFDVHRNWLAITNKLPLRQWYYEHTSQWTLDYPPFFAYFEWFLSQFVPSYVKSDGCLDIV 95

Query: 123 SRGIENPDIKAYMRFTVILSEAGLYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQPSL 182
             G        + R TVI SE  L++   +Y       +R QS    ++ A++I   P  
Sbjct: 96  EVGQFGMPTVVFQRLTVIASEILLFVVLQVYINTSKVSERTQS----FVVASSIAISPGF 151

Query: 183 ILIDHGHFQYNSVMLGLTVYSINNLLDGYYGPAAICFVLSLCFKQMALYYSPVFFAYLLS 242
           ++IDH HFQYN  +  + + SI    +  Y      + ++LCFK + LY +P +F +LL 
Sbjct: 152 LIIDHIHFQYNGFLFAILIASIVAAKNKKYLWCGFFYSVALCFKHIYLYLAPCYFVFLLR 211

Query: 243 ECLISPSLNVPRFLSVAFSTVI-----------------SFCIIFSPLYVFGGTKNVLQS 285
             +    LN+  F   ++  +I                 +F + F P ++F    ++ Q 
Sbjct: 212 AYV----LNLKDFKFKSYRDLIFIVKWRHLVKLGSVVIATFAVAFGP-FIF----DLPQL 262

Query: 286 IHRIFPFSRGIFEDKVA-NFWCVSNVLFK------YAQNYTQQELQRF-----------S 327
           + R+FPFSRG+     A NFW + + + K          YT +   +F            
Sbjct: 263 LTRLFPFSRGLTHAYWAPNFWAIYSTIDKILTMVFLKMPYTYKLASQFISPPLIPASLNE 322

Query: 328 IIATAAG---------------FLP------SFLVVLCYPKKHMIPF-----------AL 355
           I A  A                 LP      +FL+ L Y    ++P            ++
Sbjct: 323 IKAKMAANNNGSKGLVEDVYFVILPQIVPKLTFLLTLLYQVLAVVPVLFDPSFKRFMGSM 382

Query: 356 AACSMAFFLFSFQVHEKSILVPLLPITLLYCSTDWNVLSMVSWINNVALFTLWPLLKKDH 415
             C +A FLF + VHEK+I++ ++P + L  S D  +LS    + +    +L+PLL +  
Sbjct: 383 TLCGLASFLFGWHVHEKAIMLVIIPFSFLVIS-DRRLLSSFMLLTSAGYVSLFPLLYESQ 441

>NDAI0F00510 Chr6 (118893..120605) [1713 bp, 570 aa] {ON} Anc_5.669
           YOR067C
          Length = 570

 Score =  123 bits (308), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 109/416 (26%), Positives = 183/416 (43%), Gaps = 75/416 (18%)

Query: 64  DFEAQRHWMELTNHLPLSQWYWYDLQYWGLDYPPLTAYHSYVLGK-LGSLLNSEWFALLS 122
           DF+  R+W+ +TN LPL +WY+     W LDYPP  AY  + + + +  ++  +    + 
Sbjct: 54  DFDVHRNWLAITNKLPLKEWYYEHTSQWTLDYPPFFAYFEWFMSQFVPKVVRDDGCLDIV 113

Query: 123 SRGIENPDIKAYMRFTVILSEAGLYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQPSL 182
             G        + R +VI+SE  L++    +  K    +R QS    +I A +I+  P  
Sbjct: 114 PVGQFGWATVVFQRTSVIISEILLFVVLQWFINKSKDNERTQS----FIVATSIILSPGF 169

Query: 183 ILIDHGHFQYNSVMLGLTVYSINNLLDGYYGPAAICFVLSLCFKQMALYYSPVFFAYLLS 242
           ++IDH HFQYN  +  + + SI       Y    + + ++LCFK + LY +P +F +LL 
Sbjct: 170 LIIDHIHFQYNGFLFAILIASIVAAKQERYLLCGLFYSIALCFKHIFLYLAPCYFVFLLR 229

Query: 243 ECLISPSLNVPRFLSVAFSTVISFCIIFSPLYVFGGTK-------------NVLQSIHRI 289
             +    LNV  F   ++  +I   I ++ L+  GG               ++ Q   R+
Sbjct: 230 AYV----LNVKNFKFKSYKDLI-LLIQWNNLFKLGGIVLSIFGICFLPFIYHLPQVFTRL 284

Query: 290 FPFSRGI--------------FEDKVANFW-------------CVSNVLF---------- 312
           FPF RG+              F DK+A                C+ + LF          
Sbjct: 285 FPFGRGLTHAYWAPNFWAIYSFTDKIATTLLLKLPYVHKLLCKCIKHPLFPTTREEIQSR 344

Query: 313 --KYAQNYTQ------------QELQRFSIIATAAGFLPSFLVVLCYPKKHMIPFALAAC 358
             +Y  N ++            Q + + S I T    L + + +L  P       +L  C
Sbjct: 345 IMEYGNNGSKGLVEDVYFIILPQIIPKLSFILTGFYQLLAVVPLLFDPSFKRFIGSLTLC 404

Query: 359 SMAFFLFSFQVHEKSILVPLLPITLLYCSTDWNVLSMVSWINNVALFTLWPLLKKD 414
            MA FLF + VHEK+IL+ ++P + L    D  +L+    +++    +L+PLL K+
Sbjct: 405 GMASFLFGWHVHEKAILLVIIPFSFL-VVCDRRLLTSFMLVSSAGYVSLFPLLYKN 459

>YOR067C Chr15 complement(451729..453462) [1734 bp, 577 aa] {ON}
           ALG8Glucosyl transferase, involved in N-linked
           glycosylation; adds glucose to the dolichol-linked
           oligosaccharide precursor prior to transfer to protein
           during lipid-linked oligosaccharide biosynthesis;
           similar to Alg6p
          Length = 577

 Score =  122 bits (307), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 113/421 (26%), Positives = 185/421 (43%), Gaps = 84/421 (19%)

Query: 64  DFEAQRHWMELTNHLPLSQWYWYDLQYWGLDYPPLTAYHSYVLGKL--GSLLNSEWFALL 121
           DF+  R+W+ +TN LP+S+WY+     W LDYPP  AY  + L +    S+ +     ++
Sbjct: 66  DFDVHRNWLAITNKLPISEWYYEHTSQWTLDYPPFFAYFEWFLSQFVPKSVRDDGCLDIV 125

Query: 122 SSRGIENPDIKAYMRFTVILSEAGLYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQPS 181
                  P I  + R TVI SE  L++   +Y       +R QS    ++ A++I+  P 
Sbjct: 126 EIGKFGLPTI-VFQRLTVIFSEILLFVILQIYINTTKLSERSQS----FVVASSIVLSPG 180

Query: 182 LILIDHGHFQYNSVMLGLTVYSINNLLDGYYGPAAICFVLSLCFKQMALYYSPVFFAYLL 241
            ++IDH HFQYN  +  + + SI    +  Y   A+ +  ++CFK + LY +P +F +LL
Sbjct: 181 FLIIDHIHFQYNGFLFAILIGSIVAAKNKRYILCAVLYTTAICFKHIFLYLAPCYFVFLL 240

Query: 242 SECLISPSLNVPRF-----------------LSVAFSTVISFCIIFSPLYVFGGTKNVLQ 284
              +    LNV  F                 L +A   V  F I F P         + Q
Sbjct: 241 RAYV----LNVNNFKFKSYKDFLFLIRWANLLKLATVVVGIFTICFLPF-----AHQMPQ 291

Query: 285 SIHRIFPFSRGIFEDKVA-NFWC--------VSNVLFK------YAQNYTQ-----QELQ 324
            + R+FPFSRG+     A NFW         ++ V+ K      +A  + +     Q ++
Sbjct: 292 VLSRLFPFSRGLTHAYWAPNFWALYSFMDKILTTVMLKLPYVHTFATKFIKPPLIPQNIK 351

Query: 325 RFS--IIATAAG-----------FLP------SFLVVLCYPKKHMIPF-----------A 354
             +  + A   G            LP      +F++ + Y    ++P            +
Sbjct: 352 EINERLAANNNGSKGLVQDVFFVILPQIPPKLTFILTIFYQVLAVLPLLFDPSFKRFVGS 411

Query: 355 LAACSMAFFLFSFQVHEKSILVPLLPITLLYCSTDWNVLSMVSWINNVALFTLWPLLKKD 414
           L  C +A FLF + VHEK+I++ ++P T L    D  +L     + +    +L+PLL K 
Sbjct: 412 LTLCGLASFLFGWHVHEKAIMLVIIPFTFL-VGFDRRLLVPFMLVASAGYVSLYPLLYKG 470

Query: 415 H 415
            
Sbjct: 471 Q 471

>Kpol_1018.73 s1018 complement(205615..207480) [1866 bp, 621 aa]
           {ON} complement(205615..207480) [1866 nt, 622 aa]
          Length = 621

 Score =  122 bits (307), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 109/416 (26%), Positives = 186/416 (44%), Gaps = 74/416 (17%)

Query: 64  DFEAQRHWMELTNHLPLSQWYWYDLQYWGLDYPPLTAYHSYVLGK-LGSLLNSEWFALLS 122
           DF+  R+WM +TN LP+S+WY+ +   W LDYPP  AY  + L + +  ++  +    + 
Sbjct: 109 DFDVHRNWMAITNALPISKWYFENTSQWTLDYPPFFAYFEWFLSQFVPKIVRDDGCLDIV 168

Query: 123 SRGIENPDIKAYMRFTVILSEAGLYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQPSL 182
             G        + R TVI+SE  L+     Y       +R QS    ++ A++I+  P  
Sbjct: 169 EVGQFGWPTVVFQRLTVIISEICLFAVLQYYINTSNLNERTQS----FVVASSIVLSPGF 224

Query: 183 ILIDHGHFQYNSVMLGLTVYSINNLLDGYYGPAAICFVLSLCFKQMALYYSPVFFAYLLS 242
           +++DH HFQYN+ +  + + SI       Y   A+ + ++LCFK + LY +P +F +LL 
Sbjct: 225 LIVDHIHFQYNAFLFSILIASIVAAKQKKYIACAVFYTIALCFKHIFLYLAPCYFVFLLR 284

Query: 243 ECLISPS-------------LNVPRFLSVAFSTVISFCIIFSPLYVFGGTKNVLQSIHRI 289
             +++               +   R L +    +  F I F+P ++F     + Q + R+
Sbjct: 285 AYVLNFKDFKFKSYKDLIFIVQWRRLLKLGSIVLGIFGICFAP-FIF----QMPQVLSRL 339

Query: 290 FPFSRGIFEDKVA-NFWCVSNVL----------FKYAQNYTQQELQRFSIIATAAG---- 334
           FPFSRG+     A NFW + + L          F Y   +  + +    I ++ A     
Sbjct: 340 FPFSRGLTHAYWAPNFWAIYSFLDKILAVVMLKFPYVHRFISKFISSPLIPSSIAEIKLR 399

Query: 335 ------------------FLP------SFLVVLCYPKKHMIPF-----------ALAACS 359
                              LP      +FL+ L Y    +IP            +L  C 
Sbjct: 400 MEENNNGSKGLVEDVFFVILPQIQPKLTFLLTLFYQILAVIPVLFNPSFKRFIGSLTLCG 459

Query: 360 MAFFLFSFQVHEKSILVPLLPITLLYCSTDWNVLSMVSWINNVALFTLWPLLKKDH 415
           +A +LF + VHEK+IL+ ++P + L    D  +LS    + +    +L+PLL ++ 
Sbjct: 460 LASYLFGWHVHEKAILLVIIPFSFL-VVCDRRLLSSFMLVASAGYVSLFPLLYENQ 514

>Smik_15.247 Chr15 complement(417710..419443) [1734 bp, 577 aa] {ON}
           YOR067C (REAL)
          Length = 577

 Score =  121 bits (304), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 111/417 (26%), Positives = 184/417 (44%), Gaps = 76/417 (18%)

Query: 64  DFEAQRHWMELTNHLPLSQWYWYDLQYWGLDYPPLTAYHSYVLGKL--GSLLNSEWFALL 121
           DF+  R+W+ +TN LP+S+WY+     W LDYPP  AY  + L +     + +     ++
Sbjct: 66  DFDVHRNWLAITNKLPISEWYYEHTSQWTLDYPPFFAYFEWFLSQFVPKVVRDDGCLDIV 125

Query: 122 SSRGIENPDIKAYMRFTVILSEAGLYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQPS 181
                  P I  + R TVI SE  LY    +Y       +R QS    ++ A++I+  P 
Sbjct: 126 EVGKFGLPTI-VFQRLTVIFSEILLYAVLQIYINTTKLSERSQS----FVVASSIVLSPG 180

Query: 182 LILIDHGHFQYNSVMLGLTVYSINNLLDGYYGPAAICFVLSLCFKQMALYYSPVFFAYLL 241
            ++IDH HFQYN  +  + + SI    +  Y   A  +  ++CFK + LY +P +F +LL
Sbjct: 181 FLMIDHIHFQYNGFLFAILIGSIVAAKNKKYLLCAFLYTTAICFKHIFLYLAPCYFVFLL 240

Query: 242 SECLISPSLNVPRFLSVAFSTVISFCIIFSPLYVFGG-------------TKNVLQSIHR 288
              +    LNV  F   ++   + F I ++ L+  G                 + Q + R
Sbjct: 241 RAYV----LNVNNFKFKSYKDFL-FLIRWANLFKLGSIVIGIFTICFVPFAHQMPQVLSR 295

Query: 289 IFPFSRGIFEDKVA-NFWC--------VSNVLFK------YAQNYTQ-----QELQRFS- 327
           +FPFSRG+     A NFW         ++ V+ K      +A  + +     Q ++  + 
Sbjct: 296 LFPFSRGLTHAYWAPNFWALYSFMDKILTTVMLKLPYVHTFATKFIKPPLIPQNIKEINE 355

Query: 328 -IIATAAG-----------FLP------SFLVVLCYPKKHMIPF-----------ALAAC 358
            + A   G            LP      +F++ L Y    ++P            +L  C
Sbjct: 356 RLAANNNGSKGLVQDVFFVILPQIPPKLTFILTLFYQNLAVLPLLFDPSFKRFVGSLTLC 415

Query: 359 SMAFFLFSFQVHEKSILVPLLPITLLYCSTDWNVLSMVSWINNVALFTLWPLLKKDH 415
            +A FLF + VHEK+I++ ++P T L    D  +L     + +    +L+PLL K  
Sbjct: 416 GLASFLFGWHVHEKAIMLVIIPFTFL-VGFDRRLLVPFMLVASAGYVSLYPLLYKGQ 471

>Skud_15.234 Chr15 complement(413571..415304) [1734 bp, 577 aa] {ON}
           YOR067C (REAL)
          Length = 577

 Score =  119 bits (298), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 110/417 (26%), Positives = 183/417 (43%), Gaps = 76/417 (18%)

Query: 64  DFEAQRHWMELTNHLPLSQWYWYDLQYWGLDYPPLTAYHSYVLGKL--GSLLNSEWFALL 121
           DF+  R+W+ +TN LP+S+WY+     W LDYPP  AY  + L +     + +     ++
Sbjct: 66  DFDVHRNWLAITNKLPISKWYYEHTSQWTLDYPPFFAYFEWFLSQFVPKVVRDDGCLDIV 125

Query: 122 SSRGIENPDIKAYMRFTVILSEAGLYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQPS 181
                  P I  + R TVI S+  L++   +Y       +R QS    ++ A++I+  P 
Sbjct: 126 EVGKFGLPTI-VFQRLTVIFSDILLFVVLQVYINTTDLSERSQS----FVVASSIVLSPG 180

Query: 182 LILIDHGHFQYNSVMLGLTVYSINNLLDGYYGPAAICFVLSLCFKQMALYYSPVFFAYLL 241
             +IDH HFQYN  +  + + SI       Y   AI +  ++CFK + LY +P +F +LL
Sbjct: 181 FFMIDHIHFQYNGFLFAILIGSIVAAKKKRYILCAILYTTAICFKHIFLYLAPCYFVFLL 240

Query: 242 SECLISPSLNVPRFLSVAFSTVISFCIIFSPLYVFGG-------------TKNVLQSIHR 288
              +    LNV  F   ++   + F I ++ L+  G                 + Q + R
Sbjct: 241 RAYV----LNVNNFKFKSYKDFL-FLIRWANLFKLGSIVIGIFTICFLPFAHQMPQVLSR 295

Query: 289 IFPFSRGIFEDKVA-NFWCVSNVLFK--------------YAQNYTQ-----QELQRFS- 327
           +FPFSRG+     A NFW + + + K              +A  + +     Q L+  + 
Sbjct: 296 LFPFSRGLTHAYWAPNFWALYSFMDKILTTIMLRLPYVHTFATKFIKPPLIPQNLKEINE 355

Query: 328 -IIATAAG-----------FLP------SFLVVLCYPKKHMIPF-----------ALAAC 358
            + A   G            LP      +F++ + Y    ++P            +L  C
Sbjct: 356 RLAANNNGSKGLVQDVFFVILPQIPPKLTFILTIFYQILAVLPLLFDPSFKRFVGSLTLC 415

Query: 359 SMAFFLFSFQVHEKSILVPLLPITLLYCSTDWNVLSMVSWINNVALFTLWPLLKKDH 415
            +A FLF + VHEK+I++ ++P T L    D  +L     I +    +L+PLL K  
Sbjct: 416 GLASFLFGWHVHEKAIMLVIVPFTFL-VGFDRRLLVPFMLIASAGYVSLYPLLYKGQ 471

>NCAS0G00450 Chr7 (77781..79493) [1713 bp, 570 aa] {ON} Anc_5.669
           YOR067C
          Length = 570

 Score =  119 bits (297), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 105/420 (25%), Positives = 179/420 (42%), Gaps = 82/420 (19%)

Query: 64  DFEAQRHWMELTNHLPLSQWYWYDLQYWGLDYPPLTAYHSYVLGK-LGSLLNSEWFALLS 122
           DF+  R+W+ +TN LPL QWY+     W LDYPP  AY  +++ + +  ++  +    + 
Sbjct: 56  DFDVHRNWLAVTNKLPLKQWYYEHTSQWTLDYPPFFAYFEWIISQFVPQVVRDDGCLDIV 115

Query: 123 SRGIENPDIKAYMRFTVILSEAGLYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQPSL 182
             G        + R +VI SE  L++  + +F     +K R      +I A +I+  P  
Sbjct: 116 EIGKFGEPTVIFQRLSVITSEILLFV-VLQWFINTSNVKERTQ---SFIVATSIILSPGF 171

Query: 183 ILIDHGHFQYNSVMLGLTVYSINNLLDGYYGPAAICFVLSLCFKQMALYYSPVFFAYLLS 242
           +++DH HFQYN  +  + + SI       Y   A+ +  +LCFK + LY +P +F +LL 
Sbjct: 172 LIVDHIHFQYNGFLFSILIASIVAAKQKRYILCAVFYTTALCFKHIFLYLAPCYFVFLLR 231

Query: 243 ECLISPSLNVPRFLSVAFSTVISFCIIFSPLYVFGGTK-------------NVLQSIHRI 289
             +    LNV  F   ++  ++   + ++ L+   G               ++ Q + R+
Sbjct: 232 AYV----LNVKGFQFKSYKDLVRL-VQWTNLFRLAGVVLSIVGVCFGPFIFDMPQLLTRL 286

Query: 290 FPFSRGIFEDKVA-NFWCVSNVLFKYAQN------YTQQELQRFSIIATAAGFLP----- 337
           FPFSRG+     A NFW + +   K          Y      RF     +A F P     
Sbjct: 287 FPFSRGLTHAYWAPNFWAIYSFTDKVLTTLMLKLPYVHTLATRF----ISAPFFPATIKE 342

Query: 338 -------------------------------SFLVVLCYPKKHMIPF-----------AL 355
                                          +F++ L Y    +IP            +L
Sbjct: 343 IQKRLSEDNNGTKGLVQDVYFIVLPQIVPKLTFILTLFYQLLAVIPLLFDPSFKRFIGSL 402

Query: 356 AACSMAFFLFSFQVHEKSILVPLLPITLLYCSTDWNVLSMVSWINNVALFTLWPLLKKDH 415
             C MA +LF + VHEK+I++ ++P + L    D  +LS     ++    +L+PLL ++ 
Sbjct: 403 TLCGMASYLFGWHVHEKAIMLVIIPFSFLVVC-DRRLLSSFMLASSAGYVSLFPLLYENQ 461

>Suva_8.118 Chr8 complement(214797..216527) [1731 bp, 576 aa] {ON}
           YOR067C (REAL)
          Length = 576

 Score =  118 bits (296), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 108/416 (25%), Positives = 178/416 (42%), Gaps = 75/416 (18%)

Query: 64  DFEAQRHWMELTNHLPLSQWYWYDLQYWGLDYPPLTAYHSYVLGKL--GSLLNSEWFALL 121
           DF+  R+W+ +TN LP+S+WY+     W LDYPP  AY  + L +     + +     ++
Sbjct: 66  DFDVHRNWLAITNKLPMSEWYYEHTSQWTLDYPPFFAYFEWFLSQFVPKVVRDDGCLDIV 125

Query: 122 SSRGIENPDIKAYMRFTVILSEAGLYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQPS 181
                  P I  + R TVI SE  L+    +Y       +R QS    ++ A++I+  P 
Sbjct: 126 EVGKFGLPTI-VFQRLTVIFSEILLFAVLQIYINTTKLSERSQS----FVVASSIVLSPG 180

Query: 182 LILIDHGHFQYNSVMLGLTVYSINNLLDGYYGPAAICFVLSLCFKQMALYYSPVFFAYLL 241
            ++IDH HFQYN  +  + + SI    +  Y   A+ +  S+CFK + LY +P +F +LL
Sbjct: 181 FLMIDHIHFQYNGFLFAILIGSIVAAKNKKYLWCAVLYTTSICFKHIFLYLAPCYFVFLL 240

Query: 242 SECLISPSLNVPRFLSVAFSTVISFCIIFSPLYVFGG-------------TKNVLQSIHR 288
              +    LNV  F   ++   + F I ++ L+  G                 + Q + R
Sbjct: 241 RAYV----LNVNNFKFKSYKDFL-FLIRWTNLFKLGSIVIGIFTICFLPFAHQMPQVLSR 295

Query: 289 IFPFSRGIFEDKVA-NFWCVSNVLFK---------------------------------- 313
           +FPFSRG+     A NFW + + + K                                  
Sbjct: 296 LFPFSRGLTHAYWAPNFWALYSFMDKILTTIMLKLPYVHMFATKLIKPPLIPKDIKEINE 355

Query: 314 --YAQNYTQQELQ------------RFSIIATAAGFLPSFLVVLCYPKKHMIPFALAACS 359
              A N ++  +Q            R + I T    + + L +L  P       +L  C 
Sbjct: 356 RLLANNGSKGLVQDVFFVILPQIPPRLTFILTIFYQILAVLPILFDPSFKRFIGSLTLCG 415

Query: 360 MAFFLFSFQVHEKSILVPLLPITLLYCSTDWNVLSMVSWINNVALFTLWPLLKKDH 415
           +A +LF + VHEK+I++ ++P T L    D  +L     + +    +L+PLL K  
Sbjct: 416 LASYLFGWHVHEKAIMLVIIPFTFL-VGFDRRLLIPFMLVASAGYVSLYPLLFKGQ 470

>KNAG0L01920 Chr12 complement(344454..346160) [1707 bp, 568 aa] {ON}
           Anc_5.669 YOR067C
          Length = 568

 Score =  117 bits (294), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 103/416 (24%), Positives = 183/416 (43%), Gaps = 75/416 (18%)

Query: 64  DFEAQRHWMELTNHLPLSQWYWYDLQYWGLDYPPLTAYHSYVLGK-LGSLLNSEWFALLS 122
           DF+  R+W+ +TN LPL +WY+     W LDYPP  AY  +VL + + + + ++    + 
Sbjct: 53  DFDVHRNWLAITNALPLREWYYEKTSQWTLDYPPFFAYFEWVLSQFVPAAVRADGCLDIV 112

Query: 123 SRGIENPDIKAYMRFTVILSEAGLYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQPSL 182
            +G+       + R TVI SE  L++   +Y       ++ QS    ++ A++I+  P L
Sbjct: 113 PQGVFGALTVLFQRCTVIASEVLLFVVLQVYINTSPPAEKTQS----FVVASSIVLSPML 168

Query: 183 ILIDHGHFQYNSVMLGLTVYSINNLLDGYYGPAAICFVLSLCFKQMALYYSPVFFAYLLS 242
           +++DH HFQYN  +  + + SI       +   A  +  +LCFK + LY +P +F +LL 
Sbjct: 169 LIVDHIHFQYNGFLFAILIASIVAARKRKFLLCAFFYSTALCFKHIFLYLAPCYFMFLLR 228

Query: 243 ECLISPS-------------LNVPRFLSVAFSTVISFCIIFSPLYVFGGTKNVLQSIHRI 289
             ++                ++  R   +    +    + F+P       +++ Q + R+
Sbjct: 229 TYVLQFEGFRFKSYKDLFRIIHWGRLFKLGGVVLGVAVVCFAPF-----ARDMPQLLSRL 283

Query: 290 FPFSRGIFEDKVA-NFWC--------------------------VSNVLFKYAQNYTQQE 322
           FPFSRG+     A NFW                           +S  +F  + +  +Q 
Sbjct: 284 FPFSRGLTHAYWAPNFWALYSLCDKVLTVALLKVPLFHRLILKVLSPKIFPASLDIIRQR 343

Query: 323 LQRFSIIATAA-------GFLP------SFLVVLCYPKKHMIPF-----------ALAAC 358
           L++ +   T           LP      +FL+ L Y    ++P            +L  C
Sbjct: 344 LKKNANHGTKGLVEDVYFVVLPQITPATTFLLTLLYQVLAVLPLLFDASFKRFLGSLTLC 403

Query: 359 SMAFFLFSFQVHEKSILVPLLPITLLYCSTDWNVLSMVSWINNVALFTLWPLLKKD 414
             A FLF + VHEK+I++ ++P + L    D  +L+    +      +L+PLL K+
Sbjct: 404 GFASFLFGWHVHEKAIMLVIIPFSFL-VVYDRRLLTSFKLVTTAGYVSLFPLLYKN 458

>KAFR0D02440 Chr4 (489816..491543) [1728 bp, 575 aa] {ON} Anc_5.669
           YOR067C
          Length = 575

 Score =  116 bits (291), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 112/419 (26%), Positives = 184/419 (43%), Gaps = 82/419 (19%)

Query: 64  DFEAQRHWMELTNHLPLSQWYWYDLQYWGLDYPPLTAYHSYVLGKL-GSLLNSEWFALLS 122
           DF+  R+W+ +TN + L  WY+     W LDYPP  AY  + +  L  S +  +    + 
Sbjct: 64  DFDVHRNWLAITNGMHLKDWYYEHTSQWTLDYPPFFAYFEWFISHLVPSFVRRDGCLDIV 123

Query: 123 SRGIENPDIKAYMRFTVILSEAGLYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQPSL 182
             G        + R TVI SE+ L++   +Y       +R QS    +I A++I+  P  
Sbjct: 124 EVGQFGWPTVLFQRLTVIFSESLLFLVLQIYINTSEVEERTQS----FIVASSIVLSPGF 179

Query: 183 ILIDHGHFQYNSVMLGLTVYSINNLLDGYYGPAAICFVLSLCFKQMALYYSPVFFAYLLS 242
           +++DH HFQYN  +  + V SI    +  Y   A+ + ++LCFK + LY +P +F +LL 
Sbjct: 180 LIVDHIHFQYNGFLFAILVASIVAARNKRYLLCALFYSIALCFKHIFLYLAPCYFVFLLR 239

Query: 243 ECLISPSLNVPRFLSVAFSTVI-----------------SFCIIFSPLYVFGGTKNVLQS 285
             +    LN   F   ++  +I                  F + F P ++F    ++ Q 
Sbjct: 240 VYV----LNFENFKFRSYKDLIFLIRWKNLCQLGMIVVGVFSLCFGP-FIF----DMPQL 290

Query: 286 IHRIFPFSRGIFEDKVA-NFWCVSNVLFK----------YAQNYTQQ-----------EL 323
           + R+FPFSRG+     A NFW + + L K          Y  N+  +           E 
Sbjct: 291 LSRLFPFSRGLTHAYWAPNFWALYSFLDKVLTVFALRLHYVHNFAAKFIAPSLLPSSIEE 350

Query: 324 QRFSIIATAAG-----------FLP------SFLVVLCYPKKHMIPF-----------AL 355
            R  I     G            LP      +FL+ L Y    +IP            +L
Sbjct: 351 IRQRIAEHNNGTKGLVQDVFFVILPQISPKLTFLLTLFYQILAVIPLLFDPSFKRFMGSL 410

Query: 356 AACSMAFFLFSFQVHEKSILVPLLPITLLYCSTDWNVLSMVSWINNVALFTLWPLLKKD 414
             C MA +LF + VHEK+I++ ++P + L    D  +L   + +++    +L+PLL ++
Sbjct: 411 TLCGMASYLFGWHVHEKAIMLVIIPFSFL-VVFDRRLLISFTLVSSAGYVSLFPLLYEN 468

>KLLA0F16621g Chr6 complement(1531745..1533430) [1686 bp, 561 aa]
           {ON} highly similar to uniprot|P40351 Saccharomyces
           cerevisiae YOR067C ALG8 adds glucose to the dolichol-
           linked oligosaccharide precursor prior to transfer to
           protein glycosyl transferase
          Length = 561

 Score =  114 bits (284), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 111/420 (26%), Positives = 177/420 (42%), Gaps = 74/420 (17%)

Query: 59  GPIHGDFEAQRHWMELTNHLPLSQWYWYDLQYWGLDYPPLTAYHSYVLGKL--GSLLNSE 116
           G    DF+  R+W+ +TN LPL++WY      W LDYPP  AY  + L +    S+    
Sbjct: 47  GYYSTDFDVHRNWLAITNKLPLNKWYVESTSQWTLDYPPFFAYFEWFLSQFVPKSVAEDG 106

Query: 117 WFALLSSRGIENPDIKAYMRFTVILSEAGLYIPAVLYFTKWFGIKRRQSPIGQYIAAAAI 176
              ++       P I  + R TVILSE  LY  A+  F     I  + +    ++ A++I
Sbjct: 107 CLDIVKVGSFGLPTI-IFQRITVILSELVLY-AALQVFINTSDISEKSA---NFVVASSI 161

Query: 177 LFQPSLILIDHGHFQYNSVMLGLTVYSINNLLDGYYGPAAICFVLSLCFKQMALYYSPVF 236
           +  P L+++DH HFQYN  + G+ + SI    +  Y   A  F ++LCFK + LY +P +
Sbjct: 162 VLSPGLLIVDHIHFQYNGFLFGILISSIVAAKNKRYILCAAFFSIALCFKHIFLYLAPAY 221

Query: 237 FAYLLSECLISPS-------------LNVPRFLSVAFSTVISFCIIFSPLYVFGGTKNVL 283
           F +LL   ++  S             +     L +A   +  F + F P           
Sbjct: 222 FVFLLRAYVLDFSSFKFRSYKDLISIVQWSNLLKLASVVMGIFSLAFLPF-----ITTWQ 276

Query: 284 QSIHRIFPFSRGI--------------FEDKVANFWC---------VSNVLFKYAQNYTQ 320
           Q + R+FPFSRG+              F DKV              +S VL    +    
Sbjct: 277 QLLARLFPFSRGLTHAYWAPNVWAVYSFTDKVLTVLVLKLPYLQKILSIVLTSMPKTAAD 336

Query: 321 QELQRFSIIATAAGF--------LP------SFLVVLCYPKKHMIPF-----------AL 355
             ++  S  +   G         LP      +FL+ L Y    ++P            +L
Sbjct: 337 IHVRIESNNSGTRGLVQDVFFVVLPQITPKLTFLLTLFYQILAVVPVLFDPSFKRFVGSL 396

Query: 356 AACSMAFFLFSFQVHEKSILVPLLPITLLYCSTDWNVLSMVSWINNVALFTLWPLLKKDH 415
             C    FLF + VHEK+I++ + P + L    D  +L+  + + +    +L+PLL +  
Sbjct: 397 TLCGFVSFLFGWHVHEKAIMLVIFPFSFL-VPFDRRLLTPFTLLASAGYVSLFPLLYESQ 455

>TDEL0B02540 Chr2 (459825..461534) [1710 bp, 569 aa] {ON} Anc_5.669
           YOR067C
          Length = 569

 Score =  114 bits (284), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 103/414 (24%), Positives = 177/414 (42%), Gaps = 78/414 (18%)

Query: 64  DFEAQRHWMELTNHLPLSQWYWYDLQYWGLDYPPLTAYHSYVLGKLGSLLNSEWFAL-LS 122
           DF+  R+W+ +TN LPL +WY+     W LDYPP  AY  ++L +    +  E  AL + 
Sbjct: 55  DFDVHRNWLAITNELPLKEWYYEKTSQWTLDYPPFFAYFEWLLSQFVPKIVKEDGALDIV 114

Query: 123 SRGIENPDIKAYMRFTVILSEAGLYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQPSL 182
             G        + R TVI SE  L++   ++       ++ +S    ++ A++I+  P  
Sbjct: 115 EIGQFGWPTVVFQRLTVIFSEVLLFVVLQVFVNTSSATEKTRS----FVVASSIVLSPGF 170

Query: 183 ILIDHGHFQYNSVMLGLTVYSINNLLDGYYGPAAICFVLSLCFKQMALYYSPVFFAYLLS 242
           ++IDH HFQYN  +    + SI       Y   A  + ++LCFK + LY +P +F +LL 
Sbjct: 171 LMIDHIHFQYNGFLFAPLIASIVAAKHKKYMWCATFYAIALCFKHIFLYLAPCYFVFLLR 230

Query: 243 ECLISPSLNVPRFLSVAFSTVISFCIIFSPLYVFGGTKNVL---------------QSIH 287
             +++       F +  F +      I    ++F     VL               Q + 
Sbjct: 231 AYVLN-------FKNFEFKSYKDLIFIVQWKHLFKMASVVLGIFFICFGPFLYDLPQVMT 283

Query: 288 RIFPFSRGIFEDKVA-NFWCVSNVLFK----------YAQNYTQQELQ-----------R 325
           R+FPFSRG+     A NFW + + L K          Y   +  + +            +
Sbjct: 284 RLFPFSRGLTHAYWAPNFWAIYSFLDKILTFVMLKLPYVHAFATKFISPPLIPESLDDLK 343

Query: 326 FSIIATAAG-----------FLP------SFLVVLCYPKKHMIPF-----------ALAA 357
             ++   +G            LP      +F++ + Y    +IP            +L  
Sbjct: 344 ERLVQNNSGTKGLVQDVFFAILPQISPKLTFILTMFYQALAVIPLLFDPSFKRFIGSLTL 403

Query: 358 CSMAFFLFSFQVHEKSILVPLLPITLLYCSTDWNVLSMVSWINNVALFTLWPLL 411
           C ++ +LF + VHEK+I++ ++P + L    D  +LS    +      +L+PLL
Sbjct: 404 CGLSSYLFGWHVHEKAIMLVIVPFSFL-VVCDRRLLSSFMLVAAAGYVSLFPLL 456

>ADR210C Chr4 complement(1070234..1071952) [1719 bp, 572 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR067C
           (ALG8)
          Length = 572

 Score =  112 bits (280), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 104/386 (26%), Positives = 168/386 (43%), Gaps = 75/386 (19%)

Query: 64  DFEAQRHWMELTNHLPLSQWYWYDLQYWGLDYPPLTAYHSYVLGKL--GSLLNSEWFALL 121
           DFE  R+W+ +T+ LPL +WY      W +DYPPL A+  + L ++  G++       L+
Sbjct: 59  DFEVHRNWLAVTHRLPLRKWYVDATSQWTMDYPPLFAWLEWALSQVVPGAVRRDGCLKLV 118

Query: 122 SSRGIENPDIKAYMRFTVILSEAGLYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQPS 181
           +      P +  + R TVI SE  LY+   +Y +        Q     ++   ++   P+
Sbjct: 119 AEGRYGWPTV-VFQRLTVIASEVLLYVVLQVYVSS----SAAQERTVNFVVTTSVALSPA 173

Query: 182 LILIDHGHFQYNSVMLGLTVYSINNLLDGYYGPAAICFVLSLCFKQMALYYSPVFFAYLL 241
            +L+DH HFQYN  +  + V SI    +  Y      F ++LC K + LY +P +F +LL
Sbjct: 174 FLLVDHIHFQYNGFLFAVLVASIVAARERRYVLCGALFTVALCLKHIFLYLAPAYFVFLL 233

Query: 242 SECLISPSLNVPRFLSVAFSTVISFCIIFSPLYVFGGTKNVL-------------QSIHR 288
              +    L++  F   ++  ++ F + +  L   GG    +             Q + R
Sbjct: 234 RAYV----LDLGEFRFRSYRDLV-FAVRWGNLCRLGGVVLAIMAVTFAPFAGVMPQLMAR 288

Query: 289 IFPFSRGIFEDKVA-NFWC----VSNVL----------FKYAQNYTQQELQRFSI----I 329
           +FPFSRG+     A NFW     V  VL          +K A +  Q  L   SI     
Sbjct: 289 LFPFSRGLTHAYWAPNFWAIYSFVDKVLTFLMLRVPYVYKLATSLVQPPLIPASIDEIRA 348

Query: 330 ATAAG--------------FLP------SFLVVLCYPKKHMIPF-----------ALAAC 358
             AAG               LP      +FL+ L Y    ++P            +L+ C
Sbjct: 349 RMAAGNHGTRGLVQDVSFVILPQIQPKLTFLLTLFYQVLAVLPVLFDPSFKRFIGSLSLC 408

Query: 359 SMAFFLFSFQVHEKSILVPLLPITLL 384
             + FLF + VHEK+I++ ++P + L
Sbjct: 409 GFSAFLFGWHVHEKAIMLVIVPFSFL 434

>SAKL0G00836g Chr7 (77387..79072) [1686 bp, 561 aa] {ON} highly
           similar to uniprot|P40351 Saccharomyces cerevisiae
           YOR067C ALG8 adds glucose to the dolichol- linked
           oligosaccharide precursor prior to transfer to protein
           glycosyl transferase
          Length = 561

 Score =  110 bits (276), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 104/423 (24%), Positives = 174/423 (41%), Gaps = 78/423 (18%)

Query: 59  GPIHGDFEAQRHWMELTNHLPLSQWYWYDLQYWGLDYPPLTAYHSYVLGKL--GSLLNSE 116
           G    DF+  R+W+ +TN LPL +WY      W LDYPP  AY  + L +     + +  
Sbjct: 43  GYFSTDFDVHRNWLAITNKLPLREWYIEATSQWTLDYPPFFAYFEWFLSQFVPKIVRDDG 102

Query: 117 WFALLSSRGIENPDIKAYMRFTVILSEAGLYIPAVLYFTKWFGIKRRQSPIGQYIAAAAI 176
              ++       P I  + R TVI+SE  L++   ++  K             +I A++I
Sbjct: 103 CLDIVEVGNFGMPTI-IFQRITVIVSEVLLFVVLQIFINK----SATNEKSANFIVASSI 157

Query: 177 LFQPSLILIDHGHFQYNSVMLGLTVYSINNLLDGYYGPAAICFVLSLCFKQMALYYSPVF 236
           +  P  +++DH HFQYN  +  + + +I       Y      F  +LCFK + LY +P F
Sbjct: 158 VLSPGFLIVDHIHFQYNGFLFAILIAAIVAAKHHRYLLCGAFFATALCFKHIFLYLAPSF 217

Query: 237 FAYLLSECLISPS-------------LNVPRFLSVAFSTVISFCIIFSPLYVFGGTKNVL 283
           F +LL   ++  +             +   R L +    +  F + F+P         + 
Sbjct: 218 FVFLLRAYILDFTNFKFKSYKDLVSIVKWQRALKLGLVVLGIFAVCFAPF-----ISEMP 272

Query: 284 QSIHRIFPFSRGIFEDKVA-NFWCVSNVLFKYAQNYTQQEL---QRFSIIATAAGFLP-- 337
           Q + R+FPFSRG+     A NFW + ++L K    +    L    RF I   A   +P  
Sbjct: 273 QLLERLFPFSRGLTHAYWAPNFWALYSLLDK-VLTFVMLRLPYVHRFIIKFVAPPLIPAT 331

Query: 338 ----------------------------------SFLVVLCYPKKHMIPF---------- 353
                                             +FL+ L Y    +IP           
Sbjct: 332 IDEIKQRLSQNNVGTRGLVQDVYFVILPQIQPKLTFLLTLFYQILAVIPVLFNPSFKRFA 391

Query: 354 -ALAACSMAFFLFSFQVHEKSILVPLLPITLLYCSTDWNVLSMVSWINNVALFTLWPLLK 412
            +L  C  + FLF + VHEK+I++ ++P + L  + D  +++    + +    +L+PLL 
Sbjct: 392 GSLTLCGFSSFLFGWHVHEKAIMLVIIPFSFL-VTLDRRLVTPFRLLVSAGYVSLFPLLY 450

Query: 413 KDH 415
           +  
Sbjct: 451 QSQ 453

>Ecym_4051 Chr4 (109310..111124) [1815 bp, 604 aa] {ON} similar to
           Ashbya gossypii ADR210C
          Length = 604

 Score =  105 bits (262), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 104/415 (25%), Positives = 172/415 (41%), Gaps = 80/415 (19%)

Query: 64  DFEAQRHWMELTNHLPLSQWYWYDLQYWGLDYPPLTAYHSYVLGK-LGSLLNSEWFALLS 122
           D E  R+W+ LTN LPL  WY      W LDYPP  AY  +VL + + +++  +    + 
Sbjct: 93  DLEVHRNWLALTNKLPLLDWYREATSQWTLDYPPFFAYFEWVLSQFVPAVVRDDGCLDIV 152

Query: 123 SRGIENPDIKAYMRFTVILSEAGLYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQPSL 182
             G        ++R TVI +E  L++   ++                +I A++I   P  
Sbjct: 153 KEGKFGWPTVVFLRLTVIGTEILLFVVLQVFINT----SDESERTVNFIIASSIALSPGF 208

Query: 183 ILIDHGHFQYNSVMLGLTVYSINNLLDGYYGPAAICFVLSLCFKQMALYYSPVFFAYLLS 242
           +++DH HFQYN  +  + + SI       Y      F   LCFK + LY +P +F +LL 
Sbjct: 209 LIVDHMHFQYNGFLFAILIASIVAAKKERYLLCGAFFTTVLCFKHIFLYLAPAYFTFLLR 268

Query: 243 ECLISPS----------LNVPRF-----LSVAFSTVISFCII-FSPLYVFGGTKNVLQSI 286
             +++ S          + V R+     L V   ++++ C + F P+        + Q I
Sbjct: 269 AYVLNFSNFSFRTYRDLIFVVRWFNLLKLGVIIVSILAVCFVPFIPV--------LPQLI 320

Query: 287 HRIFPFSRGI--------------FEDKVANF---------WCVSNVLFK---------- 313
            R+FPFSRG+              F D++  F          C + ++            
Sbjct: 321 SRLFPFSRGLTHAYWAPNFWAVYAFMDRILTFIMLKMPYVHKCATKIVLPPLIPNSIEEI 380

Query: 314 ----YAQNYTQQELQRFSIIATAAGFLP--SFLVVLCYPKKHMIPF-----------ALA 356
                A NY  + L +  +        P  +F + L Y    +IP             L 
Sbjct: 381 KNRIGASNYGTRGLVQDILFIILPQVQPRLTFALTLFYQILAIIPVLFNPSFKRFIGCLT 440

Query: 357 ACSMAFFLFSFQVHEKSILVPLLPITLLYCSTDWNVLSMVSWINNVALFTLWPLL 411
            C  + FLF + VHEK+I++ ++P + L  S D  +L+    +      +L+PLL
Sbjct: 441 LCGFSSFLFGWHVHEKAIMLVIVPFSFL-VSMDRRLLTPFMLLTASGYVSLFPLL 494

>CAGL0A01914g Chr1 (195146..206377) [11232 bp, 3743 aa] {ON} highly
           similar to uniprot|P38811 Saccharomyces cerevisiae
           YHR099w TRA1
          Length = 3743

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 39/85 (45%), Gaps = 18/85 (21%)

Query: 12  FFASPLYDFLSPFRPVANQYYA---------------EYVIVIFALVIRCAVGLGSFSGE 56
           F  + +YD L  F P AN+Y                 E V+V+  L   C +GL  FS E
Sbjct: 596 FLKTVVYD-LKIFNPSANEYTLAHPKLWASVSRVFSYEEVLVLRDLFHECIIGLRFFSSE 654

Query: 57  NSGPIHGDFEAQRHWMELTNHLPLS 81
           N  P++ D  +++H+      LP+S
Sbjct: 655 N--PVNKDLLSKKHFDITMPSLPVS 677

>KAFR0B04590 Chr2 (954347..956197) [1851 bp, 616 aa] {ON} Anc_2.158
           YNL115C
          Length = 616

 Score = 31.6 bits (70), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 38/92 (41%), Gaps = 7/92 (7%)

Query: 280 KNVLQSIHRIF------PFSRGIFEDKVANFWCVSNVLFKYAQNYTQQELQRFSIIATAA 333
           +NV +  HR F             ED+ + F+   N  F+Y QNY +  L  +  I    
Sbjct: 53  RNVTKKSHRTFGSNGNGATDNASHEDRDSEFYANENGRFQYHQNY-RSFLTNWKCILNVV 111

Query: 334 GFLPSFLVVLCYPKKHMIPFALAACSMAFFLF 365
            FL + ++VL +   + I    A  +  F  F
Sbjct: 112 LFLNTLVLVLLFVSDYFIEILPADRNTTFTNF 143

>NDAI0F03120 Chr6 (754315..754998) [684 bp, 227 aa] {ON} Anc_2.111
           YNL158W
          Length = 227

 Score = 30.8 bits (68), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 31/53 (58%), Gaps = 3/53 (5%)

Query: 252 VPRFLSVAFSTVISFCII-FSPLYVFGGTKNVLQSIHRIFPFSRGIFEDKVAN 303
           +P F+ ++F  ++  CI  FS ++V   T+++L SI + FP +R   ED   N
Sbjct: 4   LPSFIRISFYLLL--CINGFSQIFVIANTESILISIPKDFPATRKKNEDSTIN 54

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.330    0.143    0.469 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 58,010,142
Number of extensions: 2562651
Number of successful extensions: 7171
Number of sequences better than 10.0: 56
Number of HSP's gapped: 7228
Number of HSP's successfully gapped: 75
Length of query: 536
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 422
Effective length of database: 40,409,475
Effective search space: 17052798450
Effective search space used: 17052798450
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 68 (30.8 bits)