Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_56.224336.21ON32232214440.0
KLTH0C11220g6.21ON32732710951e-150
SAKL0E01210g6.21ON32332110011e-136
Smik_15.1766.21ON3453308721e-116
YOR007C (SGT2)6.21ON3463308671e-115
Kpol_1037.266.21ON3423348661e-115
Skud_15.1686.21ON3483328621e-114
ZYRO0C07788g6.21ON3343188561e-114
TPHA0J003406.21ON3383378431e-112
TDEL0G044806.21ON3433318411e-111
Suva_15.1826.21ON3463308411e-111
NCAS0H008306.21ON3383358361e-110
KAFR0L004106.21ON3313348271e-109
Ecym_30256.21ON3183198211e-109
NDAI0D008106.21ON3493428191e-108
CAGL0E02739g6.21ON3433278141e-107
TBLA0G010506.21ON3503268051e-106
KNAG0M011706.21ON3393268031e-105
KLLA0D01155g6.21ON3353327931e-104
ACR005W6.21ON3273327185e-93
Kpol_1032.86.21ON3433265189e-63
NDAI0I022406.21ON3502193593e-39
NCAS0D026706.21ON3512413585e-39
TPHA0M002706.21ON3773613412e-36
TBLA0A072706.21ON3732482992e-30
CAGL0H08195g5.617ON5831102585e-24
Kwal_55.199355.617ON5931012542e-23
NDAI0F009105.617ON5831112427e-22
AEL224W5.617ON5801232401e-21
TPHA0D028805.617ON5851012401e-21
Smik_15.2055.617ON5891232373e-21
ZYRO0A05676g5.617ON5721102355e-21
KLTH0E02178g5.617ON5931122339e-21
Kpol_1018.695.617ON5901222331e-20
YOR027W (STI1)5.617ON5891232312e-20
SAKL0G07084g5.617ON5851232294e-20
TDEL0A048405.617ON5761172285e-20
NCAS0G008105.617ON5841002269e-20
KAFR0C058905.617ON5751002241e-19
Ecym_55825.617ON5841102214e-19
Skud_15.1925.617ON5891232206e-19
TBLA0E033005.617ON5821102197e-19
Suva_8.805.617ON5861102181e-18
KLLA0A07062g5.617ON5811102181e-18
KNAG0B032005.617ON5791012101e-17
NCAS0A00490singletonON620991887e-15
KAFR0B066103.481ON511961631e-11
TDEL0D055003.481ON5121021602e-11
AAR083C3.481ON5381211593e-11
YGR123C (PPT1)3.481ON513881584e-11
Skud_7.4323.481ON5131361584e-11
KLLA0F24046g2.152ON6041471576e-11
Smik_6.2153.481ON513841558e-11
KNAG0A079003.481ON512891541e-10
NCAS0F034903.481ON5121021513e-10
Suva_7.4083.481ON513851496e-10
SAKL0F03102g3.481ON513971471e-09
CAGL0D05060g3.481ON510831461e-09
Ecym_44133.481ON510761461e-09
TBLA0C039503.481ON5121201452e-09
NDAI0B057903.481ON523881443e-09
KNAG0A039508.506ON3861051406e-09
AGL268C8.506ON3791151397e-09
Kpol_505.413.481ON5131021381e-08
NCAS0B024008.506ON380991362e-08
TPHA0D032203.481ON5131481372e-08
CAGL0H07425g8.506ON380951362e-08
Kwal_33.147672.152ON594961353e-08
YBR155W (CNS1)8.506ON385921326e-08
CAGL0L04048g2.152ON5871611327e-08
Kwal_27.118908.506ON3341141309e-08
NDAI0C052908.506ON3791251301e-07
Smik_2.2958.506ON385921301e-07
KLTH0B05170g2.152ON593981283e-07
SAKL0H10934g8.506ON3801021254e-07
Suva_4.4058.506ON385921254e-07
KAFR0E029808.506ON380921229e-07
NCAS0G024802.152ON596831239e-07
NDAI0F028102.152ON609891231e-06
Ecym_82042.152ON597871221e-06
ABR131W2.152ON594891221e-06
TBLA0C055302.152ON610721202e-06
YHR117W (TOM71)2.152ON639951202e-06
TDEL0B013108.506ON380991183e-06
ZYRO0B04224g3.481ON5131081193e-06
NCAS0B070102.152ON6251111193e-06
KLTH0F14542g3.481ON5131041183e-06
NDAI0B043402.152ON6641011176e-06
ZYRO0F08624g8.506ON3791121157e-06
Kwal_55.211753.481ON5111041158e-06
Suva_15.3142.152ON6441311151e-05
KLLA0B10912g3.481ON512751141e-05
Skud_8.1782.152ON638891132e-05
Skud_2.2828.506ON385891122e-05
KLLA0B09966g8.506ON3701331122e-05
SAKL0E10956g2.152ON600981122e-05
Ecym_25598.506ON370991104e-05
Ecym_20906.328ON172551064e-05
TPHA0L014208.506ON374921094e-05
Kpol_513.28.506ON374951095e-05
SAKL0A01672g6.328ON128631018e-05
KNAG0I025206.328ON117901009e-05
Smik_8.1952.152ON6351611071e-04
CAGL0L12936g2.152ON6001401061e-04
KLTH0E11748g8.506ON3781171042e-04
TPHA0I015102.152ON6031101033e-04
KAFR0F007202.152ON608711014e-04
TDEL0B051402.152ON599741016e-04
NCAS0E024907.412ON809971016e-04
ADR230W5.689ON685711007e-04
YNL121C (TOM70)2.152ON6171081008e-04
ZYRO0G06512g2.152ON60472998e-04
KNAG0H035302.152ON61482990.001
KAFR0J025706.328ON12162910.002
Skud_14.2112.152ON617108970.002
TBLA0H033808.506ON375105950.002
Smik_14.2072.152ON617108960.002
Kpol_1018.1067.412ON75391950.003
NCAS0A147707.458ON300133930.004
Suva_14.2192.152ON617126930.005
Kpol_1048.212.152ON59786930.005
SAKL0E14542g5.689ON69062930.006
Kpol_1028.516.328ON11786860.006
KLLA0C08910g6.328ON11553860.007
TBLA0I023106.328ON11663850.008
TBLA0H019705.352ON840132900.011
AAR054C6.328ON13364840.018
KNAG0H006103.367ON973104890.019
NDAI0I004406.328ON12867820.023
NDAI0C051308.470ON590100870.027
Smik_2.367.412ON75199870.030
Suva_2.347.412ON76399870.030
YCR060W (TAH1)6.328ON11191810.032
YBL084C (CDC27)7.412ON75899860.033
TPHA0E007407.412ON74697850.045
Kpol_1043.605.689ON70697850.050
KNAG0A041208.470ON602102850.051
NDAI0E040407.412ON78397840.071
ZYRO0B03828g7.412ON72791840.072
TPHA0D038606.328ON12099780.079
AGL294W7.412ON656106830.089
Smik_2.2543.367ON1020103830.093
Suva_4.3613.367ON963103820.11
Ecym_71427.412ON675111820.11
CAGL0H07095g5.352ON661150820.12
KLTH0C06204g7.412ON62797810.14
TDEL0A074306.328ON12458760.14
YBR112C (CYC8)3.367ON966103810.15
Skud_2.2403.367ON984103810.16
KLLA0E20857g7.412ON71087800.19
CAGL0K11209g8.470ON59092790.23
NCAS0B025608.470ON578101790.23
KLLA0E22705g1.456ON389115780.26
Smik_3.1596.328ON11572740.27
Kwal_34.160921.456ON395129780.28
KLTH0F18150g5.689ON689104780.34
SAKL0D11110g1.456ON432125770.35
NDAI0F004005.689ON76469780.36
TBLA0D004607.412ON83597770.41
Skud_4.5068.470ON611133760.53
Skud_2.247.412ON76999760.56
Ecym_40315.689ON68871760.61
ZYRO0F00374g6.4ON618129750.67
YDR244W (PEX5)8.470ON61295740.89
CAGL0K09240g6.328ON14275710.91
KNAG0F027105.268ON47199731.2
KNAG0B022407.412ON739109731.2
Suva_2.4108.470ON611111731.2
Smik_4.4918.470ON61249731.3
Kwal_55.218395.689ON690104731.5
Kpol_172.23.367ON418103711.9
YKL022C (CDC16)2.665ON84066722.1
AFR453W8.470ON56993712.4
KLLA0C15455g8.470ON56688702.7
Suva_11.2042.665ON79364702.9
YPL269W (KAR9)6.4ON644153702.9
ZYRO0C16522g3.367ON974103703.2
Kpol_520.67.458ON292111693.2
TDEL0C027207.412ON70099703.3
NCAS0D045006.328ON12152663.3
KLLA0D13662g7.149ON654100693.9
TBLA0C015901.456ON408114684.5
Kpol_1067.251.456ON391133684.8
SAKL0F16236g7.546ON140851695.0
Ecym_13968.470ON57376685.0
NDAI0D018205.268ON46692685.0
KLLA0D09020g3.395ON53030685.2
Kwal_23.36703.367ON802103685.4
KLTH0F10428g3.367ON795103676.5
SAKL0G11088g5.268ON49483676.8
SAKL0F12936g7.412ON63291677.1
SAKL0B07986g3.367ON880103677.6
KLTH0F16522g5.413ON36465667.8
TDEL0C050903.367ON759103678.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_56.22433
         (322 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_56.22433 s56 complement(124778..125746) [969 bp, 322 aa] {O...   560   0.0  
KLTH0C11220g Chr3 (920972..921955) [984 bp, 327 aa] {ON} similar...   426   e-150
SAKL0E01210g Chr5 complement(93267..94238) [972 bp, 323 aa] {ON}...   390   e-136
Smik_15.176 Chr15 complement(306259..307296) [1038 bp, 345 aa] {...   340   e-116
YOR007C Chr15 complement(338938..339978) [1041 bp, 346 aa] {ON} ...   338   e-115
Kpol_1037.26 s1037 complement(59590..60618) [1029 bp, 342 aa] {O...   338   e-115
Skud_15.168 Chr15 complement(298955..300001) [1047 bp, 348 aa] {...   336   e-114
ZYRO0C07788g Chr3 (589880..590884) [1005 bp, 334 aa] {ON} simila...   334   e-114
TPHA0J00340 Chr10 complement(76166..77182) [1017 bp, 338 aa] {ON...   329   e-112
TDEL0G04480 Chr7 (813648..814679) [1032 bp, 343 aa] {ON} Anc_6.2...   328   e-111
Suva_15.182 Chr15 complement(313413..314453) [1041 bp, 346 aa] {...   328   e-111
NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {O...   326   e-110
KAFR0L00410 Chr12 complement(75459..76454) [996 bp, 331 aa] {ON}...   323   e-109
Ecym_3025 Chr3 complement(50289..51245) [957 bp, 318 aa] {ON} si...   320   e-109
NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {O...   320   e-108
CAGL0E02739g Chr5 complement(259023..260054) [1032 bp, 343 aa] {...   318   e-107
TBLA0G01050 Chr7 complement(262407..263459) [1053 bp, 350 aa] {O...   314   e-106
KNAG0M01170 Chr13 complement(211476..212495) [1020 bp, 339 aa] {...   313   e-105
KLLA0D01155g Chr4 complement(104847..105854) [1008 bp, 335 aa] {...   310   e-104
ACR005W Chr3 (363355..364338) [984 bp, 327 aa] {ON} Syntenic hom...   281   5e-93
Kpol_1032.8 s1032 complement(15762..16793) [1032 bp, 343 aa] {ON...   204   9e-63
NDAI0I02240 Chr9 (512140..513192) [1053 bp, 350 aa] {ON} Anc_6.2...   142   3e-39
NCAS0D02670 Chr4 complement(512529..513584) [1056 bp, 351 aa] {O...   142   5e-39
TPHA0M00270 Chr13 complement(53640..54773) [1134 bp, 377 aa] {ON...   135   2e-36
TBLA0A07270 Chr1 complement(1811640..1812761) [1122 bp, 373 aa] ...   119   2e-30
CAGL0H08195g Chr8 complement(804418..806169) [1752 bp, 583 aa] {...   103   5e-24
Kwal_55.19935 s55 (182767..184548) [1782 bp, 593 aa] {ON} YOR027...   102   2e-23
NDAI0F00910 Chr6 complement(223205..224956) [1752 bp, 583 aa] {ON}     98   7e-22
AEL224W Chr5 (207712..209454) [1743 bp, 580 aa] {ON} Syntenic ho...    97   1e-21
TPHA0D02880 Chr4 (599288..601045) [1758 bp, 585 aa] {ON} Anc_5.6...    97   1e-21
Smik_15.205 Chr15 (346899..348668) [1770 bp, 589 aa] {ON} YOR027...    96   3e-21
ZYRO0A05676g Chr1 (459999..461717) [1719 bp, 572 aa] {ON} highly...    95   5e-21
KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly...    94   9e-21
Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON} (1971...    94   1e-20
YOR027W Chr15 (381053..382822) [1770 bp, 589 aa] {ON}  STI1Hsp90...    94   2e-20
SAKL0G07084g Chr7 (580004..581761) [1758 bp, 585 aa] {ON} highly...    93   4e-20
TDEL0A04840 Chr1 (851520..853250) [1731 bp, 576 aa] {ON} Anc_5.6...    92   5e-20
NCAS0G00810 Chr7 complement(138192..139946) [1755 bp, 584 aa] {O...    92   9e-20
KAFR0C05890 Chr3 (1165932..1167659) [1728 bp, 575 aa] {ON} Anc_5...    91   1e-19
Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {O...    90   4e-19
Skud_15.192 Chr15 (340847..342616) [1770 bp, 589 aa] {ON} YOR027...    89   6e-19
TBLA0E03300 Chr5 complement(827677..829425) [1749 bp, 582 aa] {O...    89   7e-19
Suva_8.80 Chr8 (142691..144451) [1761 bp, 586 aa] {ON} YOR027W (...    89   1e-18
KLLA0A07062g Chr1 complement(636546..638291) [1746 bp, 581 aa] {...    89   1e-18
KNAG0B03200 Chr2 complement(619530..621269) [1740 bp, 579 aa] {O...    86   1e-17
NCAS0A00490 Chr1 complement(76652..78514) [1863 bp, 620 aa] {ON}       77   7e-15
KAFR0B06610 Chr2 (1372434..1373969) [1536 bp, 511 aa] {ON} Anc_3...    67   1e-11
TDEL0D05500 Chr4 complement(991567..993105) [1539 bp, 512 aa] {O...    66   2e-11
AAR083C Chr1 complement(492375..493991) [1617 bp, 538 aa] {ON} S...    66   3e-11
YGR123C Chr7 complement(736662..738203) [1542 bp, 513 aa] {ON}  ...    65   4e-11
Skud_7.432 Chr7 complement(715852..717393) [1542 bp, 513 aa] {ON...    65   4e-11
KLLA0F24046g Chr6 (2240454..2242268) [1815 bp, 604 aa] {ON} simi...    65   6e-11
Smik_6.215 Chr6 complement(354154..355695) [1542 bp, 513 aa] {ON...    64   8e-11
KNAG0A07900 Chr1 complement(1258164..1259702) [1539 bp, 512 aa] ...    64   1e-10
NCAS0F03490 Chr6 complement(698757..700295) [1539 bp, 512 aa] {O...    63   3e-10
Suva_7.408 Chr7 complement(706942..708483) [1542 bp, 513 aa] {ON...    62   6e-10
SAKL0F03102g Chr6 (258266..259807) [1542 bp, 513 aa] {ON} highly...    61   1e-09
CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {...    61   1e-09
Ecym_4413 Chr4 complement(856330..857862) [1533 bp, 510 aa] {ON}...    61   1e-09
TBLA0C03950 Chr3 complement(950339..951877) [1539 bp, 512 aa] {O...    60   2e-09
NDAI0B05790 Chr2 complement(1406039..1407610) [1572 bp, 523 aa] ...    60   3e-09
KNAG0A03950 Chr1 complement(529620..530780) [1161 bp, 386 aa] {O...    59   6e-09
AGL268C Chr7 complement(205872..207011) [1140 bp, 379 aa] {ON} S...    58   7e-09
Kpol_505.41 s505 complement(91130..92671) [1542 bp, 513 aa] {ON}...    58   1e-08
NCAS0B02400 Chr2 complement(402763..403905) [1143 bp, 380 aa] {O...    57   2e-08
TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {O...    57   2e-08
CAGL0H07425g Chr8 (725307..726449) [1143 bp, 380 aa] {ON} highly...    57   2e-08
Kwal_33.14767 s33 complement(809994..811778) [1785 bp, 594 aa] {...    57   3e-08
YBR155W Chr2 (549771..550928) [1158 bp, 385 aa] {ON}  CNS1TPR-co...    55   6e-08
CAGL0L04048g Chr12 (476407..478170) [1764 bp, 587 aa] {ON} simil...    55   7e-08
Kwal_27.11890 s27 (990685..991689) [1005 bp, 334 aa] {ON} YBR155...    55   9e-08
NDAI0C05290 Chr3 (1224979..1226118) [1140 bp, 379 aa] {ON} Anc_8...    55   1e-07
Smik_2.295 Chr2 (535786..536943) [1158 bp, 385 aa] {ON} YBR155W ...    55   1e-07
KLTH0B05170g Chr2 (427608..429389) [1782 bp, 593 aa] {ON} simila...    54   3e-07
SAKL0H10934g Chr8 complement(945834..946976) [1143 bp, 380 aa] {...    53   4e-07
Suva_4.405 Chr4 (719015..720172) [1158 bp, 385 aa] {ON} YBR155W ...    53   4e-07
KAFR0E02980 Chr5 (596891..598033) [1143 bp, 380 aa] {ON} Anc_8.5...    52   9e-07
NCAS0G02480 Chr7 complement(440105..441895) [1791 bp, 596 aa] {O...    52   9e-07
NDAI0F02810 Chr6 (690977..692806) [1830 bp, 609 aa] {ON} Anc_2.1...    52   1e-06
Ecym_8204 Chr8 complement(419900..421693) [1794 bp, 597 aa] {ON}...    52   1e-06
ABR131W Chr2 (641631..643415) [1785 bp, 594 aa] {ON} Syntenic ho...    52   1e-06
TBLA0C05530 Chr3 complement(1338666..1340498) [1833 bp, 610 aa] ...    51   2e-06
YHR117W Chr8 (342349..344268) [1920 bp, 639 aa] {ON}  TOM71Mitoc...    51   2e-06
TDEL0B01310 Chr2 complement(234307..235449) [1143 bp, 380 aa] {O...    50   3e-06
ZYRO0B04224g Chr2 (350069..351610) [1542 bp, 513 aa] {ON} highly...    50   3e-06
NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON} Anc_2...    50   3e-06
KLTH0F14542g Chr6 complement(1191800..1193341) [1542 bp, 513 aa]...    50   3e-06
NDAI0B04340 Chr2 (1087851..1089845) [1995 bp, 664 aa] {ON} Anc_2...    50   6e-06
ZYRO0F08624g Chr6 (691992..693131) [1140 bp, 379 aa] {ON} simila...    49   7e-06
Kwal_55.21175 s55 complement(716457..717992) [1536 bp, 511 aa] {...    49   8e-06
Suva_15.314 Chr15 (544646..546580) [1935 bp, 644 aa] {ON} YHR117...    49   1e-05
KLLA0B10912g Chr2 (955948..957486) [1539 bp, 512 aa] {ON} simila...    49   1e-05
Skud_8.178 Chr8 (316128..318044) [1917 bp, 638 aa] {ON} YHR117W ...    48   2e-05
Skud_2.282 Chr2 (517201..518358) [1158 bp, 385 aa] {ON} YBR155W ...    48   2e-05
KLLA0B09966g Chr2 complement(872760..873872) [1113 bp, 370 aa] {...    48   2e-05
SAKL0E10956g Chr5 (916623..918425) [1803 bp, 600 aa] {ON} simila...    48   2e-05
Ecym_2559 Chr2 (1089202..1090314) [1113 bp, 370 aa] {ON} similar...    47   4e-05
Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON} ...    45   4e-05
TPHA0L01420 Chr12 (293980..295104) [1125 bp, 374 aa] {ON} Anc_8....    47   4e-05
Kpol_513.2 s513 (1962..3086) [1125 bp, 374 aa] {ON} (1962..3086)...    47   5e-05
SAKL0A01672g Chr1 complement(154932..155318) [387 bp, 128 aa] {O...    44   8e-05
KNAG0I02520 Chr9 complement(487699..488052) [354 bp, 117 aa] {ON...    43   9e-05
Smik_8.195 Chr8 (318688..320595) [1908 bp, 635 aa] {ON} YHR117W ...    46   1e-04
CAGL0L12936g Chr12 (1382623..1384425) [1803 bp, 600 aa] {ON} sim...    45   1e-04
KLTH0E11748g Chr5 (1043203..1044339) [1137 bp, 378 aa] {ON} simi...    45   2e-04
TPHA0I01510 Chr9 complement(342661..344472) [1812 bp, 603 aa] {O...    44   3e-04
KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {O...    44   4e-04
TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {O...    44   6e-04
NCAS0E02490 Chr5 complement(493779..496208) [2430 bp, 809 aa] {O...    44   6e-04
ADR230W Chr4 (1103275..1105332) [2058 bp, 685 aa] {ON} Syntenic ...    43   7e-04
YNL121C Chr14 complement(398684..400537) [1854 bp, 617 aa] {ON} ...    43   8e-04
ZYRO0G06512g Chr7 complement(515759..517573) [1815 bp, 604 aa] {...    43   8e-04
KNAG0H03530 Chr8 (657450..659294) [1845 bp, 614 aa] {ON} Anc_2.1...    43   0.001
KAFR0J02570 Chr10 (488372..488737) [366 bp, 121 aa] {ON} Anc_6.3...    40   0.002
Skud_14.211 Chr14 complement(388749..390602) [1854 bp, 617 aa] {...    42   0.002
TBLA0H03380 Chr8 (829314..830441) [1128 bp, 375 aa] {ON} Anc_8.5...    41   0.002
Smik_14.207 Chr14 complement(378339..380192) [1854 bp, 617 aa] {...    42   0.002
Kpol_1018.106 s1018 (280224..282485) [2262 bp, 753 aa] {ON} (280...    41   0.003
NCAS0A14770 Chr1 complement(2911657..2912559) [903 bp, 300 aa] {...    40   0.004
Suva_14.219 Chr14 complement(395316..397169) [1854 bp, 617 aa] {...    40   0.005
Kpol_1048.21 s1048 complement(67975..69768) [1794 bp, 597 aa] {O...    40   0.005
SAKL0E14542g Chr5 (1199439..1201511) [2073 bp, 690 aa] {ON} weak...    40   0.006
Kpol_1028.51 s1028 complement(123535..123888) [354 bp, 117 aa] {...    38   0.006
KLLA0C08910g Chr3 complement(781726..782073) [348 bp, 115 aa] {O...    38   0.007
TBLA0I02310 Chr9 (528067..528417) [351 bp, 116 aa] {ON} Anc_6.32...    37   0.008
TBLA0H01970 Chr8 (464239..466761) [2523 bp, 840 aa] {ON} Anc_5.3...    39   0.011
AAR054C Chr1 complement(440706..441107) [402 bp, 133 aa] {ON} Sy...    37   0.018
KNAG0H00610 Chr8 (99931..102852) [2922 bp, 973 aa] {ON} Anc_3.36...    39   0.019
NDAI0I00440 Chr9 complement(89650..90036) [387 bp, 128 aa] {ON} ...    36   0.023
NDAI0C05130 Chr3 (1193350..1195122) [1773 bp, 590 aa] {ON} Anc_8...    38   0.027
Smik_2.36 Chr2 complement(61159..63414) [2256 bp, 751 aa] {ON} Y...    38   0.030
Suva_2.34 Chr2 complement(63832..65304,65365..66183) [2292 bp, 7...    38   0.030
YCR060W Chr3 (224399..224734) [336 bp, 111 aa] {ON}  TAH1Compone...    36   0.032
YBL084C Chr2 complement(67169..69445) [2277 bp, 758 aa] {ON}  CD...    38   0.033
TPHA0E00740 Chr5 complement(142456..144696) [2241 bp, 746 aa] {O...    37   0.045
Kpol_1043.60 s1043 (123502..125622) [2121 bp, 706 aa] {ON} (1235...    37   0.050
KNAG0A04120 Chr1 complement(556919..558727) [1809 bp, 602 aa] {O...    37   0.051
NDAI0E04040 Chr5 (900685..903036) [2352 bp, 783 aa] {ON} Anc_7.4...    37   0.071
ZYRO0B03828g Chr2 (318153..320336) [2184 bp, 727 aa] {ON} simila...    37   0.072
TPHA0D03860 Chr4 (807913..808275) [363 bp, 120 aa] {ON} Anc_6.32...    35   0.079
AGL294W Chr7 (154711..156681) [1971 bp, 656 aa] {ON} Syntenic ho...    37   0.089
Smik_2.254 Chr2 complement(447517..450579) [3063 bp, 1020 aa] {O...    37   0.093
Suva_4.361 Chr4 complement(631697..632812,632933..633154,633188....    36   0.11 
Ecym_7142 Chr7 complement(287110..289137) [2028 bp, 675 aa] {ON}...    36   0.11 
CAGL0H07095g Chr8 (700262..702247) [1986 bp, 661 aa] {ON} simila...    36   0.12 
KLTH0C06204g Chr3 complement(538533..540416) [1884 bp, 627 aa] {...    36   0.14 
TDEL0A07430 Chr1 (1296631..1297005) [375 bp, 124 aa] {ON} Anc_6....    34   0.14 
YBR112C Chr2 complement(462870..465770) [2901 bp, 966 aa] {ON}  ...    36   0.15 
Skud_2.240 Chr2 complement(431507..434461) [2955 bp, 984 aa] {ON...    36   0.16 
KLLA0E20857g Chr5 (1860517..1862649) [2133 bp, 710 aa] {ON} simi...    35   0.19 
CAGL0K11209g Chr11 (1089300..1091072) [1773 bp, 590 aa] {ON} sim...    35   0.23 
NCAS0B02560 Chr2 complement(427447..429183) [1737 bp, 578 aa] {O...    35   0.23 
KLLA0E22705g Chr5 complement(2027229..2028398) [1170 bp, 389 aa]...    35   0.26 
Smik_3.159 Chr3 (222475..222822) [348 bp, 115 aa] {ON} YCR060W (...    33   0.27 
Kwal_34.16092 s34 complement(198730..199917) [1188 bp, 395 aa] {...    35   0.28 
KLTH0F18150g Chr6 (1462613..1464682) [2070 bp, 689 aa] {ON} weak...    35   0.34 
SAKL0D11110g Chr4 (920630..921928) [1299 bp, 432 aa] {ON} simila...    34   0.35 
NDAI0F00400 Chr6 complement(96274..98568) [2295 bp, 764 aa] {ON}...    35   0.36 
TBLA0D00460 Chr4 complement(113831..116338) [2508 bp, 835 aa] {O...    34   0.41 
Skud_4.506 Chr4 (905143..906978) [1836 bp, 611 aa] {ON} YDR244W ...    34   0.53 
Skud_2.24 Chr2 complement(50790..53099) [2310 bp, 769 aa] {ON} Y...    34   0.56 
Ecym_4031 Chr4 complement(73900..75966) [2067 bp, 688 aa] {ON} s...    34   0.61 
ZYRO0F00374g Chr6 complement(37241..39097) [1857 bp, 618 aa] {ON...    33   0.67 
YDR244W Chr4 (950563..952401) [1839 bp, 612 aa] {ON}  PEX5Peroxi...    33   0.89 
CAGL0K09240g Chr11 complement(914042..914470) [429 bp, 142 aa] {...    32   0.91 
KNAG0F02710 Chr6 (509609..511024) [1416 bp, 471 aa] {ON} Anc_5.2...    33   1.2  
KNAG0B02240 Chr2 complement(434466..436685) [2220 bp, 739 aa] {O...    33   1.2  
Suva_2.410 Chr2 (729992..731827) [1836 bp, 611 aa] {ON} YDR244W ...    33   1.2  
Smik_4.491 Chr4 (895429..897267) [1839 bp, 612 aa] {ON} YDR244W ...    33   1.3  
Kwal_55.21839 s55 (998426..1000498) [2073 bp, 690 aa] {ON} YOR08...    33   1.5  
Kpol_172.2 s172 (4270..5523) [1254 bp, 418 aa] {ON} (4270..5523)...    32   1.9  
YKL022C Chr11 complement(394726..397248) [2523 bp, 840 aa] {ON} ...    32   2.1  
AFR453W Chr6 (1251460..1253169) [1710 bp, 569 aa] {ON} Syntenic ...    32   2.4  
KLLA0C15455g Chr3 (1341570..1343270) [1701 bp, 566 aa] {ON} simi...    32   2.7  
Suva_11.204 Chr11 complement(378512..380893) [2382 bp, 793 aa] {...    32   2.9  
YPL269W Chr16 (33013..34947) [1935 bp, 644 aa] {ON}  KAR9Karyoga...    32   2.9  
ZYRO0C16522g Chr3 complement(1281166..1284090) [2925 bp, 974 aa]...    32   3.2  
Kpol_520.6 s520 (15903..16781) [879 bp, 292 aa] {ON} (15903..167...    31   3.2  
TDEL0C02720 Chr3 (477529..479631) [2103 bp, 700 aa] {ON} Anc_7.4...    32   3.3  
NCAS0D04500 Chr4 (855490..855855) [366 bp, 121 aa] {ON} Anc_6.32...    30   3.3  
KLLA0D13662g Chr4 complement(1178179..1180143) [1965 bp, 654 aa]...    31   3.9  
TBLA0C01590 Chr3 complement(370571..371797) [1227 bp, 408 aa] {O...    31   4.5  
Kpol_1067.25 s1067 (57301..58476) [1176 bp, 391 aa] {ON} (57301....    31   4.8  
SAKL0F16236g Chr6 (1313573..1317799) [4227 bp, 1408 aa] {ON} sim...    31   5.0  
Ecym_1396 Chr1 (820413..822134) [1722 bp, 573 aa] {ON} similar t...    31   5.0  
NDAI0D01820 Chr4 (422414..423814) [1401 bp, 466 aa] {ON} Anc_5.268     31   5.0  
KLLA0D09020g Chr4 (758818..760410) [1593 bp, 530 aa] {ON} simila...    31   5.2  
Kwal_23.3670 s23 (387536..389944) [2409 bp, 802 aa] {ON} YBR112C...    31   5.4  
KLTH0F10428g Chr6 (902697..905084) [2388 bp, 795 aa] {ON} highly...    30   6.5  
SAKL0G11088g Chr7 (940673..942157) [1485 bp, 494 aa] {ON} simila...    30   6.8  
SAKL0F12936g Chr6 (1016829..1018727) [1899 bp, 632 aa] {ON} simi...    30   7.1  
SAKL0B07986g Chr2 complement(675999..678641) [2643 bp, 880 aa] {...    30   7.6  
KLTH0F16522g Chr6 complement(1340683..1341777) [1095 bp, 364 aa]...    30   7.8  
TDEL0C05090 Chr3 complement(908033..910312) [2280 bp, 759 aa] {O...    30   8.1  

>Kwal_56.22433 s56 complement(124778..125746) [969 bp, 322 aa] {ON}
           YOR007C (SGT2) - small glutamine-rich tetratricopeptide
           repeat containing protein [contig 185] FULL
          Length = 322

 Score =  560 bits (1444), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/322 (90%), Positives = 293/322 (90%)

Query: 1   MSPSNKDLANLIVDFLSHTVENKEVSEDYVDSLNVAIDCITEAFEFDRESVATTLEKTFA 60
           MSPSNKDLANLIVDFLSHTVENKEVSEDYVDSLNVAIDCITEAFEFDRESVATTLEKTFA
Sbjct: 1   MSPSNKDLANLIVDFLSHTVENKEVSEDYVDSLNVAIDCITEAFEFDRESVATTLEKTFA 60

Query: 61  GRSLKQVVEAASVGSSSPQESVKVNIPVEDAETKAKAESLKLEGNKAMAAKDFEQAVLKY 120
           GRSLKQVVEAASVGSSSPQESVKVNIPVEDAETKAKAESLKLEGNKAMAAKDFEQAVLKY
Sbjct: 61  GRSLKQVVEAASVGSSSPQESVKVNIPVEDAETKAKAESLKLEGNKAMAAKDFEQAVLKY 120

Query: 121 SEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAEDAIKVNPSYSKGYSRLGFAQYALGK 180
           SEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAEDAIKVNPSYSKGYSRLGFAQYALGK
Sbjct: 121 SEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAEDAIKVNPSYSKGYSRLGFAQYALGK 180

Query: 181 PEEALDAYKKVLDIEGEAATDAMKRDYDTAMKKVGQSLNVEKSAPAATRDGAGSATGSGG 240
           PEEALDAYKKVLDIEGEAATDAMKRDYDTAMKKVGQSLNVEKSAPAATRDGAGSATGSGG
Sbjct: 181 PEEALDAYKKVLDIEGEAATDAMKRDYDTAMKKVGQSLNVEKSAPAATRDGAGSATGSGG 240

Query: 241 LPDISSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVMNNPAVKQMAEKFQSGGGTPSM 300
           LPDISSM                             EVMNNPAVKQMAEKFQSGGGTPSM
Sbjct: 241 LPDISSMLGGGLGGLLNNPQLMQAAQQMMQNPNAMQEVMNNPAVKQMAEKFQSGGGTPSM 300

Query: 301 ADLMNNPALMDMAKNMFGGGKQ 322
           ADLMNNPALMDMAKNMFGGGKQ
Sbjct: 301 ADLMNNPALMDMAKNMFGGGKQ 322

>KLTH0C11220g Chr3 (920972..921955) [984 bp, 327 aa] {ON} similar to
           uniprot|Q12118 Saccharomyces cerevisiae YOR007C SGT2
           Glutamine-rich cytoplasmic protein of unknown function
           contains tetratricopeptide (TPR) repeats which often
           mediate protein-protein interactions conserved in human
           and C. elegans
          Length = 327

 Score =  426 bits (1095), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 221/327 (67%), Positives = 259/327 (79%), Gaps = 5/327 (1%)

Query: 1   MSPSNKDLANLIVDFLSHTVENKEVSEDYVDSLNVAIDCITEAFEFDRESVATTLEKTFA 60
           M+P+ K+LA+LI+D+L  T E KE+ EDY+DSLNVAIDC+TEAFE ++ES ++ +EK+F 
Sbjct: 1   MNPTKKELASLIIDYLCRTAEGKEIGEDYIDSLNVAIDCVTEAFEVEKESASSVIEKSFG 60

Query: 61  GRSLKQVVEAASVG-SSSPQESVKVNIPVEDAETKAKAESLKLEGNKAMAAKDFEQAVLK 119
           G+SL+Q+V A+S G +++ QE VKVNIPVEDAE KAKAE+LKLEGNKAMA KDFE A+ K
Sbjct: 61  GQSLEQIVGASSKGPTATQQEPVKVNIPVEDAEIKAKAEALKLEGNKAMATKDFEHAISK 120

Query: 120 YSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAEDAIKVNPSYSKGYSRLGFAQYALG 179
           YSEAI+ LP+NAVY+ANRAAA+SSLKKY EAV+DAE AIKVNPSYSKGYSRLGFAQYALG
Sbjct: 121 YSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRLGFAQYALG 180

Query: 180 KPEEALDAYKKVLDIEGEAATDAMKRDYDTAMKKVGQSLNVEKSAPAATRDGAGSATGSG 239
           +PEEALDAYKKVLDIEG  ATDAMKRDYDTAMKKV QSLNVE+SAPAA+   +  A G  
Sbjct: 181 RPEEALDAYKKVLDIEGSNATDAMKRDYDTAMKKVEQSLNVERSAPAASNAESPDAAGGS 240

Query: 240 GLPDISSMXXXXXXXXXXXX----XXXXXXXXXXXXXXXXXEVMNNPAVKQMAEKFQSGG 295
           G PDI+SM                                 E+M+NPA+KQMA+KFQSGG
Sbjct: 241 GFPDIASMLGGGLGGGLGGLLKNPQVMQAAQQMMQNPNAMQEMMSNPAIKQMADKFQSGG 300

Query: 296 GTPSMADLMNNPALMDMAKNMFGGGKQ 322
           GTPSMADLMNNPALMDMAKNMFGG KQ
Sbjct: 301 GTPSMADLMNNPALMDMAKNMFGGPKQ 327

>SAKL0E01210g Chr5 complement(93267..94238) [972 bp, 323 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007C SGT2 Glutamine-rich cytoplasmic protein of
           unknown function contains tetratricopeptide (TPR)
           repeats which often mediate protein-protein interactions
           conserved in human and C. elegans
          Length = 323

 Score =  390 bits (1001), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 196/321 (61%), Positives = 241/321 (75%), Gaps = 3/321 (0%)

Query: 1   MSPSNKDLANLIVDFLSHTVENKEVSEDYVDSLNVAIDCITEAFEFDRESVATTLEKTFA 60
           M+ SNK++A LIVDFLS TVE   VSEDY DSLNVAIDCI+EAFEF+R++V+  ++ +F 
Sbjct: 1   MAQSNKEIAALIVDFLSSTVEKNAVSEDYADSLNVAIDCISEAFEFERDAVSEIVKNSFD 60

Query: 61  GRSLKQVVEAASVGSSSPQESVKVNIPVEDAETKAKAESLKLEGNKAMAAKDFEQAVLKY 120
            R L +++++A+    +  E VKVNIP EDA TKAKAE LKL+GNKAMA+KDFE A+ KY
Sbjct: 61  NRKLDELLKSAATALPTQSEPVKVNIPAEDANTKAKAEDLKLQGNKAMASKDFETAIKKY 120

Query: 121 SEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAEDAIKVNPSYSKGYSRLGFAQYALGK 180
           +EAI+VLP+NAVYYANRAAA+SSLKKYEE+V+DAE AIKVNPSYSKGYSRLGFA+YALGK
Sbjct: 121 TEAIEVLPSNAVYYANRAAAYSSLKKYEESVQDAESAIKVNPSYSKGYSRLGFAKYALGK 180

Query: 181 PEEALDAYKKVLDIEGEAATDAMKRDYDTAMKKVGQSLNVEKSAPAATRDGAGSA---TG 237
           PEEAL+AYK VLDIEG+ ATD MKRDY+TA +KV QSLN+EKS P  T +   S     G
Sbjct: 181 PEEALEAYKTVLDIEGDKATDVMKRDYETAKRKVEQSLNLEKSVPTQTDEQESSTDAGAG 240

Query: 238 SGGLPDISSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVMNNPAVKQMAEKFQSGGGT 297
           + G PD++S+                             E+M NPAV+QMAE F SGGGT
Sbjct: 241 ASGFPDMASLLGGGLGGLLNNPQVMSAAQKLMQNPGAMDEMMKNPAVRQMAENFSSGGGT 300

Query: 298 PSMADLMNNPALMDMAKNMFG 318
           P++ DLM+NPA+ DMAKN+FG
Sbjct: 301 PNLGDLMSNPAIKDMAKNLFG 321

>Smik_15.176 Chr15 complement(306259..307296) [1038 bp, 345 aa] {ON}
           YOR007C (REAL)
          Length = 345

 Score =  340 bits (872), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 179/330 (54%), Positives = 235/330 (71%), Gaps = 11/330 (3%)

Query: 1   MSPSNKDLANLIVDFLSHTVENKEVSEDYVDSLNVAIDCITEAFEFDRESVATTLEKT-F 59
           M  S +++A LIV++ S  VE KE+SED  DSLNVA+DCI+EAF F+R++ +  L K+ F
Sbjct: 1   MLASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFERDAASGILGKSEF 60

Query: 60  AGRSLKQVVEAASVGSSSPQ----ESVKVNIPVEDAETKAKAESLKLEGNKAMAAKDFEQ 115
            G+SL  V+ +AS  S S +    ++V+VNIP EDAETKAKAE LK++GNKAMA KD+E 
Sbjct: 61  KGKSLADVLNSASKASESNEKDDAQNVEVNIPEEDAETKAKAEDLKMQGNKAMANKDYEL 120

Query: 116 AVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAEDAIKVNPSYSKGYSRLGFAQ 175
           A+ KY+EAIQVLPTNA+YYANRAAAHSSL++Y+EAVKDAE +I ++PSY +GYSRLGFA+
Sbjct: 121 AINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISIDPSYFRGYSRLGFAK 180

Query: 176 YALGKPEEALDAYKKVLDIEGEAATDAMKRDYDTAMKKVGQSLNVEKSAPAATRDGAGSA 235
           YA GKPEEAL+AYKKVLDIEG+ AT+AMKRDY++A KKV QSLN+EK+ P  +RD   +A
Sbjct: 181 YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKAVPEQSRDADANA 240

Query: 236 TGSGG------LPDISSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVMNNPAVKQMAE 289
           +   G      L  +                                ++M +P+++QMAE
Sbjct: 241 SQGAGSSGLPDLGSLLGGGLGGLMNNPQLMQAAQKMMSNPGAMQNIQKMMQDPSIRQMAE 300

Query: 290 KFQSGGGTPSMADLMNNPALMDMAKNMFGG 319
            F SGGG P+++DLMNNPAL +MA N+FGG
Sbjct: 301 GFTSGGGAPNLSDLMNNPALRNMAGNLFGG 330

>YOR007C Chr15 complement(338938..339978) [1041 bp, 346 aa] {ON}
           SGT2Glutamine-rich cytoplasmic protein that serves as a
           scaffold for binding Get4/5p and other proteins required
           to mediate posttranslational insertion of tail-anchored
           proteins into the ER membrane; has similarity to human
           cochaperone SGT
          Length = 346

 Score =  338 bits (867), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 180/330 (54%), Positives = 235/330 (71%), Gaps = 11/330 (3%)

Query: 1   MSPSNKDLANLIVDFLSHTVENKEVSEDYVDSLNVAIDCITEAFEFDRESVATTLEKT-F 59
           MS S +++A LIV++ S  VE KE+SED  DSLNVA+DCI+EAF F+RE+V+  L K+ F
Sbjct: 1   MSASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFEREAVSGILGKSEF 60

Query: 60  AGRSLKQVVEAASVGSSSPQ----ESVKVNIPVEDAETKAKAESLKLEGNKAMAAKDFEQ 115
            G+ L  ++ +AS    S +    E+V++NIP +DAETKAKAE LK++GNKAMA KD+E 
Sbjct: 61  KGQHLADILNSASRVPESNKKDDAENVEINIPEDDAETKAKAEDLKMQGNKAMANKDYEL 120

Query: 116 AVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAEDAIKVNPSYSKGYSRLGFAQ 175
           A+ KY+EAI+VLPTNA+YYANRAAAHSSLK+Y++AVKDAE AI ++PSY +GYSRLGFA+
Sbjct: 121 AINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRLGFAK 180

Query: 176 YALGKPEEALDAYKKVLDIEGEAATDAMKRDYDTAMKKVGQSLNVEKSAPAATRDG---- 231
           YA GKPEEAL+AYKKVLDIEG+ AT+AMKRDY++A KKV QSLN+EK+ P  +RD     
Sbjct: 181 YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKTVPEQSRDADVDA 240

Query: 232 --AGSATGSGGLPDISSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVMNNPAVKQMAE 289
               SA G   L  +                                ++M +P+++QMAE
Sbjct: 241 SQGASAGGLPDLGSLLGGGLGGLMNNPQLMQAAQKMMSNPGAMQNIQKMMQDPSIRQMAE 300

Query: 290 KFQSGGGTPSMADLMNNPALMDMAKNMFGG 319
            F SGGGTP+++DLMNNPAL +MA N+FGG
Sbjct: 301 GFASGGGTPNLSDLMNNPALRNMAGNLFGG 330

>Kpol_1037.26 s1037 complement(59590..60618) [1029 bp, 342 aa] {ON}
           complement(59590..60618) [1029 nt, 343 aa]
          Length = 342

 Score =  338 bits (866), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 184/334 (55%), Positives = 229/334 (68%), Gaps = 14/334 (4%)

Query: 1   MSPSNKDLANLIVDFLSHTVENKEVSEDYVDSLNVAIDCITEAFEFDRESVATTLEKTFA 60
           MS SNKD+A LI+DFLS  V+  EVSED  DSLNVA+DCI EAFEF+R+SVA  ++ +F 
Sbjct: 1   MSVSNKDIAALIIDFLSTVVDKNEVSEDNADSLNVAMDCIAEAFEFERDSVAGVVKSSFQ 60

Query: 61  GRSLKQVVEAASVGSSSP---QESVKVNIPVEDAETKAKAESLKLEGNKAMAAKDFEQAV 117
           G SL   +  ++  S++     E+VKVN+  +D E    AE+LKLEGNKAMA KD+E A+
Sbjct: 61  GNSLSSYLNGSTSASAATTTADETVKVNVTEDDTEASEAAEALKLEGNKAMAGKDYELAI 120

Query: 118 LKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAEDAIKVNPSYSKGYSRLGFAQYA 177
            KY+EAI  LPTNAVY+ANRAAA+SSLKKY+EAV+DA  AIK+NP+YSKGYSRLGFA++A
Sbjct: 121 KKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPTYSKGYSRLGFAKFA 180

Query: 178 LGKPEEALDAYKKVLDIEGEAATDAMKRDYDTAMKKVGQSLNVEKSA----PAATRDGAG 233
            GK E+AL+AYKKVLDIEG+ AT+ MKRDY+TA KKV QSLN+EKS       A  D A 
Sbjct: 181 QGKAEDALEAYKKVLDIEGDKATEMMKRDYETAKKKVEQSLNLEKSTVSGNATAESDSAS 240

Query: 234 SA---TGSGGLPDISSMXXXXXXXXX----XXXXXXXXXXXXXXXXXXXXEVMNNPAVKQ 286
           +A    G GG+PD SSM                                  +M NP+VKQ
Sbjct: 241 AADPFAGMGGMPDFSSMLGGGGLGNLLNNPQLMQAAQQMMQDPEAMKQVESMMQNPSVKQ 300

Query: 287 MAEKFQSGGGTPSMADLMNNPALMDMAKNMFGGG 320
           MA++F SG GTP  + LMN+P++ DMAKNMFG G
Sbjct: 301 MADQFSSGNGTPDFSALMNDPSIRDMAKNMFGNG 334

>Skud_15.168 Chr15 complement(298955..300001) [1047 bp, 348 aa] {ON}
           YOR007C (REAL)
          Length = 348

 Score =  336 bits (862), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 179/332 (53%), Positives = 232/332 (69%), Gaps = 13/332 (3%)

Query: 1   MSPSNKDLANLIVDFLSHTVENKEVSEDYVDSLNVAIDCITEAFEFDRESVATTLEKT-F 59
           MS S  ++A+LIV++ S  VE KE+SED  DSLNVA+DCI+EAF F+RE+V + LE + F
Sbjct: 1   MSASKGEIASLIVNYFSSIVEKKEISEDSADSLNVAMDCISEAFGFEREAVPSILENSEF 60

Query: 60  AGRSLKQVVEAASVGSSSPQ----ESVKVNIPVEDAETKAKAESLKLEGNKAMAAKDFEQ 115
            G++L  ++ + S  S S +    ++V+VNIP EDAE KAKAE LK++GNKAMA KD+E 
Sbjct: 61  KGQNLTDLLNSTSRVSESTKKDDAQNVEVNIPEEDAEIKAKAEDLKMQGNKAMANKDYEL 120

Query: 116 AVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAEDAIKVNPSYSKGYSRLGFAQ 175
           A+ KY+EAI+VLPTNA+YYANRAAAHSSLK Y+EAV+DAE AI ++P+Y +GYSRLGFA+
Sbjct: 121 AINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISIDPTYFRGYSRLGFAK 180

Query: 176 YALGKPEEALDAYKKVLDIEGEAATDAMKRDYDTAMKKVGQSLNVEKSAPAATRDGAGSA 235
           YA GKPEEAL+AYKKVLDIEG+ AT+AMKRDY++A KKV QSLN+EK+ P  +RD   +A
Sbjct: 181 YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKTVPEQSRDADANA 240

Query: 236 TGSGG--------LPDISSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVMNNPAVKQM 287
             S G        L  +                                ++M +P +KQM
Sbjct: 241 DASQGAGTSGLPDLGSLLGGGLGGLMNNPQLMQAAQKMMSNPGAMQNIQKMMQDPNIKQM 300

Query: 288 AEKFQSGGGTPSMADLMNNPALMDMAKNMFGG 319
           AE F SGGG P+++DLMNNPAL  MA N+FGG
Sbjct: 301 AEGFTSGGGAPNLSDLMNNPALRSMAGNLFGG 332

>ZYRO0C07788g Chr3 (589880..590884) [1005 bp, 334 aa] {ON} similar
           to uniprot|Q12118 Saccharomyces cerevisiae YOR007C SGT2
           Glutamine-rich cytoplasmic protein of unknown function
           contains tetratricopeptide (TPR) repeats which often
           mediate protein-protein interactions conserved in human
           and C. elegans
          Length = 334

 Score =  334 bits (856), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 179/318 (56%), Positives = 225/318 (70%), Gaps = 10/318 (3%)

Query: 1   MSPSNKDLANLIVDFLSHTVENKEVSEDYVDSLNVAIDCITEAFEFDRESVATTLEKTFA 60
           M+PSNKD+++LIVD+L+  V+ K VSED +DSLNVAI+CITEAF  ++ S +      F 
Sbjct: 1   MAPSNKDISSLIVDYLADVVDKKSVSEDSIDSLNVAIECITEAFGIEKGSSSAA----FG 56

Query: 61  GRSLKQVVEAASVGSSSPQESVKVNIPVEDAETKAKAESLKLEGNKAMAAKDFEQAVLKY 120
           G++L +++ A +   SS  E+VKVNIP EDAE K+KAESLKLEGNKAMA KD+E A+ KY
Sbjct: 57  GKNLAELLSAGAGAPSSQGENVKVNIPAEDAELKSKAESLKLEGNKAMAGKDYELAIKKY 116

Query: 121 SEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAEDAIKVNPSYSKGYSRLGFAQYALGK 180
           SEAI V+PTNAVYYANRAAAHSSLK Y+EA+KDAE A+KV+ SYSKGYSRLG+A++A GK
Sbjct: 117 SEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAESAVKVDSSYSKGYSRLGYAKFAQGK 176

Query: 181 PEEALDAYKKVLDIEGEAATDAMKRDYDTAMKKVGQSLNVEKSAPAATRD-GAGSATGS- 238
            EEAL+AYKKVLDIEG++ATD MKRDY+TA +KV Q+L + K+    T D G G   G+ 
Sbjct: 177 SEEALEAYKKVLDIEGDSATDVMKRDYETAKRKVEQALELNKTDETETSDRGTGEPAGAN 236

Query: 239 -GGLPDISSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXE---VMNNPAVKQMAEKFQSG 294
            GG  D+SSM                             +   +M NP V+QMAEKF  G
Sbjct: 237 PGGGFDLSSMLGGGLGGLLNNPQVMQAAQQMMQNPQAMSQMETMMQNPNVRQMAEKFAGG 296

Query: 295 GGTPSMADLMNNPALMDM 312
            GTP++ D+MNNPAL DM
Sbjct: 297 NGTPNLNDIMNNPALRDM 314

>TPHA0J00340 Chr10 complement(76166..77182) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score =  329 bits (843), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 189/337 (56%), Positives = 223/337 (66%), Gaps = 23/337 (6%)

Query: 1   MSPSNKDLANLIVDFLSHTVENKEVSEDYVDSLNVAIDCITEAFEFDRESVATTLEKTFA 60
           M+ SNK++A LIVD+L++ V+ KEVS D  DSLNVA+DCI EAFEF+R+SV  T++  F 
Sbjct: 1   MAASNKEIAALIVDYLNNVVDKKEVSGDNADSLNVAMDCIAEAFEFERDSVKDTVKSAFN 60

Query: 61  GRSLKQVVEAASVGSSSPQESVKVNIPVE--DAETKAKAESLKLEGNKAMAAKDFEQAVL 118
           G  L       S  S S    ++VNI  +  D E KA AE LKLEGNKAMA KD+E A+ 
Sbjct: 61  GNGL------TSFLSGSATNDIQVNIADDAADEEQKATAEGLKLEGNKAMATKDYESAIK 114

Query: 119 KYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAEDAIKVNPSYSKGYSRLGFAQYAL 178
           KYSEAI+VLPTNAVYYANRAAA+SSLKKY++AV DAE AIKVNP+YSKGYSRLGFA++A 
Sbjct: 115 KYSEAIEVLPTNAVYYANRAAAYSSLKKYDDAVNDAESAIKVNPTYSKGYSRLGFAKFAQ 174

Query: 179 GKPEEALDAYKKVLDIEGEAATDAMKRDYDTAMKKVGQSLNVEKSAP--AATRDGA---- 232
           GK E+ALDAYKKVLDIEG+ ATD MKRDY+TA KKV QSLN+EK  P  A T   A    
Sbjct: 175 GKVEDALDAYKKVLDIEGDKATDIMKRDYETAKKKVEQSLNLEKVTPKEAETESNADAGT 234

Query: 233 --GSATGSGGLPDISSMXXXXXXXXX-------XXXXXXXXXXXXXXXXXXXXEVMNNPA 283
                 G GG PD+SSM                                     +M NPA
Sbjct: 235 GAAGMGGMGGFPDLSSMLGGGLGGGLGDLLKNPQIMQAAQQMMQNPNAMQQMESMMQNPA 294

Query: 284 VKQMAEKFQSGGGTPSMADLMNNPALMDMAKNMFGGG 320
           V+QMAE F SG GTP ++ +MNNP L DMAKNMFG G
Sbjct: 295 VRQMAENFASGEGTPDLSAMMNNPDLKDMAKNMFGNG 331

>TDEL0G04480 Chr7 (813648..814679) [1032 bp, 343 aa] {ON} Anc_6.21
           YOR007C
          Length = 343

 Score =  328 bits (841), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 184/331 (55%), Positives = 226/331 (68%), Gaps = 18/331 (5%)

Query: 1   MSPSNKDLANLIVDFLSHTVENKEVSEDYVDSLNVAIDCITEAFEFDR-ESVATTLEKTF 59
           MSPSNK++A+LIVD+LS  VE K VSE+ +DSLNVAIDCI E+FE  + +S A      F
Sbjct: 1   MSPSNKEVASLIVDYLSQLVEKKAVSEEAIDSLNVAIDCIGESFEVQKGDSKAV-----F 55

Query: 60  AGRSLKQVVEAASVGSSSPQ-----ESVKVNIPVEDAETKAKAESLKLEGNKAMAAKDFE 114
            G+ L ++++  S GSSS       ES+KVNIP EDAETKAKAE+LKLEGNKAMA KDF+
Sbjct: 56  GGKGLVELLQNES-GSSSETATTQAESIKVNIPAEDAETKAKAETLKLEGNKAMACKDFD 114

Query: 115 QAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAEDAIKVNPSYSKGYSRLGFA 174
            A+ KYS+AI+VLPTNAVYYANRAAAHSS+K YEEA+KDAE AIK +P+YSKGYSRLG+A
Sbjct: 115 LAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSRLGYA 174

Query: 175 QYALGKPEEALDAYKKVLDIEGEAATDAMKRDYDTAMKKVGQSLNVEKSAPAATRDGAGS 234
           ++ALG+ E+AL+AYKKVLDIEG+ A+D MKRDY+TA KKV QSL++EK      R     
Sbjct: 175 KFALGQAEDALEAYKKVLDIEGDKASDVMKRDYETAKKKVEQSLDLEKKPETQARGADAG 234

Query: 235 ATGSGGLP------DISSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVMNNPAVKQMA 288
           A G+GG         +                                 +M NP V+QMA
Sbjct: 235 AGGAGGSGGFGDFASMLGGGLGGLLNNPQLMQAAQQMMQNPQAMSQMESMMQNPGVRQMA 294

Query: 289 EKFQSGGGTPSMADLMNNPALMDMAKNMFGG 319
           E F  G G P+M DLMNNPAL DMA ++FGG
Sbjct: 295 ENFAQGNGMPNMGDLMNNPALRDMAGSLFGG 325

>Suva_15.182 Chr15 complement(313413..314453) [1041 bp, 346 aa] {ON}
           YOR007C (REAL)
          Length = 346

 Score =  328 bits (841), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 179/330 (54%), Positives = 235/330 (71%), Gaps = 11/330 (3%)

Query: 1   MSPSNKDLANLIVDFLSHTVENKEVSEDYVDSLNVAIDCITEAFEFDRESVATTLEK-TF 59
           MS S +++A+LIV++ S  VE KEVSED  DSLNVA+DCI+EAF F+R++V++ L+K TF
Sbjct: 1   MSASKEEIASLIVNYFSSIVEKKEVSEDSADSLNVAMDCISEAFGFERDAVSSILDKSTF 60

Query: 60  AGRSLKQVVEAAS----VGSSSPQESVKVNIPVEDAETKAKAESLKLEGNKAMAAKDFEQ 115
            G+SL  ++ ++S     G     ++V+VNIP EDAETKAKAE LK++GNKAMA K++E 
Sbjct: 61  KGQSLNNLLSSSSKLPESGKKDDAQNVEVNIPEEDAETKAKAEELKIQGNKAMANKEYEL 120

Query: 116 AVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAEDAIKVNPSYSKGYSRLGFAQ 175
           A+ KY+EAI VLPTNA+YYANRAAAHSSLK+Y+EA+KDAE AI V+PSY +GYSRLGFA+
Sbjct: 121 AIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPSYFRGYSRLGFAK 180

Query: 176 YALGKPEEALDAYKKVLDIEGEAATDAMKRDYDTAMKKVGQSLNVEKSAPAATRDGAGSA 235
           YA GKPEEAL+AYKKVLDIEG+ ATDAMKRDY++A K+V QSLN+EK+AP   RD   +A
Sbjct: 181 YAQGKPEEALEAYKKVLDIEGDNATDAMKRDYESAKKRVEQSLNLEKTAPEQPRDAGANA 240

Query: 236 TGSGGLPDISSMXXXXXXXXXXXXXXXXXXXXXXX------XXXXXXEVMNNPAVKQMAE 289
               G   +  +                                    +M +P+++QMAE
Sbjct: 241 GQGAGAGGLPDLGSLLGGGLGGLMNNPQLMQAAQKMMSNPGAMQNIQNMMQDPSIRQMAE 300

Query: 290 KFQSGGGTPSMADLMNNPALMDMAKNMFGG 319
            F SGGGTP+++DLM NPAL +MA ++FGG
Sbjct: 301 GFTSGGGTPNLSDLMKNPALRNMAGSLFGG 330

>NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score =  326 bits (836), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 177/335 (52%), Positives = 234/335 (69%), Gaps = 20/335 (5%)

Query: 1   MSPSNKDLANLIVDFLSHTVENKEVSEDYVDSLNVAIDCITEAFEFDRESVATTLEKTFA 60
           MS SNK++ +LIVDFLS  ++NKE+SED  DSLNVAIDCITE+FEF+R++VA TL+  F+
Sbjct: 1   MSLSNKEVGSLIVDFLSTVIKNKEISEDSADSLNVAIDCITESFEFERDTVAQTLQDKFS 60

Query: 61  GRSLKQVVEAASVGSSS--PQESVKVNIPVEDAETKAKAESLKLEGNKAMAAKDFEQAVL 118
           G++LK+++ +AS  S+    +ESVKVNIPVEDAE KA AES KLEGNKAMAAKD+  A+ 
Sbjct: 61  GKTLKEILSSASATSTGSEKEESVKVNIPVEDAEIKATAESFKLEGNKAMAAKDYRLAIE 120

Query: 119 KYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAEDAIKVNPSYSKGYSRLGFAQYAL 178
           KYSEAI+ LPTN +YYANRAAA+SS+K+Y+ A+KDAE AI+++P+YSKGYSRL FA+YAL
Sbjct: 121 KYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGYSRLAFAKYAL 180

Query: 179 GKPEEALDAYKKVLDIEGEAATDAMKRDYDTAMKKVGQSLNVEKSA---PAATRDG---- 231
            KPEEAL+ YKKVLD+EG+ AT AMKRD++ A  +V  S+N+EKS+   P  +R      
Sbjct: 181 NKPEEALEYYKKVLDMEGDKATPAMKRDFEMAKNRVESSMNLEKSSTTTPEPSRSAGQQP 240

Query: 232 AGSATGSGGLPDISSMXXXXXXXXXXXX--------XXXXXXXXXXXXXXXXXEVMNNPA 283
           A    GS G+PD+SS+                                     E+M NP 
Sbjct: 241 ANPFAGS-GMPDMSSLFGNGGGMGGLSSFLNNPQVMQAAQQMMSDPNSMQKMQEMMQNPN 299

Query: 284 VKQMAEKFQSGGGTPSMADLMNNPALMDMAKNMFG 318
           +++MA+   SG    ++ DLMNNP++ DMA N+FG
Sbjct: 300 LREMAQNLASGDA--NLDDLMNNPSVKDMANNLFG 332

>KAFR0L00410 Chr12 complement(75459..76454) [996 bp, 331 aa] {ON}
           Anc_6.21 YOR007C
          Length = 331

 Score =  323 bits (827), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 175/334 (52%), Positives = 226/334 (67%), Gaps = 17/334 (5%)

Query: 1   MSPSNKDLANLIVDFLSHTVENKEVSEDYVDSLNVAIDCITEAFEFDRESVATTLEKTFA 60
           M  SNK+++ LIVD+L    E  +VSED  DSLNVAIDCIT++FEF+R+S +  ++  F 
Sbjct: 1   MPLSNKEISTLIVDYLVKVTEKNDVSEDVKDSLNVAIDCITDSFEFERDSTSGLIKSKFY 60

Query: 61  GRSLKQVVEAASVGSSSPQESVKVNIPVE----DAETKAKAESLKLEGNKAMAAKDFEQA 116
             SL +++E A   S+  +E+V VN+P +    D ETK KAE LKLEGNKAMA KDF+ A
Sbjct: 61  NLSLPELLEVAMENSA--KENVTVNVPKDELENDEETKVKAEKLKLEGNKAMAMKDFDLA 118

Query: 117 VLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAEDAIKVNPSYSKGYSRLGFAQY 176
           + KYSEAI + P NA+YYANRAAA+SSLK +E+A +DAE AI+V+P+YSKGYSRLGFA+Y
Sbjct: 119 IAKYSEAISISPNNAIYYANRAAAYSSLKDFEKATEDAESAIRVDPNYSKGYSRLGFAKY 178

Query: 177 ALGKPEEALDAYKKVLDIEGEAATDAMKRDYDTAMKKVGQSLNVEK--SAP---AATRDG 231
           AL KPEEAL+AYKKVLD+EG+ AT+ MKRDY+TA K+V QSLN+EK  S P   + T   
Sbjct: 179 ALNKPEEALEAYKKVLDLEGDKATEIMKRDYETAKKRVEQSLNLEKKESTPKEESVTESA 238

Query: 232 AGSATGSGGLPDISSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEV---MNNPAVKQMA 288
           A +A  +GG PD+SSM                             ++   M NP+++QMA
Sbjct: 239 ANAA--AGGFPDMSSMLGGGLNGLLNNPQLMQAAQQMMSDPNAMSKIQSMMQNPSIRQMA 296

Query: 289 EKFQSGGGTPSMADLMNNPALMDMAKNMFGGGKQ 322
           E FQ  G TP  + LMN+P + DMAKN FGG  Q
Sbjct: 297 ENFQ-NGNTPDFSQLMNDPNIKDMAKNFFGGNNQ 329

>Ecym_3025 Chr3 complement(50289..51245) [957 bp, 318 aa] {ON}
           similar to Ashbya gossypii ACR005W
          Length = 318

 Score =  320 bits (821), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 168/319 (52%), Positives = 215/319 (67%), Gaps = 4/319 (1%)

Query: 1   MSPSNKDLANLIVDFLSHTVENKEVSEDYVDSLNVAIDCITEAFEFDRESVATTLEKTFA 60
           M  SNK++A LIV FLS +   K+V E+YVDSLNVAIDCI EAFE +RE     + K + 
Sbjct: 1   MPGSNKEIAALIVQFLSTST--KDVQEEYVDSLNVAIDCIAEAFEIEREDSNEIVSKAYN 58

Query: 61  GRSLKQVVEA-ASVGSSSPQESVKVNIPVEDAETKAKAESLKLEGNKAMAAKDFEQAVLK 119
           GR L  +V++ AS  + S  E    N      E   +AE+LKLEGNKA AAKDFE AV K
Sbjct: 59  GRGLVDLVKSGASEPTLSSSEPTGNNTDAHAPEVAERAENLKLEGNKAFAAKDFEGAVKK 118

Query: 120 YSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAEDAIKVNPSYSKGYSRLGFAQYALG 179
           Y+EAI+++P NAV+Y NRAAA+SS KK+EEAV+DAE A+++NPSYS+GYSRLG A+YALG
Sbjct: 119 YTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGLAKYALG 178

Query: 180 KPEEALDAYKKVLDIEGEAATDAMKRDYDTAMKKVGQSLNVEKSAPAATRDGAGSATGSG 239
           KPEEA++AYKKVLDIEG+ AT+AMKRDY++A KKV +SLN+E + P          + +G
Sbjct: 179 KPEEAMEAYKKVLDIEGDNATEAMKRDYESAKKKVEESLNLE-ALPKGEEQQTSEGSSAG 237

Query: 240 GLPDISSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVMNNPAVKQMAEKFQSGGGTPS 299
           G PD+SSM                             E+MNNPA+KQMA+ F SGGGTP+
Sbjct: 238 GFPDLSSMLGGGLGGLLNNPQVMQAAQKMMQNPSAMQEMMNNPAIKQMAQNFASGGGTPN 297

Query: 300 MADLMNNPALMDMAKNMFG 318
           + D+M +P + DMA   FG
Sbjct: 298 LGDMMKDPNIKDMAGKFFG 316

>NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {ON}
           Anc_6.21 YOR007C
          Length = 349

 Score =  320 bits (819), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 176/342 (51%), Positives = 227/342 (66%), Gaps = 24/342 (7%)

Query: 1   MSPSNKDLANLIVDFLSHTVENKEVSEDYVDSLNVAIDCITEAFEFDRESVATTLEKTFA 60
           MS +NKD+  LIVDFLS  +E  EVSED  DSLNVA+DCI+EA EFDRE V  T++  F 
Sbjct: 1   MSLNNKDIGALIVDFLSTIIEKNEVSEDNADSLNVAMDCISEALEFDREVVPETIKNKFN 60

Query: 61  GRSLKQVVEAASVGSSS----PQESVKVNIPVEDAETKAKAESLKLEGNKAMAAKDFEQA 116
           G++L  ++   S  +++     +ESV+VNIPVEDAE KA AE+ KLEGNKAMA KDF  A
Sbjct: 61  GKTLVDILNTTSTATANTTIEKEESVEVNIPVEDAEIKANAEAFKLEGNKAMAMKDFHLA 120

Query: 117 VLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAEDAIKVNPSYSKGYSRLGFAQY 176
           V KY+EAI++LPTNA+YYANRAAAHSSLK++EEA+KDAE AIK++PSYSKGYSRL FA+Y
Sbjct: 121 VEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAIKIDPSYSKGYSRLAFAKY 180

Query: 177 ALGKPEEALDAYKKVLDIEGEAATDAMKRDYDTAMKKVGQSLNVEKSAPAATRDGAG--- 233
            LGK EEAL++YKKVLDIEG+ AT  MKRDY+TA K+V +S+NVEKS       G     
Sbjct: 181 GLGKHEEALESYKKVLDIEGDNATAGMKRDYETAKKRVEESMNVEKSKTPEQGQGQQQTN 240

Query: 234 -SATGS------GGLPDISSMXXXXXXXXXXXX--------XXXXXXXXXXXXXXXXXEV 278
            SA G+      GG+PD+SS+                                      +
Sbjct: 241 ESAQGNAPNPFAGGMPDMSSLFGGAGMGGGLGSLLSNPDFMSTAQKLMSDPNAMQQVQSM 300

Query: 279 MNNPAVKQMAEKFQSGGGTPSMADLMNNPALMDMAKNMFGGG 320
           M++P+++ +A  F++G     M D+MNNPA+ +MA N+F G 
Sbjct: 301 MSDPSMRDLANNFKNGNT--DMNDIMNNPAIRNMASNLFKGN 340

>CAGL0E02739g Chr5 complement(259023..260054) [1032 bp, 343 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007c SGT2
          Length = 343

 Score =  318 bits (814), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 172/327 (52%), Positives = 222/327 (67%), Gaps = 23/327 (7%)

Query: 5   NKDLANLIVDFLSHTVENKEVSEDYVDSLNVAIDCITEAFEFDRESVATTLEKTFAGRSL 64
           +K++A +I+ +L   V  K V EDY+DS+NVAIDCI E+FE +R  V + L+++   + L
Sbjct: 2   SKEVAAVIIKYLEGVVAEKAVGEDYLDSVNVAIDCIAESFEVERGDVDSVLKQSGISKGL 61

Query: 65  KQVVEAASVGSSSPQESVKVNIPVEDAETKAKAESLKLEGNKAMAAKDFEQAVLKYSEAI 124
           ++ +E    G +   E VKVNIP EDAETKAKAE+LKLEGNKAMA KDFE A+ KYSEAI
Sbjct: 62  EECLECMK-GGAVKSEDVKVNIPAEDAETKAKAEALKLEGNKAMAGKDFELAIAKYSEAI 120

Query: 125 QVLPTNAVYYANRAAAHSSLKKYEEAVKDAEDAIKVNPSYSKGYSRLGFAQYALGKPEEA 184
           +VLPTNA+YYANRAAAHSSLK+Y+EAV DAE AI+++P+YSKGYSRLGFA+YA  KPEEA
Sbjct: 121 EVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRLGFAKYAQNKPEEA 180

Query: 185 LDAYKKVLDIEGEAATDAMKRDYDTAMKKVGQSLNVEKSAPAATRDGAG----------- 233
           L+AYKKV+D+EG+ ATD MKRDY+TA KKV QSLN+EK+  A   D              
Sbjct: 181 LEAYKKVMDLEGDKATDIMKRDYETAKKKVEQSLNLEKTPDARGADSGAGAGAGAGGAGG 240

Query: 234 ---SATGSGGLPDISSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVMNNPAVKQMAEK 290
              S+  SGGL  + +                               +M +P+++QMAE+
Sbjct: 241 FDFSSMLSGGLSGLMN--------NPQIMQAAQQMMSNPQALQQMQSMMQDPSIRQMAEQ 292

Query: 291 FQSGGGTPSMADLMNNPALMDMAKNMF 317
           F SG GTP+M DLM+NPAL +MA +MF
Sbjct: 293 FTSGNGTPNMDDLMSNPALRNMASSMF 319

>TBLA0G01050 Chr7 complement(262407..263459) [1053 bp, 350 aa] {ON}
           Anc_6.21 YOR007C
          Length = 350

 Score =  314 bits (805), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 175/326 (53%), Positives = 227/326 (69%), Gaps = 12/326 (3%)

Query: 1   MSPSNKDLANLIVDFLSHTVENKEVSEDYVDSLNVAIDCITEAFEFDRESVATTLEKTFA 60
           MS SNKD+ANL+VDFLS  +E K VS D  DSLNVAIDCITEAFEF+++ V +TL   F 
Sbjct: 1   MSYSNKDIANLLVDFLSTAIEKKAVSSDNADSLNVAIDCITEAFEFEKDDVKSTLASKFG 60

Query: 61  GRSLKQVVEAAS--VGSSSPQESVKVNIP----VEDAETKAKAESLKLEGNKAMAAKDFE 114
           G+SL ++++AA+   G SS  E +KV+I      ED E  AKAE+LKLEGNKAMAAKD+ 
Sbjct: 61  GKSLTELLDAATNAKGRSSSPEDIKVSISDKDEEEDKELAAKAEALKLEGNKAMAAKDYN 120

Query: 115 QAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAEDAIKVNPSYSKGYSRLGFA 174
            AV KY+ AI+++PT AVYYANRAAA+SS +KY+EA+KDAE AIKV P++SKGYSRLGFA
Sbjct: 121 LAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRLGFA 180

Query: 175 QYALGKPEEALDAYKKVLDIEGEAATDAMKRDYDTAMKKVGQSLNVEKSAPAATRDGAGS 234
           ++A GK +EAL+AYKK L+++G+ ATD MKRDY+TA KKV QSLNVEKSA  +    A +
Sbjct: 181 KFAQGKSQEALEAYKKALEVDGDKATDIMKRDYETAKKKVEQSLNVEKSATPSAS--ASA 238

Query: 235 ATGSGGLPDISSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEV---MNNPAVKQMAEKF 291
           +  +GG+PD++SM                             ++   M NP+++QMAE  
Sbjct: 239 SASAGGMPDMASMLGGGLGSFLNNPQIMQAAQQMMSNPRAMEQMESMMQNPSIRQMAENL 298

Query: 292 QSGGGTPSMADLMNNPALMDMAKNMF 317
            S G +  M D MNNPA+ +MA N+F
Sbjct: 299 -SSGSSEGMGDFMNNPAIREMASNLF 323

>KNAG0M01170 Chr13 complement(211476..212495) [1020 bp, 339 aa] {ON}
           Anc_6.21 YOR007C
          Length = 339

 Score =  313 bits (803), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 160/326 (49%), Positives = 232/326 (71%), Gaps = 8/326 (2%)

Query: 1   MSPSNKDLANLIVDFLSHTVENKEVSEDYVDSLNVAIDCITEAFEFDRESVATTLEKTFA 60
           M+ SNK++++LI+D+L+  V   EVS D +DSLNVAIDC+TE F  ++++++ T+E  F 
Sbjct: 1   MAYSNKEVSSLIIDYLNKVVSKAEVSADDIDSLNVAIDCLTEVFGVEKDTLSATIESKFN 60

Query: 61  GRSLKQVVEAASVGSSSPQE----SVKVNIPVEDAETKAKAESLKLEGNKAMAAKDFEQA 116
           G+SL ++++AAS  + +  E    +VK+NIP EDAETKAKAE+LKLEGNKA+A+KD++ A
Sbjct: 61  GKSLTELLDAASQNAGNTDECKTETVKINIPQEDAETKAKAEALKLEGNKAVASKDYDLA 120

Query: 117 VLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAEDAIKVNPSYSKGYSRLGFAQY 176
           V KY+EAI++LPTNAVY+ANRAAA+++ + Y+EAVKDAE+AIK++P+YSKGYSRL +A+Y
Sbjct: 121 VEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAYAKY 180

Query: 177 ALGKPEEALDAYKKVLDIEGEAATDAMKRDYDTAMKKVGQSLNVEKSAPAATRDGAGSAT 236
                EE+L+AYKKVL+IEG++AT+  KR Y+TA K+V +SLN+EKS P  +  G  +  
Sbjct: 181 VQENFEESLEAYKKVLEIEGDSATEVTKRGYETAKKRVEESLNLEKSVPTESAGGQTNPA 240

Query: 237 GSGGLPDISSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEV---MNNPAVKQMAEKFQS 293
             GG PD SS+                             ++   M NPA++QMAE+F+ 
Sbjct: 241 AGGGFPDFSSLMSGGLEGLMNNPQMMQAAQSMMSNPGAMEKIQSMMQNPAIQQMAEQFK- 299

Query: 294 GGGTPSMADLMNNPALMDMAKNMFGG 319
           GG TP  +++MNNPA+ +MA ++F G
Sbjct: 300 GGNTPDFSEMMNNPAVRNMASSLFSG 325

>KLLA0D01155g Chr4 complement(104847..105854) [1008 bp, 335 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007C SGT2 Glutamine-rich cytoplasmic protein of
           unknown function contains tetratricopeptide (TPR)
           repeats which often mediate protein-protein interactions
           conserved in human and C. elegans
          Length = 335

 Score =  310 bits (793), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 179/332 (53%), Positives = 228/332 (68%), Gaps = 14/332 (4%)

Query: 1   MSPSNKDLANLIVDFLSHTVENKEVSEDYVDSLNVAIDCITEAFEFDRESVATTLEKTFA 60
           MS SNK++A LIVDFLS +     V+EDYVDSLNVAIDCITEAF+F+R+   + +   F 
Sbjct: 1   MSLSNKEIAALIVDFLSSSS--SSVNEDYVDSLNVAIDCITEAFQFERDETDSLISGPFN 58

Query: 61  GRSLKQVVEAASVGSSSPQESVKVNIPVEDAETKAKAESLKLEGNKAMAAKDFEQAVLKY 120
           G+ L +++ +A        E VKV+IPVEDA  KAKAE LKL+GNKAMAAK F++A+ KY
Sbjct: 59  GKKLPELLASAPSSGGVSGEPVKVHIPVEDAAAKAKAEELKLQGNKAMAAKKFDEAIEKY 118

Query: 121 SEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAEDAIKVNPSYSKGYSRLGFAQYALGK 180
           + AI+V P+NAVYY+NRAAA+SSLK+YE+AVKDAE AI+V+P+YSKG+SRLGFA+YAL K
Sbjct: 119 TAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGFAKYALNK 178

Query: 181 PEEALDAYKKVLDIEGEAATDAMKRDYDTAMKKVGQSLNVEKSAPAATRDGAG--SATGS 238
           PEEALDAYKKVLDIEGE ATD MKRDY+TA KKV  S+N+EKS+ +A+ +     SAT  
Sbjct: 179 PEEALDAYKKVLDIEGEKATDVMKRDYETAKKKVETSMNLEKSSTSASSEDVSDKSATEG 238

Query: 239 GGLPDISSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVM----------NNPAVKQMA 288
            G                                    ++M          +NPA+KQMA
Sbjct: 239 PGAGAGGLPDLSSLLGGGGLGGGLGALLNNPQVMQAAEKMMQNPGLMQDMMSNPAMKQMA 298

Query: 289 EKFQSGGGTPSMADLMNNPALMDMAKNMFGGG 320
            +F SGGG P ++ +MN+P++ DMAKNMFGGG
Sbjct: 299 NQFSSGGGMPDLSQMMNDPSIRDMAKNMFGGG 330

>ACR005W Chr3 (363355..364338) [984 bp, 327 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR007C (SGT2)
          Length = 327

 Score =  281 bits (718), Expect = 5e-93,   Method: Compositional matrix adjust.
 Identities = 162/332 (48%), Positives = 218/332 (65%), Gaps = 21/332 (6%)

Query: 1   MSPSNKDLANLIVDFLSHTVENKEVSEDYVDSLNVAIDCITEAFEFDRESVATTLEKTFA 60
           MSPSNKD+A LIVDFL  T   K V EDY DSL VAIDCITEAFE       T + +   
Sbjct: 1   MSPSNKDIAALIVDFL--TTSAKTVGEDYEDSLKVAIDCITEAFELGPGEADTLVSEKCG 58

Query: 61  GRSLKQVVEAASVGSSSPQESVKVNIPVEDAETKAKAESLKLEGNKAMAAKDFEQAVLKY 120
           GRSL Q++   + G +   ++ +  +  E  E K +AE+LKLEGN+AMAAKD+E A+ KY
Sbjct: 59  GRSLSQLL---TTGMAHTSDAGEPKVAAE--ELKKEAEALKLEGNRAMAAKDYETAIQKY 113

Query: 121 SEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAEDAIKVNPSYSKGYSRLGFAQYALGK 180
           + AI+VLPT+AVYYANRAAA+SSL++YE+AV+DAE A KV+ SYSKG+SRLG+A+YALG+
Sbjct: 114 TAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAKYALGR 173

Query: 181 PEEALDAYKKVLDIEGEAATDAMKRDYDTAMKKVGQSLNVEKSAPAA-TRDGAGSATGSG 239
            EEAL+AYK+VLDIEG+ AT+AM+RDY++A +KV +S+N++++A    + D A  + G  
Sbjct: 174 HEEALEAYKRVLDIEGDNATEAMRRDYESAKRKVEESINMDRNAEVTESGDSAAGSAGGS 233

Query: 240 GLPDISSMXXXXXXXXXXXX-------------XXXXXXXXXXXXXXXXXEVMNNPAVKQ 286
           GLPD++SM                                          E+M+NPA+K+
Sbjct: 234 GLPDLASMFGGGGLGGGLGGGLGGGLGGLLNNPQVMQAAQKMMQNPSAIQEMMSNPAIKK 293

Query: 287 MAEKFQSGGGTPSMADLMNNPALMDMAKNMFG 318
           MAE F SG G+  + DLM +PA+ +MA   FG
Sbjct: 294 MAENFASGNGSSGLGDLMADPAVRNMASKFFG 325

>Kpol_1032.8 s1032 complement(15762..16793) [1032 bp, 343 aa] {ON}
           complement(15762..16793) [1032 nt, 344 aa]
          Length = 343

 Score =  204 bits (518), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 120/326 (36%), Positives = 184/326 (56%), Gaps = 10/326 (3%)

Query: 1   MSPSNKDLANLIVDFLSHTVENKEVSEDYVDSLNVAIDCITEAFEFDRESVATTLEKTFA 60
           MS +NKD   LIV++L   ++ KEVSED  +SLNVAIDCI++ FE D  S    +   F 
Sbjct: 1   MSLNNKDFGALIVNYLHKIIDGKEVSEDNAESLNVAIDCISDVFELDPTSEEKIINDVFN 60

Query: 61  GRSLKQVVEAASVGSSSPQESVKVNIPVEDA--ETKAKAESLKLEGNKAMAAKDFEQAVL 118
              LK +     +G  +  + V++ +  E+   + K +AE+LKLEGNK M+ K+++ A+ 
Sbjct: 61  KSDLKTIT-LKGLGLQNVSDVVELEVKNEEISEDKKKEAEALKLEGNKQMSLKNYKSAID 119

Query: 119 KYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAEDAIKVNPSYSKGYSRLGFAQYAL 178
           KYS+AI++ P+N  YY+NRAAA+  ++ +  AV DA  AIK++P+YSK YSRLG A+ A 
Sbjct: 120 KYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPTYSKAYSRLGAAKLAE 179

Query: 179 GKPEEALDAYKKVLDIEGEAATDAMKRDYDTAMKKVGQSLNVEKSAPAATRDGAGSATGS 238
           G  E+A+ A+KKVL++EG+ +T+ MK DY+ A K V   + + K+ P  +  G      +
Sbjct: 180 GNNEDAVHAFKKVLELEGDKSTEVMKNDYENAKKLVQTFVTLNKNVPDPS--GPPPLNTT 237

Query: 239 GGLPDI-----SSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVMNNPAVKQMAEKFQS 293
             L DI     SS                               +M NP V+Q AE   +
Sbjct: 238 DVLTDIATVLGSSFGSLMNNTQMMQRAQQMMQTQNPEMMQQVEGLMQNPVVRQFAENVAN 297

Query: 294 GGGTPSMADLMNNPALMDMAKNMFGG 319
           G G   ++D++NNP++ ++A  +  G
Sbjct: 298 GNGPGGLSDVLNNPSVKEVANGLMNG 323

>NDAI0I02240 Chr9 (512140..513192) [1053 bp, 350 aa] {ON} Anc_6.21
           YOR007C
          Length = 350

 Score =  142 bits (359), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 85/219 (38%), Positives = 130/219 (59%), Gaps = 22/219 (10%)

Query: 1   MSPSNKDLANLIVDFLSHTVENKEVSEDYVDSLNVAIDCITEAFEFDRESVATTLEKTFA 60
           MS + +  A+LI+ +LS+   N  + ED  +SL VAI CI E+F  D + + T+L++   
Sbjct: 1   MSLTKEQTASLIISYLSYLTNNNVLDEDKKESLRVAITCIGESFSLDGDILPTSLKE--- 57

Query: 61  GRSLKQVVEAASVGSSSPQESVKVNIPVEDAETKA---KAESLKLEGNKAMAAKDFEQAV 117
            R+LK +++               N+   +A  K    +AE+LK EGN+AM    +E+A+
Sbjct: 58  -RTLKTILQE--------------NLNTLEATQKIHNEEAEALKKEGNEAMIEGQYEEAI 102

Query: 118 LKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAEDAIKVNPSYSKGYSRLGFAQYA 177
            KY+EAIQ    N  YY+NR+ A+S L +YE+AV DA  AI ++PS+SK YSRLG+A+  
Sbjct: 103 KKYTEAIQ-FSKNVAYYSNRSLAYSKLGRYEDAVNDATLAINIDPSFSKAYSRLGYAKCC 161

Query: 178 LGKPEEALDAYKKVLDIEGEAATDAMKRDYDTAMKKVGQ 216
             K E+ + AYK+ +D+EG  A+  +  DY+ A  K  Q
Sbjct: 162 QDKLEDGMTAYKRAIDLEGTNASKTLYDDYEDARFKYEQ 200

>NCAS0D02670 Chr4 complement(512529..513584) [1056 bp, 351 aa] {ON}
           Anc_6.21 YOR007C
          Length = 351

 Score =  142 bits (358), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 92/241 (38%), Positives = 141/241 (58%), Gaps = 25/241 (10%)

Query: 1   MSPSNKDLANLIVDFLSHTVENKEVSEDYVDSLNVAIDCITEAFEFDRESVATTLEKTFA 60
           MS SNK++A+ IV +LS  +   +V+EDY +S++VAI+CI ++F+          E+  A
Sbjct: 1   MSLSNKEIASRIVSYLSSLIRTGQVTEDYAESISVAIECIRDSFDLQ--------EEVSA 52

Query: 61  GRSLKQVVEAASVGSSSPQESVKVNIPVEDAETKAKAESLKLEGNKAMAAKDFEQAVLKY 120
              L  V+ A       P+ S K     E      +A  LKLEGNKA+  ++++ A+ KY
Sbjct: 53  DSDLATVLLANLNLEPEPKLSEK-----ERELVNEQAIKLKLEGNKAVERENYKDAIDKY 107

Query: 121 SEAIQVLPTNAV-----YYANRAAAHSSLKKYEEAVKDAEDAIKVNPSYSKGYSRLGFAQ 175
           + AI +L  N +     Y +N++ A +   +YEEA  DA   IK++P++SKGYSRL  A+
Sbjct: 108 TRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEEACDDALACIKIDPTFSKGYSRLAEAK 167

Query: 176 YALGKPEEALDAYKKVLDIEGEAATDAMKRDYDTAMKKVGQSLNVEKSAPAATRDGAGSA 235
               K E+A++AYK+VLD+EG  ATD MKRD++   +K  ++LN       +T   +GSA
Sbjct: 168 IGQNKYEDAMNAYKQVLDLEGNKATDTMKRDFEITKQKF-ETLNF------STHIDSGSA 220

Query: 236 T 236
           T
Sbjct: 221 T 221

>TPHA0M00270 Chr13 complement(53640..54773) [1134 bp, 377 aa] {ON}
           Anc_6.21 YOR007C
          Length = 377

 Score =  135 bits (341), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 103/361 (28%), Positives = 171/361 (47%), Gaps = 58/361 (16%)

Query: 1   MSPSNKDLANLIVDFLSHTVENKEVSEDYVDSLNVAIDCITEAFEFDRESVATTLEKTFA 60
           M+ +++++A++IVD+ +  + + ++++D VDSLNVAIDCI + F+ D++ ++  L+  + 
Sbjct: 1   MNTTDQEIASIIVDYFNKCITSGKLNQDNVDSLNVAIDCIADVFDVDKDLISNILKTAYR 60

Query: 61  GRSL----------------KQVVEAASVGSSSPQESVK--------VNIPV-------E 89
              L                K      SV +     +          +N+PV       E
Sbjct: 61  SNDLLTYLPNGKRSALNLDKKNTTINVSVQTKDKINAYNDLSRNKDDINVPVKVIEDIEE 120

Query: 90  DAETKA------KAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSS 143
             ETK       KAE LK +GN+ M AK + +A+  YS+AI++ PTN  YY NRA A+  
Sbjct: 121 TKETKVSNDDMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIK 180

Query: 144 LKKYEEAVKDAEDAI----KVNPSYSKGYSRLGFAQYALGKPEEALDAYKKVLDI----- 194
              ++ A+ DA  +I    K++P+  K Y RLG A+Y +G  E +L A+K++++I     
Sbjct: 181 ANNFDHAIIDANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEIAQENN 240

Query: 195 EGEAATDAMKRDYDTAMKKVGQSLNVEKSAPAATRDGAGSATGSG-----GLPDISSMXX 249
           +G+  T  M  DY+ A +KV Q L   +   +  ++G+G++   G      L DI +M  
Sbjct: 241 KGDEITKQMDADYEKAKEKV-QELFFMQITKSTGKEGSGNSVNDGPKRKVTLNDILNMAG 299

Query: 250 XXXXXXXXXXXXXXXXXXXXXXXXXXXE----VMNNPAVKQMAEKFQSG--GGTPSMADL 303
                                      +    VMN+P V+QM E   S      P + DL
Sbjct: 300 NNLNIIMSNPLFKEVVEQLLASNPQAKQQFDNVMNDPRVRQMKENVNSDSMSNIPILKDL 359

Query: 304 M 304
            
Sbjct: 360 F 360

>TBLA0A07270 Chr1 complement(1811640..1812761) [1122 bp, 373 aa]
           {ON} Anc_6.21 YOR007C
          Length = 373

 Score =  119 bits (299), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 71/248 (28%), Positives = 130/248 (52%), Gaps = 37/248 (14%)

Query: 4   SNKDLANLIVDFLSHTVENKEVSEDYVDSLNVAIDCITEAFEFDRESVATTLEKTFAGRS 63
           ++KD+A LIV+FL + +  KE+S+D +DSLNVAIDCI + +  +   ++++L   F+   
Sbjct: 7   NDKDVACLIVNFLENVISKKEISQDNIDSLNVAIDCIQQCYNLNEAYISSSLILKFSKSD 66

Query: 64  LKQVVE-----------------AASVGSSSPQESVK-------------VNIPVEDA-- 91
           L  ++                    ++  SS  ESVK             ++I + D   
Sbjct: 67  LTSILNNFAKNNYKNITSTKETTPLTLEPSSLNESVKKNQSNISNDNNEKISINLNDTSK 126

Query: 92  -----ETKAKAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKK 146
                + K  A++ K EGN+ M ++D+++A+  Y+ AI   P + +YY+NR+ A+  +  
Sbjct: 127 NNFSDKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVND 186

Query: 147 YEEAVKDAEDAIKVNPSYSKGYSRLGFAQYALGKPEEALDAYKKVLDIEGEAATDAMKRD 206
           YE A+ DA   I ++ ++SK Y RL   +    +  +ALD YKK +++  ++  + + R+
Sbjct: 187 YESAINDANFCISIDANFSKAYIRLANIKVQQHQYIDALDYYKKFIELNKDSVPEKITRE 246

Query: 207 YDTAMKKV 214
           ++    KV
Sbjct: 247 FEDLKLKV 254

>CAGL0H08195g Chr8 complement(804418..806169) [1752 bp, 583 aa] {ON}
           highly similar to uniprot|P15705 Saccharomyces
           cerevisiae YOR027w STI1
          Length = 583

 Score =  103 bits (258), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 81/110 (73%), Gaps = 3/110 (2%)

Query: 97  AESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPT-NAVYYANRAAAHSSLKKYEEAVKDAE 155
           A+  K +GN A  AKD+E+A+  +S+AI+V  T N V+Y+NR+A ++SLKK+ EA+ DAE
Sbjct: 4   ADEYKQQGNAAFVAKDYEKAIDLFSKAIEVSETPNHVFYSNRSACYASLKKFPEALNDAE 63

Query: 156 DAIKVNPSYSKGYSRLGFAQYALGKPEEALDAYKKVLDIEG--EAATDAM 203
           + +K+NP++SKGY+RLG A   LG  +EA  +YKK L+++G  +AA D +
Sbjct: 64  ECVKINPTWSKGYNRLGAAHLGLGDLDEAEGSYKKALELDGSNQAAKDGL 113

 Score = 59.7 bits (143), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 60/121 (49%)

Query: 96  KAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAE 155
           KAE  +LEG       D+  AV  Y+E I+  P +A  Y+NRAAA S L  + EA++D  
Sbjct: 389 KAEEARLEGKDYFTKGDWPNAVKAYTEMIKRAPEDARGYSNRAAALSKLMSFPEAIEDCN 448

Query: 156 DAIKVNPSYSKGYSRLGFAQYALGKPEEALDAYKKVLDIEGEAATDAMKRDYDTAMKKVG 215
            AI+ +P++ + Y R   AQ A+ +   A++        + E    A  R+ D    K  
Sbjct: 449 KAIEKDPNFIRAYIRKATAQIAVKEFAAAIETLDAARTKDAEVNNSANVREIDQLYVKAS 508

Query: 216 Q 216
           Q
Sbjct: 509 Q 509

 Score = 37.4 bits (85), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 48/96 (50%), Gaps = 8/96 (8%)

Query: 104 GNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAH-------SSLKKYEEAVKDAED 156
           GNKA  A+ F++A+  Y  A   L  +  Y  NR+AA        ++LK  +EAV+   +
Sbjct: 263 GNKAYKARQFDEAIAHYDAAWN-LHQDITYLNNRSAAEFEKGDAETALKTLDEAVEKGRE 321

Query: 157 AIKVNPSYSKGYSRLGFAQYALGKPEEALDAYKKVL 192
                   +K ++R+G   +     ++A++ Y+K L
Sbjct: 322 MRTDYKLIAKSFARMGNVHHKTNNLKKAIEFYQKSL 357

>Kwal_55.19935 s55 (182767..184548) [1782 bp, 593 aa] {ON} YOR027W
           (STI1) - Heat shock protein also induced by canavanine
           and entry into stationary phase [contig 159] FULL
          Length = 593

 Score =  102 bits (254), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 51/101 (50%), Positives = 75/101 (74%), Gaps = 1/101 (0%)

Query: 97  AESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPT-NAVYYANRAAAHSSLKKYEEAVKDAE 155
           AE  K +GN A  AKDFE+A   +S+AI+   T N V Y+NR+A ++SLKK++EA++DAE
Sbjct: 3   AEEFKKQGNAAFVAKDFEKAAELFSKAIESSETPNHVLYSNRSACYTSLKKFKEALEDAE 62

Query: 156 DAIKVNPSYSKGYSRLGFAQYALGKPEEALDAYKKVLDIEG 196
           + +K+NP++SKGY+R+G AQY LG  ++A   YKK L+I+ 
Sbjct: 63  ECVKINPTWSKGYNRVGAAQYGLGNLDDAEKEYKKALEIDS 103

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 48/83 (57%)

Query: 96  KAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAE 155
           KAE  +L+G +     D+  AV  Y+E I+  P +A  Y+NRAA  + L  + +A+KD +
Sbjct: 400 KAEEARLQGKEFFTKGDWPSAVSAYTEMIKRAPEDARGYSNRAAVLAKLMSFPDAIKDCD 459

Query: 156 DAIKVNPSYSKGYSRLGFAQYAL 178
            AI  +P++ + Y R   AQ A+
Sbjct: 460 VAISKDPNFVRAYIRKASAQIAV 482

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 69/120 (57%), Gaps = 8/120 (6%)

Query: 80  ESVKVNIPVEDAETKAKAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAA 139
           + ++V+ P  + ++KAKA++ K EGNK   A+ F++A+  Y++A   L  +  Y  NR+A
Sbjct: 250 DKMEVDEPEPEQDSKAKADAEKAEGNKYYKARKFDEAIEHYNKAWD-LHRDVTYLNNRSA 308

Query: 140 AHSSLKKYEEAVKDAEDAI----KVNPSY---SKGYSRLGFAQYALGKPEEALDAYKKVL 192
           A      YE+A+K   +A+    ++   Y   SK ++R+G A   +   ++A++ Y++ L
Sbjct: 309 AEYEKGDYEQAIKTLTEAVDQGREMRADYKLISKSFARIGNAYLKMDDLKKAIEFYQRSL 368

>NDAI0F00910 Chr6 complement(223205..224956) [1752 bp, 583 aa] {ON}
          Length = 583

 Score = 97.8 bits (242), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 79/111 (71%), Gaps = 4/111 (3%)

Query: 97  AESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPT-NAVYYANRAAAHSSLKKYEEAVKDAE 155
           A+  K +GN A  +KDF +A+  +++AI+V PT N V Y+NR+AA++S K+++EA+ DA 
Sbjct: 5   ADEYKQQGNAAFTSKDFNKAIELFTKAIEVSPTPNHVLYSNRSAAYTSAKQFQEALNDAT 64

Query: 156 DAIKVNPSYSKGYSRLGFAQYALGKPEEALDAYKKVLDIE---GEAATDAM 203
           + +K+NP++SKGY+RLG A++ LG  EEA   YK+ L ++    +AA D +
Sbjct: 65  ECVKINPTWSKGYNRLGAAEFGLGNLEEAEKNYKEALKLDNNNNKAAQDGL 115

 Score = 68.9 bits (167), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 39/91 (42%), Positives = 55/91 (60%)

Query: 96  KAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAE 155
           KAE  +LEG +     D+  AV  YSE I+  P +A  Y+NRAAA S L  + EA+KD +
Sbjct: 388 KAEEARLEGKEYFTKGDWPNAVKAYSEMIKRAPEDARGYSNRAAALSKLMSFPEAIKDCD 447

Query: 156 DAIKVNPSYSKGYSRLGFAQYALGKPEEALD 186
           +AIK +P++ + Y R   AQ A+ +   ALD
Sbjct: 448 NAIKKDPNFVRAYIRKATAQIAIKEYANALD 478

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 59/107 (55%), Gaps = 8/107 (7%)

Query: 93  TKAKAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVK 152
           +K +A+  K+EGNK   A  F++A+ +Y++A   L  +  Y  NR+AA      +E A+ 
Sbjct: 251 SKLEADEAKVEGNKLYKAHKFDEAIEQYNKAW-ALNKDITYLNNRSAAEFEKGDFETAIA 309

Query: 153 DAEDAI----KVNPSY---SKGYSRLGFAQYALGKPEEALDAYKKVL 192
              +A+    ++   Y   +K ++R+G A +  G  ++++D Y+K L
Sbjct: 310 TLNEAVDQGRELRADYKIIAKSFARIGNAYHKKGDLKKSIDYYQKSL 356

>AEL224W Chr5 (207712..209454) [1743 bp, 580 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR027W (STI1)
          Length = 580

 Score = 97.1 bits (240), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 84/123 (68%), Gaps = 3/123 (2%)

Query: 97  AESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPT-NAVYYANRAAAHSSLKKYEEAVKDAE 155
           AE  K EGN A AAKDFE+A+  + +AI+V    N V Y+NR+A ++S++K+ EA+ DA+
Sbjct: 4   AEEYKKEGNSAFAAKDFEKAIELFGKAIEVSEQPNHVLYSNRSACYASMRKFREALADAQ 63

Query: 156 DAIKVNPSYSKGYSRLGFAQYALGKPEEALDAYKKVLDIE--GEAATDAMKRDYDTAMKK 213
           + +++ P +SKG++RLG A Y LG  +EA ++YKK L+++   +AA D + +   T  ++
Sbjct: 64  ECVRIKPDWSKGHNRLGAAHYGLGDLDEAEESYKKALELDSSNKAAQDGLAQVQATQQQR 123

Query: 214 VGQ 216
           + Q
Sbjct: 124 MEQ 126

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 50/83 (60%)

Query: 96  KAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAE 155
           KAE  +L+G +     D+  AV  Y+E I+  P +A  Y+NRAAA + L  + +A+KD +
Sbjct: 387 KAEEARLQGKEYFTNADWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPDAIKDCD 446

Query: 156 DAIKVNPSYSKGYSRLGFAQYAL 178
            AI+ +P++ + Y R   AQ A+
Sbjct: 447 MAIQKDPNFVRAYIRKATAQIAV 469

 Score = 48.9 bits (115), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 57/106 (53%), Gaps = 8/106 (7%)

Query: 94  KAKAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKD 153
           ++KAE  K +GN+    + F++A+  Y +A   L  +  Y  NRAAA      YE A+K 
Sbjct: 251 RSKAEEAKAKGNELYKKRQFDEAIANYEKAWD-LHKDITYLNNRAAAEYEKGDYESAIKT 309

Query: 154 AEDAIK----VNPSY---SKGYSRLGFAQYALGKPEEALDAYKKVL 192
            E A++    +   Y   +K ++RLG A Y L   ++A++ Y+K L
Sbjct: 310 LEKAVEEGRELRADYKVIAKSFARLGNAHYKLADLKKAIEYYEKSL 355

>TPHA0D02880 Chr4 (599288..601045) [1758 bp, 585 aa] {ON} Anc_5.617
           YOR027W
          Length = 585

 Score = 97.1 bits (240), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 47/101 (46%), Positives = 74/101 (73%), Gaps = 1/101 (0%)

Query: 97  AESLKLEGNKAMAAKDFEQAVLKYSEAIQVLP-TNAVYYANRAAAHSSLKKYEEAVKDAE 155
           A+  K +GN A +AK++E+AV  +S+AI+V P  N V Y+NR+A ++SLKK+ +A+ DA 
Sbjct: 5   ADEYKQQGNTAFSAKEYEKAVDLFSKAIEVSPEPNHVLYSNRSACYTSLKKFTDALNDAN 64

Query: 156 DAIKVNPSYSKGYSRLGFAQYALGKPEEALDAYKKVLDIEG 196
           +  K+NP++SKGY+R+G A Y LG  +EA  +YKK L+++ 
Sbjct: 65  ECTKINPTWSKGYNRVGAAHYGLGDLDEAEKSYKKALELDA 105

 Score = 58.5 bits (140), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 68/133 (51%), Gaps = 7/133 (5%)

Query: 65  KQVVEAASVGSSSPQESVKVNIPVEDAE---TKAKAESLKLEGNKAMAAKDFEQAVLKYS 121
           K + E  +  + +   S++  I V++AE      KAE  +++G        +  AV  Y+
Sbjct: 357 KSLTEFRTPATLTKLRSLEKKIKVQEAEAYINPEKAEEARIQGKDFFNKGQWPDAVKAYT 416

Query: 122 EAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAEDAIKVNPSYSKGYSRLGFAQYALGKP 181
           E I   P +A  Y+NRAAA S L  + EA+ D E A++ +P++ K Y R   AQ A+ + 
Sbjct: 417 EMIARAPDDARAYSNRAAALSKLMSFPEAISDCEKALEKDPNFVKAYIRKATAQIAIKEY 476

Query: 182 EEALDAYKKVLDI 194
             AL+     LDI
Sbjct: 477 SSALE----TLDI 485

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 38/116 (32%), Positives = 62/116 (53%), Gaps = 9/116 (7%)

Query: 85  NIPVEDAETKAK-AESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSS 143
           N+ V+DA+ + K A++ K EGNK   A  F++A+  Y +A + L  +  Y  N+AAA   
Sbjct: 245 NMEVDDADVQKKLADAEKDEGNKLYKAHKFDEAIEHYDKAWE-LHNDITYLNNKAAAQYE 303

Query: 144 LKKYEEAVKDAEDAI----KVNPSY---SKGYSRLGFAQYALGKPEEALDAYKKVL 192
              YE  +K  EDAI    ++   Y   +K ++R+G A   L   ++A + + K L
Sbjct: 304 KGDYETTIKTLEDAIEKGRELRADYKIIAKAFTRMGNAYEKLNDLKKAAEFFNKSL 359

>Smik_15.205 Chr15 (346899..348668) [1770 bp, 589 aa] {ON} YOR027W
           (REAL)
          Length = 589

 Score = 95.9 bits (237), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 83/123 (67%), Gaps = 3/123 (2%)

Query: 97  AESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPT-NAVYYANRAAAHSSLKKYEEAVKDAE 155
           A+  K +GN A  AKD+++A+  +++AI+V  T N V Y+NR+A ++SLKK+ +A+ DA+
Sbjct: 5   ADEYKQQGNSAFTAKDYDKAIELFTKAIEVSKTPNHVLYSNRSACYASLKKFSDALNDAK 64

Query: 156 DAIKVNPSYSKGYSRLGFAQYALGKPEEALDAYKKVLDIEG--EAATDAMKRDYDTAMKK 213
           + I +NPS+SKGY+RLG A   LG  +EA + YKK L+++   +AA D + + + T   +
Sbjct: 65  ECININPSWSKGYNRLGAAHLGLGDLDEAENNYKKALELDASNKAAKDGLDQVHRTQQAR 124

Query: 214 VGQ 216
             Q
Sbjct: 125 QAQ 127

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 59/121 (48%)

Query: 96  KAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAE 155
           KAE  +LEG       D+  AV  Y+E I+  P +A  Y+NRAAA + L  + EA+ D  
Sbjct: 395 KAEEARLEGKDYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCN 454

Query: 156 DAIKVNPSYSKGYSRLGFAQYALGKPEEALDAYKKVLDIEGEAATDAMKRDYDTAMKKVG 215
            AI+ +P++ + Y R   AQ A+ +   AL+        + +    A  R+ D    K  
Sbjct: 455 KAIEKDPNFVRAYIRKATAQIAVQEYAAALETLDAARTKDADVNNGASSREIDQLYYKAS 514

Query: 216 Q 216
           Q
Sbjct: 515 Q 515

 Score = 52.0 bits (123), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 74/128 (57%), Gaps = 11/128 (8%)

Query: 75  SSSPQ-ESVKVNIPVE--DAETKAKAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNA 131
           S++PQ E  K + P+E  + ++KA+A+  K EGNK   A+ F++A+  Y++A + L  + 
Sbjct: 237 SNTPQREENKESDPMEVDEDDSKAEADKEKAEGNKFYKARQFDEAIEHYNKAWE-LHRDI 295

Query: 132 VYYANRAAAHSSLKKYEEAVKDAEDAI----KVNPSY---SKGYSRLGFAQYALGKPEEA 184
            Y  NRAAA     +Y+ A+    DA+    ++   Y   S+ ++R+G A + LG  ++ 
Sbjct: 296 TYLNNRAAAEYEKGEYKTAIATLNDAVEQGREMRADYKVISRSFARIGNAYHKLGDLKKT 355

Query: 185 LDAYKKVL 192
           ++ Y+K L
Sbjct: 356 IEYYQKSL 363

>ZYRO0A05676g Chr1 (459999..461717) [1719 bp, 572 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 572

 Score = 95.1 bits (235), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 49/110 (44%), Positives = 81/110 (73%), Gaps = 3/110 (2%)

Query: 97  AESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPT-NAVYYANRAAAHSSLKKYEEAVKDAE 155
           A+  K +GN A  AKD+ +A+  +++AI+V  T N V Y+NR+A ++S KK+EEA+KDAE
Sbjct: 3   ADEFKQQGNAAFLAKDYVKAIDLFTKAIEVSETPNHVLYSNRSACYASNKKFEEALKDAE 62

Query: 156 DAIKVNPSYSKGYSRLGFAQYALGKPEEALDAYKKVLDIE--GEAATDAM 203
           + +K++PS+SKGY+R+G AQ+ L + +EA  +YK+ L+++   +AA D +
Sbjct: 63  ECVKISPSWSKGYNRVGAAQFGLSQLDEAEKSYKRALELDSSNKAAKDGL 112

 Score = 56.2 bits (134), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 49/83 (59%)

Query: 96  KAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAE 155
           KAE  +L+G +     D+  AV  Y+E ++  P +A  ++NRAAA + L  + EA++D  
Sbjct: 379 KAEEARLQGKEFFTKGDWPNAVKAYTEMVKRAPQDARGFSNRAAALAKLMSFPEAIEDCN 438

Query: 156 DAIKVNPSYSKGYSRLGFAQYAL 178
            A+ ++P++ + Y R   AQ A+
Sbjct: 439 KAVSIDPNFVRAYIRKATAQIAV 461

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 35/111 (31%), Positives = 60/111 (54%), Gaps = 8/111 (7%)

Query: 89  EDAETKAKAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYE 148
           E+  ++  AE+ K EGNK   A+ FE+A+  Y++A + L  +  Y  NR+AA      Y+
Sbjct: 238 EEPNSRVAAEAEKAEGNKLYKARQFEEAIEHYNKAWE-LHKDITYLNNRSAAEFEKGDYD 296

Query: 149 EAVKDAEDAI----KVNPSY---SKGYSRLGFAQYALGKPEEALDAYKKVL 192
            A+K   DA+    ++   Y   +K ++R+G A Y L    +A++ Y + L
Sbjct: 297 TAIKTLNDAVEQGRELRADYKTIAKSFARIGNAYYKLKDLRKAIEHYNRSL 347

>KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 593

 Score = 94.4 bits (233), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 50/112 (44%), Positives = 77/112 (68%), Gaps = 3/112 (2%)

Query: 97  AESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPT-NAVYYANRAAAHSSLKKYEEAVKDAE 155
           AE  K +GN A  AKD+E+A   +++AI+     N V Y+NR+A  +SLKK+ EA+ DA 
Sbjct: 3   AEEFKKQGNAAFVAKDYEKASELFTKAIEASEAPNHVLYSNRSACFTSLKKFNEALNDAN 62

Query: 156 DAIKVNPSYSKGYSRLGFAQYALGKPEEALDAYKKVLDIE--GEAATDAMKR 205
           + +K+NP++SKGY+R+G A + LGK +EA   YKK L+I+   +AA D +++
Sbjct: 63  ECVKINPAWSKGYNRVGAAYFGLGKLDEAEQGYKKALEIDTSNKAAQDGLEQ 114

 Score = 55.8 bits (133), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 48/83 (57%)

Query: 96  KAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAE 155
           KAE  +L+G +     D+  AV  Y+E  +  P +A  Y+NRAAA + L  + EA+KD +
Sbjct: 400 KAEEARLQGKEYFTKGDWPNAVKAYTEMTKRAPEDARGYSNRAAALAKLMSFPEAIKDCD 459

Query: 156 DAIKVNPSYSKGYSRLGFAQYAL 178
            AI  +P++ + Y R   AQ A+
Sbjct: 460 MAISKDPNFIRAYIRKATAQIAV 482

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 36/118 (30%), Positives = 66/118 (55%), Gaps = 8/118 (6%)

Query: 82  VKVNIPVEDAETKAKAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAH 141
           ++V+ P  + ++K  A++ K EGNK   A+ F++A+  Y++A   L  +  Y  NR+AA 
Sbjct: 252 MEVDEPQPEQDSKKNADAEKAEGNKFYKARKFDEAIEHYNKAWD-LHKDVTYLNNRSAAE 310

Query: 142 SSLKKYEEAVKDAEDAI----KVNPSY---SKGYSRLGFAQYALGKPEEALDAYKKVL 192
                YE+A+K   +A+    ++   Y   SK ++R+G A   L   ++A++ Y+K L
Sbjct: 311 YEKGDYEQAIKTLTEAVEQGREMRADYKLISKSFARIGNAYLKLEDFKKAIEFYQKSL 368

>Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON}
           (197149..198921) [1773 nt, 591 aa]
          Length = 590

 Score = 94.4 bits (233), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 50/122 (40%), Positives = 83/122 (68%), Gaps = 3/122 (2%)

Query: 97  AESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPT-NAVYYANRAAAHSSLKKYEEAVKDAE 155
           A+  K +GN A  AKD+++A+  +S+AI V    N V Y+NR+A ++SLKK+  A+KDAE
Sbjct: 5   ADEYKQQGNAAFVAKDYDKAIDLFSKAIDVSEQPNHVLYSNRSACYTSLKKFVNALKDAE 64

Query: 156 DAIKVNPSYSKGYSRLGFAQYALGKPEEALDAYKKVLDIEG--EAATDAMKRDYDTAMKK 213
           + +K+NPS+SKGY+R+G A + +G  +EA   YKK L+++   +AA + +++ + T   +
Sbjct: 65  ECVKINPSWSKGYNRVGAAHFGMGDLDEAEAGYKKALELDASNKAAQEGLEQVHRTQESR 124

Query: 214 VG 215
            G
Sbjct: 125 RG 126

 Score = 60.1 bits (144), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 42/128 (32%), Positives = 60/128 (46%)

Query: 89  EDAETKAKAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYE 148
           ED     KAE  +LEG       D+  AV  Y+E I+  P +A  Y+NRAA  S L  + 
Sbjct: 389 EDYINPEKAEEARLEGKDYFTKGDWPNAVKAYTEMIKRAPEDARGYSNRAAVLSKLMSFP 448

Query: 149 EAVKDAEDAIKVNPSYSKGYSRLGFAQYALGKPEEALDAYKKVLDIEGEAATDAMKRDYD 208
           EA+ D   AI+ +P++ + Y R   AQ A+ +   AL+        + E    A  R+ D
Sbjct: 449 EAIDDCNKAIEKDPNFVRAYIRKATAQIAVREFSSALETLDAARSKDAEVNKSANTREID 508

Query: 209 TAMKKVGQ 216
               K  Q
Sbjct: 509 QLYIKASQ 516

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 52/96 (54%), Gaps = 8/96 (8%)

Query: 104 GNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAEDAI----K 159
           GNK   A+ F++AV KY+EA +    +  Y  NR+AA      YE ++K  E+A+    +
Sbjct: 270 GNKLYKARQFDEAVAKYNEAWEAH-NDITYLNNRSAAEFEKGDYETSIKTLEEAVEKGRE 328

Query: 160 VNPSY---SKGYSRLGFAQYALGKPEEALDAYKKVL 192
           +   Y   +K ++R+G     L   ++A+D YKK L
Sbjct: 329 MRADYKVIAKSFARMGNCYTKLNDLKKAIDFYKKSL 364

>YOR027W Chr15 (381053..382822) [1770 bp, 589 aa] {ON}  STI1Hsp90
           cochaperone, interacts with the Ssa group of the
           cytosolic Hsp70 chaperones and activates Ssa1p ATPase
           activity; interacts with Hsp90 chaperones and inhibits
           their ATPase activity; homolog of mammalian Hop
          Length = 589

 Score = 93.6 bits (231), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 50/123 (40%), Positives = 82/123 (66%), Gaps = 3/123 (2%)

Query: 97  AESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPT-NAVYYANRAAAHSSLKKYEEAVKDAE 155
           A+  K +GN A  AKD+++A+  +++AI+V  T N V Y+NR+A ++SLKK+ +A+ DA 
Sbjct: 5   ADEYKQQGNAAFTAKDYDKAIELFTKAIEVSETPNHVLYSNRSACYTSLKKFSDALNDAN 64

Query: 156 DAIKVNPSYSKGYSRLGFAQYALGKPEEALDAYKKVLDIEG--EAATDAMKRDYDTAMKK 213
           + +K+NPS+SKGY+RLG A   LG  +EA   YKK L+++   +AA + + + + T   +
Sbjct: 65  ECVKINPSWSKGYNRLGAAHLGLGDLDEAESNYKKALELDASNKAAKEGLDQVHRTQQAR 124

Query: 214 VGQ 216
             Q
Sbjct: 125 QAQ 127

 Score = 58.9 bits (141), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 60/121 (49%)

Query: 96  KAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAE 155
           KAE  +LEG +     D+  AV  Y+E I+  P +A  Y+NRAAA + L  + EA+ D  
Sbjct: 395 KAEEARLEGKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCN 454

Query: 156 DAIKVNPSYSKGYSRLGFAQYALGKPEEALDAYKKVLDIEGEAATDAMKRDYDTAMKKVG 215
            AI+ +P++ + Y R   AQ A+ +   AL+        + E    +  R+ D    K  
Sbjct: 455 KAIEKDPNFVRAYIRKATAQIAVKEYASALETLDAARTKDAEVNNGSSAREIDQLYYKAS 514

Query: 216 Q 216
           Q
Sbjct: 515 Q 515

 Score = 52.0 bits (123), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 42/129 (32%), Positives = 72/129 (55%), Gaps = 11/129 (8%)

Query: 74  GSSSPQ-ESVKVNIPVE--DAETKAKAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTN 130
            S +PQ E  K + P+E  + ++K +A+  K EGNK   A+ F++A+  Y++A + L  +
Sbjct: 236 SSKAPQKEESKESEPMEVDEDDSKIEADKEKAEGNKFYKARQFDEAIEHYNKAWE-LHKD 294

Query: 131 AVYYANRAAAHSSLKKYEEAVKDAEDAI----KVNPSY---SKGYSRLGFAQYALGKPEE 183
             Y  NRAAA     +YE A+    DA+    ++   Y   SK ++R+G A + LG  ++
Sbjct: 295 ITYLNNRAAAEYEKGEYETAISTLNDAVEQGREMRADYKVISKSFARIGNAYHKLGDLKK 354

Query: 184 ALDAYKKVL 192
            ++ Y+K L
Sbjct: 355 TIEYYQKSL 363

>SAKL0G07084g Chr7 (580004..581761) [1758 bp, 585 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 585

 Score = 92.8 bits (229), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 83/123 (67%), Gaps = 3/123 (2%)

Query: 97  AESLKLEGNKAMAAKDFEQAVLKYSEAIQVL-PTNAVYYANRAAAHSSLKKYEEAVKDAE 155
           A+  K +GN A AAKDFE+A+  +++AI+V    N V Y+NR+A ++S K++ +A++DA+
Sbjct: 3   ADEYKQQGNAAFAAKDFEKAIELFTKAIEVSEKPNHVLYSNRSACYTSTKQFNKALEDAK 62

Query: 156 DAIKVNPSYSKGYSRLGFAQYALGKPEEALDAYKKVLDIE--GEAATDAMKRDYDTAMKK 213
             + +NP++SKGY+R+G A + LG  +EA   YKK L+++   +AA D +++ + T   +
Sbjct: 63  QCVNINPAWSKGYNRVGAAHFGLGDLDEAEQGYKKALELDSANKAAQDGLEQVHKTQQSR 122

Query: 214 VGQ 216
             Q
Sbjct: 123 QQQ 125

 Score = 59.7 bits (143), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 55/165 (33%), Positives = 82/165 (49%), Gaps = 21/165 (12%)

Query: 35  VAIDCITEAFEFDRESVA--TTLEKTFA--GRS------LKQVVE---AASVGSSSPQES 81
            AI  +TEA E  RE  A    + K+FA  G S      LK+ +E    +     +P+  
Sbjct: 310 TAIKTLTEAVEQGRELRADYKVISKSFARIGNSYHKLNELKKAIEFYQKSLTEHRTPEIL 369

Query: 82  VKVN---IPVEDAETKA-----KAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVY 133
            K+      ++  ET+A     KAE  +L+G +     D+  AV  Y+E I+  P +A  
Sbjct: 370 TKLRNCEKELKKQETEAYIDPEKAEEARLQGKEYFTKGDWPNAVKSYTEMIKRAPEDARG 429

Query: 134 YANRAAAHSSLKKYEEAVKDAEDAIKVNPSYSKGYSRLGFAQYAL 178
           Y+NRAAA S L  + EA+KD   AI  +P++ + Y R   AQ A+
Sbjct: 430 YSNRAAALSKLMSFPEAIKDCNVAISKDPNFIRAYIRKATAQIAV 474

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 37/107 (34%), Positives = 64/107 (59%), Gaps = 8/107 (7%)

Query: 93  TKAKAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVK 152
           +KAKA++ K EGNK   A+ F++A+  YS+A + L  +  Y  NRAAA     +YE A+K
Sbjct: 255 SKAKADAEKAEGNKFYKARKFDEAIEHYSKAWE-LHKDITYLNNRAAAEYEKGEYETAIK 313

Query: 153 DAEDAI----KVNPSY---SKGYSRLGFAQYALGKPEEALDAYKKVL 192
              +A+    ++   Y   SK ++R+G + + L + ++A++ Y+K L
Sbjct: 314 TLTEAVEQGRELRADYKVISKSFARIGNSYHKLNELKKAIEFYQKSL 360

>TDEL0A04840 Chr1 (851520..853250) [1731 bp, 576 aa] {ON} Anc_5.617
           YOR027W
          Length = 576

 Score = 92.4 bits (228), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 50/117 (42%), Positives = 77/117 (65%), Gaps = 3/117 (2%)

Query: 97  AESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPT-NAVYYANRAAAHSSLKKYEEAVKDAE 155
           A+  K +GN A  AKD+E+A   + +AI V    N V Y+NR+A ++SLKK+ E +KDAE
Sbjct: 4   ADEYKQQGNAAFVAKDYEKAAELFGKAIDVSEQPNHVLYSNRSACYTSLKKFAEGLKDAE 63

Query: 156 DAIKVNPSYSKGYSRLGFAQYALGKPEEALDAYKKVLDIEGEAATDAMKRDYDTAMK 212
           + +K+NP +SKGY+R+G AQ+ L   E+A  +Y+K L++  ++A  A K   D  +K
Sbjct: 64  ECVKINPGWSKGYNRVGAAQFGLNNLEDAEKSYQKALEL--DSANKAAKEGLDQVLK 118

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 38/113 (33%), Positives = 61/113 (53%)

Query: 96  KAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAE 155
           KAE  +LEG +  +  D+  AV  Y+E I+  P +A  Y+NRAAA + L  + EA+ D +
Sbjct: 381 KAEEARLEGKEYFSKADWPNAVKAYTEMIKRSPQDARGYSNRAAALAKLMSFPEAIADCD 440

Query: 156 DAIKVNPSYSKGYSRLGFAQYALGKPEEALDAYKKVLDIEGEAATDAMKRDYD 208
            AI+ +P++ + Y R   AQ A+ +   A++    V   + E    A  R+ D
Sbjct: 441 RAIEKDPNFIRAYIRKASAQIAVKEFAAAVETLDTVRTKDSELNNGANAREID 493

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 57/103 (55%), Gaps = 8/103 (7%)

Query: 97  AESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAED 156
           AE  K EGNK   A+ F++A+  Y++A + L  +  Y  NRAAA      YE A+    +
Sbjct: 248 AEEEKAEGNKFYKARKFDEAIEHYNKAWE-LHKDITYLNNRAAAEYEKGDYETAIATLTN 306

Query: 157 AI----KVNPSY---SKGYSRLGFAQYALGKPEEALDAYKKVL 192
           A+    ++   Y   +K ++R+G A + LG  +++++ Y+K L
Sbjct: 307 AVDEGREMRADYKVIAKSFARIGNAYHKLGDLKKSINFYQKSL 349

>NCAS0G00810 Chr7 complement(138192..139946) [1755 bp, 584 aa] {ON}
           Anc_5.617
          Length = 584

 Score = 91.7 bits (226), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 70/100 (70%), Gaps = 1/100 (1%)

Query: 97  AESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPT-NAVYYANRAAAHSSLKKYEEAVKDAE 155
           A+ LK +GN A A+KDF  A+  ++EAI    T N V Y+NR+A ++SLK+++EA+ DA+
Sbjct: 4   ADELKQKGNAAFASKDFTGAIEYFTEAIAASTTPNHVLYSNRSACYTSLKQFQEALNDAQ 63

Query: 156 DAIKVNPSYSKGYSRLGFAQYALGKPEEALDAYKKVLDIE 195
             +K+NP +SKGY+R+G A   LG  ++A   YKK L+++
Sbjct: 64  QCVKINPDWSKGYNRMGAAHLGLGDLDDAESNYKKALELD 103

 Score = 63.9 bits (154), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 34/83 (40%), Positives = 50/83 (60%)

Query: 96  KAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAE 155
           KAE  +LEG +     D+  AV  Y+E I+  P +A  Y+NRAAA + L  + EA+KD E
Sbjct: 389 KAEEARLEGKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIKDCE 448

Query: 156 DAIKVNPSYSKGYSRLGFAQYAL 178
            AI+ +P++ + Y R   AQ A+
Sbjct: 449 KAIEKDPNFVRAYLRKATAQIAI 471

>KAFR0C05890 Chr3 (1165932..1167659) [1728 bp, 575 aa] {ON}
           Anc_5.617 YOR027W
          Length = 575

 Score = 90.9 bits (224), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 47/100 (47%), Positives = 71/100 (71%), Gaps = 1/100 (1%)

Query: 97  AESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPT-NAVYYANRAAAHSSLKKYEEAVKDAE 155
           A+  K EGN A  AKD+++A+  +++AI+V  T N V Y+NR+AA++S K+YE+A+ DA+
Sbjct: 5   ADEYKQEGNTAFVAKDYQKAIDAFTKAIEVSETPNHVLYSNRSAAYTSSKQYEQALSDAD 64

Query: 156 DAIKVNPSYSKGYSRLGFAQYALGKPEEALDAYKKVLDIE 195
           + IK+NPS++KGY+R G A   L K EEA   Y + L I+
Sbjct: 65  ECIKINPSWAKGYTRKGAALQGLHKYEEAEQCYNETLKID 104

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 47/83 (56%)

Query: 96  KAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAE 155
           KAE  +LEG +     D+  AV  Y+E I+  P +A  Y+NRAAA + L  + +A+ D  
Sbjct: 384 KAEEARLEGKEYFTKADWPNAVKSYTEMIKRAPDDARGYSNRAAALAKLMSFPDAISDCN 443

Query: 156 DAIKVNPSYSKGYSRLGFAQYAL 178
            AI+ +PS+ + Y R    Q A+
Sbjct: 444 KAIEKDPSFIRAYLRKATCQIAV 466

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 57/106 (53%), Gaps = 8/106 (7%)

Query: 94  KAKAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKD 153
           + +A+  K EGNKA  A+ F++A+  Y++A +    +  Y  NR+AA      YE  +K 
Sbjct: 248 RIEADKAKAEGNKAYKARQFDEAISHYNQAWETF-KDITYLNNRSAAEYEKGDYETCIKT 306

Query: 154 ----AEDAIKVNPSY---SKGYSRLGFAQYALGKPEEALDAYKKVL 192
                E+A ++   Y   +K ++R+G A   L   ++A++ Y+K L
Sbjct: 307 LTEAVENARELRTDYKIVAKSFARMGNAYAKLDDLKKAIEYYQKSL 352

>Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {ON}
           similar to Ashbya gossypii AEL224W
          Length = 584

 Score = 89.7 bits (221), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 49/110 (44%), Positives = 75/110 (68%), Gaps = 3/110 (2%)

Query: 97  AESLKLEGNKAMAAKDFEQAVLKYSEAIQ-VLPTNAVYYANRAAAHSSLKKYEEAVKDAE 155
           AE  K EGN A  AKDF++AV  ++ AIQ     N V Y+NR+ A++SLKK++EA+ DA 
Sbjct: 4   AEEYKKEGNAAFVAKDFKRAVELFTNAIQESEEPNHVLYSNRSGAYASLKKFDEALSDAT 63

Query: 156 DAIKVNPSYSKGYSRLGFAQYALGKPEEALDAYKKVLDIEG--EAATDAM 203
           + +K+   +SKG++RLG A + LG  +EA ++YKK L+++   +AA D +
Sbjct: 64  ECVKIKADWSKGHNRLGAAHFGLGNLDEAEESYKKALELDATNKAAKDGL 113

 Score = 63.2 bits (152), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 34/83 (40%), Positives = 50/83 (60%)

Query: 96  KAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAE 155
           KAE  +L+G +     D+  AV  YSE I   P +A  Y+NRAAA S L  + +A+KD +
Sbjct: 391 KAEKARLDGKEYFTKGDWPSAVKAYSEMIMRAPHDARGYSNRAAALSKLMSFPDAIKDCD 450

Query: 156 DAIKVNPSYSKGYSRLGFAQYAL 178
            AI+++PS+ + Y R   AQ A+
Sbjct: 451 KAIEIDPSFVRAYIRKATAQIAV 473

 Score = 52.8 bits (125), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 42/125 (33%), Positives = 69/125 (55%), Gaps = 14/125 (11%)

Query: 75  SSSPQESVKVNIPVEDAETKAKAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYY 134
           + +P E ++V++  E+AE KAKAE     GN+    + F++A+ KY EA   L  +  Y 
Sbjct: 242 TQTPPEPMEVDLDRENAE-KAKAE-----GNQLYKQRKFDEAIAKYEEAWN-LQKDITYL 294

Query: 135 ANRAAAHSSLKKYEEAVKDAEDAI----KVNPSY---SKGYSRLGFAQYALGKPEEALDA 187
            NRAAA      Y  A+K   +A+    ++   Y   +K ++RLG A Y L + ++A++ 
Sbjct: 295 NNRAAAEYEKGDYNSAIKTLNEAVEQGRELRADYKVIAKSFARLGNAYYKLDEVKKAVEY 354

Query: 188 YKKVL 192
           Y+K L
Sbjct: 355 YEKSL 359

>Skud_15.192 Chr15 (340847..342616) [1770 bp, 589 aa] {ON} YOR027W
           (REAL)
          Length = 589

 Score = 89.4 bits (220), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 82/123 (66%), Gaps = 3/123 (2%)

Query: 97  AESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPT-NAVYYANRAAAHSSLKKYEEAVKDAE 155
           A+  K +GN A  AK+++ A+  +++AI+V  T + V ++NR+A ++SLKK+ +A+ DA 
Sbjct: 5   ADEYKQQGNAAFTAKNYDGAIELFTKAIEVSETPSHVLFSNRSACYTSLKKFSDALNDAN 64

Query: 156 DAIKVNPSYSKGYSRLGFAQYALGKPEEALDAYKKVLDIEG--EAATDAMKRDYDTAMKK 213
           + +K+NPS+SKGY+RLG A   LG  +EA   YKK L+++   +AA D +++ + T   +
Sbjct: 65  ECVKINPSWSKGYNRLGAAHLGLGDLDEAESDYKKALELDANNKAAKDGLEQVHRTQQAR 124

Query: 214 VGQ 216
             Q
Sbjct: 125 QAQ 127

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 32/83 (38%), Positives = 49/83 (59%)

Query: 96  KAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAE 155
           KAE  +LEG +     D+  AV  Y+E I+  P +A  Y+NRAAA + L  + EA+ D  
Sbjct: 395 KAEEARLEGKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCN 454

Query: 156 DAIKVNPSYSKGYSRLGFAQYAL 178
            AI+ +P++ + Y R+  AQ A+
Sbjct: 455 KAIEKDPNFVRAYIRMAAAQIAV 477

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 61/112 (54%), Gaps = 8/112 (7%)

Query: 88  VEDAETKAKAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKY 147
           V++  +KA+A++ K EGNK   A  F++A+  Y+ A + L  +  Y  NRAAA      Y
Sbjct: 253 VDEDNSKAEADNEKAEGNKFYKAHQFDEAIEHYNRAWE-LHKDITYLNNRAAAEYEKGDY 311

Query: 148 EEAVKDAEDAIK----VNPSY---SKGYSRLGFAQYALGKPEEALDAYKKVL 192
           E  +    DA++    +   Y   SK ++R+G A + LG  ++ ++ Y+K L
Sbjct: 312 ETVIATLNDAVEKGRDMRADYKVISKSFARIGNAYHKLGDLKKTIEYYQKSL 363

>TBLA0E03300 Chr5 complement(827677..829425) [1749 bp, 582 aa] {ON}
           Anc_5.617 YOR027W
          Length = 582

 Score = 89.0 bits (219), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 79/110 (71%), Gaps = 3/110 (2%)

Query: 97  AESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPT-NAVYYANRAAAHSSLKKYEEAVKDAE 155
           A+  K +GN A  AK++++A+ K+++AI+V  T N V Y+NR+A ++S K++ + ++DA 
Sbjct: 5   AQEYKDQGNAAFVAKNYDEAIEKFTKAIEVSETPNHVLYSNRSACYTSKKQFVKGLEDAN 64

Query: 156 DAIKVNPSYSKGYSRLGFAQYALGKPEEALDAYKKVLDIE--GEAATDAM 203
           + +K+NP++SKGY+R+G A + +G  +EA  AYKK L+++   +AA D +
Sbjct: 65  ECVKINPTWSKGYNRVGAAHFGMGDLDEAEKAYKKALELDSSNKAAHDGL 114

 Score = 58.5 bits (140), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 33/83 (39%), Positives = 48/83 (57%)

Query: 96  KAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAE 155
           KAE  +LEG +     D+  AV  Y+E I   P++A  Y+NRAAA S L  + EA+ D  
Sbjct: 388 KAEEARLEGKEYFTKGDWPNAVKAYTEMIARDPSDARGYSNRAAALSKLMSFPEAITDCN 447

Query: 156 DAIKVNPSYSKGYSRLGFAQYAL 178
            AI+ +P++ + Y R   AQ A+
Sbjct: 448 TAIEKDPNFIRAYIRKATAQIAI 470

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 67/128 (52%), Gaps = 13/128 (10%)

Query: 77  SPQESVKVNIPVEDA-----ETKAKAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNA 131
           +P++S  V  P E+A     E+K  A++ K EGNK   A  F++A+  Y++A + L  + 
Sbjct: 230 TPKKSETVPEPKEEASTPEDESKIAADAEKAEGNKLYKAHKFDEAIEHYNKAWE-LHNDI 288

Query: 132 VYYANRAAAHSSLKKYEEAVKDAEDAI----KVNPSY---SKGYSRLGFAQYALGKPEEA 184
            Y  NR+AA      Y+ A++   +A+    ++   Y   +K ++R+  +   L   + A
Sbjct: 289 TYLNNRSAAEFEKGDYQTAIETLHEAVEKGREMRADYKLVAKSFTRIANSYMKLNDIKSA 348

Query: 185 LDAYKKVL 192
           ++ Y+K L
Sbjct: 349 INYYQKSL 356

>Suva_8.80 Chr8 (142691..144451) [1761 bp, 586 aa] {ON} YOR027W
           (REAL)
          Length = 586

 Score = 88.6 bits (218), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 47/110 (42%), Positives = 75/110 (68%), Gaps = 3/110 (2%)

Query: 97  AESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPT-NAVYYANRAAAHSSLKKYEEAVKDAE 155
           A+  K +GN A  AKD+ +A+  +++AI+V    N V Y+NR+A ++SLKK+ +A+ DA 
Sbjct: 5   ADEYKQQGNAAFTAKDYGKAIDLFTKAIEVSEAPNHVLYSNRSACYTSLKKFTDALNDAT 64

Query: 156 DAIKVNPSYSKGYSRLGFAQYALGKPEEALDAYKKVLDIEG--EAATDAM 203
           + +K+NPS+SKGY+RLG A   LG  ++A   YKK L+++   +AA D +
Sbjct: 65  ECVKINPSWSKGYNRLGAAHLGLGDLDDAESNYKKALELDAANKAAKDGL 114

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 32/83 (38%), Positives = 48/83 (57%)

Query: 96  KAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAE 155
           KAE  +LEG +     D+  AV  Y+E I+  P +A  Y+NRAAA + L  + EA+ D  
Sbjct: 392 KAEEARLEGKEYFTKSDWPNAVKAYTEMIKRSPEDARGYSNRAAALAKLMSFPEAIADCN 451

Query: 156 DAIKVNPSYSKGYSRLGFAQYAL 178
            AI+ +P++ + Y R   AQ A+
Sbjct: 452 KAIEKDPNFVRAYIRKATAQIAV 474

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 44/136 (32%), Positives = 72/136 (52%), Gaps = 10/136 (7%)

Query: 66  QVVEAASVGSSSPQESVKVNIPVE--DAETKAKAESLKLEGNKAMAAKDFEQAVLKYSEA 123
           Q  ++ S   +  QE  K   P+E  + ++K +A+  K EGNK   A+ FE+A+  Y++A
Sbjct: 226 QTTKSESSSKAPQQEETKEAEPMEVDEDDSKVEADKEKAEGNKFYKARQFEEAIEHYNKA 285

Query: 124 IQVLPTNAVYYANRAAAHSSLKKYEEAVKDAEDAI----KVNPSY---SKGYSRLGFAQY 176
            + L  +  Y  NRAAA      YE A+    DA+    ++   Y   SK ++R+G A +
Sbjct: 286 WE-LHRDITYLNNRAAAEYEKGDYETAIATLTDAVEQGREMRADYKVISKSFARIGNAYH 344

Query: 177 ALGKPEEALDAYKKVL 192
            LG  ++ +D Y+K L
Sbjct: 345 KLGDLKKTIDNYQKSL 360

>KLLA0A07062g Chr1 complement(636546..638291) [1746 bp, 581 aa] {ON}
           highly similar to uniprot|P15705 Saccharomyces
           cerevisiae YOR027W STI1 Heat shock protein also induced
           by canavanine and entry into stationary phase
          Length = 581

 Score = 88.6 bits (218), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 46/110 (41%), Positives = 77/110 (70%), Gaps = 3/110 (2%)

Query: 97  AESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPT-NAVYYANRAAAHSSLKKYEEAVKDAE 155
           A+  K EGN+A A+KD+ +A+  +++AI+V    N V ++NR+A ++S K + +A+ DA 
Sbjct: 3   ADQFKQEGNQAFASKDYAKAIELFTKAIEVSEQPNHVLFSNRSACYASNKDFVKALDDAN 62

Query: 156 DAIKVNPSYSKGYSRLGFAQYALGKPEEALDAYKKVLDIE--GEAATDAM 203
           + +K+NPS++KGY+RLG A Y LG  +EA  +YKK L+++   +AA D +
Sbjct: 63  ECVKINPSWAKGYNRLGAAHYGLGDLDEAEQSYKKALELDSANKAAQDGL 112

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 63/122 (51%)

Query: 96  KAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAE 155
           KAE  +L+G +     D+ +AV  Y+E I+  P +A  Y+NRAAA S L  + +A++D +
Sbjct: 388 KAEEARLQGKEYFTKADWPKAVEAYTEMIKRNPNDARGYSNRAAALSKLMSFADAIRDCD 447

Query: 156 DAIKVNPSYSKGYSRLGFAQYALGKPEEALDAYKKVLDIEGEAATDAMKRDYDTAMKKVG 215
            AI+ +P++ + Y R    Q A+     A++        + E  + A  R+ D    K  
Sbjct: 448 KAIEKDPNFVRAYIRKATGQIAIKDYAGAIETLDSARTKDAEVNSGANTREIDQLYIKAS 507

Query: 216 QS 217
           Q+
Sbjct: 508 QA 509

 Score = 56.2 bits (134), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 63/113 (55%), Gaps = 8/113 (7%)

Query: 87  PVEDAETKAKAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKK 146
           P+E  + K+KAE+ K EGNK    + F++A+ KY+EA +    +  Y  NRAAA      
Sbjct: 245 PMEVDDDKSKAEAAKAEGNKLYKQRKFDEAIEKYNEAWETH-NDITYLNNRAAAEYEKGD 303

Query: 147 YEEAV----KDAEDAIKVNPSY---SKGYSRLGFAQYALGKPEEALDAYKKVL 192
           YE A+    K  E   ++   Y   SK ++R+G + + LG  ++A+D Y+K L
Sbjct: 304 YEAAIETLTKAVEQGRELRADYKVISKSFARMGNSYHKLGDLKKAIDYYEKSL 356

>KNAG0B03200 Chr2 complement(619530..621269) [1740 bp, 579 aa] {ON}
           Anc_5.617 YOR027W
          Length = 579

 Score = 85.5 bits (210), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 43/101 (42%), Positives = 73/101 (72%), Gaps = 1/101 (0%)

Query: 97  AESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPT-NAVYYANRAAAHSSLKKYEEAVKDAE 155
           A+  K +GN A AAK +++AV  +++AI+V  T N V Y+NR+A+++S +K+ EA+KDA 
Sbjct: 5   ADEYKQQGNSAFAAKKYDEAVDLFTKAIEVSETPNHVLYSNRSASYASEQKFNEALKDAL 64

Query: 156 DAIKVNPSYSKGYSRLGFAQYALGKPEEALDAYKKVLDIEG 196
           +  K+NPS++KGY+R G A + +G  ++A  +YKK L+++ 
Sbjct: 65  ECTKINPSWAKGYTREGAAHFGMGNLDDAEASYKKALELDA 105

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 32/83 (38%), Positives = 48/83 (57%)

Query: 96  KAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAE 155
           KAE  +LEG +     D+  AV  Y+E I+  P +A  Y+NRAAA S L  + +A+ D  
Sbjct: 384 KAEEARLEGKEYFTKGDWPSAVKAYTEMIKRAPEDARGYSNRAAALSKLMSFPDAISDCN 443

Query: 156 DAIKVNPSYSKGYSRLGFAQYAL 178
            AI+ +P++ + Y R   AQ A+
Sbjct: 444 KAIEKDPNFVRAYIRKATAQIAV 466

 Score = 56.2 bits (134), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 38/112 (33%), Positives = 65/112 (58%), Gaps = 8/112 (7%)

Query: 88  VEDAETKAKAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKY 147
           V+  E+K  AE  K+EGNKA  A++F++A+  Y++A + L  N  Y  NR+AA     +Y
Sbjct: 242 VDQDESKVAAEEAKVEGNKAYKARNFDEAIACYNKAWE-LDNNITYLNNRSAAEFEKGEY 300

Query: 148 EEAVKDAEDAI----KVNPSY---SKGYSRLGFAQYALGKPEEALDAYKKVL 192
           + A+    +AI    ++   Y   +K ++R+G A   +G  +EA++ Y+K L
Sbjct: 301 DTAINTLNEAIEKGREMRADYKIIAKSFARIGNAYVKMGNLKEAINHYQKSL 352

>NCAS0A00490 Chr1 complement(76652..78514) [1863 bp, 620 aa] {ON} 
          Length = 620

 Score = 77.0 bits (188), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 63/99 (63%), Gaps = 1/99 (1%)

Query: 97  AESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTN-AVYYANRAAAHSSLKKYEEAVKDAE 155
           ++ LK  GNK    K +EQAV  ++ A+    TN  + Y+NRAAAH  LK Y EA++D +
Sbjct: 8   SQELKELGNKTYKEKGYEQAVHYFTSALSQPSTNKHILYSNRAAAHIGLKHYAEALEDGK 67

Query: 156 DAIKVNPSYSKGYSRLGFAQYALGKPEEALDAYKKVLDI 194
           + +++ P++ KGYSR+G A   L K +EA + +KK L +
Sbjct: 68  NCVELAPNWDKGYSRVGVAYLGLQKLDEAEENFKKALQL 106

 Score = 62.8 bits (151), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 52/93 (55%)

Query: 96  KAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAE 155
           K E  ++EG +    +++ +A+  Y+E I+  PT+ V + NRAA    L    + + D +
Sbjct: 428 KFEEARIEGKQHFLNREYFKAMKCYTEMIKTNPTSPVGWCNRAAVFEKLLTCPQVIDDCD 487

Query: 156 DAIKVNPSYSKGYSRLGFAQYALGKPEEALDAY 188
            AI V+PSY K Y R GFAQ      +EAL+ +
Sbjct: 488 KAISVDPSYIKAYVRKGFAQITERDLDEALETW 520

 Score = 38.5 bits (88), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 31/115 (26%), Positives = 52/115 (45%), Gaps = 8/115 (6%)

Query: 89  EDAETKAKAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYE 148
           E+ E K +A+  K  GN     ++F++A++ Y++A      +  Y  N  AA      Y 
Sbjct: 287 EETEKKRRADEEKRIGNDLYKKRNFKEAIIHYTKAWNTF-QDITYLNNIGAAQFERGDYG 345

Query: 149 EAVKDAEDAI----KVNPS---YSKGYSRLGFAQYALGKPEEALDAYKKVLDIEG 196
             +K    A+      NP     +K Y R+G A + +   E A+ AY+  L + G
Sbjct: 346 NVLKSLGQAVFFAEHTNPEPQVLAKSYIRMGNAYHRIWDHEHAITAYEYGLMLNG 400

>KAFR0B06610 Chr2 (1372434..1373969) [1536 bp, 511 aa] {ON}
           Anc_3.481 YGR123C
          Length = 511

 Score = 67.4 bits (163), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 36/96 (37%), Positives = 56/96 (58%)

Query: 97  AESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAED 156
           A S K EGNK +  +DF++A   Y++AI+  PT +++Y+NRA A+  L  +  A+ D  +
Sbjct: 9   ATSYKDEGNKFLKQQDFQRANELYTKAIETDPTQSIFYSNRALANLKLDNFMNALNDCTN 68

Query: 157 AIKVNPSYSKGYSRLGFAQYALGKPEEALDAYKKVL 192
           AI++N S  K Y R G A   L   + A + +  VL
Sbjct: 69  AIELNSSNLKAYHRRGLANIGLLNFKSARNDFNIVL 104

>TDEL0D05500 Chr4 complement(991567..993105) [1539 bp, 512 aa] {ON}
           Anc_3.481 YGR123C
          Length = 512

 Score = 66.2 bits (160), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 63/102 (61%)

Query: 91  AETKAKAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEA 150
           +E  A+A  LK EGN  +  +DF +A+  Y++AI +  T ++Y++NRA AH  L  ++ +
Sbjct: 6   SEQSAEALKLKNEGNIFIKKQDFTKAIDLYTKAIGLDSTQSIYFSNRALAHLKLDNFQSS 65

Query: 151 VKDAEDAIKVNPSYSKGYSRLGFAQYALGKPEEALDAYKKVL 192
           + D ++A+K++P  +K Y R G +   L + ++A +  + VL
Sbjct: 66  LNDCDEALKLDPKNAKAYHRRGLSYIGLLEFKKAKNDLQIVL 107

>AAR083C Chr1 complement(492375..493991) [1617 bp, 538 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR123C
           (PPT1)
          Length = 538

 Score = 65.9 bits (159), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 63/121 (52%), Gaps = 6/121 (4%)

Query: 58  TFAGRSLKQVVEAASVGSSSPQESVKVNIPVEDAETKAKAESLKLEGNKAMAAKDFEQAV 117
           T AGR+          GS  P        P  D+ T A A   K EGN+ + AKD+ +AV
Sbjct: 5   TCAGRARNACYVRTVAGSGHPSP------PRRDSMTAATALDYKNEGNEWVKAKDYARAV 58

Query: 118 LKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAEDAIKVNPSYSKGYSRLGFAQYA 177
             Y+ AI+   T +++++NRA A+  L +++ A++D+  AI+++    K Y R G A   
Sbjct: 59  EAYTRAIEADGTQSIFFSNRALANLKLDRFQSALEDSARAIELDAGNVKAYHRRGLAHCG 118

Query: 178 L 178
           L
Sbjct: 119 L 119

>YGR123C Chr7 complement(736662..738203) [1542 bp, 513 aa] {ON}
           PPT1Protein serine/threonine phosphatase, regulates
           Hsp90 chaperone by affecting its ATPase and cochaperone
           binding activities; has similarity to human phosphatase
           PP5; present in both the nucleus and cytoplasm;
           expressed during logarithmic growth
          Length = 513

 Score = 65.5 bits (158), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 34/88 (38%), Positives = 53/88 (60%)

Query: 91  AETKAKAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEA 150
           A  +AKA   K EGN  +  K F +A+ KY+EAI +  T ++Y++NRA AH  +  ++ A
Sbjct: 6   AADRAKALERKNEGNVFVKEKHFLKAIEKYTEAIDLDSTQSIYFSNRAFAHFKVDNFQSA 65

Query: 151 VKDAEDAIKVNPSYSKGYSRLGFAQYAL 178
           + D ++AIK++P   K Y R   +  AL
Sbjct: 66  LNDCDEAIKLDPKNIKAYHRRALSCMAL 93

>Skud_7.432 Chr7 complement(715852..717393) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 65.5 bits (158), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 42/136 (30%), Positives = 68/136 (50%), Gaps = 26/136 (19%)

Query: 94  KAKAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKD 153
           + KA   K EGN  +  K F +A+ KY+EAI +  T  +Y++NRA +H  +  ++ A+ D
Sbjct: 9   RVKAHERKNEGNVLVKEKHFLKAIEKYTEAIDLDSTQTIYFSNRALSHFKVDNFQSALND 68

Query: 154 AEDAIKVNPSYSKGYSRLGFAQYALGKPEEALDAYKKVLDIEGEAATDAMKRDYDTAMKK 213
            ++AIK++P   K Y R   +  AL + ++A                   KRD +  +K 
Sbjct: 69  CDEAIKLDPKNIKAYHRRALSCMALLEFKKA-------------------KRDLNVLLK- 108

Query: 214 VGQSLNVEKSAPAATR 229
                 V+ + PAATR
Sbjct: 109 ------VKPNDPAATR 118

>KLLA0F24046g Chr6 (2240454..2242268) [1815 bp, 604 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 604

 Score = 65.1 bits (157), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 49/147 (33%), Positives = 81/147 (55%), Gaps = 7/147 (4%)

Query: 97  AESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAED 156
           A +LK +GN+   AKDFE+A+  Y+ AI  L  + V+Y+NR+AA+ S+  +E+ V+D   
Sbjct: 104 ALALKDKGNEFFKAKDFEKAIEYYTLAIS-LKEDPVFYSNRSAAYVSINNFEKVVEDTTA 162

Query: 157 AIKVNPSYSKGYSRLGFAQYALGKPEEA---LDAYKKVLDIEGEAATDAMKRDYD-TAMK 212
           A+K+ P YSK + R   A   LG+  +A   L A   + +  G++    ++R+ +  A K
Sbjct: 163 ALKLKPDYSKCWLRRASAYENLGQFSDAMFDLSAVSLLGEYSGQSVEQLLERNMNKQATK 222

Query: 213 KVGQSL--NVEKSAPAATRDGAGSATG 237
            +G+ L  N  K +P  +     S  G
Sbjct: 223 VLGEKLKENQGKESPLPSNTSLASFFG 249

>Smik_6.215 Chr6 complement(354154..355695) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 64.3 bits (155), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 51/84 (60%)

Query: 95  AKAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDA 154
           AKA   K EGN  +  K F +A+ KY+EAI +  T ++Y++NRA AH  +  ++ A+ D 
Sbjct: 10  AKALERKNEGNVFVKEKHFLKAIEKYTEAIDLDATQSIYFSNRAFAHFKVDNFQSALNDC 69

Query: 155 EDAIKVNPSYSKGYSRLGFAQYAL 178
           ++AIK++P   K Y R   +  AL
Sbjct: 70  DEAIKLDPKNIKAYHRRALSCMAL 93

>KNAG0A07900 Chr1 complement(1258164..1259702) [1539 bp, 512 aa]
           {ON} Anc_3.481 YGR123C
          Length = 512

 Score = 63.9 bits (154), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 55/89 (61%), Gaps = 3/89 (3%)

Query: 90  DAETKAKAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEE 149
           DAE   K    K EGN  + ++D+++A+  Y++AI++  T++++Y+NRA AH  L  ++ 
Sbjct: 8   DAEAALK---FKDEGNVYIKSQDYQKAIELYTKAIELDSTSSIFYSNRALAHLKLDNFQS 64

Query: 150 AVKDAEDAIKVNPSYSKGYSRLGFAQYAL 178
           A+ D  DAIK++ +  K Y R G A   L
Sbjct: 65  ALHDCNDAIKLDNNNIKAYHRRGLAYVGL 93

>NCAS0F03490 Chr6 complement(698757..700295) [1539 bp, 512 aa] {ON}
           Anc_3.142 YDL047W
          Length = 512

 Score = 62.8 bits (151), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 61/102 (59%)

Query: 91  AETKAKAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEA 150
           A+ K +A + K EGN  +  +++ +A+  YS+AI++ PT +++++NRA A   L  ++  
Sbjct: 6   ADAKEQAVAFKNEGNTYIKEQNYMKAIELYSQAIELDPTQSIFFSNRALAQLKLDNFQSC 65

Query: 151 VKDAEDAIKVNPSYSKGYSRLGFAQYALGKPEEALDAYKKVL 192
           + D + A++++P   K Y R G +   L + ++A +  + VL
Sbjct: 66  MNDCDVALRLDPKNIKAYHRRGLSHLGLLQCKKARNDLQVVL 107

>Suva_7.408 Chr7 complement(706942..708483) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 62.0 bits (149), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 51/85 (60%)

Query: 94  KAKAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKD 153
           +A A   K EGN  +  K F +A+ KY++AI +  T ++Y++NRA AH  +  ++ A+ D
Sbjct: 9   RANALERKNEGNVFIKEKHFLKAIEKYTQAIDLDSTQSIYFSNRAFAHFKVDNFQSALND 68

Query: 154 AEDAIKVNPSYSKGYSRLGFAQYAL 178
            ++A+K++P   K Y R   +  AL
Sbjct: 69  CDEALKLDPKNIKAYHRRALSCMAL 93

>SAKL0F03102g Chr6 (258266..259807) [1542 bp, 513 aa] {ON} highly
           similar to uniprot|P53043 Saccharomyces cerevisiae
           YGR123C
          Length = 513

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 54/97 (55%)

Query: 96  KAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAE 155
           KA   K +GN  +  K+F +A   YS+AI++  T ++Y++NRA AH  L  ++ A+ D  
Sbjct: 11  KALEFKNQGNVFIKGKNFSKAAELYSKAIELDGTQSIYFSNRAFAHLKLDNFQTALNDCN 70

Query: 156 DAIKVNPSYSKGYSRLGFAQYALGKPEEALDAYKKVL 192
            AI+++P   K Y R G +   L +  +A    K VL
Sbjct: 71  KAIELDPKNVKAYHRRGLSYIGLLEFNKARKDLKIVL 107

>CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {ON}
           highly similar to uniprot|P53043 Saccharomyces
           cerevisiae YGR123c PPT1 protein ser/thr phosphatase
          Length = 510

 Score = 60.8 bits (146), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 48/83 (57%)

Query: 96  KAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAE 155
           KA   K EGN  +  +D+ +A+ KY +AI++  T +VY++NRA  H  L  ++ A +D +
Sbjct: 8   KALEYKNEGNACVKVQDYAKAIEKYDKAIELDDTQSVYFSNRALCHLKLDNFQCASQDCD 67

Query: 156 DAIKVNPSYSKGYSRLGFAQYAL 178
            A+ ++P   K Y R G A   L
Sbjct: 68  KALALDPKNVKAYHRRGLACVGL 90

>Ecym_4413 Chr4 complement(856330..857862) [1533 bp, 510 aa] {ON}
           similar to Ashbya gossypii AAR083C
          Length = 510

 Score = 60.8 bits (146), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 28/76 (36%), Positives = 52/76 (68%)

Query: 103 EGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAEDAIKVNP 162
           +GNK +A+KD+ QA+  Y++AI++    +++++NRA A+  L +++ A++D+  AI+++ 
Sbjct: 15  QGNKFVASKDYGQAIEAYTKAIELDGCQSIFFSNRALANLKLDRFQSALEDSSKAIELDS 74

Query: 163 SYSKGYSRLGFAQYAL 178
           S  KGY R G A   L
Sbjct: 75  SNVKGYHRRGMAYAGL 90

>TBLA0C03950 Chr3 complement(950339..951877) [1539 bp, 512 aa] {ON}
           Anc_3.481 YGR123C
          Length = 512

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 37/120 (30%), Positives = 62/120 (51%), Gaps = 2/120 (1%)

Query: 95  AKAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDA 154
           AKA   K  GN A+  +D+  A+  Y+EAI++  T ++Y++NRA  H  +  ++  + D 
Sbjct: 10  AKALEFKNRGNDAIKTQDYPGAIELYTEAIKLDDTVSIYFSNRAMGHLKMDNFQSGINDC 69

Query: 155 EDAIKVNPSYSKGYSRLGFAQYALGKPEEALDAYKKVLDIEGEAATDAMKRDYDTAMKKV 214
           + A++++P   K Y R G +   L + + A    K VL  +   AT   KR  D   K +
Sbjct: 70  DKALEIDPKNIKAYHRRGMSYIGLLEFKNAQKDLKIVLASKPNDAT--AKRGLDVCEKFI 127

>NDAI0B05790 Chr2 complement(1406039..1407610) [1572 bp, 523 aa]
           {ON} Anc_3.481
          Length = 523

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 29/88 (32%), Positives = 50/88 (56%)

Query: 91  AETKAKAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEA 150
            E   +A  LK EGNK +  K + +AV  Y++AI++  T +++++NRA A   L  ++  
Sbjct: 7   TEAAQQAIDLKNEGNKYIKEKKYTKAVEYYTKAIELDSTQSIFFSNRALAQLKLDNFQSC 66

Query: 151 VKDAEDAIKVNPSYSKGYSRLGFAQYAL 178
           + D   A++++P   K Y R G +Q  L
Sbjct: 67  LDDCNSALELDPKNIKAYHRRGLSQLGL 94

>KNAG0A03950 Chr1 complement(529620..530780) [1161 bp, 386 aa] {ON}
           Anc_8.506 YBR155W
          Length = 386

 Score = 58.5 bits (140), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 53/105 (50%), Gaps = 4/105 (3%)

Query: 97  AESLKLEGNKAMAAKDFEQAVLKYSEAIQVL----PTNAVYYANRAAAHSSLKKYEEAVK 152
           AE+ K + N     K F  A   Y++ I+V       N   +ANRAA    LK Y   V 
Sbjct: 85  AENFKNQANDLYKVKRFRDARELYTKGIKVFCEDKSINESLFANRAACELELKNYRSCVA 144

Query: 153 DAEDAIKVNPSYSKGYSRLGFAQYALGKPEEALDAYKKVLDIEGE 197
           D + A+++NP   K + R+G A  ALGK +EA DA    L I+ E
Sbjct: 145 DCQKAMEINPMNLKCFYRMGKAFLALGKFKEAHDAVSFGLKIDEE 189

>AGL268C Chr7 complement(205872..207011) [1140 bp, 379 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR155W
           (CNS1)
          Length = 379

 Score = 58.2 bits (139), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 40/115 (34%), Positives = 57/115 (49%), Gaps = 6/115 (5%)

Query: 90  DAETKAKAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNA----VYYANRAAAHSSLK 145
           D E    AE+ K +GN     K F  A + Y++ I+V   +A    +   NRAA    LK
Sbjct: 70  DGEPHEVAENFKNQGNDLYKVKRFRDARVMYNKGIEVKCDDAGISELLLLNRAACELELK 129

Query: 146 KYEEAVKDAEDAIKVNPSYSKGYSRLGFAQYALGKPEEALDA--YKKVLDIEGEA 198
            Y   + D  +A+K+NP   K + R+G A   L K EEA +A  +   +D E EA
Sbjct: 130 NYRRCINDCREALKLNPKNPKAFFRIGKAFLQLDKLEEAAEAVDFGLRVDTENEA 184

>Kpol_505.41 s505 complement(91130..92671) [1542 bp, 513 aa] {ON}
           complement(91130..92671) [1542 nt, 514 aa]
          Length = 513

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 55/102 (53%)

Query: 91  AETKAKAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEA 150
           AE  AKA   K EGN  +  +++ +A+  Y++AI++ P  +++Y+NRA A   L  ++ A
Sbjct: 6   AEDIAKAVEFKNEGNVFIKEQNYSKAIELYTKAIELDPNQSIFYSNRALAQLKLDNFQSA 65

Query: 151 VKDAEDAIKVNPSYSKGYSRLGFAQYALGKPEEALDAYKKVL 192
             D  +A+ ++    K Y R G A   L + + A +    VL
Sbjct: 66  YNDCNEALTLDSKNVKAYHRRGLANVGLLEFKRARNDLNVVL 107

>NCAS0B02400 Chr2 complement(402763..403905) [1143 bp, 380 aa] {ON}
           Anc_8.506 YBR155W
          Length = 380

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 48/99 (48%), Gaps = 4/99 (4%)

Query: 90  DAETKAKAESLKLEGNKAMAAKDFEQAVLKYSEAIQVL----PTNAVYYANRAAAHSSLK 145
           + E    AE+ K +GN     K F +A   Y++ I++       N   +ANRAA    LK
Sbjct: 73  EGEPHEVAENFKNQGNDLFTVKRFREARDIYNKGIEIKCENDKINEALFANRAACQLELK 132

Query: 146 KYEEAVKDAEDAIKVNPSYSKGYSRLGFAQYALGKPEEA 184
            Y   + D + A+ +NP   K Y R+G A Y L   EEA
Sbjct: 133 NYRSCINDCKHALTLNPKNIKCYYRMGKAFYLLNNIEEA 171

>TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {ON}
           Anc_3.481 YGR123C
          Length = 513

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 41/148 (27%), Positives = 69/148 (46%), Gaps = 18/148 (12%)

Query: 92  ETKAKAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAV 151
           E  A A   K +GN+ +   D++ A+  YS+AI +  T ++Y++NRA AH     +  AV
Sbjct: 7   EDIATALDFKNKGNEYIKKSDYDSAIEFYSKAIALDSTQSIYFSNRALAHLKQDNFYSAV 66

Query: 152 KDAEDAIKVNPSYSKGYSRLGFAQYALGKPEEALDAYKKVLD------------------ 193
            D ++A+K++P   K Y R G +   + +  +A +    VL                   
Sbjct: 67  VDCDNALKLDPKNIKAYHRRGLSYVGILEFRKAKNDLNVVLKAKPNDITASNALKVCENF 126

Query: 194 IEGEAATDAMKRDYDTAMKKVGQSLNVE 221
           I  E   +A+    D A   + Q+LN+E
Sbjct: 127 IREERFKNAIGGSGDNAKSNICQTLNLE 154

>CAGL0H07425g Chr8 (725307..726449) [1143 bp, 380 aa] {ON} highly
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155w CNS1
          Length = 380

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 35/95 (36%), Positives = 49/95 (51%), Gaps = 4/95 (4%)

Query: 97  AESLKLEGNKAMAAKDFEQAVLKYSEAI----QVLPTNAVYYANRAAAHSSLKKYEEAVK 152
           AE+ K +GN     K F  A   YS+ I    QV   N   YANRAA    +K Y   + 
Sbjct: 81  AENFKKQGNDLYKVKRFRDARELYSKGIDVKCQVNTINESLYANRAACELEIKNYRRCIN 140

Query: 153 DAEDAIKVNPSYSKGYSRLGFAQYALGKPEEALDA 187
           D + A+++NP   K Y R+  A  AL + +EAL++
Sbjct: 141 DCKQALQLNPKNIKCYYRIAKAFTALERLDEALES 175

>Kwal_33.14767 s33 complement(809994..811778) [1785 bp, 594 aa] {ON}
           YHR117W (TOM71) - 71-kDa component of the protein
           translocase of the outer membrane of mitochondria
           [contig 101] FULL
          Length = 594

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 40/96 (41%), Positives = 57/96 (59%), Gaps = 2/96 (2%)

Query: 91  AETKAK-AESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEE 149
           AE K K A  LK +GN+    K FE A+  YS AI+V   + V+Y+NR+A + SL + E+
Sbjct: 89  AEEKDKFAMGLKDKGNEFFKNKQFEDALKYYSLAIEV-KEDPVFYSNRSACYVSLGQQEK 147

Query: 150 AVKDAEDAIKVNPSYSKGYSRLGFAQYALGKPEEAL 185
            V+D   A+K+ P YSK   R   A  +LGK  +A+
Sbjct: 148 VVEDTTAALKLKPDYSKCLLRRASANESLGKFADAM 183

>YBR155W Chr2 (549771..550928) [1158 bp, 385 aa] {ON}
           CNS1TPR-containing co-chaperone; binds both Hsp82p
           (Hsp90) and Ssa1p (Hsp70) and stimulates the ATPase
           activity of SSA1, ts mutants reduce Hsp82p function
           while over expression suppresses the phenotypes of an
           HSP82 ts allele and a cpr7 deletion
          Length = 385

 Score = 55.5 bits (132), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 46/92 (50%), Gaps = 4/92 (4%)

Query: 97  AESLKLEGNKAMAAKDFEQAVLKYSEAIQV----LPTNAVYYANRAAAHSSLKKYEEAVK 152
           AE+ K +GN+   AK F+ A   YS+ + V       N   YANRAA    LK Y   ++
Sbjct: 83  AENFKKQGNELYKAKRFKDARELYSKGLAVECEDKSINESLYANRAACELELKNYRRCIE 142

Query: 153 DAEDAIKVNPSYSKGYSRLGFAQYALGKPEEA 184
           D   A+ +NP   K Y R   A + L K EEA
Sbjct: 143 DCSKALTINPKNVKCYYRTSKAFFQLNKLEEA 174

>CAGL0L04048g Chr12 (476407..478170) [1764 bp, 587 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121c TOM70
           or uniprot|P38825 Saccharomyces cerevisiae YHR117w TOM7
          Length = 587

 Score = 55.5 bits (132), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 51/161 (31%), Positives = 79/161 (49%), Gaps = 15/161 (9%)

Query: 89  EDAETKAKAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYE 148
           E AE    A  LK  GN     KD+E A+  Y  A+Q L  + V+Y+N AA + SL+  +
Sbjct: 78  ETAEKNEYASELKKRGNAYFKVKDYENAINYYKFALQ-LKNDPVFYSNMAACYISLEHNK 136

Query: 149 EAVKDAEDAIKVNPSYSKGYSRLGFAQYALGKPEEALDAYKKVLDIEGEAATDAMKRDYD 208
           EA++    A+++NP YSK   +       +GK  +AL      LD+       ++  DY+
Sbjct: 137 EAIEACSKALELNPDYSKVLLKRAAVYENIGKFADAL------LDLTAV----SLNGDYN 186

Query: 209 TAMKK--VGQSLNVEKSAPAATRDGAGSATGSGGLPDISSM 247
            A  +  V + LN  K A  A +D   ++  +  LP  +SM
Sbjct: 187 DATIQPIVERVLN--KQAMMALKDHLEASEKNKVLPSYTSM 225

>Kwal_27.11890 s27 (990685..991689) [1005 bp, 334 aa] {ON} YBR155W
           (CNS1) - component of Hsp90p chaperone machinery [contig
           27] FULL
          Length = 334

 Score = 54.7 bits (130), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 35/114 (30%), Positives = 58/114 (50%), Gaps = 4/114 (3%)

Query: 90  DAETKAKAESLKLEGNKAMAAKDFEQAVLKYSEAIQVL----PTNAVYYANRAAAHSSLK 145
           D E    AE+ K +GN+    K ++ A   Y++ I++       N   ++NRAA    LK
Sbjct: 71  DGEPHEVAENFKNQGNELYKVKRYKDAREIYNKGIEIKCDSNKINESLFSNRAACELELK 130

Query: 146 KYEEAVKDAEDAIKVNPSYSKGYSRLGFAQYALGKPEEALDAYKKVLDIEGEAA 199
            Y   V D   A++ NP+  K + R+  A + L K E+A +A +  L ++ E+A
Sbjct: 131 NYRRCVNDCRQALQFNPTNIKCFYRIARAFFLLDKCEDAKEAIEFGLKLDSESA 184

>NDAI0C05290 Chr3 (1224979..1226118) [1140 bp, 379 aa] {ON}
           Anc_8.506 YBR155W
          Length = 379

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 64/125 (51%), Gaps = 7/125 (5%)

Query: 97  AESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAV-----YYANRAAAHSSLKKYEEAV 151
           AE+ K +GN    AK F+ A   Y + IQ+     V      +AN+AA    LK +   +
Sbjct: 76  AENFKNQGNDLYKAKRFKDARDVYLKGIQIENNKDVKIKESLFANKAACELELKNFRRCI 135

Query: 152 KDAEDAIKVNPSYSKGYSRLGFAQYALGKPEEALDAYKKVLDIEGEAATDAMKRDYDTAM 211
            D ++A+++NP   K Y R+  A +AL K EEA ++ +  L  + E  +  +   +DT +
Sbjct: 136 NDCKNALQLNPKNVKCYFRMTRAFFALDKLEEAKESVEFGLKFDPENTS--LINLHDTII 193

Query: 212 KKVGQ 216
           KK  Q
Sbjct: 194 KKELQ 198

>Smik_2.295 Chr2 (535786..536943) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 34/92 (36%), Positives = 47/92 (51%), Gaps = 4/92 (4%)

Query: 97  AESLKLEGNKAMAAKDFEQAVLKYSEAIQV----LPTNAVYYANRAAAHSSLKKYEEAVK 152
           AE+ K +GN+   AK F+ A   Y++ I V       N   +ANRAA    LK Y   ++
Sbjct: 83  AENFKKQGNELYKAKRFKDARELYTKGIAVECEDKSINESLFANRAACELELKNYRRCIE 142

Query: 153 DAEDAIKVNPSYSKGYSRLGFAQYALGKPEEA 184
           D   A+ +NP   K Y R   A ++L K EEA
Sbjct: 143 DCSKALTINPKNIKCYYRTSKAFFSLSKLEEA 174

>KLTH0B05170g Chr2 (427608..429389) [1782 bp, 593 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 593

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 34/98 (34%), Positives = 56/98 (57%), Gaps = 1/98 (1%)

Query: 88  VEDAETKAKAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKY 147
           + D +    A  LK +GN+    K +++A+  YS AI+V   + V+Y+NR+A + SL + 
Sbjct: 86  LSDEQKDKYAMGLKDKGNEFFKNKKYDEAIQYYSWAIEV-KEDPVFYSNRSACYVSLGQQ 144

Query: 148 EEAVKDAEDAIKVNPSYSKGYSRLGFAQYALGKPEEAL 185
           E+ V+D   A+K+ P YSK   R   A  +LG   +A+
Sbjct: 145 EKVVEDTTAALKLKPDYSKCLLRRASANESLGNFADAM 182

>SAKL0H10934g Chr8 complement(945834..946976) [1143 bp, 380 aa] {ON}
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155W CNS1 cyclophilin seven suppressor component of
           Hsp90p chaperone machinery
          Length = 380

 Score = 52.8 bits (125), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 53/102 (51%), Gaps = 4/102 (3%)

Query: 90  DAETKAKAESLKLEGNKAMAAKDFEQAVLKYSEAIQVL----PTNAVYYANRAAAHSSLK 145
           + E    AE+ K +GN    A+ ++ A   Y++ ++V       N   + NRAA    LK
Sbjct: 73  EGEPHEIAENFKNQGNDLYRARRYKDARELYNKGVEVHCDDDAINESLFLNRAACELELK 132

Query: 146 KYEEAVKDAEDAIKVNPSYSKGYSRLGFAQYALGKPEEALDA 187
            +   + D ++A++ NP   K + R+G A ++L K EEA +A
Sbjct: 133 NHRRCINDCKEALRYNPKNVKCFYRMGRAFFSLNKLEEAKEA 174

>Suva_4.405 Chr4 (719015..720172) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 52.8 bits (125), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 33/92 (35%), Positives = 48/92 (52%), Gaps = 4/92 (4%)

Query: 97  AESLKLEGNKAMAAKDFEQAVLKYSEAIQV----LPTNAVYYANRAAAHSSLKKYEEAVK 152
           AE+ K +GN+   AK F+ A   Y++ + V       N   +ANRAA    LK Y + V+
Sbjct: 83  AENFKKQGNELYKAKRFKDARELYTKGVAVECEDKSINESLFANRAACELELKNYRKCVE 142

Query: 153 DAEDAIKVNPSYSKGYSRLGFAQYALGKPEEA 184
           D   A+ +NP   K Y R+  + + L K EEA
Sbjct: 143 DCGKALTINPKNIKCYYRISKSFFQLRKLEEA 174

>KAFR0E02980 Chr5 (596891..598033) [1143 bp, 380 aa] {ON} Anc_8.506
           YBR155W
          Length = 380

 Score = 51.6 bits (122), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 33/92 (35%), Positives = 44/92 (47%), Gaps = 4/92 (4%)

Query: 97  AESLKLEGNKAMAAKDFEQAVLKYSEAIQ----VLPTNAVYYANRAAAHSSLKKYEEAVK 152
           AE+ K +GN     K F  A   Y++ I+    V   N   YANRAA    LK +   + 
Sbjct: 78  AENFKNQGNDLYKVKRFRDAREIYTKGIEMKCDVAKINESLYANRAACQLELKNFRSCIS 137

Query: 153 DAEDAIKVNPSYSKGYSRLGFAQYALGKPEEA 184
           D + A+  NP   K Y R+G A  A+ K E A
Sbjct: 138 DCKTALTYNPKNIKCYFRMGKAFTAINKFESA 169

>NCAS0G02480 Chr7 complement(440105..441895) [1791 bp, 596 aa] {ON}
           Anc_2.152
          Length = 596

 Score = 52.0 bits (123), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 33/83 (39%), Positives = 47/83 (56%), Gaps = 1/83 (1%)

Query: 97  AESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAED 156
           A +LK +GN     KDFE A+  Y+ A+  L  + VYY+N +A +SSL  YE+ ++ A  
Sbjct: 95  AGALKEKGNALFKKKDFENAIKYYTFALS-LKEDPVYYSNISACYSSLLNYEKVIEMATK 153

Query: 157 AIKVNPSYSKGYSRLGFAQYALG 179
           A+ + P YSK   R   A   LG
Sbjct: 154 ALALRPDYSKVLVRRANAYEKLG 176

>NDAI0F02810 Chr6 (690977..692806) [1830 bp, 609 aa] {ON} Anc_2.152
           YHR117W
          Length = 609

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/89 (35%), Positives = 54/89 (60%), Gaps = 2/89 (2%)

Query: 92  ETKAK-AESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEA 150
           ETK + A +LK +GN+      FE A+  Y  A++ L  + +YY+N +A ++SL +YE+ 
Sbjct: 104 ETKNEWAMALKDKGNELFKTSKFEDAIKYYHYALK-LKDDPIYYSNISACYASLLQYEKV 162

Query: 151 VKDAEDAIKVNPSYSKGYSRLGFAQYALG 179
           ++ A  A+K+ P++SK   R   A  A+G
Sbjct: 163 IEYATKALKLRPTFSKVLMRRALAYEAMG 191

>Ecym_8204 Chr8 complement(419900..421693) [1794 bp, 597 aa] {ON}
           similar to Ashbya gossypii ABR131W
          Length = 597

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 51/87 (58%), Gaps = 1/87 (1%)

Query: 99  SLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAEDAI 158
           ++K +GN+    K +E+A+  YS A++ L  + V+Y+NR+A    L K E+ V+D   A+
Sbjct: 100 AMKDKGNECFKEKKYEEAIKYYSCALR-LKKDPVFYSNRSACWVPLNKLEKVVEDTTAAL 158

Query: 159 KVNPSYSKGYSRLGFAQYALGKPEEAL 185
           ++ P YSK   R   A  +LG   +A+
Sbjct: 159 ELKPDYSKCLLRRATANESLGNFADAM 185

>ABR131W Chr2 (641631..643415) [1785 bp, 594 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL121C (TOM70) and
           YHR117W (TOM71)
          Length = 594

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 52/89 (58%), Gaps = 1/89 (1%)

Query: 97  AESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAED 156
           A +LK +GN+    + +E+A+  Y  A++ L  + V+Y+NR+A +  L K E+ V+D   
Sbjct: 95  AMALKDKGNECFKDQRYEEAIKFYDCALK-LKEDPVFYSNRSACYVPLNKLEKVVEDTTA 153

Query: 157 AIKVNPSYSKGYSRLGFAQYALGKPEEAL 185
           A+K+ P YSK   R   A  +LG   +A+
Sbjct: 154 ALKLKPDYSKCLLRRATANESLGNYADAM 182

>TBLA0C05530 Chr3 complement(1338666..1340498) [1833 bp, 610 aa]
           {ON} Anc_2.152 YHR117W
          Length = 610

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/72 (38%), Positives = 43/72 (59%), Gaps = 1/72 (1%)

Query: 99  SLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAEDAI 158
           +LK +GN    A  FE+A+  Y+ AI+ L  N ++Y+N +A + SL K EE +K    A+
Sbjct: 113 ALKDKGNSLFKADKFEEAIKYYNWAIE-LKENPIFYSNLSACYVSLNKLEEIIKYCNKAL 171

Query: 159 KVNPSYSKGYSR 170
           ++ P YSK   R
Sbjct: 172 ELKPDYSKVLLR 183

>YHR117W Chr8 (342349..344268) [1920 bp, 639 aa] {ON}
           TOM71Mitochondrial outer membrane protein with
           similarity to Tom70p; probable minor component of the
           TOM (translocase of outer membrane) complex responsible
           for recognition and import of mitochondrially directed
           proteins
          Length = 639

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 51/95 (53%)

Query: 91  AETKAKAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEA 150
           ++ +A A  LK  GN    AK+F +A+  Y  AI++ P   V+Y+N +A + S    E+ 
Sbjct: 121 SQRQAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKV 180

Query: 151 VKDAEDAIKVNPSYSKGYSRLGFAQYALGKPEEAL 185
           ++    A+++ P +SK   R   A  +LG   +A+
Sbjct: 181 IEFTTKALEIKPDHSKALLRRASANESLGNFTDAM 215

>TDEL0B01310 Chr2 complement(234307..235449) [1143 bp, 380 aa] {ON}
           Anc_8.506 YBR155W
          Length = 380

 Score = 50.1 bits (118), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 48/99 (48%), Gaps = 4/99 (4%)

Query: 90  DAETKAKAESLKLEGNKAMAAKDFEQAVLKYSEAIQV----LPTNAVYYANRAAAHSSLK 145
           + E    A + K +GN    AK F+ A   Y++ I++       N   YANRAA    +K
Sbjct: 71  EGEPHEIAGNFKNQGNDLYKAKRFKDARELYNKGIEIKCDDTSINESLYANRAACELEIK 130

Query: 146 KYEEAVKDAEDAIKVNPSYSKGYSRLGFAQYALGKPEEA 184
            Y   + D + A++ NP   K Y R+G A  AL   EEA
Sbjct: 131 NYRRCLNDCKTALQYNPKNLKCYYRMGKAFLALELLEEA 169

>ZYRO0B04224g Chr2 (350069..351610) [1542 bp, 513 aa] {ON} highly
           similar to uniprot|P53043 Saccharomyces cerevisiae
           YGR123C
          Length = 513

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 32/108 (29%), Positives = 60/108 (55%), Gaps = 1/108 (0%)

Query: 95  AKAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDA 154
           AKA   K +GN  +  +DF +A   Y++AI++  T +++++NRA AH     ++ ++ D 
Sbjct: 10  AKALEYKDQGNDFVKKQDFIKAAELYTKAIELDDTKSIFFSNRALAHLKQDNFQLSLNDC 69

Query: 155 EDAIKVNPSYSKGYSRLGFAQYALGKPEEALDAYKKVLDIE-GEAATD 201
           + A++++    K Y R G +   L + ++A    K VL  + G+ A D
Sbjct: 70  DKALELDSKNIKAYHRRGLSYVGLLEFKKARTDLKTVLKSKPGDVAAD 117

>NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON}
           Anc_2.152
          Length = 625

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 34/111 (30%), Positives = 62/111 (55%), Gaps = 3/111 (2%)

Query: 75  SSSPQESVKVNIPVEDAETKAKAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYY 134
           S+ P      ++P+E  E K  +  LK +GNK   AKD+  A+  Y+ A+  L  + ++Y
Sbjct: 102 SNDPDMIQITSLPLE--EQKKISMQLKDKGNKYFKAKDYTNAIKYYNLALD-LNKDPIFY 158

Query: 135 ANRAAAHSSLKKYEEAVKDAEDAIKVNPSYSKGYSRLGFAQYALGKPEEAL 185
           +N +A + SL + ++ ++ +  A+++NP+YSK   R   A  +L    +AL
Sbjct: 159 SNISACYVSLGQLDKVIESSTKALELNPNYSKALLRRASANESLENYSDAL 209

>KLTH0F14542g Chr6 complement(1191800..1193341) [1542 bp, 513 aa]
           {ON} highly similar to uniprot|P53043 Saccharomyces
           cerevisiae YGR123C
          Length = 513

 Score = 50.1 bits (118), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 55/104 (52%)

Query: 92  ETKAKAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAV 151
           E   KA   K +GN  +  K + +AV  YS+AI++  T +++++NRA +   L  +  A+
Sbjct: 7   EAAQKALEFKNQGNAFIKEKKYPEAVEYYSKAIELDDTQSIFFSNRAFSRLKLDNFLTAL 66

Query: 152 KDAEDAIKVNPSYSKGYSRLGFAQYALGKPEEALDAYKKVLDIE 195
           +D   +I+++P   K   R G +   L +  +A    K +L ++
Sbjct: 67  EDCNKSIELDPKNIKAIHRRGLSYVGLLEFSKARKDLKTILQVK 110

>NDAI0B04340 Chr2 (1087851..1089845) [1995 bp, 664 aa] {ON}
           Anc_2.152 YHR117W
          Length = 664

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 33/101 (32%), Positives = 58/101 (57%), Gaps = 2/101 (1%)

Query: 97  AESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAED 156
           A+ LK +GN+   +KD E A+ KY E    L  + V+Y+N +A + ++ + ++ ++ +  
Sbjct: 158 AKELKNKGNQYFKSKDNENAI-KYYEYALRLDQDPVFYSNISACYFAMNQLDKVIESSNK 216

Query: 157 AIKVNPSYSKGYSRLGFAQYALGKPEEALDAYKKVLDIEGE 197
           A+++ P YSK   R   A  ALG  +EAL  +  +L + GE
Sbjct: 217 ALELKPDYSKALLRRANAYEALGNNKEALYDF-SILSLFGE 256

>ZYRO0F08624g Chr6 (691992..693131) [1140 bp, 379 aa] {ON} similar
           to uniprot|P33313 Saccharomyces cerevisiae YBR155W CNS1
           cyclophilin seven suppressor component of Hsp90p
           chaperone machinery
          Length = 379

 Score = 48.9 bits (115), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 53/112 (47%), Gaps = 4/112 (3%)

Query: 90  DAETKAKAESLKLEGNKAMAAKDFEQAVLKYSEAIQVL----PTNAVYYANRAAAHSSLK 145
           D E    AE+ K + N    AK F++A   Y + I++       N   +AN AA    +K
Sbjct: 71  DGEPHEVAENFKNQANDLYKAKRFKEAREVYKKGIEIKCNDDKVNESLFANLAACELEIK 130

Query: 146 KYEEAVKDAEDAIKVNPSYSKGYSRLGFAQYALGKPEEALDAYKKVLDIEGE 197
            +   +   + A++ NP   K Y R+  A Y L K +EA ++ K  L I+ E
Sbjct: 131 NFRRCINLCQKALQFNPKNMKCYYRIAKAFYQLNKLDEAKESVKFGLTIDSE 182

>Kwal_55.21175 s55 complement(716457..717992) [1536 bp, 511 aa] {ON}
           YGR123C (PPT1) - serine/threonine phosphatase [contig
           295] FULL
          Length = 511

 Score = 48.9 bits (115), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 55/104 (52%)

Query: 92  ETKAKAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAV 151
           E   +A   K +GN  +  K +++AV  YS+AI++  T ++Y++NRA +   L  +  A 
Sbjct: 5   EAAQQALEFKNQGNAYVKEKKYQEAVEYYSKAIELDDTQSIYFSNRAFSRLRLDNFLTAQ 64

Query: 152 KDAEDAIKVNPSYSKGYSRLGFAQYALGKPEEALDAYKKVLDIE 195
           +D + AI ++P   K   R G +   L +  +A    + VL ++
Sbjct: 65  EDCDKAIALDPKNIKAIHRRGLSYVGLLEFFKARKDLRVVLQVK 108

>Suva_15.314 Chr15 (544646..546580) [1935 bp, 644 aa] {ON} YHR117W
           (REAL)
          Length = 644

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 66/131 (50%), Gaps = 4/131 (3%)

Query: 92  ETKAKAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAV 151
           + +A A  LK +GN    AK F  A+  Y  AI++ P + V+Y+N +A + S    ++ V
Sbjct: 126 QRQAFAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVV 185

Query: 152 KDAEDAIKVNPSYSKGYSRLGFAQYALGKPEEA---LDAYKKVLDIEGEAATDAMKRDYD 208
           +    A+++ P +SK   R   A  +LG   +A   L       D +G +    ++R+ +
Sbjct: 186 EYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFDGTSIEPMLERNLN 245

Query: 209 -TAMKKVGQSL 218
             AMK + +SL
Sbjct: 246 KQAMKVLNESL 256

>KLLA0B10912g Chr2 (955948..957486) [1539 bp, 512 aa] {ON} similar
           to uniprot|P53043 Saccharomyces cerevisiae YGR123C
          Length = 512

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 45/75 (60%)

Query: 96  KAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAE 155
           KA  LK EGNK +  K + +A   Y++AI+  P N + Y+NRA  +  L  ++ ++ DA+
Sbjct: 12  KALELKNEGNKFVKEKLYAKAAEYYTKAIEHDPENTILYSNRAFTNLKLDNFQSSLDDAK 71

Query: 156 DAIKVNPSYSKGYSR 170
            AI+++ +  K Y R
Sbjct: 72  RAIELDNNNLKAYHR 86

>Skud_8.178 Chr8 (316128..318044) [1917 bp, 638 aa] {ON} YHR117W
           (REAL)
          Length = 638

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 48/89 (53%)

Query: 97  AESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAED 156
           A  LK +GN    +K+F+ A+  Y  AI++ P + V+Y+N +A + S     + V+    
Sbjct: 125 AVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTK 184

Query: 157 AIKVNPSYSKGYSRLGFAQYALGKPEEAL 185
           A+++ P +SK   R   A  +LG   +A+
Sbjct: 185 ALEIKPDHSKALLRRASANESLGNFTDAM 213

>Skud_2.282 Chr2 (517201..518358) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/89 (33%), Positives = 43/89 (48%), Gaps = 4/89 (4%)

Query: 100 LKLEGNKAMAAKDFEQAVLKYSEAIQVLP----TNAVYYANRAAAHSSLKKYEEAVKDAE 155
            K +GN+   AK F+ A   Y + + V       N   +AN+AA    LK Y   ++D  
Sbjct: 86  FKKQGNELYKAKRFKDARELYIKGLNVECEDKFINESLFANKAACELELKNYRRCIEDCS 145

Query: 156 DAIKVNPSYSKGYSRLGFAQYALGKPEEA 184
            A+ +NP  +K Y R   A + L K EEA
Sbjct: 146 KALSINPKNTKCYYRTSKAFFQLNKLEEA 174

>KLLA0B09966g Chr2 complement(872760..873872) [1113 bp, 370 aa] {ON}
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155W CNS1 cyclophilin seven suppressor component of
           Hsp90p chaperone machinery
          Length = 370

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 61/133 (45%), Gaps = 13/133 (9%)

Query: 97  AESLKLEGNKAMAAKDFEQAVLKYSEAIQV----LPTNAVYYANRAAAHSSLKKYEEAVK 152
           A + K +GN     K F+ A   Y +A+ V    L  N   Y N AA    +K Y   + 
Sbjct: 70  ATNFKNQGNDLYKGKRFKDARAMYLKALDVKCDVLSINESLYLNLAACELEIKNYRSCIN 129

Query: 153 DAEDAIKVNPSYSKGYSRLGFAQYALGKPEEALDAYKKVLDIEGE---------AATDAM 203
              +A+K+N    K + R+G A   LG+ E++L+A +  L ++ E          AT+ +
Sbjct: 130 YCREALKLNAKNVKAFFRIGKAYLELGRFEDSLEAVQVGLAVDPENGALKSIQSKATEKL 189

Query: 204 KRDYDTAMKKVGQ 216
           KR  +   + + Q
Sbjct: 190 KRKKELENRTLAQ 202

>SAKL0E10956g Chr5 (916623..918425) [1803 bp, 600 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 600

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/98 (31%), Positives = 55/98 (56%), Gaps = 1/98 (1%)

Query: 88  VEDAETKAKAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKY 147
           + D + +  A  LK +GN+    K F+ A+  Y+ A++ L  + V+Y+NR+A + S+ + 
Sbjct: 93  LTDEQKEKYAMGLKDKGNEFFKEKKFDDAIKYYNLALE-LKKDPVFYSNRSACYVSMGQL 151

Query: 148 EEAVKDAEDAIKVNPSYSKGYSRLGFAQYALGKPEEAL 185
           E+ V+D   A+K+   YSK   R   A  +LG   +A+
Sbjct: 152 EKVVEDTTAALKLKSDYSKCLLRRASANESLGNYADAM 189

>Ecym_2559 Chr2 (1089202..1090314) [1113 bp, 370 aa] {ON} similar to
           Ashbya gossypii AGL268C
          Length = 370

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 45/99 (45%), Gaps = 4/99 (4%)

Query: 90  DAETKAKAESLKLEGNKAMAAKDFEQAVLKYSEAIQVL----PTNAVYYANRAAAHSSLK 145
           + E    A + K +GN     K ++ A   YS+ I+V       N   Y NRAA    L+
Sbjct: 72  EGEPHEVAANFKNQGNDLYKVKRYKDARTMYSKGIEVKCEDDSINGSLYLNRAACELELR 131

Query: 146 KYEEAVKDAEDAIKVNPSYSKGYSRLGFAQYALGKPEEA 184
            +   + D + A+  N    K + R+G A + L K EEA
Sbjct: 132 NFRSCINDCKKALNFNAKCVKAFYRMGQAYFKLKKLEEA 170

>Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON}
           similar to Ashbya gossypii AAR054C
          Length = 172

 Score = 45.4 bits (106), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 35/55 (63%)

Query: 97  AESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAV 151
           AE LK++GN      D+E A+L Y +A  +  +N +Y++N A A   L++++EAV
Sbjct: 41  AEDLKVKGNTFFKNGDYETAILYYEKACALDSSNPIYFSNMATALIKLERWQEAV 95

>TPHA0L01420 Chr12 (293980..295104) [1125 bp, 374 aa] {ON} Anc_8.506
           YBR155W
          Length = 374

 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 45/92 (48%), Gaps = 4/92 (4%)

Query: 97  AESLKLEGNKAMAAKDFEQAVLKYSEAIQVL----PTNAVYYANRAAAHSSLKKYEEAVK 152
           AE+ K +GN+A   K +  A + Y   I+V       N + + N+AA    +K Y   + 
Sbjct: 74  AENFKKQGNEAYKLKQYRNARVLYERGIEVNCNNDKINELLFVNKAACELEMKNYRSCIN 133

Query: 153 DAEDAIKVNPSYSKGYSRLGFAQYALGKPEEA 184
           D + A+  NP   K Y R+  A  A+ K +E+
Sbjct: 134 DCKKALSFNPLNVKCYFRMAKAFSAIEKYDES 165

>Kpol_513.2 s513 (1962..3086) [1125 bp, 374 aa] {ON} (1962..3086)
           [1125 nt, 375 aa]
          Length = 374

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 32/95 (33%), Positives = 45/95 (47%), Gaps = 4/95 (4%)

Query: 97  AESLKLEGNKAMAAKDFEQAVLKYSEAIQVL----PTNAVYYANRAAAHSSLKKYEEAVK 152
           A + K +GN     K F  A   Y++AI V       N   YANRAA    LK Y   + 
Sbjct: 74  AGNFKNQGNDLYKVKRFRDARELYNKAIDVKCDDDKINESLYANRAACELELKNYRRCIN 133

Query: 153 DAEDAIKVNPSYSKGYSRLGFAQYALGKPEEALDA 187
           D + A+ +NP   K Y R+  A  A+ K ++  +A
Sbjct: 134 DCKMALSLNPKNIKCYFRMAKAFLAIEKFDDCKEA 168

>SAKL0A01672g Chr1 complement(154932..155318) [387 bp, 128 aa] {ON}
           similar to uniprot|P25638 Saccharomyces cerevisiae
           YCR060W TAH1 HSP90
          Length = 128

 Score = 43.5 bits (101), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 35/63 (55%)

Query: 98  ESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAEDA 157
           ++LK +GN      D+E AVL Y +AI   P+N + Y+N A     L+K+ EAV      
Sbjct: 5   DTLKAKGNVFFKKCDYETAVLYYQKAITADPSNPIGYSNNAMGLIKLEKWSEAVDACNKG 64

Query: 158 IKV 160
           +K+
Sbjct: 65  LKM 67

>KNAG0I02520 Chr9 complement(487699..488052) [354 bp, 117 aa] {ON}
           Anc_6.328 YCR060W
          Length = 117

 Score = 43.1 bits (100), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 42/90 (46%), Gaps = 7/90 (7%)

Query: 98  ESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDA--- 154
           E++K +GN A    +F  A   Y + I + P N + Y+NRA A   L+K+ E +      
Sbjct: 5   ETVKEQGNVAFRNSNFSSAAEYYGKCICLEPENPIGYSNRAMALIKLQKFSETIDTCQRG 64

Query: 155 ----EDAIKVNPSYSKGYSRLGFAQYALGK 180
               ED  K  P   K   RL  AQ +L K
Sbjct: 65  LGKLEDNEKDEPIRKKLLYRLHLAQESLNK 94

>Smik_8.195 Chr8 (318688..320595) [1908 bp, 635 aa] {ON} YHR117W
           (REAL)
          Length = 635

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 40/161 (24%), Positives = 75/161 (46%), Gaps = 16/161 (9%)

Query: 91  AETKAKAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEA 150
           ++ +  A  LK +GN     K+F +A+  Y  AI++ P + V+Y+N +A + S     + 
Sbjct: 118 SQKQTYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKV 177

Query: 151 VKDAEDAIKVNPSYSKGYSRLGFAQYALGKPEEA---LDAYKKVLDIEGEAATDAMKRDY 207
           ++    A+++ P +SK   R   A  +LG   +A   L       D +G +    ++R+ 
Sbjct: 178 LEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFDGASIEPMLERNL 237

Query: 208 D-TAMKKVGQSLNVEKSAPAATRDGAGSATGSGGLPDISSM 247
           +  AMK + ++L+             G   GS  LP  +S+
Sbjct: 238 NKQAMKVLNENLS------------KGDGRGSQLLPSNTSL 266

>CAGL0L12936g Chr12 (1382623..1384425) [1803 bp, 600 aa] {ON}
           similar to uniprot|P07213 Saccharomyces cerevisiae
           YNL121c TOM70 or uniprot|P38825 Saccharomyces cerevisiae
           YHR117w TOM7
          Length = 600

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 38/140 (27%), Positives = 74/140 (52%), Gaps = 5/140 (3%)

Query: 92  ETKAKAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAV 151
           + K  A +LK +GN     K FE A+  Y+ AI+ L  + V+++N +A + SL   ++ V
Sbjct: 88  QKKVYATALKDKGNALFKEKRFEDAIEFYNHAIK-LHEDPVFHSNISACYVSLGDLDKVV 146

Query: 152 KDAEDAIKVNPSYSKGYSRLGFAQYALGKPEEAL-DAYKKVL--DIEGEAATDAMKRDYD 208
           + +  A+++ P YSK   R   A   +G+ ++A+ D     L  D  G +    ++R+ +
Sbjct: 147 ESSTRALELKPDYSKALLRRASAYENMGRYQDAMFDISVLSLNGDFNGSSIEPMLERNLN 206

Query: 209 -TAMKKVGQSLNVEKSAPAA 227
             A++ + + + ++ S P A
Sbjct: 207 KQALRVLKEDMGIDASVPQA 226

>KLTH0E11748g Chr5 (1043203..1044339) [1137 bp, 378 aa] {ON} similar
           to uniprot|P33313 Saccharomyces cerevisiae YBR155W CNS1
           cyclophilin seven suppressor component of Hsp90p
           chaperone machinery
          Length = 378

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/117 (30%), Positives = 57/117 (48%), Gaps = 5/117 (4%)

Query: 97  AESLKLEGNKAMAAKDFEQAVLKYSEAIQVL----PTNAVYYANRAAAHSSLKKYEEAVK 152
           AE+ K +GN    AK ++ A   Y+  I +       N   ++NRAA    LK Y   V 
Sbjct: 78  AENFKNQGNDLYRAKRYKDAREIYNRGIDIKCDDSKVNESLFSNRAACELELKNYRRCVN 137

Query: 153 DAEDAIKVNPSYSKGYSRLGFAQYALGKPEEALDAYKKVLDIEGE-AATDAMKRDYD 208
           D + A++ N    K Y R+  A   L K E+A  A +  L ++ E  A +A++++ D
Sbjct: 138 DCKRALQYNVKNIKCYYRIAKAFLLLNKLEDAKQAAEFGLKLDPENQALNALRQNVD 194

>TPHA0I01510 Chr9 complement(342661..344472) [1812 bp, 603 aa] {ON}
           Anc_2.152 YHR117W
          Length = 603

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 35/110 (31%), Positives = 53/110 (48%), Gaps = 15/110 (13%)

Query: 75  SSSPQESVKVNIPV--------------EDAETKAKAESLKLEGNKAMAAKDFEQAVLKY 120
           S+S  E+ KV  PV               D   +  A +LK +GN     +DFE A LKY
Sbjct: 69  SNSKNETAKVIYPVASNGEPDLSGKDSFSDELKEKYAMALKDKGNDYFKKQDFENA-LKY 127

Query: 121 SEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAEDAIKVNPSYSKGYSR 170
                 L  + V+Y+N +A + SL + E+ V+ + +A+K+   YSK   R
Sbjct: 128 YNYALTLKQDPVFYSNISACYVSLGQLEKVVESSTEALKLKHDYSKALLR 177

>KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {ON}
           Anc_2.152 YHR117W
          Length = 608

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 100 LKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAEDAIK 159
           LK +GN+    KD+E A LK+ +   +L  + V+Y+N +A + SL + ++ ++ +  A++
Sbjct: 111 LKDKGNEYFKEKDYENA-LKFYDFALILKKDPVFYSNMSACYVSLNELDKVIEMSTKALE 169

Query: 160 VNPSYSKGYSR 170
           + P YSK   R
Sbjct: 170 LKPDYSKALLR 180

>TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {ON}
           Anc_2.152 YHR117W
          Length = 599

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 44/74 (59%), Gaps = 1/74 (1%)

Query: 97  AESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAED 156
           A +LK  GN+    KD++ A LKY     V+  + V+Y+N +A + SL + ++ V+++  
Sbjct: 101 ATALKDRGNEFFKKKDYDNA-LKYYNYALVVKKDPVFYSNISACYVSLGQLDKVVENSTK 159

Query: 157 AIKVNPSYSKGYSR 170
           A+++ P YSK   R
Sbjct: 160 ALELKPDYSKALLR 173

>NCAS0E02490 Chr5 complement(493779..496208) [2430 bp, 809 aa] {ON}
           Anc_7.412 YBL084C
          Length = 809

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 50/97 (51%)

Query: 104 GNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAEDAIKVNPS 163
           G  +M   ++EQA++ + +A  + P+NA+           L   E+A+   E A ++ P+
Sbjct: 665 GMCSMKLGEYEQALVYFEKARSINPSNAILICCCGVTMEKLGNQEKALNYYELACQIQPT 724

Query: 164 YSKGYSRLGFAQYALGKPEEALDAYKKVLDIEGEAAT 200
            S    +     Y++ K  +ALDA+++++ I  E AT
Sbjct: 725 SSLAKFKRAHLLYSMAKYTQALDAFEELIKIAPEEAT 761

 Score = 37.0 bits (84), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 25/98 (25%), Positives = 53/98 (54%), Gaps = 3/98 (3%)

Query: 114 EQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAEDAIKVNPSYSKGYSRLGF 173
           E+A+  Y  A Q+ PT+++    RA    S+ KY +A+   E+ IK+ P  +     LG 
Sbjct: 709 EKALNYYELACQIQPTSSLAKFKRAHLLYSMAKYTQALDAFEELIKIAPEEATVQFILGQ 768

Query: 174 AQYALGKPEEALDAYKKVLDIEGEAA---TDAMKRDYD 208
               +G+ ++A+  Y   ++++ + +   +DA+K+ ++
Sbjct: 769 LYQIMGRKKDAIKRYTIAMNLDPKGSNLISDALKKCHE 806

 Score = 33.5 bits (75), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 58/123 (47%), Gaps = 9/123 (7%)

Query: 102 LEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYAN----RAAAHSSLKKYEEAVKDAEDA 157
           L+G++ ++   ++ A   Y +AI    +N +++ N           L +YE+A+   E A
Sbjct: 629 LQGHEYLSMDSYDTAKTFYRKAI----SNDLHHYNAYYGMGMCSMKLGEYEQALVYFEKA 684

Query: 158 IKVNPSYSKGYSRLGFAQYALGKPEEALDAYKKVLDIEGEAATDAMKRDYDT-AMKKVGQ 216
             +NPS +      G     LG  E+AL+ Y+    I+  ++    KR +   +M K  Q
Sbjct: 685 RSINPSNAILICCCGVTMEKLGNQEKALNYYELACQIQPTSSLAKFKRAHLLYSMAKYTQ 744

Query: 217 SLN 219
           +L+
Sbjct: 745 ALD 747

 Score = 32.3 bits (72), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 48/104 (46%), Gaps = 2/104 (1%)

Query: 92  ETKAKAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVY-YANRAAAHSSLKKYEEA 150
           E + K E+    GN     KD ++A+  + +A ++ P N VY Y  +   + S+  Y+ A
Sbjct: 585 EFRDKPETWCAVGNLFSLQKDHDEAIRAFDKATKLDP-NFVYAYTLQGHEYLSMDSYDTA 643

Query: 151 VKDAEDAIKVNPSYSKGYSRLGFAQYALGKPEEALDAYKKVLDI 194
                 AI  +  +   Y  +G     LG+ E+AL  ++K   I
Sbjct: 644 KTFYRKAISNDLHHYNAYYGMGMCSMKLGEYEQALVYFEKARSI 687

>ADR230W Chr4 (1103275..1105332) [2058 bp, 685 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR080W (DIA2)
          Length = 685

 Score = 43.1 bits (100), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 34/71 (47%)

Query: 128 PTNAVYYANRAAAHSSLKKYEEAVKDAEDAIKVNPSYSKGYSRLGFAQYALGKPEEALDA 187
           P   V   NRAA    L K + A+ DA   I V+    KGY R G     LG+ EEAL  
Sbjct: 67  PRFFVLLDNRAATFEKLNKLDRALADAAYMITVDAYNLKGYIRRGKVLQKLGRYEEALQV 126

Query: 188 YKKVLDIEGEA 198
           Y+  L   GEA
Sbjct: 127 YENGLKQAGEA 137

>YNL121C Chr14 complement(398684..400537) [1854 bp, 617 aa] {ON}
           TOM70Component of the TOM (translocase of outer
           membrane) complex responsible for recognition and
           initial import steps for all mitochondrially directed
           proteins; acts as a receptor for incoming precursor
           proteins
          Length = 617

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 33/108 (30%), Positives = 58/108 (53%), Gaps = 3/108 (2%)

Query: 78  PQESVKVNIPVEDAETKAKAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANR 137
           P  S K N   E+ +  A A  LK +GN+    K ++ A+  Y+ A++ L  + V+Y+N 
Sbjct: 82  PDFSNKANFTAEEKDKYALA--LKDKGNQFFRNKKYDDAIKYYNWALE-LKEDPVFYSNL 138

Query: 138 AAAHSSLKKYEEAVKDAEDAIKVNPSYSKGYSRLGFAQYALGKPEEAL 185
           +A + S+   ++ V+ +  A+++ P YSK   R   A   LGK  +A+
Sbjct: 139 SACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGKFADAM 186

>ZYRO0G06512g Chr7 complement(515759..517573) [1815 bp, 604 aa] {ON}
           similar to uniprot|P07213 Saccharomyces cerevisiae
           YNL121C TOM70 Translocase of Outer Mitochondrial
           membrane 70 kDa mitochondrial specialized import
           receptor of the outer membrane
          Length = 604

 Score = 42.7 bits (99), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 44/72 (61%), Gaps = 1/72 (1%)

Query: 99  SLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAEDAI 158
           +LK +GN+    KD++ A LKY +    L  + V+Y+N +A + S+ + ++ V+++  A+
Sbjct: 108 ALKDKGNEFFKQKDYDNA-LKYYDYALTLKKDPVFYSNISACYVSMNQLDKVVENSTKAL 166

Query: 159 KVNPSYSKGYSR 170
           ++ P YSK   R
Sbjct: 167 ELKPDYSKALLR 178

>KNAG0H03530 Chr8 (657450..659294) [1845 bp, 614 aa] {ON} Anc_2.152
           YHR117W
          Length = 614

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 46/82 (56%), Gaps = 3/82 (3%)

Query: 89  EDAETKAKAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYE 148
           E  ET A A  LK +GN+    K  E+A+  Y  A++    + V+YAN +A + SL  +E
Sbjct: 100 EQRETYALA--LKDKGNELFKEKAVEEAIKYYQWALE-FKKDPVFYANISACYVSLNDFE 156

Query: 149 EAVKDAEDAIKVNPSYSKGYSR 170
           + +++   A+++ P YSK   R
Sbjct: 157 KVLENCNKALELKPDYSKVLLR 178

>KAFR0J02570 Chr10 (488372..488737) [366 bp, 121 aa] {ON} Anc_6.328
           YCR060W
          Length = 121

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 34/62 (54%)

Query: 98  ESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAEDA 157
           +  K EGN+     ++  A+  Y + I++ P N + Y+N+A A     K +EAV+  +D 
Sbjct: 4   DHFKTEGNQYFKEGNYASAIKSYEKCIEINPENPIGYSNKAMALIKANKNQEAVRTCQDG 63

Query: 158 IK 159
           +K
Sbjct: 64  LK 65

>Skud_14.211 Chr14 complement(388749..390602) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/108 (29%), Positives = 57/108 (52%), Gaps = 3/108 (2%)

Query: 78  PQESVKVNIPVEDAETKAKAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANR 137
           P  S K N   E+ +  A A  LK +GN+    K ++ A+  Y+ A++ L  + V+Y+N 
Sbjct: 82  PDFSKKANFTAEEKDKYALA--LKDKGNQYFRNKKYDDAIKYYNWALE-LKEDPVFYSNL 138

Query: 138 AAAHSSLKKYEEAVKDAEDAIKVNPSYSKGYSRLGFAQYALGKPEEAL 185
           +A + S+   ++ V+ +  A+++ P YSK   R   A   LG   +A+
Sbjct: 139 SACYVSVGDLKKVVEMSTKALEIKPDYSKVLLRRASANEGLGNFADAM 186

 Score = 32.0 bits (71), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 26/112 (23%), Positives = 53/112 (47%), Gaps = 12/112 (10%)

Query: 120 YSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAEDAIKVNPSYSKGYSRLGFAQYALG 179
           + +A+++ P N+  Y +R   +  L+ Y++A KD + A +++P     Y +L    Y   
Sbjct: 386 FDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYREN 445

Query: 180 KPEEALDAYK----------KVLDIEGEAATDAMKRDYDTAMKKVGQSLNVE 221
           K ++    +           +V +   E  TD  K D+D A+K+   ++ +E
Sbjct: 446 KFDDCETLFSEAKRKFPEAPEVPNFFAEILTD--KNDFDKALKQYDLAIELE 495

>TBLA0H03380 Chr8 (829314..830441) [1128 bp, 375 aa] {ON} Anc_8.506
           YBR155W
          Length = 375

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 51/105 (48%), Gaps = 4/105 (3%)

Query: 97  AESLKLEGNKAMAAKDFEQAVLKYSEAIQVL----PTNAVYYANRAAAHSSLKKYEEAVK 152
           A + K  GN+    K +  A   Y++ I V       N   YANRAA    LK + + ++
Sbjct: 74  AGNFKNRGNEFYKLKQYRDAREVYTKGIDVKCDDDKINESLYANRAACELELKNFRKCIE 133

Query: 153 DAEDAIKVNPSYSKGYSRLGFAQYALGKPEEALDAYKKVLDIEGE 197
           D + A+  N    K Y R+G A  ++ + +E+ ++ +  L I+ E
Sbjct: 134 DCKKALSFNVKNIKCYYRMGKAFLSVDRFDESKESIEFGLKIDSE 178

>Smik_14.207 Chr14 complement(378339..380192) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/108 (29%), Positives = 57/108 (52%), Gaps = 3/108 (2%)

Query: 78  PQESVKVNIPVEDAETKAKAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANR 137
           P  S K N   E+ +  A A  LK +GN+    K ++ A+  Y+ A++ L  + V+Y+N 
Sbjct: 82  PDFSNKANFTAEEKDRYALA--LKDKGNQFFRNKKYDDAIKYYNWALE-LKDDPVFYSNL 138

Query: 138 AAAHSSLKKYEEAVKDAEDAIKVNPSYSKGYSRLGFAQYALGKPEEAL 185
           +A + S+   ++ V+ +  A+++ P YSK   R   A   LG   +A+
Sbjct: 139 SACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAM 186

>Kpol_1018.106 s1018 (280224..282485) [2262 bp, 753 aa] {ON}
           (280224..282485) [2262 nt, 754 aa]
          Length = 753

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 42/91 (46%)

Query: 104 GNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAEDAIKVNPS 163
           GN     KD E A+  + +A QV P  A  Y  +   HSS   ++ A      A+  +P 
Sbjct: 542 GNFLSLQKDHEDAIKAFEKATQVDPNFAYAYTLQGHEHSSNDSFDTAKNCYRKALACDPQ 601

Query: 164 YSKGYSRLGFAQYALGKPEEALDAYKKVLDI 194
           +   Y  LG +   LG+ +EAL  ++K   I
Sbjct: 602 HYNAYYGLGMSCMKLGQYDEALLHFEKARSI 632

 Score = 33.9 bits (76), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 22/97 (22%), Positives = 45/97 (46%)

Query: 104 GNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAEDAIKVNPS 163
           G   M    +++A+L + +A  + P N +       A   L+  E+A+   E A ++ PS
Sbjct: 610 GMSCMKLGQYDEALLHFEKARSINPINVILICCCGVALEKLQYQEKALSYYELACELQPS 669

Query: 164 YSKGYSRLGFAQYALGKPEEALDAYKKVLDIEGEAAT 200
            S    +     Y++G+   AL  ++++  +  + AT
Sbjct: 670 SSLANFKRAHLLYSMGRYSVALQYFEELTKLAPDEAT 706

>NCAS0A14770 Chr1 complement(2911657..2912559) [903 bp, 300 aa] {ON}
           Anc_7.458 YJR088C
          Length = 300

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 33/133 (24%), Positives = 63/133 (47%), Gaps = 17/133 (12%)

Query: 64  LKQVVEAASVGSSSPQESVKVNIPVEDAET-KAKAESLKLEGNKAMAAKDFEQAVLKYSE 122
           +K+++    V  +S  ++V +   VE  E    + E   + G   M  KDF++A+  + E
Sbjct: 130 MKKLISIKMVHDNSKNKTVTLKQLVELTEKFPLEPELWWMLGEIYMNLKDFDRAIYCFEE 189

Query: 123 AIQVLPTNAV---------YYANRAAAHSSLKKYE-------EAVKDAEDAIKVNPSYSK 166
            + ++P N V         YY  ++ +HSS  K E       +++ +A  +I+++  Y K
Sbjct: 190 ILCIMPFNYVAFAQLAESLYYKAKSMSHSSKAKVELRKEIVQKSMNNALRSIELSGLYLK 249

Query: 167 GYSRLGFAQYALG 179
           G+S +      LG
Sbjct: 250 GWSMVAITSQELG 262

>Suva_14.219 Chr14 complement(395316..397169) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 64/126 (50%), Gaps = 5/126 (3%)

Query: 60  AGRSLKQVVEAASVGSSSPQESVKVNIPVEDAETKAKAESLKLEGNKAMAAKDFEQAVLK 119
           AG S   +   A+ G   P  S K +   E+ +  A A  LK +GN+    K ++ A+  
Sbjct: 66  AGESKPPIYPVAANGE--PDFSKKADFTAEEKDKYALA--LKDKGNQYFRNKKYDDAIKY 121

Query: 120 YSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAEDAIKVNPSYSKGYSRLGFAQYALG 179
           Y+ A++ L  + V+Y+N +A + S+   ++ V+ +  A+++ P YSK   R   A   LG
Sbjct: 122 YNWALE-LKEDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLG 180

Query: 180 KPEEAL 185
              +A+
Sbjct: 181 NFADAM 186

>Kpol_1048.21 s1048 complement(67975..69768) [1794 bp, 597 aa] {ON}
           complement(67975..69768) [1794 nt, 598 aa]
          Length = 597

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 47/86 (54%), Gaps = 3/86 (3%)

Query: 85  NIPVEDAETKAKAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSL 144
           N   E  ET + A  LK +GN+    + +E A+  Y+ A+  L  + V+Y+N +A + SL
Sbjct: 89  NFTEEQKETYSVA--LKDKGNQFFKEQKYEDALKYYNYALD-LKQDPVFYSNISACYVSL 145

Query: 145 KKYEEAVKDAEDAIKVNPSYSKGYSR 170
              E+ V+ +  A+++ P YSK   R
Sbjct: 146 GNLEKVVESSTKALELKPDYSKALLR 171

>SAKL0E14542g Chr5 (1199439..1201511) [2073 bp, 690 aa] {ON} weakly
           similar to uniprot|Q7LGN4 Saccharomyces cerevisiae
           YOR080W DIA2 Protein of unknown function involved in
           invasive and pseudohyphal growth
          Length = 690

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 34/62 (54%)

Query: 136 NRAAAHSSLKKYEEAVKDAEDAIKVNPSYSKGYSRLGFAQYALGKPEEALDAYKKVLDIE 195
           NRAA+   L K ++A+KDA++ I+V P   K Y R G     L K +EA   Y + L + 
Sbjct: 76  NRAASWEKLGKLDKALKDAKNMIRVEPHNLKCYIRCGKILQKLNKDKEAYSNYSQGLKMA 135

Query: 196 GE 197
            E
Sbjct: 136 KE 137

>Kpol_1028.51 s1028 complement(123535..123888) [354 bp, 117 aa] {ON}
           complement(123535..123888) [354 nt, 118 aa]
          Length = 117

 Score = 37.7 bits (86), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 44/86 (51%), Gaps = 2/86 (2%)

Query: 98  ESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAEDA 157
           E  K  GN      ++ +AV  Y + I+V P N + Y+N A +   L KY EA++     
Sbjct: 4   EEYKTTGNTYFKDGNYLKAVEYYKKCIEVEPENPIGYSNSAMSLIKLTKYTEALESCGTG 63

Query: 158 IK-VNPSYSKGYSRLGFAQYALGKPE 182
           +K VN + S+ Y +L + +Y L   E
Sbjct: 64  LKYVNDADSQVYKKLQY-RYNLADTE 88

>KLLA0C08910g Chr3 complement(781726..782073) [348 bp, 115 aa] {ON}
           similar to uniprot|P25638 Saccharomyces cerevisiae
           YCR060W TAH1 HSP90 cofactor interacts with Hsp82p Pih1p
           Rvb1 and Rvb2 contains a single TPR domain with at least
           two TPR motifs
          Length = 115

 Score = 37.7 bits (86), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 28/53 (52%)

Query: 98  ESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEA 150
           E  K++GN A    +F  AV  Y +AI   PTN V Y+N A A   L  Y +A
Sbjct: 5   EEFKIKGNTAYKQNNFTDAVNFYKKAITYDPTNPVGYSNCAMALIKLNNYADA 57

>TBLA0I02310 Chr9 (528067..528417) [351 bp, 116 aa] {ON} Anc_6.328
           YCR060W
          Length = 116

 Score = 37.4 bits (85), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 35/63 (55%)

Query: 98  ESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAEDA 157
           E LK +GN +     + +A+  Y+  I + P+N + Y+N+A A     +++EA+   E  
Sbjct: 4   EELKAKGNISFKNGSYSEAISWYNRCISIDPSNPIGYSNKAMALLKADRFDEAITTCEKG 63

Query: 158 IKV 160
           +++
Sbjct: 64  LQL 66

>TBLA0H01970 Chr8 (464239..466761) [2523 bp, 840 aa] {ON} Anc_5.352
           YDR320C
          Length = 840

 Score = 39.3 bits (90), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 30/132 (22%), Positives = 60/132 (45%), Gaps = 5/132 (3%)

Query: 44  FEFDRESVATTLEKTFAGRSLKQVVEAASVGSSSPQESVKVNIPVEDAETKAKAESLKLE 103
           F+FD +SV +   K     + K +V A +           V +P+   E     E  +  
Sbjct: 494 FDFDSDSVTSMHIKQNNSATSKNIVTAKADEKDLVNTLPIVKVPISTIELSGYTE-FRAN 552

Query: 104 GNKAMAAKDFEQAVLKYSEAIQVLPT----NAVYYANRAAAHSSLKKYEEAVKDAEDAIK 159
           G +     D++ A+ +Y +++  LP       + Y+N  AA   + +Y ++VKD + A++
Sbjct: 553 GTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVKDCDVALE 612

Query: 160 VNPSYSKGYSRL 171
           + P   K +++ 
Sbjct: 613 LFPKNDKQWTQF 624

>AAR054C Chr1 complement(440706..441107) [402 bp, 133 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCR060W
          Length = 133

 Score = 37.0 bits (84), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 38/64 (59%)

Query: 97  AESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAED 156
           ++ L+ +GN   +  ++E AVL Y  A    P+N V+ AN + A   L+++E+A+   + 
Sbjct: 8   SDHLRSKGNDLYSKGEYETAVLYYKNASLAEPSNPVHLANMSMALLKLERWEDALSACDR 67

Query: 157 AIKV 160
           A+++
Sbjct: 68  ALEI 71

>KNAG0H00610 Chr8 (99931..102852) [2922 bp, 973 aa] {ON} Anc_3.367
           YBR112C
          Length = 973

 Score = 38.9 bits (89), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 50/104 (48%)

Query: 89  EDAETKAKAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYE 148
           +D  T++ AE+     + A    D ++A L Y   +Q  P++     + A  + S   ++
Sbjct: 57  QDPLTQSTAETWLSIASLAETVGDADRAALAYDATLQYNPSSTKALTSLAHLYRSRDMFQ 116

Query: 149 EAVKDAEDAIKVNPSYSKGYSRLGFAQYALGKPEEALDAYKKVL 192
            A +  E A++VNP  S  ++ LG     L   + A +AY++ L
Sbjct: 117 RAAELYERALQVNPELSDVWATLGHCYLMLDDLQRAYNAYQQAL 160

>NDAI0I00440 Chr9 complement(89650..90036) [387 bp, 128 aa] {ON}
           Anc_6.328 YCR060W
          Length = 128

 Score = 36.2 bits (82), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 35/67 (52%)

Query: 100 LKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAEDAIK 159
           LK EGN      D+ QA   Y + I++ PTN + Y+N+A +      +  AV+  ++ +K
Sbjct: 6   LKQEGNTFFQKGDYAQANGYYDQCIKLEPTNPIGYSNKAMSLIKQGNHGLAVETCQEGLK 65

Query: 160 VNPSYSK 166
              S +K
Sbjct: 66  YTSSSTK 72

>NDAI0C05130 Chr3 (1193350..1195122) [1773 bp, 590 aa] {ON}
           Anc_8.470
          Length = 590

 Score = 38.1 bits (87), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 24/100 (24%), Positives = 46/100 (46%)

Query: 112 DFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAEDAIKVNPSYSKGYSRL 171
           DF++ +  +  A+++ P + + +    A+ ++  + EEA+K    AI + PS+ +    L
Sbjct: 456 DFDKTLECFQNALKINPNDELMWNRLGASLANSNRSEEAIKAYHKAINLKPSFVRARYNL 515

Query: 172 GFAQYALGKPEEALDAYKKVLDIEGEAATDAMKRDYDTAM 211
             A   +G  +EA      VL +      D      DTA+
Sbjct: 516 AVASMNIGCYQEAAGHLLTVLKMHQVHGQDNTSVKTDTAV 555

 Score = 34.7 bits (78), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 15/55 (27%), Positives = 34/55 (61%)

Query: 141 HSSLKKYEEAVKDAEDAIKVNPSYSKGYSRLGFAQYALGKPEEALDAYKKVLDIE 195
           H S   +++ ++  ++A+K+NP+    ++RLG +     + EEA+ AY K ++++
Sbjct: 451 HYSNDDFDKTLECFQNALKINPNDELMWNRLGASLANSNRSEEAIKAYHKAINLK 505

>Smik_2.36 Chr2 complement(61159..63414) [2256 bp, 751 aa] {ON}
           YBL084C (REAL)
          Length = 751

 Score = 38.1 bits (87), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 44/99 (44%)

Query: 96  KAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAE 155
           K E+    GN     KD + A+  + +A Q+ P  A  Y  +   HSS    + A     
Sbjct: 532 KPETWCCVGNLLSLQKDHDAAIKAFEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYR 591

Query: 156 DAIKVNPSYSKGYSRLGFAQYALGKPEEALDAYKKVLDI 194
            A+  +P +   Y  LG +   LG+ EEAL  ++K   I
Sbjct: 592 KALACDPQHYNAYYGLGTSSMKLGQYEEALLYFEKARSI 630

 Score = 33.1 bits (74), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 22/97 (22%), Positives = 47/97 (48%)

Query: 104 GNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAEDAIKVNPS 163
           G  +M    +E+A+L + +A  + P N V       +   L   E+A++  E A  + P+
Sbjct: 608 GTSSMKLGQYEEALLYFEKARSINPVNVVLICCCGGSLEKLGYKEKALQYYELACHLQPT 667

Query: 164 YSKGYSRLGFAQYALGKPEEALDAYKKVLDIEGEAAT 200
            S    ++G   Y++ +   AL  +++++ +  + AT
Sbjct: 668 SSLSKYKMGQLLYSMTRYSVALQTFEELVKLVPDDAT 704

>Suva_2.34 Chr2 complement(63832..65304,65365..66183) [2292 bp, 763
           aa] {ON} YBL084C (REAL)
          Length = 763

 Score = 38.1 bits (87), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 44/99 (44%)

Query: 96  KAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAE 155
           K E+    GN     KD + A+  + +A Q+ P  A  Y  +   HSS    + A     
Sbjct: 544 KPETWCCIGNLLSLQKDHDAAIKAFEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYR 603

Query: 156 DAIKVNPSYSKGYSRLGFAQYALGKPEEALDAYKKVLDI 194
            A+  +P +   Y  LG +   LG+ EEAL  ++K   I
Sbjct: 604 KALACDPQHYNAYYGLGTSSMKLGQYEEALLYFEKARSI 642

 Score = 32.3 bits (72), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 21/97 (21%), Positives = 47/97 (48%)

Query: 104 GNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAEDAIKVNPS 163
           G  +M    +E+A+L + +A  + P N V       +   L   E+ ++  E A ++ P+
Sbjct: 620 GTSSMKLGQYEEALLYFEKARSINPVNVVLICCCGGSLEKLGYKEKVLQYYELACQLQPT 679

Query: 164 YSKGYSRLGFAQYALGKPEEALDAYKKVLDIEGEAAT 200
            S    ++G   Y++ +   AL  +++++ +  + AT
Sbjct: 680 SSLSKYKMGQLLYSMTRYNVALQTFEELVKLVPDDAT 716

>YCR060W Chr3 (224399..224734) [336 bp, 111 aa] {ON}  TAH1Component
           of the conserved R2TP complex (Rvb1-Rvb2-Tah1-Pih1);
           contains a single TPR domain with at least two TPR
           motifs; R2TP complex interacts with Hsp90 (Hsp82p and
           Hsc82p) to mediate assembly large protein complexes such
           as box C/D snoRNPs and RNA polymerase II
          Length = 111

 Score = 35.8 bits (81), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 43/91 (47%), Gaps = 6/91 (6%)

Query: 95  AKAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDA 154
           ++ E  K +GN       + +AV  Y + I   P N V Y+N+A A   L +Y +A++  
Sbjct: 2   SQFEKQKEQGNSLFKQGLYREAVHCYDQLITAQPQNPVGYSNKAMALIKLGEYTQAIQMC 61

Query: 155 EDAIKVNPS------YSKGYSRLGFAQYALG 179
           +  ++   +       SK   RL  AQ A+G
Sbjct: 62  QQGLRYTSTAEHVAIRSKLQYRLELAQGAVG 92

>YBL084C Chr2 complement(67169..69445) [2277 bp, 758 aa] {ON}
           CDC27Subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C), which is a ubiquitin-protein ligase required
           for degradation of anaphase inhibitors, including
           mitotic cyclins, during the metaphase/anaphase
           transition
          Length = 758

 Score = 37.7 bits (86), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 44/99 (44%)

Query: 96  KAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAE 155
           K E+    GN     KD + A+  + +A Q+ P  A  Y  +   HSS    + A     
Sbjct: 539 KPETWCCIGNLLSLQKDHDAAIKAFEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYR 598

Query: 156 DAIKVNPSYSKGYSRLGFAQYALGKPEEALDAYKKVLDI 194
            A+  +P +   Y  LG +   LG+ EEAL  ++K   I
Sbjct: 599 KALACDPQHYNAYYGLGTSAMKLGQYEEALLYFEKARSI 637

 Score = 34.7 bits (78), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 23/97 (23%), Positives = 47/97 (48%)

Query: 104 GNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAEDAIKVNPS 163
           G  AM    +E+A+L + +A  + P N V       +   L   E+A++  E A  + P+
Sbjct: 615 GTSAMKLGQYEEALLYFEKARSINPVNVVLICCCGGSLEKLGYKEKALQYYELACHLQPT 674

Query: 164 YSKGYSRLGFAQYALGKPEEALDAYKKVLDIEGEAAT 200
            S    ++G   Y++ +   AL  +++++ +  + AT
Sbjct: 675 SSLSKYKMGQLLYSMTRYNVALQTFEELVKLVPDDAT 711

>TPHA0E00740 Chr5 complement(142456..144696) [2241 bp, 746 aa] {ON}
           Anc_7.412 YBL084C
          Length = 746

 Score = 37.4 bits (85), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 44/97 (45%)

Query: 98  ESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAEDA 157
           E+    GN     K+  +A+  + +A QV P  A  Y  +   ++S   ++ A +    A
Sbjct: 529 ETWCCLGNFLSLQKNHHEAIKAFEKATQVDPKFAYAYTLQGHEYTSSDSFDVAKRCYRKA 588

Query: 158 IKVNPSYSKGYSRLGFAQYALGKPEEALDAYKKVLDI 194
           I  +P +   Y  LG     LG+ EEAL  ++K   I
Sbjct: 589 IACDPGHYNAYYGLGMVSMKLGQYEEALLFFEKARSI 625

 Score = 32.0 bits (71), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 24/97 (24%), Positives = 46/97 (47%)

Query: 104 GNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAEDAIKVNPS 163
           G  +M    +E+A+L + +A  + P N V       A   L   E+A++  E A ++ PS
Sbjct: 603 GMVSMKLGQYEEALLFFEKARSINPINVVLVCCGGVALEKLSYQEKALQYYELACELQPS 662

Query: 164 YSKGYSRLGFAQYALGKPEEALDAYKKVLDIEGEAAT 200
            S    +     Y++G+   AL  ++++  +  + AT
Sbjct: 663 SSLATFKRAHLLYSMGRYTLALKFFEELKHVAPDEAT 699

>Kpol_1043.60 s1043 (123502..125622) [2121 bp, 706 aa] {ON}
           (123502..125622) [2121 nt, 707 aa]
          Length = 706

 Score = 37.4 bits (85), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 43/97 (44%), Gaps = 12/97 (12%)

Query: 134 YANRAAAHSSLKKYEEAVKDAEDAIKVNPSYSKGYSRLGFAQYALGKPEEALDAYKKVLD 193
           Y N +A +  L++ ++A + +   I + P   KGY R+G      GK  EA   YKK L 
Sbjct: 74  YDNLSATYEKLQELDKAYESSSRMIHIEPYNMKGYIRMGKVLQRQGKDPEAYKCYKKGLL 133

Query: 194 IEGEAA-----------TDAMKRDYDTAMKKV-GQSL 218
           +  E              D +K+  D   K++  QSL
Sbjct: 134 MSREMLQKFDIVVPEKFRDIIKQQRDIVKKRINNQSL 170

>KNAG0A04120 Chr1 complement(556919..558727) [1809 bp, 602 aa] {ON}
           Anc_8.470 YDR244W
          Length = 602

 Score = 37.4 bits (85), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 24/102 (23%), Positives = 48/102 (47%), Gaps = 3/102 (2%)

Query: 109 AAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAEDAIKVNPSYSKGY 168
           A  DF + +  +  A+QV P + + +    AA ++  + EE++K    A+++ PS+ +  
Sbjct: 458 ANDDFNKTIDCFKTALQVNPNDELMWNRLGAALANSNRSEESIKAYHRALQLKPSFVRAR 517

Query: 169 SRLGFAQYALGKPEEALDAYKKVL---DIEGEAATDAMKRDY 207
             L  +   +G  +EA++     L   ++EG    D     Y
Sbjct: 518 YNLAVSSMNIGCYKEAVEHLLTALSMHEVEGLRQKDKDSHHY 559

>NDAI0E04040 Chr5 (900685..903036) [2352 bp, 783 aa] {ON} Anc_7.412
           YBL084C
          Length = 783

 Score = 37.0 bits (84), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 45/97 (46%)

Query: 104 GNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAEDAIKVNPS 163
           G  +M   +FE A+L + +A  + P+N +       A   L   E+A+   E A +V PS
Sbjct: 640 GMCSMKLGEFEHALLYFEKARSINPSNVILICCCGVAFEKLSYPEKALSYYELACQVQPS 699

Query: 164 YSKGYSRLGFAQYALGKPEEALDAYKKVLDIEGEAAT 200
            S    +     Y++     AL+ ++++  +  E AT
Sbjct: 700 SSLAKFKRAHLLYSMANYPLALECFEELTKLAPEEAT 736

>ZYRO0B03828g Chr2 (318153..320336) [2184 bp, 727 aa] {ON} similar
           to uniprot|P38042 Saccharomyces cerevisiae YBL084C CDC27
           Subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C) which is a ubiquitin-protein ligase required for
           degradation of anaphase inhibitors including mitotic
           cyclins during the metaphase/anaphase transition
          Length = 727

 Score = 37.0 bits (84), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 41/91 (45%)

Query: 104 GNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAEDAIKVNPS 163
           GN     +D ++A+  + +A +V P  A  Y  +   HSS    + A      AI  +P 
Sbjct: 516 GNLYSLQRDHDEAIRYFEKATEVDPHFAYGYTLQGHEHSSNDSIDMAKTCYRKAIASDPQ 575

Query: 164 YSKGYSRLGFAQYALGKPEEALDAYKKVLDI 194
           +   Y  LG     LG+ EEAL  ++K   I
Sbjct: 576 HYNAYYGLGMCCMKLGQYEEALLYFEKARSI 606

>TPHA0D03860 Chr4 (807913..808275) [363 bp, 120 aa] {ON} Anc_6.328
           YCR060W
          Length = 120

 Score = 34.7 bits (78), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 44/99 (44%), Gaps = 7/99 (7%)

Query: 98  ESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAEDA 157
           E  K EGN+      ++ A   Y + + + P N + Y+N+A A   L +Y E V+     
Sbjct: 4   EQYKEEGNRNFKEGSYKVAAELYQKCVDIEPENPIGYSNKAMALIKLGRYTEVVELCRKG 63

Query: 158 IKVNPSYSKG-YSRLGFAQYALGKPEEALDAYKKVLDIE 195
           +   P+ +   Y +L +      + E AL   K V D E
Sbjct: 64  LTFTPNTTDTVYKKLNY------RLEMALKNMKHVNDQE 96

>AGL294W Chr7 (154711..156681) [1971 bp, 656 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBL084C (CDC27)
          Length = 656

 Score = 36.6 bits (83), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 52/106 (49%), Gaps = 4/106 (3%)

Query: 102 LEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLK--KYEEAVKDAEDAIK 159
           L+G++      F+ A + Y +A+ + P +  Y A+     S +K  +Y+EA+   E A  
Sbjct: 477 LQGHEYSNNDAFDNAKMCYRKALAINPNH--YNAHYGLGMSCIKLGQYDEALLHFEKARS 534

Query: 160 VNPSYSKGYSRLGFAQYALGKPEEALDAYKKVLDIEGEAATDAMKR 205
           +NP         G A   LG+ E+ALD Y+   +++  ++    K+
Sbjct: 535 INPVNVILNCCCGVALERLGRREKALDFYQLACELQPNSSLALFKK 580

 Score = 31.2 bits (69), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 22/91 (24%), Positives = 43/91 (47%)

Query: 104 GNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAEDAIKVNPS 163
           GN     +D ++A+    +A  + P  A  Y  +   +S+   ++ A      A+ +NP+
Sbjct: 445 GNLFSLNRDHDEAIKALKKATSLNPQFAYAYTLQGHEYSNNDAFDNAKMCYRKALAINPN 504

Query: 164 YSKGYSRLGFAQYALGKPEEALDAYKKVLDI 194
           +   +  LG +   LG+ +EAL  ++K   I
Sbjct: 505 HYNAHYGLGMSCIKLGQYDEALLHFEKARSI 535

>Smik_2.254 Chr2 complement(447517..450579) [3063 bp, 1020 aa] {ON}
           YBR112C (REAL)
          Length = 1020

 Score = 36.6 bits (83), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 49/103 (47%)

Query: 90  DAETKAKAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEE 149
           D  T++ AE+     + A    D ++A + Y   +Q  P++A    + A  + S   ++ 
Sbjct: 41  DPLTQSTAETWLSIASLAETLGDGDRAAMAYDATLQFNPSSAKALTSLAHLYRSRDMFQR 100

Query: 150 AVKDAEDAIKVNPSYSKGYSRLGFAQYALGKPEEALDAYKKVL 192
           A +  E A+ VNP  S  ++ LG     L   + A +AY++ L
Sbjct: 101 AAELYERALLVNPELSDVWATLGHCYLMLDDLQRAYNAYQQAL 143

>Suva_4.361 Chr4
           complement(631697..632812,632933..633154,633188..634741)
           [2892 bp, 963 aa] {ON} YBR112C (REAL)
          Length = 963

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 49/103 (47%)

Query: 90  DAETKAKAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEE 149
           D  T++ AE+     + A    D ++A + Y   +Q  P++A    + A  + S   ++ 
Sbjct: 43  DPLTQSTAETWLSIASLAETLGDGDRAAMAYDATLQFNPSSAKALTSLAHLYRSRDMFQR 102

Query: 150 AVKDAEDAIKVNPSYSKGYSRLGFAQYALGKPEEALDAYKKVL 192
           A +  E A+ VNP  S  ++ LG     L   + A +AY++ L
Sbjct: 103 AAELYERALLVNPELSDVWATLGHCYLMLDDLQRAYNAYQQAL 145

>Ecym_7142 Chr7 complement(287110..289137) [2028 bp, 675 aa] {ON}
           similar to Ashbya gossypii AGL294W
          Length = 675

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 54/111 (48%), Gaps = 4/111 (3%)

Query: 97  AESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLK--KYEEAVKDA 154
           A +  L+G++      F+ A + Y +A+ + P +  Y A+     S +K  +Y+EA+   
Sbjct: 491 AYAYTLQGHEYSNNDAFDNAKMCYRKALAINPNH--YNAHYGLGMSCIKLGQYDEALLHF 548

Query: 155 EDAIKVNPSYSKGYSRLGFAQYALGKPEEALDAYKKVLDIEGEAATDAMKR 205
           E A  +NP         G A   LG+ E+ALD Y+   +++  ++    K+
Sbjct: 549 EKARSINPVNVILNCCCGVALERLGRREKALDFYQLACELQPNSSLALFKK 599

 Score = 30.8 bits (68), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 22/91 (24%), Positives = 43/91 (47%)

Query: 104 GNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAEDAIKVNPS 163
           GN     +D ++A+    +A  + P  A  Y  +   +S+   ++ A      A+ +NP+
Sbjct: 464 GNLFSLNRDHDEAIKALKKATNLDPRFAYAYTLQGHEYSNNDAFDNAKMCYRKALAINPN 523

Query: 164 YSKGYSRLGFAQYALGKPEEALDAYKKVLDI 194
           +   +  LG +   LG+ +EAL  ++K   I
Sbjct: 524 HYNAHYGLGMSCIKLGQYDEALLHFEKARSI 554

>CAGL0H07095g Chr8 (700262..702247) [1986 bp, 661 aa] {ON} similar
           to uniprot|Q06677 Saccharomyces cerevisiae YDR320c SWA2
          Length = 661

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 36/150 (24%), Positives = 69/150 (46%), Gaps = 27/150 (18%)

Query: 70  AASVGSSSPQESVKV-NIPVEDAETKAKAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLP 128
           ++ V ++S Q +V +  IP+   E     E  K  G       D+  AV +Y +++  LP
Sbjct: 335 SSPVVNTSNQNTVSITQIPISHIEISGYNE-FKARGTDYFKNGDYASAVEEYEKSLNTLP 393

Query: 129 T----NAVYYANRAAAHSSLKKYEEAVKDAEDAIKVNP-----------------SYSKG 167
                  + Y+N  A+   + ++ ++V DA++A+K+ P                 SY+  
Sbjct: 394 MKHPLRIIAYSNIIASRIKIGQHSQSVVDAQEAMKLLPEEKSLWTAAIQNSDPVRSYNDI 453

Query: 168 YSRLGFAQ----YALGKPEEALDAYKKVLD 193
           + ++   Q     A+ K + ALDAY+ +L+
Sbjct: 454 WPKIILRQAESYEAIEKYKLALDAYQTLLE 483

>KLTH0C06204g Chr3 complement(538533..540416) [1884 bp, 627 aa] {ON}
           some similarities with uniprot|P38042 Saccharomyces
           cerevisiae YBL084C CDC27 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 627

 Score = 35.8 bits (81), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 24/97 (24%), Positives = 43/97 (44%)

Query: 98  ESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAEDA 157
           E+    GN     KD E+++  +  + Q+ P+    Y  +   +SS   ++ A+     A
Sbjct: 410 ETWCCIGNLFSLKKDHEESIKAFQRSTQLDPSFTYAYTLQGHEYSSNDAFDTAMTCYRKA 469

Query: 158 IKVNPSYSKGYSRLGFAQYALGKPEEALDAYKKVLDI 194
           +  NP +   +  LG     LG+ EE L  ++K   I
Sbjct: 470 LGSNPQHYNAHYGLGMCCLKLGQYEECLLHFEKARSI 506

>TDEL0A07430 Chr1 (1296631..1297005) [375 bp, 124 aa] {ON} Anc_6.328
           YCR060W
          Length = 124

 Score = 33.9 bits (76), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 30/58 (51%)

Query: 98  ESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAE 155
           E LK +GN     +D+  A+  Y + ++   TN + ++NRA     L + +EA K  +
Sbjct: 5   ERLKAQGNSCYQQQDYAGALRWYDQCLEADATNPIAHSNRAMCLIKLNRSQEAQKACQ 62

>YBR112C Chr2 complement(462870..465770) [2901 bp, 966 aa] {ON}
           CYC8General transcriptional co-repressor, acts together
           with Tup1p; also acts as part of a transcriptional
           co-activator complex that recruits the SWI/SNF and SAGA
           complexes to promoters; can form the prion [OCT+]
          Length = 966

 Score = 35.8 bits (81), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 49/103 (47%)

Query: 90  DAETKAKAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEE 149
           D  T++ AE+     + A    D ++A + Y   +Q  P++A    + A  + S   ++ 
Sbjct: 39  DPLTQSTAETWLSIASLAETLGDGDRAAMAYDATLQFNPSSAKALTSLAHLYRSRDMFQR 98

Query: 150 AVKDAEDAIKVNPSYSKGYSRLGFAQYALGKPEEALDAYKKVL 192
           A +  E A+ VNP  S  ++ LG     L   + A +AY++ L
Sbjct: 99  AAELYERALLVNPELSDVWATLGHCYLMLDDLQRAYNAYQQAL 141

>Skud_2.240 Chr2 complement(431507..434461) [2955 bp, 984 aa] {ON}
           YBR112C (REAL)
          Length = 984

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 49/103 (47%)

Query: 90  DAETKAKAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEE 149
           D  T++ AE+     + A    D ++A + Y   +Q  P++A    + A  + S   ++ 
Sbjct: 33  DPLTQSTAETWLSIASLAETLGDGDRAAMAYDATLQFNPSSAKALTSLAHLYRSRDMFQR 92

Query: 150 AVKDAEDAIKVNPSYSKGYSRLGFAQYALGKPEEALDAYKKVL 192
           A +  E A+ VNP  S  ++ LG     L   + A +AY++ L
Sbjct: 93  AAELYERALLVNPELSDVWATLGHCYLMLDDLQRAYNAYQQAL 135

>KLLA0E20857g Chr5 (1860517..1862649) [2133 bp, 710 aa] {ON} similar
           to uniprot|Q751K0 Ashbya gossypii AGL294W AGL294Wp and
           some similarites with YBL084C uniprot|P38042
           Saccharomyces cerevisiae YBL084C CDC27 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 710

 Score = 35.4 bits (80), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 41/87 (47%)

Query: 104 GNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAEDAIKVNPS 163
           GN     KD ++A+  + +AIQ+ P  A  Y  +   +S+   ++ A      A+ +  +
Sbjct: 499 GNLHSLNKDHDEAITAFGKAIQLDPFFAYAYTLQGHEYSNNDAFDNAKSCFRKALTIEKT 558

Query: 164 YSKGYSRLGFAQYALGKPEEALDAYKK 190
           +      LG     LGK EEAL  ++K
Sbjct: 559 HYNALYGLGMCCVKLGKFEEALLFFEK 585

>CAGL0K11209g Chr11 (1089300..1091072) [1773 bp, 590 aa] {ON}
           similar to uniprot|P35056 Saccharomyces cerevisiae
           YDR244w PAS10 peroxisomal targeting signal receptor
          Length = 590

 Score = 35.0 bits (79), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 21/92 (22%), Positives = 47/92 (51%), Gaps = 3/92 (3%)

Query: 109 AAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAEDAIKVNPSYSKGY 168
           A  +F++ +  +  A++V P + + +    A+ ++  + EEA++    A+++ PS+ +  
Sbjct: 436 ANDEFDRTIDCFQAALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVRAR 495

Query: 169 SRLGFAQYALGKPEEALDAYKKVL---DIEGE 197
             L  +   +G  +EA +     L   D+EGE
Sbjct: 496 YNLAVSSMNIGCYKEAAEHLLTALSMHDVEGE 527

>NCAS0B02560 Chr2 complement(427447..429183) [1737 bp, 578 aa] {ON}
           Anc_8.470
          Length = 578

 Score = 35.0 bits (79), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 25/101 (24%), Positives = 50/101 (49%), Gaps = 2/101 (1%)

Query: 92  ETKAKAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAV 151
           E  AK E ++  G    A  DF++ +  + E++++ P + V +    A+ ++  K E+A+
Sbjct: 428 EHDAKLELIR--GLLYYAEDDFDKTIECFKESLKINPNDEVMWNRLGASLANSNKPEDAI 485

Query: 152 KDAEDAIKVNPSYSKGYSRLGFAQYALGKPEEALDAYKKVL 192
           +    A+ + PS+ +    L  A   +G  +EA +    VL
Sbjct: 486 QAYHRALNLKPSFVRARYNLAVASMNIGCYKEAGEHLLTVL 526

 Score = 33.9 bits (76), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 13/48 (27%), Positives = 32/48 (66%)

Query: 147 YEEAVKDAEDAIKVNPSYSKGYSRLGFAQYALGKPEEALDAYKKVLDI 194
           +++ ++  ++++K+NP+    ++RLG +     KPE+A+ AY + L++
Sbjct: 447 FDKTIECFKESLKINPNDEVMWNRLGASLANSNKPEDAIQAYHRALNL 494

>KLLA0E22705g Chr5 complement(2027229..2028398) [1170 bp, 389 aa]
           {ON} similar to uniprot|P47103 Saccharomyces cerevisiae
           YJR032W CPR7 Peptidyl-prolyl cis-trans isomerase
           (cyclophilin) catalyzes the cis-trans isomerization of
           peptide bonds N-terminal to proline residues binds to
           Hsp82p and contributes to chaperone activity
          Length = 389

 Score = 34.7 bits (78), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 48/115 (41%), Gaps = 22/115 (19%)

Query: 97  AESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPT-----------NAVY-------YANRA 138
           AE++K  G+     +DF  A+ KY +A++               N  +       Y N  
Sbjct: 236 AETIKESGSLLFKKRDFRNALFKYKKALKYTTAYTPEVDIDKFHNEKFTIQKHKLYLNIC 295

Query: 139 AAHSSLKKYEEAVKDA----EDAIKVNPSYSKGYSRLGFAQYALGKPEEALDAYK 189
                LK+Y E++K +    +D    N   +K Y R G   YAL + E AL  YK
Sbjct: 296 LMLFYLKEYHESIKYSTFLVDDDRVGNKDKAKAYLRRGNCLYALNRFEAALTDYK 350

>Smik_3.159 Chr3 (222475..222822) [348 bp, 115 aa] {ON} YCR060W
           (REAL)
          Length = 115

 Score = 33.1 bits (74), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 36/72 (50%), Gaps = 2/72 (2%)

Query: 104 GNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAEDAIK--VN 161
           GN       + +AV  Y + I   P N V Y+N+A A   L +Y  A++  ++ ++  + 
Sbjct: 15  GNALFKQGLYREAVDSYDQLITAQPQNPVGYSNKAMALIKLAEYTHAIQTCQEGLRYALG 74

Query: 162 PSYSKGYSRLGF 173
           P ++   S+L +
Sbjct: 75  PEHAAIRSKLQY 86

>Kwal_34.16092 s34 complement(198730..199917) [1188 bp, 395 aa] {ON}
           YJR032W (CPR7) - peptidyl-prolyl cis/trans isomerase
           [contig 270] FULL
          Length = 395

 Score = 34.7 bits (78), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 32/129 (24%), Positives = 55/129 (42%), Gaps = 23/129 (17%)

Query: 84  VNIPVEDAETKAKAESL-KLEGNKAMAAKDFEQAVLKYSEAIQ----------------- 125
           VN   E AE   +  ++ K  G+     KDF+ A+ KY +A++                 
Sbjct: 228 VNFDKESAEDAYRVTTIIKNSGSLLFKQKDFQNALFKYKKALRYVNEFIPEIEVDEAYNK 287

Query: 126 -VLPTNAVYYANRAAAHSSLKKYEEAVKDAEDAIKVNPSYS----KGYSRLGFAQYALGK 180
             +   A  Y N +    +LK+YEEA+      +++  + S    K Y R G   +A  +
Sbjct: 288 KFIELKAKLYLNLSLVMFNLKRYEEAITYTTYLLEIPEASSIDKAKAYYRSGNCHFAKKR 347

Query: 181 PEEALDAYK 189
            ++AL  +K
Sbjct: 348 YDKALSDFK 356

>KLTH0F18150g Chr6 (1462613..1464682) [2070 bp, 689 aa] {ON} weakly
           similar to uniprot|Q7LGN4 Saccharomyces cerevisiae
           YOR080W DIA2 Protein of unknown function involved in
           invasive and pseudohyphal growth
          Length = 689

 Score = 34.7 bits (78), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 46/104 (44%), Gaps = 6/104 (5%)

Query: 136 NRAAAHSSLKKYEEAVKDAEDAIKVNPSYSKGYSRLGFAQYALGKPEEALDAYKKVLDIE 195
           NRAA    +   ++A+KDA  A +  P   K Y R G     L    +AL+ Y+     E
Sbjct: 76  NRAATWEKIGDLKKALKDANRATRFEPYNLKCYLRRGKILQKLRMDGQALENYE-----E 130

Query: 196 GEAATDAMKRDYDT-AMKKVGQSLNVEKSAPAATRDGAGSATGS 238
           G  A   M R Y     KK+ ++L  +K+  +    G  ++  S
Sbjct: 131 GVKAIRDMTRKYHLDPPKKLYEALEYQKNLVSRRLKGPKTSVAS 174

>SAKL0D11110g Chr4 (920630..921928) [1299 bp, 432 aa] {ON} similar
           to uniprot|P47103 Saccharomyces cerevisiae YJR032W CPR7
           Peptidyl-prolyl cis-trans isomerase (cyclophilin)
           catalyzes the cis-trans isomerization of peptide bonds
           N-terminal to proline residues binds to Hsp82p and
           contributes to chaperone activity
          Length = 432

 Score = 34.3 bits (77), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 53/125 (42%), Gaps = 22/125 (17%)

Query: 87  PVEDAETKAKAESLKLEGNKAMAAKDFEQAVLKYSEAI----QVLPTNAV---------- 132
           P   +E+   A  +K  G +    KDF+ A  KY +A+    + +P   V          
Sbjct: 269 PESFSESYKAANKIKESGTQLFKKKDFQDAFFKYRKALRYVNEYIPDMDVDEELSVKFAE 328

Query: 133 ----YYANRAAAHSSLKKYEEAVKDAEDAIKVN--PSY--SKGYSRLGFAQYALGKPEEA 184
                Y N +    +LKKY+ A+  A   +++   P+   +K Y R G    A  + EEA
Sbjct: 329 LKMKLYLNISLVLFNLKKYDSAITHATYLLEMEKVPTLDKAKAYYRRGNCYLAKNRLEEA 388

Query: 185 LDAYK 189
           L  YK
Sbjct: 389 LKDYK 393

>NDAI0F00400 Chr6 complement(96274..98568) [2295 bp, 764 aa] {ON}
           Anc_5.689 YOR080W
          Length = 764

 Score = 34.7 bits (78), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 34/69 (49%), Gaps = 1/69 (1%)

Query: 136 NRAAAHSSLKKYEEAVKDAEDAIKVNPSYSKGYSRLGFAQYALGKPEEALDAYKKVLDIE 195
           NRAA    + + E+A++DA     + P   K + R G     L K ++A + YK  L   
Sbjct: 99  NRAACWEKMGELEKALRDATKMCFIEPYNLKCFIRKGKILQKLHKLKDAYNTYKTALR-N 157

Query: 196 GEAATDAMK 204
              ATD++K
Sbjct: 158 ANFATDSLK 166

>TBLA0D00460 Chr4 complement(113831..116338) [2508 bp, 835 aa] {ON}
           Anc_7.412 YBL084C
          Length = 835

 Score = 34.3 bits (77), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 24/97 (24%), Positives = 47/97 (48%)

Query: 104 GNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAEDAIKVNPS 163
           G   M    ++QA+L + +A  + P+NA+      +A   L   E+A+   E A  + P+
Sbjct: 693 GTCCMRLGQYDQALLYFEKAKMINPSNAILLCCCGSALEKLNFNEKALNYYELACNLQPN 752

Query: 164 YSKGYSRLGFAQYALGKPEEALDAYKKVLDIEGEAAT 200
            S    +L    Y++ +   AL+  ++V+++  E  T
Sbjct: 753 SSFAKFKLAKLLYSMSRYNLALEILEQVIEMAPEEVT 789

>Skud_4.506 Chr4 (905143..906978) [1836 bp, 611 aa] {ON} YDR244W
           (REAL)
          Length = 611

 Score = 33.9 bits (76), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 27/133 (20%), Positives = 62/133 (46%), Gaps = 22/133 (16%)

Query: 112 DFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAEDAIKVNPSYSKGYSRL 171
           DF++ +  +  A++V P + + +    A+ ++  + EEA++    A+++ PS+ +    L
Sbjct: 472 DFDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVRARYNL 531

Query: 172 GFAQYALGKPEEA------------LDAYKK-----VLDIEGEAATDAMKRDY-----DT 209
             +   +G  +EA            ++  KK     +L+   +A  D +KR +     D 
Sbjct: 532 AVSSMNIGCLKEAAGYLLSVLSMHEVNTNKKGDVGSLLNTYNDAVIDTLKRVFIAMNRDD 591

Query: 210 AMKKVGQSLNVEK 222
            ++KV   +++ K
Sbjct: 592 LLQKVKPGMDLNK 604

>Skud_2.24 Chr2 complement(50790..53099) [2310 bp, 769 aa] {ON}
           YBL084C (REAL)
          Length = 769

 Score = 33.9 bits (76), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 43/99 (43%)

Query: 96  KAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAE 155
           K E+    GN     KD + A+  + +A Q+ P  A  Y  +   HSS    + A     
Sbjct: 550 KPETWCCIGNLLSLQKDHDAAIKAFEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYR 609

Query: 156 DAIKVNPSYSKGYSRLGFAQYALGKPEEALDAYKKVLDI 194
            A+  +  +   Y  LG +   LG+ EEAL  ++K   I
Sbjct: 610 KALACDSQHYNAYYGLGTSSMKLGQYEEALLYFEKARSI 648

 Score = 33.5 bits (75), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 22/97 (22%), Positives = 47/97 (48%)

Query: 104 GNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAEDAIKVNPS 163
           G  +M    +E+A+L + +A  + P N V       +   L   E+A++  E A  + P+
Sbjct: 626 GTSSMKLGQYEEALLYFEKARSINPVNVVLICCCGGSLEKLGYKEKALQYYELACHLQPT 685

Query: 164 YSKGYSRLGFAQYALGKPEEALDAYKKVLDIEGEAAT 200
            S    ++G   Y++ +   AL  +++++ +  + AT
Sbjct: 686 SSLSKYKMGQLLYSMTRYNVALQTFEELVKLVPDDAT 722

>Ecym_4031 Chr4 complement(73900..75966) [2067 bp, 688 aa] {ON}
           similar to Ashbya gossypii ADR230W
          Length = 688

 Score = 33.9 bits (76), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 35/71 (49%)

Query: 128 PTNAVYYANRAAAHSSLKKYEEAVKDAEDAIKVNPSYSKGYSRLGFAQYALGKPEEALDA 187
           P   +   NRAA+   +    +A+ DA+  IKV+    KGY R G     + + +EAL  
Sbjct: 67  PRYLILLDNRAASWERINNLGKALIDADRMIKVDAYNLKGYIRKGKILQKMAQDKEALYV 126

Query: 188 YKKVLDIEGEA 198
           Y++ L    EA
Sbjct: 127 YREGLSKAKEA 137

>ZYRO0F00374g Chr6 complement(37241..39097) [1857 bp, 618 aa] {ON}
           similar to gnl|GLV|CAGL0A01155g Candida glabrata
           CAGL0A01155g and weakly similar to YPL269W
           uniprot|P32526 Saccharomyces cerevisiae YPL269W KAR9
           Karyogamy protein required for correct positioning of
           the mitotic spindle and for orienting cytoplasmic
           microtubules localizes at the shmoo tip in mating cells
           and at the tip of the growing bud in small-budded cells
           through anaphase
          Length = 618

 Score = 33.5 bits (75), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 26/129 (20%), Positives = 57/129 (44%), Gaps = 17/129 (13%)

Query: 15  FLSHTVENKEVSEDYVDSLNVAIDC-ITEAFEFDRESVATTLEKTFAGRSLKQVVEAASV 73
            L  ++E  E+S+D +D+L + ID  I + FE   E   + +       +LK VV   + 
Sbjct: 143 LLEASLEFDEISKDNIDTLGIVIDTNINQCFEVQEERFTSPVRHP-PSFTLKHVVRLLAS 201

Query: 74  GSSSPQESVKVNIPVEDAETKAKAESLKLEGNKAMAAKDFEQAVLKYSEAI-QVLPTNAV 132
            + + + ++    P+E+  ++                 D ++ V   S+++ ++LP    
Sbjct: 202 HTDTAEATIPTFSPIEEVLSRKYL--------------DIKRTVSPISKSLTEILPARID 247

Query: 133 YYANRAAAH 141
           +++ R   H
Sbjct: 248 HFSKRTIIH 256

>YDR244W Chr4 (950563..952401) [1839 bp, 612 aa] {ON}
           PEX5Peroxisomal membrane signal receptor for the
           C-terminal tripeptide signal sequence (PTS1) of
           peroxisomal matrix proteins, required for peroxisomal
           matrix protein import; also proposed to have
           PTS1-receptor independent functions
          Length = 612

 Score = 33.1 bits (74), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 22/95 (23%), Positives = 47/95 (49%), Gaps = 1/95 (1%)

Query: 112 DFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAEDAIKVNPSYSKGYSRL 171
           DF++ +  +  A++V P + + +    A+ ++  + EEA++    A+++ PS+ +    L
Sbjct: 472 DFDKTIDCFESALRVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVRARYNL 531

Query: 172 GFAQYALGKPEEALDAYKKVLDIEGEAATDAMKRD 206
             +   +G  +EA      VL +  E  T+  K D
Sbjct: 532 AVSSMNIGCFKEAAGYLLSVLSMH-EVNTNNKKGD 565

>CAGL0K09240g Chr11 complement(914042..914470) [429 bp, 142 aa] {ON}
           weakly similar to uniprot|P25638 Saccharomyces
           cerevisiae YCR060w
          Length = 142

 Score = 32.0 bits (71), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 38/75 (50%), Gaps = 4/75 (5%)

Query: 104 GNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAEDAIKVNPS 163
           GN+     +++ A+ +Y + I + PTNAV Y+N A A+  LK       +A+ A ++  S
Sbjct: 42  GNEHFKKGEYDLAIEQYRKCISLEPTNAVGYSNLAMAY--LK--NRCPDEAKTACEMGLS 97

Query: 164 YSKGYSRLGFAQYAL 178
           Y K        QY L
Sbjct: 98  YCKDTKLRQKLQYRL 112

>KNAG0F02710 Chr6 (509609..511024) [1416 bp, 471 aa] {ON} Anc_5.268
           YHR024C
          Length = 471

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 44/99 (44%), Gaps = 3/99 (3%)

Query: 20  VENK-EVSEDYVDS--LNVAIDCITEAFEFDRESVATTLEKTFAGRSLKQVVEAASVGSS 76
           VEN    +  Y DS    ++I CI EA     E +A  L  TFA  SLK   +      +
Sbjct: 317 VENCISFNHSYSDSGIFGISISCIPEAASQAVEIIAMQLHNTFANDSLKLAEDEVHRAKN 376

Query: 77  SPQESVKVNIPVEDAETKAKAESLKLEGNKAMAAKDFEQ 115
             + S+ +N+  +  E +     ++L G+K    +  E+
Sbjct: 377 QLKSSLLMNLESKLVELEDMGRQIQLHGHKIQVNEMIEK 415

>KNAG0B02240 Chr2 complement(434466..436685) [2220 bp, 739 aa] {ON}
           Anc_7.412 YBL084C
          Length = 739

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 27/109 (24%), Positives = 49/109 (44%)

Query: 97  AESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAED 156
           A +  L+G++  A + ++ A + Y +AI   P +   Y       S L KY++A+   E 
Sbjct: 555 AYAYTLQGHEHAANETYDTAKIMYRKAIACDPQHYNAYYGLGDCASRLGKYDKALLYFEK 614

Query: 157 AIKVNPSYSKGYSRLGFAQYALGKPEEALDAYKKVLDIEGEAATDAMKR 205
           A  +NP  +      G +   L  P++AL  Y+    ++ E      K+
Sbjct: 615 ARVINPVNAILICCCGHSLEKLNLPDQALTYYELAEKLQPEMTIPKYKK 663

>Suva_2.410 Chr2 (729992..731827) [1836 bp, 611 aa] {ON} YDR244W
           (REAL)
          Length = 611

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 23/111 (20%), Positives = 52/111 (46%), Gaps = 17/111 (15%)

Query: 112 DFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAEDAIKVNPSYSKGYSRL 171
           DF++ +  +  A++V P + + +    A+ ++  + EEA++    A+++ PS+ +    L
Sbjct: 472 DFDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVRARYNL 531

Query: 172 GFAQYALGKPEEA------------LDAYKK-----VLDIEGEAATDAMKR 205
             +   +G  +EA            +D  KK     +L+   ++  D +KR
Sbjct: 532 AVSSMNIGCYKEAAGYLLTVLSMHEVDTKKKGDLGSLLNTYNDSVIDTLKR 582

>Smik_4.491 Chr4 (895429..897267) [1839 bp, 612 aa] {ON} YDR244W
           (REAL)
          Length = 612

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 29/49 (59%)

Query: 147 YEEAVKDAEDAIKVNPSYSKGYSRLGFAQYALGKPEEALDAYKKVLDIE 195
           +++ +   E A+KVNP+    ++RLG +     + EEA+ AY + L ++
Sbjct: 474 FDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLK 522

 Score = 32.3 bits (72), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 16/73 (21%), Positives = 39/73 (53%)

Query: 112 DFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAEDAIKVNPSYSKGYSRL 171
           DF++ +  +  A++V P + + +    A+ ++  + EEA++    A+++ PS+ +    L
Sbjct: 473 DFDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVRARYNL 532

Query: 172 GFAQYALGKPEEA 184
             +   +G  +EA
Sbjct: 533 AVSSMNIGCFKEA 545

>Kwal_55.21839 s55 (998426..1000498) [2073 bp, 690 aa] {ON} YOR080W
           (DIA2) - may be involved in regulation of invasive
           growth and budding pattern [contig 126] FULL
          Length = 690

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 32/104 (30%), Positives = 41/104 (39%), Gaps = 10/104 (9%)

Query: 136 NRAAAHSSLKKYEEAVKDAEDAIKVNPSYSKGYSRLGFAQYALGKPEEALDAYKKVLDIE 195
           NRAA    L    +A+KDA  A+K  P   K Y R G     L   + AL  Y+     E
Sbjct: 76  NRAATWEKLGDLTKALKDANRAVKYEPYNLKCYLRKGKILQKLQLDDMALKNYE-----E 130

Query: 196 GEAATDAMKRDY-----DTAMKKVGQSLNVEKSAPAATRDGAGS 234
           G    D M+  Y         + V    ++ KS    TRD   S
Sbjct: 131 GLQKADEMRSRYGLEPPQKLSRIVEHQKSLIKSRITETRDTVSS 174

>Kpol_172.2 s172 (4270..5523) [1254 bp, 418 aa] {ON} (4270..5523)
           [1254 nt, 418 aa]
          Length = 418

 Score = 32.0 bits (71), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 26/103 (25%), Positives = 47/103 (45%)

Query: 90  DAETKAKAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEE 149
           D  T++ AE+     + A    D ++A L Y   +Q   ++     + A  + S   ++ 
Sbjct: 56  DPLTQSTAETWLSIASLAETVGDTDRAALAYDATLQYNQSSTKALTSLANLYRSRDMFQR 115

Query: 150 AVKDAEDAIKVNPSYSKGYSRLGFAQYALGKPEEALDAYKKVL 192
           A +  E A+ VNP  S  ++ LG     L   + A +AY++ L
Sbjct: 116 AAELYERALSVNPELSDVWATLGHCYLMLDDLQRAYNAYQQAL 158

>YKL022C Chr11 complement(394726..397248) [2523 bp, 840 aa] {ON}
           CDC16Subunit of the anaphase-promoting complex/cyclosome
           (APC/C), which is a ubiquitin-protein ligase required
           for degradation of anaphase inhibitors, including
           mitotic cyclins, during the metaphase/anaphase
           transition; required for sporulation
          Length = 840

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 38/66 (57%), Gaps = 4/66 (6%)

Query: 125 QVLPTNAVYYANRAAAHSSLKKYEEAVKDAEDAIKVNPSYSKGYSRLGFAQ-YAL-GKPE 182
           +  P +A+ + + A  + SL +  EA K    +  ++PS++  +  LGFA  YAL G+ +
Sbjct: 525 ETFPKSAITWFSVATYYMSLDRISEAQKYYSKSSILDPSFAAAW--LGFAHTYALEGEQD 582

Query: 183 EALDAY 188
           +AL AY
Sbjct: 583 QALTAY 588

>AFR453W Chr6 (1251460..1253169) [1710 bp, 569 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR244W (PEX5)
          Length = 569

 Score = 32.0 bits (71), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 21/93 (22%), Positives = 45/93 (48%), Gaps = 3/93 (3%)

Query: 109 AAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAEDAIKVNPSYSKGY 168
           A +DF++ +  +  A+ V P +   +    A+ ++  + EEA++    AI++ P++ +  
Sbjct: 429 ANEDFDKTIDCFRAALAVRPDDECMWNRLGASLANSNRSEEAIQAYHRAIQLKPTFVRAR 488

Query: 169 SRLGFAQYALGKPEEALDAYKKVL---DIEGEA 198
             L  +   +G   EA +     L   ++EG A
Sbjct: 489 YNLAVSSMNIGCYREAAEHLLTALSMHEVEGVA 521

>KLLA0C15455g Chr3 (1341570..1343270) [1701 bp, 566 aa] {ON} similar
           to uniprot|P35056 Saccharomyces cerevisiae YDR244W PEX5
           Essential for import of proteins with SKL- like import
           signal into peroxisomal matrix 69-kDa protein containing
           tetratricopeptide repeat (TPR)
          Length = 566

 Score = 31.6 bits (70), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 40/88 (45%), Gaps = 17/88 (19%)

Query: 114 EQAVLKYSEAIQVLPT---------NAVYYANRAAAHSSLKKYEEAVKDAEDAIKVNPSY 164
           +Q + KY +    LP            ++YAN        +++ + +     A++VNP+ 
Sbjct: 398 KQVITKYLQVANALPQVDPEVQLGLGTLFYAN--------EEFGKTIDCFRTALEVNPND 449

Query: 165 SKGYSRLGFAQYALGKPEEALDAYKKVL 192
              ++RLG +     + EEA+ AY K L
Sbjct: 450 ELMWNRLGASLANSNRSEEAIQAYHKAL 477

 Score = 30.0 bits (66), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 18/92 (19%), Positives = 44/92 (47%)

Query: 104 GNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAEDAIKVNPS 163
           G    A ++F + +  +  A++V P + + +    A+ ++  + EEA++    A+ + PS
Sbjct: 423 GTLFYANEEFGKTIDCFRTALEVNPNDELMWNRLGASLANSNRSEEAIQAYHKALALKPS 482

Query: 164 YSKGYSRLGFAQYALGKPEEALDAYKKVLDIE 195
           + +    L  +   +G  +EA ++    L + 
Sbjct: 483 FVRARYNLAISSMNIGCYKEAAESLLSALSMH 514

>Suva_11.204 Chr11 complement(378512..380893) [2382 bp, 793 aa] {ON}
           YKL022C (REAL)
          Length = 793

 Score = 31.6 bits (70), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 37/64 (57%), Gaps = 4/64 (6%)

Query: 127 LPTNAVYYANRAAAHSSLKKYEEAVKDAEDAIKVNPSYSKGYSRLGFAQ-YAL-GKPEEA 184
            P +A+ + + A  + SL +  EA K    +  ++PS++  +  LGFA  YAL G+ ++A
Sbjct: 476 FPKSAITWFSVATYYMSLDRISEAQKYYSKSSILDPSFAAAW--LGFAHTYALEGEQDQA 533

Query: 185 LDAY 188
           L AY
Sbjct: 534 LTAY 537

>YPL269W Chr16 (33013..34947) [1935 bp, 644 aa] {ON}  KAR9Karyogamy
           protein required for correct positioning of the mitotic
           spindle and for orienting cytoplasmic microtubules,
           localizes at the shmoo tip in mating cells and at the
           tip of the growing bud in small-budded cells through
           anaphase
          Length = 644

 Score = 31.6 bits (70), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 37/153 (24%), Positives = 67/153 (43%), Gaps = 22/153 (14%)

Query: 8   LANLIVDFLSHTVENKEVSEDYVDSLNVAIDC-ITEAFEFDRESVATTLEKTFAGRSLKQ 66
           L NL  + L  ++E  E+S+D++D+L+  I+  I+   E   E  A+ +  T    +L+Q
Sbjct: 152 LTNL-KELLDTSLEFNEISKDHMDTLHKIINSNISYCLEIQEERFASPIRHT-PSFTLEQ 209

Query: 67  VVEAASVGSSSPQESVKVNIPVEDAETKAKAESLKLEGNKAMAAKDFEQAVLKYSEAIQV 126
           +V+     + + +  V    P ED  ++   + L L+ N     K              +
Sbjct: 210 LVKLLGTHTETTEPKVPKFSPAEDILSR---KFLNLKKNIPPIEKSL----------TDI 256

Query: 127 LPTNAVYYANRAAAHSSL------KKYEEAVKD 153
           LP   V + +R   + +       KKYE  +KD
Sbjct: 257 LPQRIVQFGHRNITNITTLQTILQKKYELIMKD 289

>ZYRO0C16522g Chr3 complement(1281166..1284090) [2925 bp, 974 aa]
           {ON} highly similar to uniprot|P14922 Saccharomyces
           cerevisiae YBR112C CYC8 General transcriptional co-
           repressor acts together with Tup1p also acts as part of
           a transcriptional co-activator complex that recruits the
           SWI/SNF and SAGA complexes to promoters
          Length = 974

 Score = 31.6 bits (70), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 26/103 (25%), Positives = 46/103 (44%)

Query: 90  DAETKAKAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEE 149
           D  T+A AE+     + A    D ++A + Y   +Q    +     + A  + S   ++ 
Sbjct: 47  DPLTQATAETWLSLASLAETLGDADRAAMAYDATLQYNQASTKALTSLAHLYRSRDMFQR 106

Query: 150 AVKDAEDAIKVNPSYSKGYSRLGFAQYALGKPEEALDAYKKVL 192
           A +  E A+ VNP  S  ++ LG     L   + A +AY++ L
Sbjct: 107 AAELYERALAVNPELSDVWATLGHCYLMLDDLQRAYNAYQQAL 149

>Kpol_520.6 s520 (15903..16781) [879 bp, 292 aa] {ON} (15903..16781)
           [879 nt, 293 aa]
          Length = 292

 Score = 31.2 bits (69), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 28/111 (25%), Positives = 49/111 (44%), Gaps = 14/111 (12%)

Query: 97  AESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAV---------YY----ANRAAAHSS 143
           AE     GN       F+QA   Y E + + P N V         YY     N+  + S 
Sbjct: 159 AELWWFIGNLYFKLGQFDQAKHCYEEVVLLQPFNYVAFVRISEILYYKVIRLNKKISKSE 218

Query: 144 LKK-YEEAVKDAEDAIKVNPSYSKGYSRLGFAQYALGKPEEALDAYKKVLD 193
             +  +E++ +A  +I++N  + KG+S +     A+G  ++ L+  K  L+
Sbjct: 219 RTQILQESLNNALRSIELNEMFLKGWSLIAIVSKAMGTKKDILEVSKNKLN 269

>TDEL0C02720 Chr3 (477529..479631) [2103 bp, 700 aa] {ON} Anc_7.412
           YBL084C
          Length = 700

 Score = 31.6 bits (70), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 24/99 (24%), Positives = 43/99 (43%)

Query: 96  KAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAE 155
           K ++    GN     +D E A+  + +A ++    A  Y  +   HSS    + A     
Sbjct: 481 KPQTWCCLGNLYSLQRDHEDAIKYFEKATKIDYNFAYAYTLQGHEHSSNDSIDTAKNCYR 540

Query: 156 DAIKVNPSYSKGYSRLGFAQYALGKPEEALDAYKKVLDI 194
            A+  +P +   Y  LG     LG+ ++AL  ++K  +I
Sbjct: 541 RALACDPQHYNAYYGLGMCYMKLGQYDKALLFFEKARNI 579

>NCAS0D04500 Chr4 (855490..855855) [366 bp, 121 aa] {ON} Anc_6.328
           YCR060W
          Length = 121

 Score = 30.0 bits (66), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 27/52 (51%)

Query: 101 KLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVK 152
           K EGN+     D+  A   Y   I   PTN + Y+N+A +    + +++A++
Sbjct: 7   KTEGNRLFKLGDYTAANKFYDLCIMEEPTNPIGYSNKAMSLIKQEHFDQAIR 58

>KLLA0D13662g Chr4 complement(1178179..1180143) [1965 bp, 654 aa]
           {ON} similar to uniprot|P40009 YER005W Saccharomyces
           cerevisiae YND1 Yeast Nucleoside Diphosphatase
          Length = 654

 Score = 31.2 bits (69), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 47/100 (47%), Gaps = 4/100 (4%)

Query: 148 EEAVKDAEDAIKVNPSYSKGYSRLGFAQYALGKPEEALDAYKKVLDIEGEAATDAMKRDY 207
           +  + D  +A+K +    K YS+L   +  LGK EE      +    E E +++   R  
Sbjct: 547 KHKIFDGINAVKTSFCKLKTYSKLAQEEDMLGKLEEGTVNRGRFGRQEMENSSNFRSR-- 604

Query: 208 DTAMKKVGQSLNVEKSAPAATRDGAGSATGSGGLPDISSM 247
             +M  +G SL+ + S P + RD   ++  + G+  + SM
Sbjct: 605 --SMMNLGDSLDSKDSYPLSDRDRKNTSLPNQGMRPVFSM 642

>TBLA0C01590 Chr3 complement(370571..371797) [1227 bp, 408 aa] {ON}
           Anc_1.456 YJR032W
          Length = 408

 Score = 30.8 bits (68), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 46/114 (40%), Gaps = 22/114 (19%)

Query: 97  AESLKLEGNKAMAAKDFEQAVLKYSEAIQVLP-----------TNAVY-------YANRA 138
           A ++K  G      KDF+ A  KY ++++ +             N  Y       Y N  
Sbjct: 240 ANTIKESGTLLFKKKDFQNAFFKYKKSLRYITEYIPDMEMDKENNIKYTNLKIKLYLNMC 299

Query: 139 AAHSSLKKYEEAVKDAEDAIKVNP----SYSKGYSRLGFAQYALGKPEEALDAY 188
                ++KYEEA++ A   I++        +K Y R G    A  + E+AL  Y
Sbjct: 300 LMMFDMQKYEEAIQYATYIIEMENVPKLDVAKAYYRSGNCYLAKKRLEDALKDY 353

>Kpol_1067.25 s1067 (57301..58476) [1176 bp, 391 aa] {ON}
           (57301..58476) [1176 nt, 392 aa]
          Length = 391

 Score = 30.8 bits (68), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 33/133 (24%), Positives = 57/133 (42%), Gaps = 27/133 (20%)

Query: 84  VNIPVEDAETKAKA-ESLKLEGNKAMAAKDFEQAVLKYSEAI----QVLPTNAV------ 132
           +N   ED+    +A  ++K  G      KD++ A+LKY +++    + +P   V      
Sbjct: 224 INFDPEDSSKAYEATNTIKESGTLLFKQKDYQNALLKYKKSLKYVNEFIPEMEVNKDNCI 283

Query: 133 --------YYANRAAAHSSLK------KYEEAVKDAEDAIKVNPSYSKGYSRLGFAQYAL 178
                    Y N +  + +LK       Y   + D E+   ++   +K Y R G A +A 
Sbjct: 284 LFTVLKMKLYLNISLVYFNLKDNDNCITYTTYLLDMENVPDLDQ--AKAYYRRGNAYFAK 341

Query: 179 GKPEEALDAYKKV 191
            + EEAL+ YK  
Sbjct: 342 KRLEEALNDYKNC 354

>SAKL0F16236g Chr6 (1313573..1317799) [4227 bp, 1408 aa] {ON}
           similar to uniprot|P17883 Saccharomyces cerevisiae
           YPR189W SKI3 dsRNA virus protection family member
           contains 8 copies of the tetratricopeptide (TPR) domain
          Length = 1408

 Score = 31.2 bits (69), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 30/51 (58%), Gaps = 1/51 (1%)

Query: 147 YEEAVKDAEDAIKVNPSYSKGYSRLGFAQYALGKPEEALDAYKKVL-DIEG 196
           + EA K   + IK  P   +  S LG+++  LG P+ A++ +K VL ++EG
Sbjct: 500 WGEANKLLSEVIKEFPDNCEVTSELGWSELHLGDPDSAIEKFKYVLNNVEG 550

>Ecym_1396 Chr1 (820413..822134) [1722 bp, 573 aa] {ON} similar to
           Ashbya gossypii AFR453W
          Length = 573

 Score = 30.8 bits (68), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 16/76 (21%), Positives = 38/76 (50%)

Query: 109 AAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAEDAIKVNPSYSKGY 168
           A  +F++ +  +  A+ V P +   +    A+ ++  + EEA++    AI++ P++ +  
Sbjct: 433 ANDEFDKTIDCFKAALHVRPNDECMWNRLGASLANSNRSEEAIQAYHRAIQLKPAFVRAR 492

Query: 169 SRLGFAQYALGKPEEA 184
             L  +   +G  +EA
Sbjct: 493 YNLAVSSMNIGCYKEA 508

>NDAI0D01820 Chr4 (422414..423814) [1401 bp, 466 aa] {ON} Anc_5.268
          Length = 466

 Score = 30.8 bits (68), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 23/92 (25%), Positives = 43/92 (46%), Gaps = 2/92 (2%)

Query: 26  SEDYVDS--LNVAIDCITEAFEFDRESVATTLEKTFAGRSLKQVVEAASVGSSSPQESVK 83
           +  Y DS    ++I C+ EA +   E +A  L  TFA ++L+   +  S   +  + S+ 
Sbjct: 319 NHSYSDSGIFGISIACLPEAAKQATEIIAQQLYSTFANKNLRLSHDEVSRAKNQLKSSLL 378

Query: 84  VNIPVEDAETKAKAESLKLEGNKAMAAKDFEQ 115
           +N+  +  E +     ++L   K   AK  E+
Sbjct: 379 MNLESKLIELEDMGRQIQLRNRKVPVAKMIEK 410

>KLLA0D09020g Chr4 (758818..760410) [1593 bp, 530 aa] {ON} similar
           to uniprot|P20424 Saccharomyces cerevisiae YPR088C SRP54
           Signal recognition particle (SRP) subunit (homolog of
           mammalian SRP54) contains the signal sequence- binding
           activity of SRP interacts with the SRP RNA and mediates
           binding of SRP to signal receptor contains GTPase domain
          Length = 530

 Score = 30.8 bits (68), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 20/30 (66%), Gaps = 3/30 (10%)

Query: 293 SGGGTPSMAD---LMNNPALMDMAKNMFGG 319
           SGGG P+M D   +M +P++ +MAK   GG
Sbjct: 500 SGGGMPNMQDIMGMMQDPSMQEMAKQFSGG 529

>Kwal_23.3670 s23 (387536..389944) [2409 bp, 802 aa] {ON} YBR112C
           (CYC8) - 1:1 [contig 253] FULL
          Length = 802

 Score = 30.8 bits (68), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 24/103 (23%), Positives = 46/103 (44%)

Query: 90  DAETKAKAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEE 149
           D  T++ AE+     + A    D ++A + Y   +Q  P++     + A  + S   ++ 
Sbjct: 59  DPLTQSTAETWLSIASLAETLGDADRAAMAYDATLQYNPSSTKALTSLAHLYRSRDMFQR 118

Query: 150 AVKDAEDAIKVNPSYSKGYSRLGFAQYALGKPEEALDAYKKVL 192
           A +  + A+ VNP     ++ LG     L   + A  AY++ L
Sbjct: 119 AAELYQRALTVNPELGDIWATLGHCYLMLDDLQRAYAAYQQAL 161

>KLTH0F10428g Chr6 (902697..905084) [2388 bp, 795 aa] {ON} highly
           similar to uniprot|P14922 Saccharomyces cerevisiae
           YBR112C CYC8 General transcriptional co- repressor acts
           together with Tup1p also acts as part of a
           transcriptional co-activator complex that recruits the
           SWI/SNF and SAGA complexes to promoters
          Length = 795

 Score = 30.4 bits (67), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 23/103 (22%), Positives = 46/103 (44%)

Query: 90  DAETKAKAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEE 149
           D  T++ AE+     + A    D ++A + Y   +Q  P++     + A  + S   ++ 
Sbjct: 55  DPLTQSTAETWLSIASLAETLGDADRAAMAYDATLQYNPSSTKALTSLAHLYRSRDMFQR 114

Query: 150 AVKDAEDAIKVNPSYSKGYSRLGFAQYALGKPEEALDAYKKVL 192
           A +  + A+ +NP     ++ LG     L   + A  AY++ L
Sbjct: 115 AAELYQRALSINPELGDIWATLGHCYLMLDDLQRAYAAYQQAL 157

>SAKL0G11088g Chr7 (940673..942157) [1485 bp, 494 aa] {ON} similar
           to uniprot|P11914 Saccharomyces cerevisiae YHR024C MAS2
           Larger subunit of the mitochondrial processing protease
           essential processing enzyme that cleaves the N-terminal
           targeting sequences from mitochondrially imported
           proteins
          Length = 494

 Score = 30.4 bits (67), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 38/83 (45%), Gaps = 2/83 (2%)

Query: 26  SEDYVDS--LNVAIDCITEAFEFDRESVATTLEKTFAGRSLKQVVEAASVGSSSPQESVK 83
           +  Y DS    ++  C+ +A  +  E +A  L  TF+  SLK   E  S   +  + S+ 
Sbjct: 329 NHSYSDSGIFGISASCVPQAAPYMAEIIAQQLANTFSNDSLKLTEEEVSRAKNQLKSSLL 388

Query: 84  VNIPVEDAETKAKAESLKLEGNK 106
           +N+  +  E +     ++L G K
Sbjct: 389 MNLESKLVELEDLGRQIQLHGRK 411

>SAKL0F12936g Chr6 (1016829..1018727) [1899 bp, 632 aa] {ON} similar
           to uniprot|Q751K0 Ashbya gossypii AGL294W AGL294Wp and
           some similarites with YBL084C uniprot|P38042
           Saccharomyces cerevisiae YBL084C CDC27 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 632

 Score = 30.4 bits (67), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 23/91 (25%), Positives = 39/91 (42%)

Query: 104 GNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAEDAIKVNPS 163
           GN     KD ++A+  + +A Q+ P     Y  +   +SS   ++ A      A+  N  
Sbjct: 421 GNMFSLNKDHDEAIKSFQKATQLDPRFTYAYTLQGHEYSSNDAFDTAKTCYRKALATNSQ 480

Query: 164 YSKGYSRLGFAQYALGKPEEALDAYKKVLDI 194
           +      LG     LG+ EE+L  ++K   I
Sbjct: 481 HYNASYGLGMCCLKLGQYEESLLHFQKAHSI 511

>SAKL0B07986g Chr2 complement(675999..678641) [2643 bp, 880 aa] {ON}
           highly similar to uniprot|P14922 Saccharomyces
           cerevisiae YBR112C CYC8 General transcriptional co-
           repressor acts together with Tup1p also acts as part of
           a transcriptional co-activator complex that recruits the
           SWI/SNF and SAGA complexes to promoters
          Length = 880

 Score = 30.4 bits (67), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 23/103 (22%), Positives = 45/103 (43%)

Query: 90  DAETKAKAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEE 149
           D  T++ AE+     + A    D ++A + Y   +Q  P++     + A  + S   ++ 
Sbjct: 51  DPLTQSTAETWLSIASLAETLDDIDRAAMAYDATLQYNPSSTKALTSLAHLYRSRDMFQR 110

Query: 150 AVKDAEDAIKVNPSYSKGYSRLGFAQYALGKPEEALDAYKKVL 192
           A +  + A+  NP     ++ LG     L   + A  AY++ L
Sbjct: 111 AAELYQRALSFNPELGDIWATLGHCYLMLDDLQRAYAAYQQAL 153

>KLTH0F16522g Chr6 complement(1340683..1341777) [1095 bp, 364 aa]
           {ON} similar to uniprot|P07285 YDR354W Saccharomyces
           cerevisiae TRP4 anthranilate phosphoribosyl transferase
          Length = 364

 Score = 30.0 bits (66), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 37/65 (56%), Gaps = 6/65 (9%)

Query: 61  GRSLKQVVEAASVGSSSPQESVKVNIPVEDAETKAKAESLKLEGNKAMAAKDFEQAVLKY 120
           G++++ ++++ +   S PQ SV+V +P+    +  +A  L L   KA    +  + VLKY
Sbjct: 24  GKAIELIIDSLA---SDPQPSVEVYVPIASFLSSLRATGLDL---KAEYISEAAKTVLKY 77

Query: 121 SEAIQ 125
           S+ ++
Sbjct: 78  SDVVE 82

>TDEL0C05090 Chr3 complement(908033..910312) [2280 bp, 759 aa] {ON}
           Anc_3.367 YBR112C
          Length = 759

 Score = 30.4 bits (67), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 25/103 (24%), Positives = 48/103 (46%)

Query: 90  DAETKAKAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEE 149
           D  T++ AE+     + A    D ++A + Y   +Q    +     + A  + S   +++
Sbjct: 19  DPLTQSTAETWLSIASLAETLGDADRAAMAYDATLQYNQASTKALTSLAHLYRSRDMFQK 78

Query: 150 AVKDAEDAIKVNPSYSKGYSRLGFAQYALGKPEEALDAYKKVL 192
           A +  E A+ VNP  S  ++ LG     L   ++A +AY++ L
Sbjct: 79  AAELYEKALAVNPELSDVWATLGHCYLMLDDLQKAYNAYQQAL 121

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.307    0.123    0.327 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 28,613,641
Number of extensions: 1050995
Number of successful extensions: 4711
Number of sequences better than 10.0: 269
Number of HSP's gapped: 4600
Number of HSP's successfully gapped: 367
Length of query: 322
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 212
Effective length of database: 40,868,139
Effective search space: 8664045468
Effective search space used: 8664045468
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 66 (30.0 bits)