Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_56.224246.20ON1089108956240.0
KLTH0C11242g6.20ON1097108531340.0
Sklu_YGOB_Anc_6.20b6.20ON1088109522260.0
Sklu_YGOB_Anc_6.20singletonOFF84983019070.0
Ecym_30246.20ON1079108117790.0
ACR006C6.20ON1071108516650.0
TDEL0G044906.20ON1093109616650.0
ZYRO0C07810g6.20ON1099111916300.0
Smik_13.1576.20ON1090109916260.0
Suva_13.1606.20ON1090109916080.0
Skud_13.1526.20ON1090110515840.0
KLLA0D01133g6.20ON1067109113611e-169
Kpol_1037.256.20ON1105108813081e-161
KNAG0M011606.20ON1131114712481e-152
NCAS0H008206.20ON1146112211881e-143
CAGL0L07634g6.20ON1130109711661e-140
YML002W6.20ON73772410951e-134
TPHA0J003306.20ON1107111211071e-132
TBLA0A072606.20ON120412028821e-100
NDAI0D008006.20ON11938678465e-95
YML003WsingletonOFF2902894734e-52
KAFR0L004006.20ON9428275042e-51
TBLA0C01300singletonON26259810.39
SAKL0F13244g7.425ON20478761.4
CAGL0C01309g2.257ON111053754.2
Kpol_483.104.237ON111895736.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_56.22424
         (1089 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_56.22424 s56 (121475..124744) [3270 bp, 1089 aa] {ON} YML00...  2170   0.0  
KLTH0C11242g Chr3 complement(921970..925263) [3294 bp, 1097 aa] ...  1211   0.0  
Sklu_YGOB_Anc_6.20b Chr5 (89924..92470,92474..93193) [3267 bp, 1...   862   0.0  
Sklu_YGOB_Anc_6.20 Chr5 (89924..92473) [2550 bp, 849 aa] {OFF} A...   739   0.0  
Ecym_3024 Chr3 (46949..50188) [3240 bp, 1079 aa] {ON} similar to...   689   0.0  
ACR006C Chr3 complement(364436..367651) [3216 bp, 1071 aa] {ON} ...   645   0.0  
TDEL0G04490 Chr7 complement(814781..818062) [3282 bp, 1093 aa] {...   645   0.0  
ZYRO0C07810g Chr3 complement(591035..594334) [3300 bp, 1099 aa] ...   632   0.0  
Smik_13.157 Chr13 (254644..257916) [3273 bp, 1090 aa] {ON} YML00...   630   0.0  
Suva_13.160 Chr13 (253437..256709) [3273 bp, 1090 aa] {ON} YML00...   624   0.0  
Skud_13.152 Chr13 (249372..252644) [3273 bp, 1090 aa] {ON} YML00...   614   0.0  
KLLA0D01133g Chr4 (101580..104783) [3204 bp, 1067 aa] {ON} some ...   528   e-169
Kpol_1037.25 s1037 (56141..59458) [3318 bp, 1105 aa] {ON} (56141...   508   e-161
KNAG0M01160 Chr13 (207940..211335) [3396 bp, 1131 aa] {ON} Anc_6...   485   e-152
NCAS0H00820 Chr8 (148184..151624) [3441 bp, 1146 aa] {ON} Anc_6....   462   e-143
CAGL0L07634g Chr12 complement(840409..843801) [3393 bp, 1130 aa]...   453   e-140
YML002W Chr13 (264541..266754) [2214 bp, 737 aa] {ON} Putative p...   426   e-134
TPHA0J00330 Chr10 (72684..76007) [3324 bp, 1107 aa] {ON} Anc_6.2...   431   e-132
TBLA0A07260 Chr1 (1807831..1811445) [3615 bp, 1204 aa] {ON} Anc_...   344   e-100
NDAI0D00800 Chr4 (177862..181443) [3582 bp, 1193 aa] {ON} Anc_6....   330   5e-95
YML003W Chr13 (263483..264355) [873 bp, 290 aa] {OFF} Putative p...   186   4e-52
KAFR0L00400 Chr12 (72520..75348) [2829 bp, 942 aa] {ON} Anc_6.20...   198   2e-51
TBLA0C01300 Chr3 complement(285536..286324) [789 bp, 262 aa] {ON}      36   0.39 
SAKL0F13244g Chr6 (1046281..1046895) [615 bp, 204 aa] {ON} simil...    34   1.4  
CAGL0C01309g Chr3 (136270..139602) [3333 bp, 1110 aa] {ON} simil...    33   4.2  
Kpol_483.10 s483 (21646..25002) [3357 bp, 1118 aa] {ON} (21646.....    33   6.6  

>Kwal_56.22424 s56 (121475..124744) [3270 bp, 1089 aa] {ON} YML002W -
            Hypothetical ORF [contig 185] FULL
          Length = 1089

 Score = 2170 bits (5624), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1060/1089 (97%), Positives = 1060/1089 (97%)

Query: 1    MPYYLPVLLNPLINAVFNCPTPLNSSLKKVFSAIEKVRFVLIAPPTELLLEYEDLESGLP 60
            MPYYLPVLLNPLINAVFNCPTPLNSSLKKVFSAIEKVRFVLIAPPTELLLEYEDLESGLP
Sbjct: 1    MPYYLPVLLNPLINAVFNCPTPLNSSLKKVFSAIEKVRFVLIAPPTELLLEYEDLESGLP 60

Query: 61   LQDLCYATGFVSDHIVLLDGREGLQEEEYKTLSGKTILLRSQQGIIFTAAAFDTRRRCRI 120
            LQDLCYATGFVSDHIVLLDGREGLQEEEYKTLSGKTILLRSQQGIIFTAAAFDTRRRCRI
Sbjct: 61   LQDLCYATGFVSDHIVLLDGREGLQEEEYKTLSGKTILLRSQQGIIFTAAAFDTRRRCRI 120

Query: 121  QRAELLTNFNEYLKGDTTFPIIHVDFPLTGRLARRDEWQCFRVTKNQEHTNGPKNSGKLS 180
            QRAELLTNFNEYLKGDTTFPIIHVDFPLTGRLARRDEWQCFRVTKNQEHTNGPKNSGKLS
Sbjct: 121  QRAELLTNFNEYLKGDTTFPIIHVDFPLTGRLARRDEWQCFRVTKNQEHTNGPKNSGKLS 180

Query: 181  HGDNNISLEQLLRINPEYGESLNDIVKAQRISLNSSVTGTTHLASHFVQTCKKALDVVRA 240
            HGDNNISLEQLLRINPEYGESLNDIVKAQRISLNSSVTGTTHLASHFVQTCKKALDVVRA
Sbjct: 181  HGDNNISLEQLLRINPEYGESLNDIVKAQRISLNSSVTGTTHLASHFVQTCKKALDVVRA 240

Query: 241  YPAFQVLPNLPICVHEYIELNLYDDYWAQLTNSLRDSEIESSSDYSLLKHISVSQVPSFL 300
            YPAFQVLPNLPICVHEYIELNLYDDYWAQLTNSLRDSEIESSSDYSLLKHISVSQVPSFL
Sbjct: 241  YPAFQVLPNLPICVHEYIELNLYDDYWAQLTNSLRDSEIESSSDYSLLKHISVSQVPSFL 300

Query: 301  YPSNPEKFDLRLITQAEKNVKGAVESFRKIAVTNCHSAKAKVIIETLQTLSRSLLVDDRA 360
            YPSNPEKFDLRLITQAEKNVKGAVESFRKIAVTNCHSAKAKVIIETLQTLSRSLLVDDRA
Sbjct: 301  YPSNPEKFDLRLITQAEKNVKGAVESFRKIAVTNCHSAKAKVIIETLQTLSRSLLVDDRA 360

Query: 361  VTIDADTLVSLFVVVVCHAQVKDLRSHLFYLQEFTKDTNLVTFGILAYGMSTLEAVLCYF 420
            VTIDADTLVSLFVVVVCHAQVKDLRSHLFYLQEFTKDTNLVTFGILAYGMSTLEAVLCYF
Sbjct: 361  VTIDADTLVSLFVVVVCHAQVKDLRSHLFYLQEFTKDTNLVTFGILAYGMSTLEAVLCYF 420

Query: 421  ESPEKVASLEKYCRANLSHWKSISEGSIDLNADTTVPLDDLLKIRTSDGQSCLAVCLQHR 480
            ESPEKVASLEKYCRANLSHWKSISEGSIDLNADTTVPLDDLLKIRTSDGQSCLAVCLQHR
Sbjct: 421  ESPEKVASLEKYCRANLSHWKSISEGSIDLNADTTVPLDDLLKIRTSDGQSCLAVCLQHR 480

Query: 481  RTEEFELIKNTREAWFPLEDLLHDETTDGSNLLIHMLESGCDRLAVMLINTLISNCTKDE 540
            RTEEFELIKNTREAWFPLEDLLHDETTDGSNLLIHMLESGCDRLAVMLINTLISNCTKDE
Sbjct: 481  RTEEFELIKNTREAWFPLEDLLHDETTDGSNLLIHMLESGCDRLAVMLINTLISNCTKDE 540

Query: 541  LIAFLNHTNKYQRSCGHYLMHAPQLIDLVGDILNWEQRDCNGHTPLFAIVRAYDRPDYFD 600
            LIAFLNHTNKYQRSCGHYLMHAPQLIDLVGDILNWEQRDCNGHTPLFAIVRAYDRPDYFD
Sbjct: 541  LIAFLNHTNKYQRSCGHYLMHAPQLIDLVGDILNWEQRDCNGHTPLFAIVRAYDRPDYFD 600

Query: 601  MVSAAYRAAVGQSKVRNSRFRVSNHTDDKGNTLLHVIKSDVSILLADPFIDVNATNAKGL 660
            MVSAAYRAAVGQSKVRNSRFRVSNHTDDKGNTLLHVIKSDVSILLADPFIDVNATNAKGL
Sbjct: 601  MVSAAYRAAVGQSKVRNSRFRVSNHTDDKGNTLLHVIKSDVSILLADPFIDVNATNAKGL 660

Query: 661  TPLMVYVRYNRIGNVRTILQDQRLIIGKHQSGAYLSCFDYVKNPAVLKELGKYASYLPFE 720
            TPLMVYVRYNRIGNVRTILQDQRLIIGKHQSGAYLSCFDYVKNPAVLKELGKYASYLPFE
Sbjct: 661  TPLMVYVRYNRIGNVRTILQDQRLIIGKHQSGAYLSCFDYVKNPAVLKELGKYASYLPFE 720

Query: 721  FSINVHSVKREGDEWVLWITVTGGEKQVPVKVFKRSLRFIQAFLTLFSDAHPMTFVPVDE 780
            FSINVHSVKREGDEWVLWITVTGGEKQVPVKVFKRSLRFIQAFLTLFSDAHPMTFVPVDE
Sbjct: 721  FSINVHSVKREGDEWVLWITVTGGEKQVPVKVFKRSLRFIQAFLTLFSDAHPMTFVPVDE 780

Query: 781  LLRELRALSQSRILILNKMDTKRFLKRCSVTLSMVSQERLFADAFTDXXXXXXXXXXXXX 840
            LLRELRALSQSRILILNKMDTKRFLKRCSVTLSMVSQERLFADAFTD             
Sbjct: 781  LLRELRALSQSRILILNKMDTKRFLKRCSVTLSMVSQERLFADAFTDSNLNLSSSRGLGS 840

Query: 841  XXXFTQNMKMMEPEEVRSIQSILKFNLSEISXXXXXXXXXXXXXVFEGLKGKDLSEACMT 900
               FTQNMKMMEPEEVRSIQSILKFNLSEIS             VFEGLKGKDLSEACMT
Sbjct: 841  SESFTQNMKMMEPEEVRSIQSILKFNLSEISALKTAMLLMKKLAVFEGLKGKDLSEACMT 900

Query: 901  FGAKCKYVTQGKIQSFDHFLNVQAPNLFDFEGIANNIALCELCSSLLCKHIGQVLNDDIP 960
            FGAKCKYVTQGKIQSFDHFLNVQAPNLFDFEGIANNIALCELCSSLLCKHIGQVLNDDIP
Sbjct: 901  FGAKCKYVTQGKIQSFDHFLNVQAPNLFDFEGIANNIALCELCSSLLCKHIGQVLNDDIP 960

Query: 961  KWWHTYGELLSLRREYKKSFPDANRPHVSENSGLFGSYIETKRTKLEQSYAARINHTSVR 1020
            KWWHTYGELLSLRREYKKSFPDANRPHVSENSGLFGSYIETKRTKLEQSYAARINHTSVR
Sbjct: 961  KWWHTYGELLSLRREYKKSFPDANRPHVSENSGLFGSYIETKRTKLEQSYAARINHTSVR 1020

Query: 1021 LSEISTKINQDNERLAVELNNFINFKNEFLKSAIKEHADTNIKRLREQLVCSEEALYDYK 1080
            LSEISTKINQDNERLAVELNNFINFKNEFLKSAIKEHADTNIKRLREQLVCSEEALYDYK
Sbjct: 1021 LSEISTKINQDNERLAVELNNFINFKNEFLKSAIKEHADTNIKRLREQLVCSEEALYDYK 1080

Query: 1081 HKIRHVTYK 1089
            HKIRHVTYK
Sbjct: 1081 HKIRHVTYK 1089

>KLTH0C11242g Chr3 complement(921970..925263) [3294 bp, 1097 aa] {ON}
            similar to uniprot|Q04263 Saccharomyces cerevisiae
            YML002W Hypothetical ORF
          Length = 1097

 Score = 1211 bits (3134), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 601/1085 (55%), Positives = 772/1085 (71%), Gaps = 4/1085 (0%)

Query: 1    MPYYLPVLLNPLINAVFNCPTPLNSSLKKVFSAIEKVRFVLIAPPTELLLEYEDLESGLP 60
            MPYYLPVLLNPLINAVFNCPTP NS L+KVF+ IEK RF L+ P  E+LLEYEDLESG  
Sbjct: 1    MPYYLPVLLNPLINAVFNCPTPQNSPLRKVFTRIEKQRFALVTPTPEILLEYEDLESGSS 60

Query: 61   LQDLCYATGFVSDHIVLLDGREGLQEEEYKTLSGKTILLRSQQGIIFTAAAFDTRRRCRI 120
            LQDLCY+  FVSDHI+LL G     EEEYKTLSGKTI LR+QQ  +FT   FD RRRC++
Sbjct: 61   LQDLCYSASFVSDHILLLGGGGCSHEEEYKTLSGKTITLRNQQKALFTGEGFDARRRCQV 120

Query: 121  QRAELLTNFNEYLKGDTTFPIIHVDFPLTGRLARRDEWQCFRVTKNQEHTNGPKNSGKLS 180
               ELL+NFNEY +G +T+PIIHVDFPLTGRLARRDEW  F+  +         NS   +
Sbjct: 121  LETELLSNFNEYFQGSSTYPIIHVDFPLTGRLARRDEWPGFKAYRFASTDTTSANSSLAA 180

Query: 181  HGDNNISLEQLLRINPEYGESLNDIVKAQRISLNSSVTGTTHLASHFVQTCKKALDVVRA 240
              +   SLEQ+LR +P YG+ L+ I++ QR +L+SS     +LA+HF+QTC+KAL  ++ 
Sbjct: 181  STEPKASLEQMLRAHPSYGDKLSAIIRTQRAALSSSTYNADNLAAHFMQTCEKALAAIQE 240

Query: 241  YPAFQVLPNLPICVHEYIELNLYDDYWAQLTNSLRDSEIESSSDYSLLKHISVSQVPSFL 300
              +F+  PNL + +HEY+E+NLYDD+WAQLTNSL+DSEIE+ SD+S+L++IS+SQVPSFL
Sbjct: 241  DQSFRAFPNLRLQIHEYVEMNLYDDFWAQLTNSLKDSEIENQSDFSILRNISISQVPSFL 300

Query: 301  YPSNPEKFDLRLITQAEKNVKGAVESFRKIAVTNCHSAKAKVIIETLQTLSRSLLVDDRA 360
            YP++ +KFD+R +TQ EKN++ AVE  R++ VTN HS+KAKVI+ETLQT+SRSL ++D+ 
Sbjct: 301  YPTDRQKFDIRCVTQVEKNLREAVECLRRLPVTNSHSSKAKVIVETLQTVSRSLEINDKV 360

Query: 361  VTIDADTLVSLFVVVVCHAQVKDLRSHLFYLQEFTKDTNLVTFGILAYGMSTLEAVLCYF 420
            +++DADTLVSL VVVVC A+VKDL+SHLFYLQEF KD+N +TFGILAYGMSTLEAVL YF
Sbjct: 361  ISVDADTLVSLLVVVVCQAEVKDLKSHLFYLQEFAKDSNSITFGILAYGMSTLEAVLSYF 420

Query: 421  ESPEKVASLEKYCRANLSHWKSISEGSIDLNADTTVPLDDLLKIRTSDGQSCLAVCLQHR 480
            ES EK+  LEK+C +N S+W+++++G + L +     + D+L+ RT  G SCL++CLQ+R
Sbjct: 421  ESREKLKLLEKHCSSNASYWEALADGKLPLGSLNPSEVKDILRTRTPAGLSCLSICLQNR 480

Query: 481  RTEEFELIKNTREAWFPLEDLLHDETTDGSNLLIHMLESGCDRLAVMLINTLISNCTKDE 540
            +   F  +    E  FPLEDLL+DET +GSNLLI ML++GC  L+   I  L  +CTK E
Sbjct: 481  QPNLFLHLATKFEHCFPLEDLLNDETVEGSNLLIQMLDNGCSSLSGNFIEMLFRSCTKTE 540

Query: 541  LIAFLNHTNKYQRSCGHYLMHAPQLIDLVGDILNWEQRDCNGHTPLFAIVRAYDRPDYFD 600
            L +FLNH N+YQRS GHYLMHA  LI  VG  +NWEQRDCNGHTPLFAI+R YD  DY  
Sbjct: 541  LESFLNHVNRYQRSSGHYLMHALDLIVKVGKFINWEQRDCNGHTPLFAIIRTYDHTDYDA 600

Query: 601  MVSAAYRAAVGQSKVRNSRFRVSNHTDDKGNTLLHVIKSDVSILLADPFIDVNATNAKGL 660
            MV  AY++A     ++  +FR+S H D+KGNTLLHVIKS+VS++L DP ++VN+ N KGL
Sbjct: 601  MVLEAYKSARLWCTLKGKQFRLSKHQDNKGNTLLHVIKSNVSVVLDDPLVNVNSFNKKGL 660

Query: 661  TPLMVYVRYNRIGNVRTILQDQRLIIGKHQSGAYLSCFDYVKNPAVLKELGKYASYLPFE 720
            TP+MVY RYNR+ N+++IL+D+RLII K Q+G+YL+CFDY+KNP VL ELGK+A +LP  
Sbjct: 661  TPIMVYARYNRLDNIKSILRDKRLIIQKCQNGSYLTCFDYIKNPVVLGELGKHAFFLPQS 720

Query: 721  FSINVHSVKREGDEWVLWITVTGGEKQVPVKVFKRSLRFIQAFLTLFSDAHPMTFVPVDE 780
            + I  H++K EGDEWVLW+T+ G     P KV +RSL+FIQ+FL  FS  + MTF+P + 
Sbjct: 721  YQIRAHNIKFEGDEWVLWMTLVGSVPNAPAKVIQRSLKFIQSFLISFSKTNSMTFIPAES 780

Query: 781  LLRELRALSQSRILILNKMDTKRFLKRCSVTLSMVSQERLFADAFTDXXXXXXXXXXXXX 840
            L  EL  L++ +I+ +N+++TK FL+R SV LS++ ++  F   F +             
Sbjct: 781  LAEELSLLAKMKIISINRLETKHFLRRASVVLSLICRQEEFEHIFNNPSGSLVNAAEHVQ 840

Query: 841  XXXFTQNMKMMEPEEVRSIQSILKFNLSEISXXXXXXXXXXXXXVFEGLKGKDLSEACMT 900
                     M+EPEEV SIQ I+KFN +EI              +F  LKGKDL  +   
Sbjct: 841  EQEANSTYGMIEPEEVASIQKIMKFNRTEILAIKSGALMLKKLAIFGILKGKDLERSHTM 900

Query: 901  FGAKCKYVTQ--GKIQSFDHFLNVQAPNLFDFEGIANNIALCELCSSLLCKHIGQVLNDD 958
            F +     T+  G+  +    L    P   +F  +ANN AL EL S LL + I ++LN D
Sbjct: 901  FQSHGNNFTKIIGRSTNVFGSLKHSLPQC-EFGYLANNTALLELSSRLLVQKIDKILNHD 959

Query: 959  IPKWWHTYGELLSLRREYKKSFPDANRPHVSENSGLFGSYIETKRTKLEQSYAARINHTS 1018
            IP WW TYGEL+SLR EY K+FPD  RP V+EN+G   SYIETKR +LEQ    RIN +S
Sbjct: 960  IPHWWKTYGELVSLRHEYNKNFPDDVRPRVAENTGFISSYIETKRVRLEQGLVGRINRSS 1019

Query: 1019 VRLSEISTKINQDNERLAVELNNFINFKNEFLKSA-IKEHADTNIKRLREQLVCSEEALY 1077
              L   S  + + NE LAVELNNFINFK EF  SA IKEHA  NIK L+EQLVC EEALY
Sbjct: 1020 KNLLRFSLMLRRSNESLAVELNNFINFKAEFWVSATIKEHAAMNIKWLQEQLVCLEEALY 1079

Query: 1078 DYKHK 1082
            DYK K
Sbjct: 1080 DYKDK 1084

>Sklu_YGOB_Anc_6.20b Chr5 (89924..92470,92474..93193) [3267 bp, 1088
            aa] {ON} ANNOTATED BY YGOB -
          Length = 1088

 Score =  862 bits (2226), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 443/1095 (40%), Positives = 668/1095 (61%), Gaps = 23/1095 (2%)

Query: 1    MPYYLPVLLNPLINAVFNCPTPLNSSLKKVFSAIEKVRFVLIAPPTELLLEYEDLESGLP 60
            MPY+LP+LLNPL+N+VFNCPTP  S LKK+F+++   RF+L+ P   +LL Y+DL++G  
Sbjct: 1    MPYHLPILLNPLVNSVFNCPTPSTSPLKKIFASLRDQRFILVVPNVNILLHYQDLDTGSS 60

Query: 61   LQDLCYATGFVSDHIVLLDGREGLQEEEYKTLSGKTILLRSQQGIIFTAAAFDTRRRCRI 120
            LQDLCY   FV++HI++L       ++E+KTL+GKT+L+RSQ GI+ T   F ++RRC+I
Sbjct: 61   LQDLCYTYEFVANHIIILKKDSKYSDQEFKTLNGKTVLIRSQNGIVLTGDGFPSKRRCKI 120

Query: 121  QRAELLTNFNEYLKGDTTFPIIHVDFPLTGRLARRDEWQCFRVTKNQEHTNGPKNSGKLS 180
               EL  NFN+YLKG   FP+IH+D PL     + DE Q F V     +T+    S  L+
Sbjct: 121  TNTELFINFNDYLKGSKYFPLIHIDKPLMSDAVKNDELQVFGVRST--NTSSLPLSTDLT 178

Query: 181  HGDNNISLEQLLRINPEYGESLNDIVKAQRISLNSSVTGTTHLASHFVQTCKKALDVVRA 240
              + + S EQL R++P+ G+  + + K QR  +N++  G   L   F +   +A +++R 
Sbjct: 179  QREVS-SFEQLFRLHPQLGDRFSGLFKEQRQEINANFKGLDSLVDFFDKFNYEAFELIRH 237

Query: 241  YPAFQVLPNLPICVHEYIELNLYDDYWAQLTNSLRDSEIESSSDYSLLKHISVSQVPSFL 300
               F+    L   VH Y+ELNLYDD W Q+T   RD EIE++ DY+LLK+I++SQVP+  
Sbjct: 238  ERRFENHSKLHQTVHNYVELNLYDDIWKQITQLYRDDEIEATYDYNLLKYIAISQVPTPF 297

Query: 301  YPSNPEKFDLRLITQAEKNVKGAVESFRKIAVTNCHSAKAKVIIETLQTL---SRSLLVD 357
            YP    KF L+ +T  EK+++ A + F+++A ++ HS K K+I++TLQTL   S     D
Sbjct: 298  YPEKQSKFSLKKVTHFEKSLEQATDCFKRLAFSSSHSEKTKIIMDTLQTLTDYSEFPDAD 357

Query: 358  DRAVTIDADTLVSLFVVVVCHAQVKDLRSHLFYLQEFTKDTNLVTFGILAYGMSTLEAVL 417
               VTIDADTL+ L V+VVC +QVK+L+SHLFYLQ F+ D N + FG++AY +STLEAVL
Sbjct: 358  IEDVTIDADTLIGLMVLVVCRSQVKNLKSHLFYLQNFSLDENTIKFGVVAYALSTLEAVL 417

Query: 418  CYFESPE---KVASLEKYCRANLSHWKSISEGSIDLNADTTVPLDDLLKIRTSDGQSCLA 474
            CYFE  E   K+ SLE  CR N   W  +S  ++    D+     D+L+IRT+ G+SCL+
Sbjct: 418  CYFEDAENSGKIRSLEFNCRRNKQFWDHLSCKAVSF--DSLKSYRDILRIRTAGGESCLS 475

Query: 475  VCLQHRRTEEFELIKNTREAWFPLEDLLHDETTDGSNLLIHMLESGCDRLAVMLINTLIS 534
            VC+Q       E +    E   PLED+L D+T +GS LL+  LE+G  R+A +L+  L  
Sbjct: 476  VCIQKGNFSGIECLLQNFEHELPLEDILDDQTINGSTLLMQTLETGNTRMADVLLEILCQ 535

Query: 535  NCTKDELIAFLNHTNKYQRSCGHYLMHAPQLIDLVGDILNWEQRDCNGHTPLFAIVRAYD 594
            +CT +EL  +LN  N+++R+  HYL    Q+ D +G   +WE +D +GHTPLFAI R+YD
Sbjct: 536  SCTINELREYLNRRNRWKRTAAHYLTQDLQMADKIGIFFDWEAKDISGHTPLFAIFRSYD 595

Query: 595  RPDYFDMVSAAYRAAVGQSKVRNSRFRVSNHTDDKGNTLLHVIKSDVSILLADPFIDVNA 654
             PDY  MV+ A+R A    ++R   F  S H D KGNTLLHV+K+++ ILL    IDVN 
Sbjct: 596  HPDYAQMVTNAFRTASKWYEIRGENFNFSAHKDTKGNTLLHVMKTNIEILLEQENIDVNE 655

Query: 655  TNAKGLTPLMVYVRYNRIGNVRTILQDQRLIIGKHQSGAYLSCFDYVKNPAVLKELGKYA 714
             N KGLTPLMVYV+YNR+ NV+ IL+D RLI+ KHQ   +L+CFDYVKNP +  ELG +A
Sbjct: 656  VNKKGLTPLMVYVKYNRLDNVKCILRDNRLIMEKHQKSLFLNCFDYVKNPVIQAELGFHA 715

Query: 715  SYLPFEFSINVHSVKREGDEWVLWITVTGGEKQVPVKVFKRSLRFIQAFLTLFSDAHPMT 774
            +       +  H+ + E + W LWIT+ G +++   +  K ++R IQ  L ++   +PM+
Sbjct: 716  AEKTKFGEVVAHTFRFENNRWFLWITLKGKDRETDFQTVKHNIRAIQGLLQVYLRRNPMS 775

Query: 775  FVPVDELLRELRALSQSRILILNKMDTKRFLKRCSVTLSMVSQERLFADAFTDXXXXXXX 834
            F+P+D +L +L  + ++ ++ + K++  RFL   ++ L ++ Q+  F  A          
Sbjct: 776  FLPIDAVLEDLHEIGKTGLVSVGKLEVHRFLCELTLVLKLICQKEEFKKALY-LPASDLV 834

Query: 835  XXXXXXXXXFTQNMKMMEPEEVRSIQSILKFNLSEISXXXXXXXXXXXXXVFEGLKGKDL 894
                      T   + +EPEE+ SIQS L+FNLSE+S             +F  LK +D+
Sbjct: 835  NWIRESGRKRTNVSRRIEPEEINSIQSFLRFNLSELSLIRDKISILQKLSIFSELKAQDI 894

Query: 895  SEA-CMTFGAKCKYVTQGKIQSFDHFLNVQAPNLFDFEGIA-----NNIALCELCSSLLC 948
            ++A CM F    +       Q+F     +   +  D E ++     +NI   + C++ L 
Sbjct: 895  NQARCMLFSQSVRLEDTAISQAF----GISGLSEKDSEDLSATILTSNIDFLKECTNKLV 950

Query: 949  KHIGQVLNDDIPKWWHTYGELLSLRREYKKSFPDANRPHVSENSGLFGSYIETKRTKLEQ 1008
              I Q+L   + +WW  Y ELL  R +Y K+FP++ +PH+ +N GLFG+Y+E KR+KLE+
Sbjct: 951  GKIDQLLQGKLTRWWKLYAELLDARNQYNKNFPNSVKPHLDDNKGLFGTYVEGKRSKLEE 1010

Query: 1009 SYAARINHTSVRLSEISTKINQDNERLAVELNNFINFKNEFLKSA-IKEHADTNIKRLRE 1067
              +A+I     RL  ++ ++ Q++E LA EL+ ++ FK  +L++  I++     I  L++
Sbjct: 1011 KLSAQIKSCLERLQTLTYEVKQEHEALAEELSIYLEFKTNYLRTGIIQDFTVGKINTLKD 1070

Query: 1068 QLVCSEEALYDYKHK 1082
             +   + +L +YK +
Sbjct: 1071 TMRHFKRSLKNYKEQ 1085

>Sklu_YGOB_Anc_6.20 Chr5 (89924..92473) [2550 bp, 849 aa] {OFF}
           ANNOTATED BY YGOB -
          Length = 849

 Score =  739 bits (1907), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/830 (43%), Positives = 532/830 (64%), Gaps = 11/830 (1%)

Query: 1   MPYYLPVLLNPLINAVFNCPTPLNSSLKKVFSAIEKVRFVLIAPPTELLLEYEDLESGLP 60
           MPY+LP+LLNPL+N+VFNCPTP  S LKK+F+++   RF+L+ P   +LL Y+DL++G  
Sbjct: 1   MPYHLPILLNPLVNSVFNCPTPSTSPLKKIFASLRDQRFILVVPNVNILLHYQDLDTGSS 60

Query: 61  LQDLCYATGFVSDHIVLLDGREGLQEEEYKTLSGKTILLRSQQGIIFTAAAFDTRRRCRI 120
           LQDLCY   FV++HI++L       ++E+KTL+GKT+L+RSQ GI+ T   F ++RRC+I
Sbjct: 61  LQDLCYTYEFVANHIIILKKDSKYSDQEFKTLNGKTVLIRSQNGIVLTGDGFPSKRRCKI 120

Query: 121 QRAELLTNFNEYLKGDTTFPIIHVDFPLTGRLARRDEWQCFRVTKNQEHTNGPKNSGKLS 180
              EL  NFN+YLKG   FP+IH+D PL     + DE Q F V     +T+    S  L+
Sbjct: 121 TNTELFINFNDYLKGSKYFPLIHIDKPLMSDAVKNDELQVFGVRST--NTSSLPLSTDLT 178

Query: 181 HGDNNISLEQLLRINPEYGESLNDIVKAQRISLNSSVTGTTHLASHFVQTCKKALDVVRA 240
             + + S EQL R++P+ G+  + + K QR  +N++  G   L   F +   +A +++R 
Sbjct: 179 QREVS-SFEQLFRLHPQLGDRFSGLFKEQRQEINANFKGLDSLVDFFDKFNYEAFELIRH 237

Query: 241 YPAFQVLPNLPICVHEYIELNLYDDYWAQLTNSLRDSEIESSSDYSLLKHISVSQVPSFL 300
              F+    L   VH Y+ELNLYDD W Q+T   RD EIE++ DY+LLK+I++SQVP+  
Sbjct: 238 ERRFENHSKLHQTVHNYVELNLYDDIWKQITQLYRDDEIEATYDYNLLKYIAISQVPTPF 297

Query: 301 YPSNPEKFDLRLITQAEKNVKGAVESFRKIAVTNCHSAKAKVIIETLQTL---SRSLLVD 357
           YP    KF L+ +T  EK+++ A + F+++A ++ HS K K+I++TLQTL   S     D
Sbjct: 298 YPEKQSKFSLKKVTHFEKSLEQATDCFKRLAFSSSHSEKTKIIMDTLQTLTDYSEFPDAD 357

Query: 358 DRAVTIDADTLVSLFVVVVCHAQVKDLRSHLFYLQEFTKDTNLVTFGILAYGMSTLEAVL 417
              VTIDADTL+ L V+VVC +QVK+L+SHLFYLQ F+ D N + FG++AY +STLEAVL
Sbjct: 358 IEDVTIDADTLIGLMVLVVCRSQVKNLKSHLFYLQNFSLDENTIKFGVVAYALSTLEAVL 417

Query: 418 CYFESPE---KVASLEKYCRANLSHWKSISEGSIDLNADTTVPLDDLLKIRTSDGQSCLA 474
           CYFE  E   K+ SLE  CR N   W  +S  ++    D+     D+L+IRT+ G+SCL+
Sbjct: 418 CYFEDAENSGKIRSLEFNCRRNKQFWDHLSCKAVSF--DSLKSYRDILRIRTAGGESCLS 475

Query: 475 VCLQHRRTEEFELIKNTREAWFPLEDLLHDETTDGSNLLIHMLESGCDRLAVMLINTLIS 534
           VC+Q       E +    E   PLED+L D+T +GS LL+  LE+G  R+A +L+  L  
Sbjct: 476 VCIQKGNFSGIECLLQNFEHELPLEDILDDQTINGSTLLMQTLETGNTRMADVLLEILCQ 535

Query: 535 NCTKDELIAFLNHTNKYQRSCGHYLMHAPQLIDLVGDILNWEQRDCNGHTPLFAIVRAYD 594
           +CT +EL  +LN  N+++R+  HYL    Q+ D +G   +WE +D +GHTPLFAI R+YD
Sbjct: 536 SCTINELREYLNRRNRWKRTAAHYLTQDLQMADKIGIFFDWEAKDISGHTPLFAIFRSYD 595

Query: 595 RPDYFDMVSAAYRAAVGQSKVRNSRFRVSNHTDDKGNTLLHVIKSDVSILLADPFIDVNA 654
            PDY  MV+ A+R A    ++R   F  S H D KGNTLLHV+K+++ ILL    IDVN 
Sbjct: 596 HPDYAQMVTNAFRTASKWYEIRGENFNFSAHKDTKGNTLLHVMKTNIEILLEQENIDVNE 655

Query: 655 TNAKGLTPLMVYVRYNRIGNVRTILQDQRLIIGKHQSGAYLSCFDYVKNPAVLKELGKYA 714
            N KGLTPLMVYV+YNR+ NV+ IL+D RLI+ KHQ   +L+CFDYVKNP +  ELG +A
Sbjct: 656 VNKKGLTPLMVYVKYNRLDNVKCILRDNRLIMEKHQKSLFLNCFDYVKNPVIQAELGFHA 715

Query: 715 SYLPFEFSINVHSVKREGDEWVLWITVTGGEKQVPVKVFKRSLRFIQAFLTLFSDAHPMT 774
           +       +  H+ + E + W LWIT+ G +++   +  K ++R IQ  L ++   +PM+
Sbjct: 716 AEKTKFGEVVAHTFRFENNRWFLWITLKGKDRETDFQTVKHNIRAIQGLLQVYLRRNPMS 775

Query: 775 FVPVDELLRELRALSQSRILILNKMDTKRFLKRCSVTLSMVSQERLFADA 824
           F+P+D +L +L  + ++ ++ + K++  RFL   ++ L ++ Q+  F  A
Sbjct: 776 FLPIDAVLEDLHEIGKTGLVSVGKLEVHRFLCELTLVLKLICQKEEFKKA 825

>Ecym_3024 Chr3 (46949..50188) [3240 bp, 1079 aa] {ON} similar to
            Ashbya gossypii ACR006C
          Length = 1079

 Score =  689 bits (1779), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/1081 (36%), Positives = 591/1081 (54%), Gaps = 20/1081 (1%)

Query: 1    MPYYLPVLLNPLINAVFNCPTPLNSSLKKVFSAIEKVRFVLIAPPTELLLEYEDLESGLP 60
            MPY+LPVLLNPL+NAVFNCPTP  S LKK+F+ ++  RF+L+ P T++LL+Y+DL+SGLP
Sbjct: 1    MPYHLPVLLNPLVNAVFNCPTPTTSPLKKLFNNVKGQRFILLVPSTDVLLQYQDLDSGLP 60

Query: 61   LQDLCYATGFVSDHIVLLDGREGLQEEEYKTLSGKTILLRSQQGIIFTAAAFDTRRRCRI 120
            L +LCY   FV+ HI++      + E+EY+TL+G ++++RSQ GI+ +       R+CR+
Sbjct: 61   LSELCYNYDFVASHILIQLQESKVTEQEYRTLNGNSVIIRSQAGIVMSKPEL---RKCRV 117

Query: 121  QRAELLTNFNEYLKGDTTFPIIHVDFPLTGRLARRDEWQCFRVTKNQEHTNGPKNSGKLS 180
            +  E+L NFN+YL     FP++H+D PL G L R DE Q F    + E  N  K+    +
Sbjct: 118  KSYEVLRNFNDYLSNVIYFPLLHIDRPLVGALVRNDELQVF---GSYEMHNPSKSKTINT 174

Query: 181  HGDNNISLEQLLRINPEYGESLNDIVKAQRISLNSSVTGTTHLASHFVQTCKKALDVVRA 240
              +N+I  E+ +R+ P+ G  L+   +  R  + + V     L   F         V++ 
Sbjct: 175  ISENHIPFEKFIRLYPQLGAQLDGYFQRDRQRIRNEVDQLDKLIKIFKDLVIDVYGVIKE 234

Query: 241  YPAFQVLPNLPICVHEYIELNLYDDYWAQLTNSLRDSEIESSSDYSLLKHISVSQVPSFL 300
               F+    L     EY+ELN+Y+D W +L       E +  S YS  K+IS++ V + L
Sbjct: 235  DKNFRNYMELLNVTQEYVELNMYEDIWLKLVQLNGSKEPDRVSGYSSTKYISLNNVATIL 294

Query: 301  YPSNPEKFDLRLITQAEKNVKGAVESFRKIAVTNCHSAKAKVIIETLQTLSRSLLVDDRA 360
            YP     FDLR++T+ EK V  A + F K+++TN H+ KAK+++ T Q L+  +      
Sbjct: 295  YPEGTNSFDLRVVTEVEKRVVKATDCFAKLSLTNSHNEKAKIVVSTFQILTTKMEYTSID 354

Query: 361  VTIDADTLVSLFVVVVCHAQVKDLRSHLFYLQEFTKDTNLVTFGILAYGMSTLEAVLCYF 420
             TIDADTL+ L +VV+C +QVK+L+SHL YL+EF    + V FG+  Y +ST+EAVL YF
Sbjct: 355  PTIDADTLIGLMLVVLCRSQVKNLKSHLEYLREFAPRPDDVKFGLTGYSLSTIEAVLAYF 414

Query: 421  ES---PEKVASLEKYCRANLSHWKSISEGSIDLNADTTVPLDDLLKIRTSDGQSCLAVCL 477
            E+    EK+  L     AN   W  I  G     A +     + L  R+S+ +S L++C+
Sbjct: 415  EAGDGTEKLKKLISLSEANRVFWDLIRSGV----AVSLSSYKNSLISRSSNCESSLSICI 470

Query: 478  QHRRTEEFELIKNTREAWFPLEDLLHDETTDGSNLLIHMLESGCDRLAVMLINTLISNCT 537
               R +  + I    +    LEDLL D     S LLI  LE+G D +A +LI+ +ISNCT
Sbjct: 471  HAGRLDLIKEILLNYQEQIKLEDLLFDVNQANSTLLIQALETGHDEIAELLIDVMISNCT 530

Query: 538  KDELIAFLNHTNKYQRSCGHYLMHAPQLIDLVGDILNWEQRDCNGHTPLFAIVRAYDRPD 597
             +E   ++N +N   R+  HYL  A  +I+ +G  L+W ++D N HTPLF I RAYD+  
Sbjct: 531  NNEFYEYVNRSNSAGRTVAHYLPQAFSIIEKIGLYLDWRKKDVNMHTPLFIICRAYDQLH 590

Query: 598  YFDMVSAAYRAAVGQSKVRNSRFRVSNHTDDKGNTLLHVIKSDVSILLADPFIDVNATNA 657
            Y +M+S ++       + R   F  ++H D  GN+LLH++K  +  +L+ P I+VN +N 
Sbjct: 591  YSEMLSRSFEYVFEYCRRRGEDFSFTDHEDPMGNSLLHIMKGGIQSILSQPNINVNKSNI 650

Query: 658  KGLTPLMVYVRYNRIGNVRTILQDQRLIIGKHQSGAYLSCFDYVKNPAVLKELGKYASYL 717
            KG+TPLM+Y +YNRI N+R IL+D+RLI+ K Q+   L   DYVKNP +L  +G + +  
Sbjct: 651  KGMTPLMLYAKYNRIENIRDILEDKRLIVSKIQNPQTLKAIDYVKNPMILNLIGTHIAKN 710

Query: 718  PFEFSINVHSVKREGDEWVLWITVTGGEKQVPVKVFKRSLRFIQAFLTLFSDAHPMTFVP 777
                 ++   +K E + W LWITV   +        ++S++ IQ  L  ++  HPM F+P
Sbjct: 711  SLYGLLSADGIKFEDNCWYLWITVKFSDNS--YSTLRQSVKNIQGLLQFYNKKHPMNFLP 768

Query: 778  VDELLRELRALSQSRILILNKMDTKRFLKRCSVTLSMVSQERLFADAFTDXXXXXXXXXX 837
            +D +L  L+ + +  IL +  ++   FL   +  LS++ Q   +                
Sbjct: 769  IDHILSILKNIGKPGILPVINLENSIFLGLLTQLLSVIGQRNEYMAVLRYNESDLSTWLR 828

Query: 838  XXXXXXFTQNMKMMEPEEVRSIQSILKFNLSEISXXXXXXXXXXXXXVFEGLKGKDLSEA 897
                       + +EPEEV SIQS LKFNLSE S             VF+ LK +D+  A
Sbjct: 829  TNNFKPRANKDERIEPEEVSSIQSFLKFNLSEFSEIKEKFTILRKLVVFQSLKAQDIECA 888

Query: 898  CMTFGAKCKYVTQGKIQSFDHFLNVQAPNLFDFEGIANNIALCELCSSLLCKHIGQVLND 957
                  + + V+     S +        N +  +     I    +C   L   I  VL+ 
Sbjct: 889  QRIIYQQMEIVSNSVGPSVEKTFIGSNEN-YSLDSFQQAIEFIAMCLETLSSKIQYVLDS 947

Query: 958  DIPKWWHTYGELLSLRREYKKSFP-DANRPHVS--ENSGLFGSYIETKRTKLEQSYAARI 1014
             +  WW  YGEL SLRREY+++FP D     VS  E+ G F SYIE KR K E    AR+
Sbjct: 948  KVTLWWRLYGELSSLRREYQRNFPSDFKSSDVSGEESKGFFESYIEGKRQKTEDKLQARL 1007

Query: 1015 NHTSVRLSEISTKINQDNERLAVELNNFINFKNEFLKS-AIKEHADTNIKRLREQLVCSE 1073
                 +L  +S ++ +D+E LA E++ F+ FKN   +S  +K +A+  IK  R  L   E
Sbjct: 1008 RVCITKLQTLSGELKKDHENLAEEISFFVTFKNFAYESFVMKTYANICIKHHRNILQVIE 1067

Query: 1074 E 1074
            E
Sbjct: 1068 E 1068

>ACR006C Chr3 complement(364436..367651) [3216 bp, 1071 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YML002W and
            YML003W; YML002W and YML003W represent one ORF in this
            genome
          Length = 1071

 Score =  645 bits (1665), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/1085 (34%), Positives = 601/1085 (55%), Gaps = 29/1085 (2%)

Query: 1    MPYYLPVLLNPLINAVFNCPTPLNSSLKKVFSAIEKVRFVLIAPPTELLLEYEDLESGLP 60
            MPY+LPVLLNPL+NAVFNCP P  S LKK+F+  +  +F+L+ P TE+LL+Y+D  + +P
Sbjct: 1    MPYHLPVLLNPLVNAVFNCPAPGASPLKKLFNNAKDKKFILVVPRTEVLLQYQDATTYVP 60

Query: 61   LQDLCYATGFVSDHIVLLDGREGLQEEEYKTLSGKTILLRSQQGIIFTAAAFDTRRRCRI 120
            L +LCY   FV+ H ++      + E E++T++GK++++R Q GII    A  + ++CRI
Sbjct: 61   LTELCYNYEFVASHTLVQLQEARVTELEFQTINGKSVVIRPQSGII---TAQPSAKKCRI 117

Query: 121  QRAELLTNFNEYLKGDTTFPIIHVDFPLTGRLARRDEWQCFRVTKNQEHTNGPKNSGKLS 180
            QR ELL +FN+YL G T F ++++D PL G +   +     RV   QE    P    +++
Sbjct: 118  QRCELLRSFNDYLLGRTAFALLYIDRPLVGEI---ELITPLRVFGPQEQ---PLQYQRIT 171

Query: 181  H-GDNNISLEQLLRINPEYGESLNDIVKAQRISLNSSVTGTTHLASHFVQTCKKALDVVR 239
               D  + LEQ LR++P+ G  L+++ K  +  +         L   F +  +K   +++
Sbjct: 172  QTADAPLPLEQFLRLHPQLGNQLDEVFKDAKERMRYIALSLKELVRLFHELVEKVYCLIK 231

Query: 240  AYPAFQVLPNLPICVHEYIELNLYDDYWAQLTNSLRDSEIESSSDYSLLKHISVSQVPSF 299
                F+   NL   V  Y+ELN+Y+D W +L      +E +    Y + + IS++Q+ + 
Sbjct: 232  LDKNFRNYLNLLEMVQGYVELNMYEDVWRKLVQLNGKNEPDRVPGYYITRSISLNQLSTS 291

Query: 300  LYPSNPEKFDLRLITQAEKNVKGAVESFRKIAVTNCHSAKAKVIIETLQTLSRSLLVDDR 359
            +YP   +KF+L  +T+ EK V  A E F K+ +TN H  KA+++I T Q L+        
Sbjct: 292  IYPEELDKFNLSPVTEIEKRVVQATECFSKLTLTNSHHEKARILISTFQKLTTKTSQATL 351

Query: 360  AVTIDADTLVSLFVVVVCHAQVKDLRSHLFYLQEFTKDTNLVTFGILAYGMSTLEAVLCY 419
               IDADTL+ L VVVVC AQVK+L+SHL YL+EF ++++ V FG+L Y +STLEAV+ Y
Sbjct: 352  DPMIDADTLLGLMVVVVCRAQVKNLKSHLDYLREFAQNSDDVKFGLLGYSLSTLEAVVGY 411

Query: 420  FE---SPEKVASLEKYCRANLSHWKSISEGSIDLNADTTVPLDDLLKIRTSDGQSCLAVC 476
            F+   S  K+  L   C+ N   W  I +G I +N       +++L  RT   +S L++C
Sbjct: 412  FDIGGSSIKLERLITQCQRNKIFWNLIEQG-IPINLKEH---EEVLISRTPSCESVLSLC 467

Query: 477  LQHRRTEEFELIKNTREAWFPLEDLLHDETTDGSNLLIHMLESGCDRLAVMLINTLISNC 536
            +Q+ R + F  I    ++ F LED+L D      +LLI  L++G   +   +I+ LI+NC
Sbjct: 468  IQYGRQDVFYDIIANYQSHFTLEDILQDVNQSNCSLLIQALQAGNKDITEAVIDLLIANC 527

Query: 537  TKDELIAFLNHTNKYQRSCGHYLMHAPQLIDLVGDILNWEQRDCNGHTPLFAIVRAYDRP 596
            T  E+ A++N  +   R+ GHYL    +++D +G  ++W+++D N HTPLF + RAYD P
Sbjct: 528  TNTEMYAYINKCDIAGRTVGHYLPQNYEIVDRLGKFVDWKRKDLNMHTPLFTVCRAYDHP 587

Query: 597  DYFDMVSAAYRAAVGQSKVRNSRFRVSNHTDDKGNTLLHVIKSDVSILLADPFIDVNATN 656
             Y +++S  ++        R  RF  ++H D  GNTLLH+IK  + + L+ P  +VN  N
Sbjct: 588  SYLELLSKCFQHCFDFYSTRGKRFSFADHEDPLGNTLLHIIKDGIQLALSTPGANVNKCN 647

Query: 657  AKGLTPLMVYVRYNRIGNVRTILQDQRLIIGKHQSGAYLSCFDYVKNPAVLKELGKYASY 716
             +G+TPLMVY +YNRI N+R IL D+RLI+ K Q    L   DYVKNP +L  +G   + 
Sbjct: 648  TRGMTPLMVYAKYNRIENIREILNDKRLILSKLQDPQSLKAIDYVKNPIILNLIGTAMAK 707

Query: 717  LPFEFSINVHSVKREGDEWVLWITVTGGEKQVPVKVFKRSLRFIQAFLTLFSDAHPMTFV 776
                  ++VH++K E + W LWIT +   +    K    +L+ IQ+ L +++  HPM+F+
Sbjct: 708  NSLYGCLSVHNIKYEENAWYLWITSSLSPES--YKTSSYALKDIQSLLQIYNKKHPMSFL 765

Query: 777  PVDELLRELRALSQSRILILNKMDTKRFLKRCSVTLSMVSQERLFADAFTDXXXXXXXXX 836
            P+D  L  L+ L +S I+ +  ++    L+  + +LS++ Q   + + F+          
Sbjct: 766  PIDHHLETLKTLGKSGIISVINLENSMLLEALTFSLSIIQQREDYKNVFSYTESELSTWL 825

Query: 837  XXXXXXXFTQNMKMMEPEEVRSIQSILKFNLSEISXXXXXXXXXXXXXVFEGLKGKDL-- 894
                          +EPEE+ SIQ+ LKF+L+E +             +FE  K  D+  
Sbjct: 826  RASMVKQKPNKRDKIEPEEIHSIQNFLKFSLTEFNYLREKFTVLKKLIIFEHYKSHDIEC 885

Query: 895  -SEACMTFGAKCKYVTQGKIQSFDHFLNVQAPNLFDFEGIANNIALCELCSSLLCKHIGQ 953
                  + G     V   K      F N     +  FE   + + +C    SL  K I +
Sbjct: 886  SQRILYSQGEIIASVVPSKRLRTSPFDNEFNDGIDPFEQAVDFMCMC--LDSLTSK-IVE 942

Query: 954  VLNDDIPKWWHTYGELLSLRREYKKSFPDANRPH--VSENS-GLFGSYIETKRTKLEQSY 1010
            VL+  +  WW  YGE+ +L++EY+++FP+  +P+   SE+S G F SY+E KR KLE   
Sbjct: 943  VLDSKVSTWWTLYGEITNLQKEYQRNFPEKGKPNSASSEDSKGFFVSYMEDKRQKLESKL 1002

Query: 1011 AARINHTSVRLSEISTKINQDNERLAVELNNFINFKN-EFLKSAIKEHADTNIKRLREQL 1069
             +R++  S  L  +  ++   +E LA E++ FI+ KN  ++   +K + +  IK+ +  L
Sbjct: 1003 QSRLSVCSENLQHLDAELKHCHELLAEEISFFISSKNFAYMNFMVKAYVNRRIKQHKNML 1062

Query: 1070 VCSEE 1074
            +  EE
Sbjct: 1063 LAIEE 1067

>TDEL0G04490 Chr7 complement(814781..818062) [3282 bp, 1093 aa] {ON}
            Anc_6.20 YML002W
          Length = 1093

 Score =  645 bits (1665), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/1096 (33%), Positives = 611/1096 (55%), Gaps = 45/1096 (4%)

Query: 1    MPYYLPVLLNPLINAVFNCPTPLNSSLKKVFSAIEKVRFVLIAPPTELLLEYEDLESGLP 60
            MPY+LPVLLNPL+NAVFNCP P  S+LKK+FS ++  +F+L+ PP + LL+  D  SG P
Sbjct: 1    MPYHLPVLLNPLVNAVFNCPNPSTSNLKKLFSNLKDRKFILLVPPCDRLLDCNDKLSGSP 60

Query: 61   LQDLCYATGFVSDHIVLLDGREG-------LQEEEYKTLSGKTILLRSQQGIIFTAAAFD 113
            LQ+LCY+  FV+ H++L+D +           + ++ TL+GK +++RSQ  II T+  F 
Sbjct: 61   LQELCYSYEFVASHVLLIDEQNAEYMTTAPPSQVKFDTLNGKKVIVRSQNRIILTSDGFQ 120

Query: 114  TRRRCRIQRAELLTNFNEYLKGDTTFPIIHVDFPLTGRLARRDEWQCFRV--TKNQEHTN 171
             ++RC I + +L  NFNEYL  +  FPI+ +D P+     R    Q  +   +  +E  +
Sbjct: 121  VKKRCHITKTDLFVNFNEYLLQEYKFPILCIDEPICAESVRTQRVQISQTLGSGKRETKD 180

Query: 172  GPKNSGKLSHGDNNISLEQLLRINPEYGESLNDIVKAQRISLNSSVTGTTHLASHFVQTC 231
            G   +   S G  + S + +LRI+P++    N++    R    S+  G       F    
Sbjct: 181  GSSPTLDSSQGSKS-SFDNILRIHPDWALKFNELFAEYR----STPEGDDPHIELFHDII 235

Query: 232  KKALDVVRAYPAFQVLPNLPICVHEYIELNLYDDYWAQLTNSLRDSEIESSSDYSLLKHI 291
            ++A   +R+   F  +P+L   +++Y+ELNLYDD W ++T+  +DSE+ES+     L+++
Sbjct: 236  RRAYSAMRSDALFASMPDLSDLIYDYVELNLYDDIWVRITHHFKDSEVESNG----LRYL 291

Query: 292  SVSQVPSFLYPSNPEKFDLRLITQAEKNVKGAVESFRKIAVTNCHSAKAKVIIETLQTLS 351
            S+ Q+ + LYP   E+F+L+ +   E N++ A+ SF ++ + + H+ KA  +I+TL+ LS
Sbjct: 292  SLHQLETGLYPDKFEEFNLKSVVSMENNIELAMNSFSRLPLAHAHADKAMYLIDTLRNLS 351

Query: 352  R--SLLVDDRAVTIDADTLVSLFVVVVCHAQVKDLRSHLFYLQEFTKDTNLVTFGILAYG 409
            R    + +   V I ADTL+SLFV+V+C  Q+++L+  LFYLQ F K+   +TFG+L Y 
Sbjct: 352  RVDKSIQEVSPVAIGADTLLSLFVLVICRTQLRNLKGQLFYLQNFAKNETSITFGVLGYA 411

Query: 410  MSTLEAVLCYFE---SPEKVASLEKYCRANLSHWKSISEGSIDLNADTTVPLDDLLKIRT 466
            +STLEA +CYF+     +K++ LE  C    S    +S  S  +N    +     L  RT
Sbjct: 412  ISTLEAAVCYFDELKGSKKMSRLESECENARSLVDKLSSESSSVN---LIHYQKTLSYRT 468

Query: 467  SDGQSCLAVCLQHRRTEEF-ELIKNTREAWFPLEDLLHDETTDGSNLLIHMLESGCDRLA 525
              G+S L++C+ + + +   EL+ + R   FPLED+L D+TT+G  LL+  L+ G    A
Sbjct: 469  EQGESLLSICIANGKNDILQELLSDERS--FPLEDILEDQTTEGCTLLMQSLKCGNGDAA 526

Query: 526  VMLINTLISNCTKDELIAFLNHTNKYQRSCGHYLMHAPQLIDLVGDILNWEQRDCNGHTP 585
             ++++ + S+CT++E+ A+ N ++K +R+  HYL H   +++ +G+  +W+ +D +GHT 
Sbjct: 527  SLIVDLIKSSCTQEEMFAYFNRSDKDKRTAAHYLTHEINILEQIGNFFDWDVKDSSGHTA 586

Query: 586  LFAIVRAYDRPDYFDMVSAAYRAAVGQSKVRNSRFRVSNHTDDKGNTLLHVIKSDVSILL 645
            LF I R+YD+P+Y DM+ A++R A      R   F  + H D K NTLLH++K  +SILL
Sbjct: 587  LFTIFRSYDQPNYDDMIRASFRCAAEWYACRMRPFCFTVHEDRKENTLLHILKRSISILL 646

Query: 646  ADPFIDVNATNAKGLTPLMVYVRYNRIGNVRTILQDQRLIIGKHQSGAYLSCFDYVKNPA 705
                +DVNA N KGLTPLMVY +YNR+ N ++IL D+R+I+GK Q    L   DY KNP 
Sbjct: 647  EYESVDVNARNRKGLTPLMVYAKYNRLDNTKSILTDKRVILGKIQHPLLLCSIDYAKNPL 706

Query: 706  VLKELGKYASYLPFEFSINVHSVKREGDEWVLWITVTGGEKQVPVKVFKRSLRFIQAFLT 765
            +L E+ K ++         VH++K E   W++ ITV   +++   +  +  L+ +Q F  
Sbjct: 707  ILHEIAKQSAMDTAFGKCFVHTLKYESSSWLVNITVQ-ADRKGNFETVEFHLKTVQNFFR 765

Query: 766  LFSDAHPMTFVPVDELLRELRALSQSRILILNKMDTKRFLKRCSVTLS-MVSQERLFADA 824
                  PMTF+P+D  L +L +L ++R+  + K++T  +L+  +   + +++ + L  D 
Sbjct: 766  TVLRTCPMTFLPLDSTLNQLASLGKARLSSIGKLETVCYLRSLTNCFNVLINSQELPKDI 825

Query: 825  FTDXXXXXXXXXXXXXXXXFTQN---MKMMEPEEVRSIQSILKFNLSEISXXXXXXXXXX 881
              +                        K +EPEE+  IQ  L+FN +E+S          
Sbjct: 826  LANESKLLSWIKVQYKAFRNGTTHIFSKKVEPEEMSIIQGFLRFNQAELSTLRSKLHVMK 885

Query: 882  XXXVFEGLKGKDLSEAC---MTFGAKCKYVTQGKIQSF-DHFLNVQAPNLFD-FEGIANN 936
               +F  LK  D+ ++    +  G++      G +    DH  +       D    +  +
Sbjct: 886  KLAIFLRLKSSDVEQSVELLLPLGSE----GMGDLYPLTDHKFSCTTVYGNDSMILLVED 941

Query: 937  IALCELCSSLLCKHIGQVLNDDIPKWWHTYGELLSLRREYKKSFPD-ANRPHVSENSGLF 995
            I L   C+  L  HI  +L   IP+WW  YGELL+ R++Y ++FP        S ++G+ 
Sbjct: 942  IDLMLKCTIRLYDHINNLLQVKIPEWWKLYGELLNFRKQYAQNFPHLVKNGETSTDAGII 1001

Query: 996  GSYIETKRTKLEQSYAARINHTSVRLSEISTKINQDNERLAVELNNFINFKNEFL-KSAI 1054
            G  +E K+ KLE+  +  I  T   +++    I  D+E LA +L+ F+ FK  ++ +  I
Sbjct: 1002 GKILEGKKEKLEKRLSFSIAETRRSMNQAGAIIAHDHESLAEQLSKFMEFKGAYICRGVI 1061

Query: 1055 KEHADTNIKRLREQLV 1070
            K     NIK L+E+L+
Sbjct: 1062 KRWVRENIKELKERLI 1077

>ZYRO0C07810g Chr3 complement(591035..594334) [3300 bp, 1099 aa] {ON}
            similar to uniprot|Q04257 Saccharomyces cerevisiae
            YML003W/YML002W Hypothetical ORF
          Length = 1099

 Score =  632 bits (1630), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/1119 (35%), Positives = 607/1119 (54%), Gaps = 71/1119 (6%)

Query: 1    MPYYLPVLLNPLINAVFNCPTPLNSSLKKVFSAIEKVRFVLIAPPTELLLEYEDLESGLP 60
            M Y++PVLLNPL+N+VFNC  P +S  KK+F  ++  RF+L+ PPTE LL + D ESG  
Sbjct: 1    MAYHIPVLLNPLVNSVFNCSNPSDSQFKKLFGKLKTERFILLVPPTEKLLYHVDAESGSS 60

Query: 61   LQDLCYATGFVSDHIVLL------DGREGLQ--EEEYKTLSGKTILLRSQQGIIFTAAAF 112
            + DLC    FV+ HI+LL      DG   L   + EYKTL+ K + +RS  G I T   F
Sbjct: 61   MNDLCQNYDFVASHILLLQQDTYSDGGFNLSASQTEYKTLNDKRVAVRSSSGEILTTEGF 120

Query: 113  DTRRRCRIQRAELLTNFNEYLKGDTTFPIIHVDFPLTGRLARRDEWQCFRVTKNQEHTNG 172
              RRR RIQ  EL+TNFN+YL G   F ++H+D PL G L R+ +         Q + NG
Sbjct: 121  PLRRRARIQNVELITNFNDYLNGSEKFALVHIDHPLIGTLIRKID---IPRGLAQGNFNG 177

Query: 173  PKNSGKLSHG---DNNISLEQLLRINPEYGESLNDIVKAQRISLNSSVTGTTHLASHFVQ 229
                G L       +  S E +LR++P++   LN      R    S+          F  
Sbjct: 178  VDAKGSLVRDLTQKSWSSFENILRLHPDWSNILNGYFNRYR----STPLTEGPYEELFRM 233

Query: 230  TCKKALDVVRAYPAFQVLPNLPICVHEYIELNLYDDYWAQLTNSLRDSEIESSSDYSLLK 289
              K+    +     F+ +P+L   + +Y+ELNL+DD W ++ NS R  EI++      LK
Sbjct: 234  IVKQVHAKMVNDELFRKIPHLYDLIFDYVELNLFDDVWIRIVNSYRKDEIDTEP----LK 289

Query: 290  HISVSQVPSFLYPSNPEKFDLRLITQAEKNVKGAVESFRKIAVTNCHSAKAKVIIETLQT 349
             +S++++ + LY    EKF L+ +T  EKN+  A+ SF  + +T+ H+ KA  +I TLQ+
Sbjct: 290  FLSINELETELYQKKYEKFRLQDVTTMEKNIDLAINSFVGLPLTHTHAEKADCLINTLQS 349

Query: 350  LSRS----LLVDDRAVTIDADTLVSLFVVVVCHAQVKDLRSHLFYLQEFTKDTNLVTFGI 405
            LS +    + +    +T+DADTL+S FV+VVC  QVK+++SHLFYL++F+KD N + FGI
Sbjct: 350  LSNTREQDMDIQTLPITMDADTLISFFVLVVCRTQVKNIKSHLFYLKKFSKDENSIKFGI 409

Query: 406  LAYGMSTLEAVLCYFESPEKVASLEKYCRAN--------LSHWKSISEGSIDLNADTTVP 457
            L Y +STLEAV+ YF+  +    L+K    +        L   KS  +  +D++      
Sbjct: 410  LGYAISTLEAVVFYFDGLKGTKKLQKLQDDSNKAKELYILISDKSTGQAVLDISQ----- 464

Query: 458  LDDLLKIRTSDGQSCLAVCLQHRRTEE-FELIKNTREAWFPLEDLLHDETTDGSNLLIHM 516
                L+ RT  G+S L+ C+ + +    +EL+KN  E  FPLED+L DET DGS LLI  
Sbjct: 465  FRSNLEFRTPQGESVLSQCIINDKNGLLYELLKNY-EDIFPLEDILDDETVDGSTLLIQA 523

Query: 517  LESGCDRLAVMLINTLISNCTKDELIAFLNHTNKYQRSCGHYLMHAPQLIDLVGDILNWE 576
            L+      A M++  L ++CT+ EL  ++N  +K +R+  HYL H   +++ +G  +NW+
Sbjct: 524  LKCDNSEAAQMIVEVLQNSCTEQELREYVNRADKNRRTVAHYLTHEMNILESIGKYINWK 583

Query: 577  QRDCNGHTPLFAIVRAYDRPDYFDMVSAAYRAAVGQSKVRNSRFRVSNHTDDKGNTLLHV 636
             +D NGHTPLF I R YD+ +Y  M+SAA+R+AV   +     F+ S+H D+KGNTLLH+
Sbjct: 584  SQDSNGHTPLFTIFRCYDQQNYEAMISAAFRSAVRWYQANGEDFQFSDHEDNKGNTLLHI 643

Query: 637  IKSDVSILLADPFIDVNATNAKGLTPLMVYVRYNRIGNVRTILQDQRLIIGKHQSGAYLS 696
            IK++VSILL    +D+N TN KGLTPLM+Y RYNR  NV+TI++DQR+I+ K Q  ++L+
Sbjct: 644  IKNNVSILLDYDNVDINCTNKKGLTPLMIYTRYNRFDNVKTIIRDQRIILDKLQHPSFLN 703

Query: 697  CFDYVKNPAVLKELGKYA-SYLPFEFSINVHSVKREGDEWVLWITV-TGGEKQVPVKVFK 754
             FDY +NP VLKEL   A     FE +  VH +K E   W   ITV  G       K  K
Sbjct: 704  SFDYARNPLVLKELVSQAIKTTAFELAF-VHHLKYEAPSWFFHITVKIGAGADEEYKTVK 762

Query: 755  RSLRFIQAFLTLFSDAHPMTFVPVDELLRELRALSQSRILILNKMDTKRF---------- 804
              ++ +Q    +    H  +F+P+++ L +L  L +SR+  + K++T  F          
Sbjct: 763  LHIKTLQNLFQVLLKMHFASFLPLEKALEDLSNLYKSRMPSIAKLETLYFFYMLTDCFDV 822

Query: 805  -LKRCSVTLSMVSQERLFADAFTDXXXXXXXXXXXXXXXXFTQNMKMMEPEEVRSIQSIL 863
             L+  ++   ++ + RL +   +                   Q  K +EPEE+  + S L
Sbjct: 823  LLRHDNLNKLVLRESRLVSWIRSQDKKCNNSKKL--------QKQKNVEPEEIGIMASFL 874

Query: 864  KFNLSEISXXXXXXXXXXXXXVFEGLKGKDLSEACM---TFGAKCKYVTQGKIQSFDHFL 920
            +FN  E+S             +F  LK  DL+ +      FG +   + Q ++   D  +
Sbjct: 875  RFNRGELSAVKLKLMTMKKLLIFLKLKNTDLTHSYQFLSLFGTEYN-LAQDRLLFKDLEI 933

Query: 921  NVQAPNLFDFEGIANNIALCELCSSLLCKHIGQVLNDDIPKWWHTYGELLSLRREYKKSF 980
            N  A            IA  E C+  L   + Q+L+ DIP+WW  YG++L + + YK+ F
Sbjct: 934  NCCAFGEEATMTFVREIAFLENCTGKLLDRVEQLLSVDIPEWWKLYGDVLEMHKVYKQKF 993

Query: 981  PDANRPHVSENSGLFGSYIETKRTKLEQSYAARINHTSVRLSEISTKINQDNERLAVELN 1040
            P+ +R      +G+  S+ E KR K+E   ++ +     R+  +  +I+  +E LA EL+
Sbjct: 994  PNISRN--DSGTGIIASFFEGKREKMESKLSSDLADCKKRMRRVGDRISSTHEILAEELS 1051

Query: 1041 NFINFK-NEFLKSAIKEHADTNIKRLREQLV-CSEEALY 1077
             ++ FK N F+   ++     NI  L+ +LV   + ALY
Sbjct: 1052 KYMEFKSNFFINGILRRAVRENINILKGRLVEMRKRALY 1090

>Smik_13.157 Chr13 (254644..257916) [3273 bp, 1090 aa] {ON} YML002W
            (REAL)
          Length = 1090

 Score =  630 bits (1626), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/1099 (34%), Positives = 605/1099 (55%), Gaps = 46/1099 (4%)

Query: 4    YLPVLLNPLINAVFNCPTPLNSSLKKVFSAIEKVRFVLIAPPTELLLEYEDLESGLPLQD 63
            +LP LLNPLINA+FNCP P  S LKK+F+ ++  RF+L+APP+E LL Y D+++ LPL +
Sbjct: 5    HLPTLLNPLINAIFNCPEPEKSPLKKLFATLKTCRFILLAPPSEYLLNYHDVKTKLPLHE 64

Query: 64   LCYATGFVSDHIVLLDGREGL----QEEEYKTLSGKTILLRSQQGIIFTAAAFDTRRRCR 119
            LCY   F++ HI+L+     +    ++  Y+TL GKT++++ +  +I     F  RRR +
Sbjct: 65   LCYNAEFINSHILLMTENSFINTNSRDSHYETLDGKTVVIQWKNNVIHALNGFQVRRRLK 124

Query: 120  IQRAELLTNFNEYLKGDTTFPIIHVDFPLTGRLARRDEWQCFRVTKN-QEHTNGPKNSGK 178
            I   ++L NFN+Y +G T F II+++ PL+      D  QCF   K   +      N   
Sbjct: 125  ILGTKILPNFNDYFEGATDFVIIYIEQPLSCESVPNDYLQCFHSYKKIPKSVYSVHNLSL 184

Query: 179  LSHGDNNISLEQLLRINPEYGESLNDIVKAQRISLNSSVTGTTHLASHFVQTCKKALDVV 238
             S      S E +L I+P     L ++    R +L  S   +  +    VQ   +A + +
Sbjct: 185  DSSQQERSSFENILHIHPTRLTQLGEMFSNYR-TLAPSDDPSEKIFECIVQ---QAFEGM 240

Query: 239  RAYPAFQVLPNLPICVHEYIELNLYDDYWAQLTNSLRDSEIESSSDYSLLKHISVSQVPS 298
            ++   F+  PNL   +HEY ELNLYDD W++LT+  +  E+  + +Y   K+ S++ + +
Sbjct: 241  KSDSLFKKFPNLYDLIHEYFELNLYDDIWSRLTSHFKSYEV-GTEEY---KYFSINHLLA 296

Query: 299  FLYPSNPEKFDLRLITQAEKNVKGAVESFRKIAVTNCHSAKAKVIIETLQTLS------- 351
              Y  +  +F L+ +T  EK V  A + F+K+ +T+ ++ K+K+++ETLQ LS       
Sbjct: 297  DFYSKDFREFKLQDVTFIEKRVHLASKHFQKLTLTHSYTEKSKILVETLQELSGTTDMGS 356

Query: 352  RSLLVDDRA--VTIDADTLVSLFVVVVCHAQVKDLRSHLFYLQEFTKDTNLVTFGILAYG 409
              L V  R   + +DADTL+SLFV+V+C ++ K L+SHL+YLQ F+ +++   FGIL Y 
Sbjct: 357  HQLDVPGRLNNLAMDADTLISLFVLVICRSEQKHLKSHLYYLQNFSNNSSSSKFGILGYA 416

Query: 410  MSTLEAVLCYFESPEKVASLEKYCRANLSHWKS------ISEGSIDLNADTTVPLDDLLK 463
            +STLEAV+CYFE  +K +  +   +AN+   K+      +S  ++    +      D+L 
Sbjct: 417  VSTLEAVVCYFEDFKKNS--DNMAKANVLLQKTKRLVNMLSCENVTNKVENLATYKDILP 474

Query: 464  IRTSDGQSCLAVCLQHRRTEEFELIKNTREAWFPLEDLLHDETTDGSNLLIHMLESGCDR 523
             R   GQS L++C+ + +      I +  ++ FPLEDLL DET DGS LLI  ++SG   
Sbjct: 475  YRNGQGQSILSICISNNKNHILLDILSEYDSIFPLEDLLEDETIDGSTLLIESIKSGNLE 534

Query: 524  LAVMLINTLISNCTKDELIAFLNHTNKYQRSCGHYLMHAPQLIDLVGDILNWEQRDCNGH 583
             A +LI  ++ NCT++ELI+++N T+KY R+  HYL H   ++  +G+ ++W++++  G 
Sbjct: 535  AAKILIRIMMLNCTEEELISYINRTDKYSRTVAHYLTHEIDILKSIGNYVDWKRKNSGGQ 594

Query: 584  TPLFAIVRAYDRPDYFDMVSAAYRAAVGQSKVRNSRFRVSNHTDDKGNTLLHVIKSDVSI 643
            TPLF+I R+YD+P+Y  MV  A+  A    + +N  F   +HTD+KGN LLHV+K+D SI
Sbjct: 595  TPLFSIFRSYDQPNYEAMVKIAFNIANTWYRKQNRSFDYRDHTDNKGNDLLHVLKTDASI 654

Query: 644  LLADPFIDVNATNAKGLTPLMVYVRYNRIGNVRTILQDQRLIIGKHQSGAYLSCFDYVKN 703
            LL    +D+N  N KGLTPLMVYV+Y R+ N+  I++DQRL++ K Q   + +CFDY K+
Sbjct: 655  LLQLTKLDINGENYKGLTPLMVYVKYKRLNNIEAIIKDQRLVLEKIQKSTFFTCFDYAKD 714

Query: 704  PAVLKELGKYASYLPFEFSINVHSVKREGDEWVLWITVTGGEKQVPVKVFKRSLRFIQAF 763
              VL ++G+  +       I  HS++       + IT    + + P      +++ IQ  
Sbjct: 715  HTVLSKVGERGAKDSLFGLIYFHSLRYHNLNAAVNITF-ASDTEKPFSNTVINMKTIQGL 773

Query: 764  LTLFSDAHPMTFVPVDELLRELRALSQSRILILNKMDTKRFLKRCSVTLSMV-----SQE 818
            L      +P TF+P++  + E+  LS+S + I+ K D    L + S   +++       +
Sbjct: 774  LRSILKDNPFTFLPLNIYIDEISQLSRSDVTIIGKADVMSLLHKLSNCFNVLLFLKKVPK 833

Query: 819  RLFADAFTDXXXXXXXXXXXXXXXXFTQNMKMMEPEEVRSIQSILKFNLSEISXXXXXXX 878
             LF D  +                   +N K MEPEE+  IQS L+FN  EIS       
Sbjct: 834  SLFTDEASILYWMRINTSKRNQKQPSKENYKTMEPEEINMIQSFLRFNFDEISSFKASLS 893

Query: 879  XXXXXXVFEGLKGKDLSEACMTFGAKCKYVTQGKIQSFDHFL-NVQAPNLFDFEGIAN-- 935
                  +F  LK  D  +         K +   K  + D F  N+   N+F+   +A   
Sbjct: 894  ILRKILIFISLKSNDFKDVNDNLNEMGKSIYNAK--AADAFAGNLTNHNMFNDYSLAKLL 951

Query: 936  -NIALCELCSSLLCKHIGQVLNDDIPKWWHTYGELLSLRREYKKSFPDANRPH-VSENSG 993
             ++   E C+  L   +  +L + IP WW  YGEL++L + Y+K+FP   +P   ++ SG
Sbjct: 952  EHVRFLEECTIQLSNLVQLILLEKIPNWWKHYGELITLHKNYRKAFPSVVKPKSTTDTSG 1011

Query: 994  --LFGSYIETKRTKLEQSYAARINHTSVRLSEISTKINQDNERLAVELNNFINFKNEFL- 1050
                G +IETKR + EQ  A +I  +S  L E+ ++I   +E+LA EL+N++ F+   L 
Sbjct: 1012 HIQLGGFIETKREQSEQRLAVQIKVSSKSLKELGSEIFVAHEKLAEELSNYMEFRKACLN 1071

Query: 1051 KSAIKEHADTNIKRLREQL 1069
            +  I   A TNI  L+E +
Sbjct: 1072 QRNIVAFAATNISVLQENI 1090

>Suva_13.160 Chr13 (253437..256709) [3273 bp, 1090 aa] {ON} YML002W
            (REAL)
          Length = 1090

 Score =  624 bits (1608), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/1099 (34%), Positives = 596/1099 (54%), Gaps = 48/1099 (4%)

Query: 3    YYLPVLLNPLINAVFNCPTPLNSSLKKVFSAIEKVRFVLIAPPTELLLEYEDLESGLPLQ 62
            Y+LP LLNPLINA+FNCP P  S LKK+F+ ++  RF+L+APP+ LLL Y D+++ LPL 
Sbjct: 4    YHLPTLLNPLINAIFNCPEPEKSPLKKLFANLQTRRFILLAPPSHLLLNYHDVKTKLPLH 63

Query: 63   DLCYATGFVSDHIVLLDGRE----GLQEEEYKTLSGKTILLRSQQGIIFTAAAFDTRRRC 118
            +LCY   F++ HI+L          L+++ Y+TL GKT++++ +  +I T   F  RRR 
Sbjct: 64   ELCYNADFINSHILLTTENSYINTTLRDDHYETLDGKTVVVQWKNNVIHTLNGFPLRRRL 123

Query: 119  RIQRAELLTNFNEYLKGDTTFPIIHVDFPLTGRLARRDEWQCFRVTKNQEHTNGPKNSGK 178
            +I   ++L NFN+Y KG   F I+++D PL       D   CF     +E +   +N+  
Sbjct: 124  KILDTKILPNFNDYFKGAEYFAILYIDQPLGCEFVPNDYLHCF--NSYEETSKTARNAPN 181

Query: 179  LSHGDNNI---SLEQLLRINPEYGESLNDIV-KAQRISLNSSVTGTTHLASHFVQTCKKA 234
            L    + +   S E +L I+P +   L  +    +R +LN   +        F +  ++A
Sbjct: 182  LLMDTSQLERSSFENILHIHPAWLTQLGQLFSNYRRAALNDDPSKKM-----FEELVEQA 236

Query: 235  LDVVRAYPAFQVLPNLPICVHEYIELNLYDDYWAQLTNSLRDSEIESSSDYSLLKHISVS 294
             D +++   F+   NL   +H+Y ELNLY+D W++LT   +  E+ + +     ++ SV+
Sbjct: 237  FDGMKSDSLFKNFSNLYDLIHDYFELNLYEDIWSRLTIHFKGYEVNTEN----CEYFSVN 292

Query: 295  QVPSFLYPSNPEKFDLRLITQAEKNVKGAVESFRKIAVTNCHSAKAKVIIETLQTLSRSL 354
            Q+ +  Y  + E F L  IT  E+ V  A + F+K+A+++ ++ K+K+++ETLQ LS + 
Sbjct: 293  QLLTDYYSKDFESFKLSDITFIERRVSVASKHFQKLALSHSYAEKSKILVETLQHLSGTT 352

Query: 355  LVDDRA---------VTIDADTLVSLFVVVVCHAQVKDLRSHLFYLQEFTKDTNLVTFGI 405
             +             +T+DADTL+SLFV+VVC ++ K +RSHL+YLQ F+ +++   FGI
Sbjct: 353  DMGSHKPDLSNGFNNLTMDADTLISLFVLVVCRSEQKHIRSHLYYLQNFSNNSSSSKFGI 412

Query: 406  LAYGMSTLEAVLCYFESPEKVASLEKY----CRANLSHWKSISEGSIDLNADTTVPLDDL 461
            L Y +STLEAV+CYFE+  K  +        C         +S  +     +      D+
Sbjct: 413  LGYAISTLEAVVCYFENFNKNNNNVAKANLLCIKTRDLLDKLSCENPTNEVNDLATYKDI 472

Query: 462  LKIRTSDGQSCLAVCLQHRRTEEFELIKNTREAWFPLEDLLHDETTDGSNLLIHMLESGC 521
            L  R   GQS L++C+ + + +    + +  EA FP+ED+L DET DGS LLI  ++ G 
Sbjct: 473  LAYRNEQGQSILSLCITNNKNDILLDVLSEYEALFPIEDILEDETIDGSTLLIESIKVGN 532

Query: 522  DRLAVMLINTLISNCTKDELIAFLNHTNKYQRSCGHYLMHAPQLIDLVGDILNWEQRDCN 581
                 +LI  ++ NCT +EL+ ++N T+KY RS  HYL H   ++  +G  +NW+Q++ +
Sbjct: 533  LEATKILIRIMLFNCTDEELVTYVNKTDKYARSVAHYLTHEMDILKSIGSYINWKQKNSS 592

Query: 582  GHTPLFAIVRAYDRPDYFDMVSAAYRAAVGQSKVRNSRFRVSNHTDDKGNTLLHVIKSDV 641
            G TPLF+I R+YD+P+Y +MV  A+  A    +  N+ F  S+HTD+KGN+LLHV+K+DV
Sbjct: 593  GQTPLFSIFRSYDQPNYEEMVKVAFNIASSWYQRHNTSFGYSDHTDNKGNSLLHVLKTDV 652

Query: 642  SILLADPFIDVNATNAKGLTPLMVYVRYNRIGNVRTILQDQRLIIGKHQSGAYLSCFDYV 701
            SILL    +++N  N KGLTPLMVYV+Y R+ N+  I +D RLI+ K Q+  + +CFDY 
Sbjct: 653  SILLQLTKLNINGENYKGLTPLMVYVKYKRLSNIDAITKDHRLILEKVQNSTFFTCFDYA 712

Query: 702  KNPAVLKELGKYASYLPFEFSINVHSVKREGDEWVLWITVTGGEKQVPVKVFKRSLRFIQ 761
            K+  VL ++G+  +       I +HS++       + +T     ++ P      +++ IQ
Sbjct: 713  KDRLVLSKIGERGANDSIFGLIYLHSLRYHNLNATVNVTSVSKTEE-PFVTAVINMKTIQ 771

Query: 762  AFLTLFSDAHPMTFVPVDELLRELRALSQSRILILNKMDTKRFLKR---CSVTLSMVSQ- 817
              L      +P TF+P+D  +  +  L++S + I+ K D +  L +   C   L  + + 
Sbjct: 772  GLLRSIVKDNPFTFLPIDNYIDGISHLNRSDLTIIGKADVRSLLHKLTNCFNVLLFLKKV 831

Query: 818  -ERLFADAFTDXXXXXXXXXXXXXXXXFTQNMKMMEPEEVRSIQSILKFNLSEISXXXXX 876
             + LF D  +                    N K MEPEE+  IQS L+FN  EI      
Sbjct: 832  PQNLFTDEASVLYWMRINTSRRNQKPPSKDNPKTMEPEEINMIQSFLRFNFDEILSFKAS 891

Query: 877  XXXXXXXXVFEGLKGKDLSEACMTFGAKCKYVTQGKIQSFDHFLN-VQAPNLF---DFEG 932
                    +F  LK  D  +A  +       VT GK  + D F   ++   +F     + 
Sbjct: 892  LNILRKILIFLSLKSSDFEDAYASLLKMGTKVTNGK--AADAFTTIIKNHKMFSDLSLDE 949

Query: 933  IANNIALCELCSSLLCKHIGQVLNDDIPKWWHTYGELLSLRREYKKSFPDANRPHVSENS 992
            +  ++   E C+  L   I  +L D IP WW  YGE L+L + Y+K+FP A +P  +  +
Sbjct: 950  LLEHVQFLEECTIQLFNSIQTILFDRIPNWWKHYGEFLTLHKNYRKAFPSAVKPKSTAGT 1009

Query: 993  GL---FGSYIETKRTKLEQSYAARINHTSVRLSEISTKINQDNERLAVELNNFINFKNEF 1049
                  G +IETKR + EQ  + +I  +S  L E+ ++I   +E LA EL+N++ F+   
Sbjct: 1010 SSHIPLGGFIETKREQSEQRLSVQIKASSKILKELGSEIFSAHENLAEELSNYMEFRKAC 1069

Query: 1050 L-KSAIKEHADTNIKRLRE 1067
            L +  I   A  NI  L+E
Sbjct: 1070 LDQRTIVAFAIKNISVLQE 1088

>Skud_13.152 Chr13 (249372..252644) [3273 bp, 1090 aa] {ON} YML002W
            (REAL)
          Length = 1090

 Score =  614 bits (1584), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/1105 (33%), Positives = 598/1105 (54%), Gaps = 56/1105 (5%)

Query: 3    YYLPVLLNPLINAVFNCPTPLNSSLKKVFSAIEKVRFVLIAPPTELLLEYEDLESGLPLQ 62
            Y+LP LLNPLINA+FNCP P  S LKK+F+ ++  RF+L+APP   LL Y D+++ LPL 
Sbjct: 4    YHLPTLLNPLINAIFNCPEPEKSPLKKLFANLKTRRFILLAPPLRFLLNYHDVKTKLPLH 63

Query: 63   DLCYATGFVSDHIVLLDGRE----GLQEEEYKTLSGKTILLRSQQGIIFTAAAFDTRRRC 118
            +LCY   F++ HI+L          L++  Y+TL GK ++++ +  II     F  R+R 
Sbjct: 64   ELCYNVDFINSHILLTTENSYLNTTLRDSHYETLDGKAVVIQWKNNIIHALNGFPIRQRL 123

Query: 119  RIQRAELLTNFNEYLKGDTTFPIIHVDFPLTGRLARRDEWQCF----RVTKN-QEHTNGP 173
            +I   ++L NFN+Y +G   F I+ +D PL   +A  D  +CF     V KN Q  +N P
Sbjct: 124  KILETKVLPNFNDYFEGAADFAILFIDQPLNCEVAPNDYLKCFDSYEEVPKNAQSVSNLP 183

Query: 174  KNSGKLSHGDNNISLEQLLRINPEYGESLNDIVKA-QRISLNSSVTGTTHLASHFVQTCK 232
             NS +        S + +L I+      L  +    +R++ N   +        F    +
Sbjct: 184  VNSYEQERS----SFDNILHIHSARLAQLGQLFSNYRRLAPNDDPSKKM-----FEDIVQ 234

Query: 233  KALDVVRAYPAFQVLPNLPICVHEYIELNLYDDYWAQLTNSLRDSEIESSSDYSLLKHIS 292
            ++ D +++   F+   NL   +H+Y ELNLYDD W++L    +  E+++       K+ S
Sbjct: 235  QSFDGMKSDSLFKNFSNLYDLIHDYFELNLYDDIWSRLVTHFKGYEVDTEK----YKYFS 290

Query: 293  VSQVPSFLYPSNPEKFDLRLITQAEKNVKGAVESFRKIAVTNCHSAKAKVIIETLQTLSR 352
            V+Q+ +  +  + ++F L  IT  E+ V  A + F+K+ +T+ ++ K+K+++ETLQ LS 
Sbjct: 291  VNQLLADFFSKDFKEFKLSDITFIERRVNVASKHFQKLTLTHSYAEKSKILVETLQQLSG 350

Query: 353  SLLVDDR---------AVTIDADTLVSLFVVVVCHAQVKDLRSHLFYLQEFTKDTNLVTF 403
               +            ++T+DADTL+SLFV+VVC ++ K L+SHL+YLQ F+ + +   F
Sbjct: 351  PTEISSHQQELPNGLNSLTMDADTLLSLFVLVVCRSEQKHLKSHLYYLQNFSNNPSSTKF 410

Query: 404  GILAYGMSTLEAVLCYFESPEKVASLEKYCRANLSHWKS------ISEGSIDLNADTTVP 457
            GIL Y +STLEAV+CYFE  +K  + E   +AN+S+ K+      +S  +     +    
Sbjct: 411  GILGYAISTLEAVVCYFEDFDK--NNENLAKANVSYQKTRELLDKLSSENPTNEIENLAT 468

Query: 458  LDDLLKIRTSDGQSCLAVCLQHRRTEEFELIKNTREAWFPLEDLLHDETTDGSNLLIHML 517
             +D L+ R   GQS L++C+ + +      +    E  FP+ED+L DET DGS LLI  +
Sbjct: 469  YEDNLQYRNEQGQSILSICITNTKNCILLDVLTEYEDLFPMEDILEDETLDGSTLLIESI 528

Query: 518  ESGCDRLAVMLINTLISNCTKDELIAFLNHTNKYQRSCGHYLMHAPQLIDLVGDILNWEQ 577
            ++G    A +LI  ++ NC++ EL++++N  +KY R+  HYL H   ++  +G  ++W++
Sbjct: 529  KTGNIEAAKILIGIMLLNCSEGELVSYVNKADKYARTVAHYLTHEMDILKSIGSYVDWKR 588

Query: 578  RDCNGHTPLFAIVRAYDRPDYFDMVSAAYRAAVGQSKVRNSRFRVSNHTDDKGNTLLHVI 637
            ++ +G TPLF+I R YD+P+Y +MV  A+  A    +  NS F   +HTD KGN+LLH++
Sbjct: 589  KNSSGQTPLFSIFRTYDQPNYEEMVKIAFNIANSWYQKHNSSFDYLDHTDSKGNSLLHIL 648

Query: 638  KSDVSILLADPFIDVNATNAKGLTPLMVYVRYNRIGNVRTILQDQRLIIGKHQSGAYLSC 697
            KSDVSILL    +D+N  N KGLTPLM+YV+Y RI N+  I +D RLI+ K Q+  + +C
Sbjct: 649  KSDVSILLQLSKLDINGRNYKGLTPLMIYVKYKRISNIDAITKDSRLILEKVQNSTFFTC 708

Query: 698  FDYVKNPAVLKELGKYASYLPFEFSINVHSVKREGDEWVLWITVTGGEKQVPVKVFKRSL 757
            FDY K+ +VL ++G+  +       + +HS++         IT T      P      ++
Sbjct: 709  FDYAKDHSVLSKIGERGARDSLFGLVYLHSLRYHNLNATTNIT-TASNTDKPFLTTVINM 767

Query: 758  RFIQAFLTLFSDAHPMTFVPVDELLRELRALSQSRILILNKMDTKRFLKR---CSVTLSM 814
            + IQ  L      +  TF+P++  + E+  L++S + I+ K D +  L +   C   L  
Sbjct: 768  KTIQGLLRSILKDNQFTFLPLNSYIDEISHLNRSDLTIIGKADVRSLLHKLTNCFNVLLF 827

Query: 815  VSQ--ERLFADAFTDXXXXXXXXXXXXXXXXFTQNMKMMEPEEVRSIQSILKFNLSEISX 872
            + +  + LF D  +                    N K MEPEE+  IQS L+FN  EIS 
Sbjct: 828  LKKVPQNLFTDEASVLYWMRINTSKRNQKPPSKDNPKTMEPEEINMIQSFLRFNFDEISS 887

Query: 873  XXXXXXXXXXXXVFEGLKGKDLSEACMTFGAKCKYVTQGKIQSFDHFLNV-QAPNLFDFE 931
                        +F  LK  D  +   +     + +  G  ++ D F  +    N+F   
Sbjct: 888  FKASLNILRKILIFLSLKSNDFEDTYDSLREMGRKIING--EAADAFARIFTNHNMFSDL 945

Query: 932  GIA---NNIALCELCSSLLCKHIGQVLNDDIPKWWHTYGELLSLRREYKKSFPDANRPHV 988
             +A    +++  E C+  L   +  +L D I KWW  YGE L+L++ Y+K+FP   +P  
Sbjct: 946  ALAELLEHVSFLEQCTIQLSTFVQTILFDKITKWWKHYGEFLALQKNYRKAFPSVVKPKS 1005

Query: 989  SENSGL---FGSYIETKRTKLEQSYAARINHTSVRLSEISTKINQDNERLAVELNNFINF 1045
            + ++      GS+IETKR + EQ  A +I  +S  L E+ ++I   +E+LA EL+N++ F
Sbjct: 1006 ATDTPSHIPLGSFIETKREQSEQRLAVQIKASSKILKELGSEIFTAHEKLAEELSNYMEF 1065

Query: 1046 KNEFL-KSAIKEHADTNIKRLREQL 1069
            +   L +  I   A TNI   +E +
Sbjct: 1066 RKACLDQRTIVAFATTNIGIFQEYI 1090

>KLLA0D01133g Chr4 (101580..104783) [3204 bp, 1067 aa] {ON} some
            similarities with uniprot|Q04257 Saccharomyces cerevisiae
            YML002W and some similarities with uniprot|Q04257
            Saccharomyces cerevisiae YML003W Hypothetical ORF
          Length = 1067

 Score =  528 bits (1361), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 353/1091 (32%), Positives = 563/1091 (51%), Gaps = 52/1091 (4%)

Query: 1    MPYYLPVLLNPLINAVFNCPTPLNSSLKKVFSAIEKVRFVLIAPPTELLLEYEDLESGLP 60
            MPY+LPVLLNPL+NA+FNCP+P  SSLK++FS ++  RF ++ P TE LL+++DLESGL 
Sbjct: 1    MPYHLPVLLNPLLNAIFNCPSPKTSSLKQMFSRLDDERFFILVPSTETLLQFQDLESGLE 60

Query: 61   LQDLCYATGFVSDHIVLLDG-------REGLQEEEYKTLSGKTILLRSQQGIIFTAAAFD 113
            L +LCY   FV+ HIV++         +  +   ++ TL+G+ + +R +   I T   F 
Sbjct: 61   LAELCYHYDFVASHIVVIKDPTKDVPDQRSIYNTDFTTLNGRKLSIRYRNSTIVTGDGFT 120

Query: 114  TRRRCRIQRAELLTNFNEYLKGDTTFPIIHVDFPLTGRLARRDEWQCFRVTKNQEHTNGP 173
             RR+  I+   LL  FN+YLKG    PI+H+  PL G L   DE Q F      +++   
Sbjct: 121  ERRKITIKEINLLPTFNDYLKGSNYTPILHISMPLCGDLVPLDELQVFSKVAGNKYSKQE 180

Query: 174  KNSGKLSHGDNNI-SLEQLLRINPEYGE--SLNDIVKAQRISLNSSVTGTTHLASHFVQT 230
            +           +   EQ ++   +  E  +L   +   RI    SV G   + + ++ T
Sbjct: 181  QAPLPFDEEQKKVLYFEQRIQSISDVAERVALTFHLTKARIKKAISVIG---IRTEWLNT 237

Query: 231  CKKALDVVRAYPAFQVLPNLPICVHEYIELNLYDDYWAQLTNSLRDSEIESSSDYSLLKH 290
                  ++        L +L   +++Y+EL L+ D   QL+  + D E+E   D+  L+ 
Sbjct: 238  RDSIRQIISLDKRLNHLEDLDAMIYDYVELKLFTDIQQQLSEIVEDQELEHRFDFKALRS 297

Query: 291  ISVSQVPSFLYPSNPEKFDLRLITQAEKNVKGAVESFRKIAVTNCHSAKAKVIIETLQTL 350
            IS++QVP+  YP + + F L  + + EK+V  A+E  + I +   HS K +V+  T++ L
Sbjct: 298  ISLNQVPTNFYPKDEKSFSLASVVELEKSVNDALEYLKSIDLKTTHSGKLEVLSTTMRLL 357

Query: 351  SRSLLVDDRAVTIDADTLVSLFVVVVCHAQVKDLRSHLFYLQEFTKDTNLVTFGILAYGM 410
            SR +      ++ DADTL+SLFV+++C +QV  L   L YL  F      + FG+  Y +
Sbjct: 358  SREI----NGISTDADTLLSLFVLLICRSQVTGLVRTLTYLTNFEISETSIKFGLQGYVL 413

Query: 411  STLEAVLCYFESPEKVASLEKYCRANLSHWKSISEGSIDLNADTTVPLDDLLKIRTSDGQ 470
            ST EA L +F   + V SL K C +N   W SI + S  + A+    L   L+IRT  G+
Sbjct: 414  STFEAALSFFHQ-DTVDSLTKKCASNKKIWASIQKHS-KVEAEL---LSSNLRIRTDSGE 468

Query: 471  SCLAVCLQHRRTEEFELIKNTREAWFPLEDLLHDETTDGSNLLIHMLESGCDRLAVMLIN 530
            S L++C+Q    E    +    E+ FPLED+L D     S LLI  L+    + A +L  
Sbjct: 469  SLLSICIQSHNNEVLTTLLANFESEFPLEDILDDRDFALSTLLIQALQVQNSQAAAILSE 528

Query: 531  TLISNCTKDELIAFLNHTNKYQRSCGHYLMHAPQLIDLVGDILNWEQRDCNGHTPLFAIV 590
             ++ +CT+ E+ ++LN  N + R   HY+M    L++ VG   NWE +D NGHTPLFA+ 
Sbjct: 529  IILKSCTESEVRSYLNSPNLHNRITAHYIMQDISLLESVGRYFNWEHKDINGHTPLFAVF 588

Query: 591  RAYDRPDYFDMVSAAYRAAVGQSKVRNSRFRVSNHTDDKGNTLLHVIKSDVSILLADPFI 650
            R+YD  +Y ++V+      V      N  F    H D KGNTLLHV+KS +  LL  P +
Sbjct: 589  RSYDAVNYDEIVTKVLDQVVKWYANNNKPFNFKIHEDPKGNTLLHVMKSGIESLLKLPDV 648

Query: 651  DVNATNAKGLTPLMVYVRYNRIGNVRTILQDQRLIIGKHQSGAYLSCFDYVKNPAVLKEL 710
            +VN  ++KGLTPLM+Y RYNRI N+ TI++D+RL+    Q    ++  D+ KNP V K +
Sbjct: 649  NVNKPDSKGLTPLMIYSRYNRITNIETIMKDERLLCDLVQQPLVMTSLDFTKNPKVTKTI 708

Query: 711  GKYASYLPFEFS---INVHSVKREGDEWVLWITVTGGEKQVPVKVFKR-SLRFIQAFLTL 766
                  L   F+   + +HS++ E  +W + I   G        +FK+ SL  IQ +L  
Sbjct: 709  ------LDATFNREPVVIHSLRFEERKWKIGIFSEG--------IFKKYSLDLIQYYLRY 754

Query: 767  FSDAHPMTFVPVDELLRELRALSQSRILILNKMDTKRFLKRCSVTLSMV-SQERLFADAF 825
                +P +F PV  L  ELR L    +  + ++ +    K+  +  S V ++ +L+    
Sbjct: 755  LKIMYPCSFHPVQLLTNELRLLGIYGVPGVLRLQSYHTFKKLDMLFSYVNTRGKLWLGK- 813

Query: 826  TDXXXXXXXXXXXXXXXXFTQNMKMMEPEEVRSIQSILKFNLSEISXXXXXXXXXXXXXV 885
             D                 ++    +EPEE+  IQ+ LK+NL+E               +
Sbjct: 814  -DEEELKVLLDVPTPYLSESERFIKLEPEEINGIQTFLKYNLAEFQKLRNCLIILKKLAI 872

Query: 886  FEGLKGKDLSEACMTFGAKCKYVTQ-GKIQSFDHFLNVQAPNLFDFEGIANNIALCELCS 944
             + +K +D+     +F +    ++Q G  +SF++     + +L  +E    N+   E   
Sbjct: 873  VQQIKHRDVITMRNSFLSLGNQMSQKGVAKSFENTNCAWSYDLSYYE-FTRNLEYLEHSV 931

Query: 945  SLLCKHIGQVLNDDIPKWWHTYGELLSLRREYKKSFPDANRPHVSENSGLFGSYIETKRT 1004
              L  +   +L      WW  +GEL+ L++E+KK+FP+   P  S N     +YIE KR+
Sbjct: 932  VTLLNNFESLLA-KTTLWWKHFGELMELKKEWKKNFPNDKAPPSSANRNFIDTYIEGKRS 990

Query: 1005 KLEQSYAARINHTSVRLSEISTKINQDNERLAVELNNFINFKNEF-----LKSAIKEHAD 1059
            K     + ++  +S+ L +I  +I   +E +AV +N FI FK +F     +KS + +   
Sbjct: 991  KFRNKLSNQLKMSSLNLKKIGGEIKTTHESIAVGINLFIEFKEQFYHDHIVKSIVDQRIR 1050

Query: 1060 TNIKRLREQLV 1070
             N K++ +QL+
Sbjct: 1051 EN-KQIMQQLI 1060

>Kpol_1037.25 s1037 (56141..59458) [3318 bp, 1105 aa] {ON}
            (56141..59458) [3318 nt, 1106 aa]
          Length = 1105

 Score =  508 bits (1308), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 327/1088 (30%), Positives = 559/1088 (51%), Gaps = 50/1088 (4%)

Query: 1    MPYYLPVLLNPLINAVFNCPTPLNSSLKKVFSAIEKVRFVLIAPPTELLLEYEDLESGLP 60
            + Y++PVLLNPLINAVFNCP P+NS L+K+F  I+   F+LI PP E+LL Y D E GL 
Sbjct: 4    LSYHMPVLLNPLINAVFNCPDPINSPLRKLFERIKYKNFMLIVPPNEILLHYRDPEKGLT 63

Query: 61   LQDLCYATGFVSDHIVL----------LDGREGLQ--EEEYKTLSGKTILLRSQQGIIFT 108
            L++LCY   FV+ HI+L          + G+   +  +  YK+L+   +L+++   I   
Sbjct: 64   LKELCYEFEFVASHIILDTDNSSNNLQVKGKNSNETLDNRYKSLNNNQLLIKNNNIIPLD 123

Query: 109  AAAFDTRRRCRIQRAELLTNFNEYLKGDTTFPIIHVDFPLTGRLARRDEWQCFRVTKNQE 168
                  +++ +I   ++L NFNEYL G   + II+ D+P +     + E + F ++K + 
Sbjct: 124  FNNSTQKKKYKIIDIKILPNFNEYLSGSEKYTIIYTDYPFSNSWLPKIEIESFYISKKE- 182

Query: 169  HTNGPKNSGKLSHGD---------NNISLEQLLRINPEYGESLNDIVKAQRISLNSSVTG 219
             +N  K +   +H              S   ++ I+ E+    N+I  +  I   +    
Sbjct: 183  -SNNIKAAQITNHKSPLSQDLAQKTKSSFRHIINIHKEW----NNIFDSYIIDFKNKQLN 237

Query: 220  TTHLASHFVQTCKKALDVVRAYPAFQVLPN-LPICVHEYIELNLYDDYWAQLTNSLRDSE 278
             T L  +F +   KA   ++    F    N L   + EY+E + Y+  W  +  ++ D++
Sbjct: 238  LTSLPIYFREIVDKAYQKMKFEEIFLSFHNDLYNLIFEYLESSFYNSIWDHIDRNMIDNQ 297

Query: 279  IESSSDYSLLKHISVSQVPSFLYPSNPEKFDLRLITQAEKNVKGAVESFRKIAVTNCHSA 338
               +    ++  +S+ Q+   LY  N +KF+L  + + E+ VK A + F+KI  +  HS 
Sbjct: 298  FLHTE---MMDFLSIDQLELELYNQNFQKFNLVNVIKVERCVKDATDQFKKIIDSKSHSE 354

Query: 339  KAKVIIETLQTLSRSLLVDDRAVTIDADTLVSLFVVVVCHAQVKDLRSHLFYLQEFTKDT 398
            K +++I+ LQ L+    V    + +DADTL++LF++V+C ++V  LR+HL+YLQ F+ D 
Sbjct: 355  KCQILIDALQKLTSYDDVHYEPLMVDADTLMNLFLLVICRSKVPFLRNHLYYLQNFSTDE 414

Query: 399  NLVTFGILAYGMSTLEAVLCY---FESPEKVASLEKYCRANLSHWKSISEGSIDLNADTT 455
            N V FG+L YG+ST EA LCY   F++ EK       C  N      IS  + D +    
Sbjct: 415  NNVKFGLLGYGISTFEATLCYLKDFQAGEKFNKQVLNCIRNKELISKISSEA-DHSTFQV 473

Query: 456  VPLDDLLKIRTSDGQSCLAVCLQHRRTEE-FELIKNTREAWFPLEDLLHDETTDGSNLLI 514
                D  K R   G+S LA+C++H++ E  FE++ N  E  FPLED+L DE  +G+ LL+
Sbjct: 474  KLYKDCFKFRNEMGESILALCIKHKKNETLFEILLNF-EDMFPLEDILDDEDIEGTTLLM 532

Query: 515  HMLESGCDRLAVMLINTLISNCTKDELIAFLNHTNKYQRSCGHYLMHAPQLIDLVGDILN 574
              L+   +  A ++++ L S+C++DELI + N T+  QR   HY+ +   ++  +G   N
Sbjct: 533  KALKVENEVGAKLIVDVLQSSCSEDELIKYFNRTDNNQRIAAHYITNQIDVLKRIGLFFN 592

Query: 575  WEQRDCNGHTPLFAIVRAYDRPDYFDMVSAAYRAAVGQSKVRNSRFRVSNHTDDKGNTLL 634
            W+ +D  G+TPL  I R YD+  Y  M+  A+  A    + RN +    +H D K NTLL
Sbjct: 593  WKIKDDKGYTPLTTICRTYDQECYEQMIETAFFEAQKWYENRNQKLNFKDHNDSKENTLL 652

Query: 635  HVIKSDVSILLADPFIDVNATNAKGLTPLMVYVRYNRIGNVRTILQDQRLIIGKHQSGAY 694
            H++K D+ +LL    I++NA N K +TPLM YV+YNR+ N++ I++D+RLI+GK+Q   +
Sbjct: 653  HILKCDIQVLLKYDNININAHNLKYITPLMTYVKYNRVSNIQEIIRDERLILGKYQKHTF 712

Query: 695  LSCFDYVKNPAVLKELGKYASYLPFEFSINVHSVKREGDEWVLWITV--TGGEKQVPVKV 752
            L C+D+VKN  + ++LG  +         + +S++ E   WVL+ T   T  +  +   V
Sbjct: 713  LDCYDFVKNTIIFEDLGVRSVRNSMFNLFSAYSLRVENSNWVLYFTFKDTNQDSYITKSV 772

Query: 753  FKRSLRFIQAFLTLFSDAHPMTFVPVDELLRELRALSQSRILI-LNKMDTKRFLKRCSVT 811
               SL+ +   +  ++  +P+ F+P  E+L  L  + ++     + K+  + FL   S  
Sbjct: 773  ---SLKILFNIIKKYNKLYPLHFIPHKEVLLRLTGIVKNNPNNGIQKLKNRAFLNLISNY 829

Query: 812  L-SMVSQERLFADAFTDXXXXXXXXXXXXXXXXFTQNMKMMEPEEVRSIQSILKFNLSEI 870
              +++  +    + F +                     K M  +++  I+S ++FN++E+
Sbjct: 830  FGTLIETDDFDTELFKNPESLTKWIKAGKRKHKKENYYKRMTLDDINMIKSFVQFNINEL 889

Query: 871  SXXXXXXXXXXXXXVFEGLKGKDLSEACMTFGAKCKYVTQGKIQS-FDHFLNVQAPNLFD 929
                           F  LK  D++E+   F      + Q  I +       +  P  F 
Sbjct: 890  GKLNRTLAILKKLCTFLALKINDVNESYKLFRNFGALLQQKDISNQMKKIDGLIKPKYFQ 949

Query: 930  --FEGIANNIALCELCSSLLCKHIGQVLNDDIPKWWHTYGELLSLRREYKKSFPDAN-RP 986
              F  + + I+  E+C+  +  +   ++ +DIP+W   +  L +L+++YK+ F D + R 
Sbjct: 950  SIFLILLDQISFLEICTIHMSDNFNDLIKNDIPEWHSVHFILSNLKKQYKRDFSDFDSRN 1009

Query: 987  HVSENSGLFGSYIETKRTKLEQSYAARINHTSVRLSEISTKINQDNERLAVELNNFINFK 1046
             ++EN  +   Y + KR   E+  +  I   +    +++  I   +E LA E N F+ FK
Sbjct: 1010 GLNEN--ILSRYTKNKREAAEKRISEEIIENTTLFDKVTAHIWYAHENLAEEFNKFLTFK 1067

Query: 1047 NEFLKSAI 1054
            + F K  I
Sbjct: 1068 SRFFKDVI 1075

>KNAG0M01160 Chr13 (207940..211335) [3396 bp, 1131 aa] {ON} Anc_6.20
            YML002W
          Length = 1131

 Score =  485 bits (1248), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 358/1147 (31%), Positives = 568/1147 (49%), Gaps = 109/1147 (9%)

Query: 5    LPVLLNPLINAVFNCPTPLNSSLKKVFSAIEKVRFVLIAPPTELLLEYEDLESGLPLQDL 64
            +P LLNPL++AVFNC     S L+KV+S++  + F+L+ PPT  L  Y+D  +  PL +L
Sbjct: 1    MPELLNPLVDAVFNCQDVEASPLRKVYSSLHDIPFILLVPPTFALWYYDDRNTKFPLHEL 60

Query: 65   CYATGFVSDHIVL-------------LDGREGLQEEEYKTLSGKTILLRSQQGIIFTAAA 111
            C++  FVS HI+              L     ++E ++ T +GK I     +  ++T   
Sbjct: 61   CHSPEFVSSHILTRYSGKDNKPIDTDLSRLRAVREAKFCTFNGKIINGLFSKQSLYTTDG 120

Query: 112  FDTRRRCRIQRAELLTNFNEYLKGDTTFPIIHVDFPL--TGRLARRDEWQCF-RVTKNQE 168
            F  R   RI + E L +F  YL+G +TF +I++D PL  T RL + ++  CF  +T N  
Sbjct: 121  FSFRSTRRILKYETLDHFQNYLQGSSTFILIYIDQPLIDTNRLLKCEDLDCFPNLTINT- 179

Query: 169  HTNGPKNSGKLSHGDNNISLEQLLRINPEYGESLNDIVKAQ-----RISLNSSVTGTTHL 223
             T   ++   LS  +          + P+    LN ++ AQ     R    +     T  
Sbjct: 180  -TPSTRSLANLSSAE----------VPPQRNPLLNSMIHAQYNWKFRAVFQNYRKEITQS 228

Query: 224  ASHFVQTCKKALDVVRAY--PAFQVLPNLPICVHEYIELNLYDDYWAQLTN-SLRDSEIE 280
             S  +   +K +D +      +F  +P +   + EY+E N+YDD W  L N +  + E E
Sbjct: 229  ESMLIPGFRKTIDKIYDGLDNSFHTIPTIRQLIQEYVEQNVYDDVWQVLINRNNAEGEKE 288

Query: 281  SSSDYS-LLKHISVSQVPSFLYPSNPEKFDLRLITQAEKNVKGAVESFRKIAVTNCHSAK 339
              S+ S + + IS+ Q+ +  Y +   KF L+ I Q EKN+  A +SF  ++VT+ +  K
Sbjct: 289  KQSESSDIFRFISLDQLDTDFYKAKFSKFYLKDIVQLEKNISKATKSFENLSVTHTYVEK 348

Query: 340  AKVIIETLQTLSRSL-LVDDRAVTIDADTLVSLFVVVVCHAQVKDLRSHLFYLQEFTKDT 398
             +V++ETLQ LS+ +  V    V I ADTLVSLF++++   ++K++R HL+YLQ F +D 
Sbjct: 349  CRVLVETLQILSKPVKRVGGYQVPITADTLVSLFILLIKRTKMKNIRCHLYYLQNFHQDE 408

Query: 399  NLVTFGILAYGMSTLEAVLCYFES----PEKVASLEKYCRANLSHW-------KSISEGS 447
            N + FG+L Y +STLEAV+CY E+     E++  +EK   ANL  +       K +S   
Sbjct: 409  NSIKFGLLGYAISTLEAVICYLETIETDKERLDCIEKN-DANLEEFLTLLTRSKCVSNEG 467

Query: 448  IDLNADTTVPLDDLLKIRTSDGQSCLAVCLQHRRTEEF-ELIKNTREAWFPLEDLLHDET 506
            +DL+           + R  DG S L++C+ + + + F EL+    E++F  EDLL D+T
Sbjct: 468  LDLSK-----YSHNFRYRNGDGNSTLSLCIINFKNDIFFELLSENYESYFAFEDLLEDQT 522

Query: 507  TDGSNLLIHMLESGCDRLAVMLINTLISNCTKDELIAFLNHTNKYQRSCGHYLMHAPQLI 566
            T+G+ LL+  L+     +   L + ++ N T++EL  +    +KY+R+ GHY+     L+
Sbjct: 523  TEGTTLLMQSLQHSNHEITEYLTDIMLKNSTEEELYYYCGKRDKYKRNIGHYICGQQTLL 582

Query: 567  DLVGDILNWEQRDCNGHTPLFAIVRAYDRPDYFDMVSAAYRAAV-GQSKVRNSRFRVSNH 625
              +G  + W+ +DC G TPL  I R+YD+  Y  MV  ++  AV   S V+NS+F   +H
Sbjct: 583  QKIGKYIKWDSKDCTGQTPLCVIFRSYDQAFYDVMVETSFAIAVEWYSTVKNSKFCFRDH 642

Query: 626  TDDKGNTLLHVIKSDVSILLADPFIDVNATNAKGLTPLMVYVRYNRIGNVRTILQDQRLI 685
            TD KGNTLLH+IK ++S LL  P +D+N  N++GL+PL     Y+R  NV  +L+D RLI
Sbjct: 643  TDSKGNTLLHIIKCNISFLLQSPDVDINKVNSQGLSPLTNNAMYDRGENVEALLKDPRLI 702

Query: 686  IGKHQSGAYLSCFDYVKNPAVLKELGKYASYL-----PFEFSINVHSVKREGDEWVLWIT 740
                      S FD++K     K     + Y      PF   I  H   R  ++  + +T
Sbjct: 703  ---------FSSFDFLKQYPNTKSAPILSHYCLDNEAPFRNIIASHFDFRISNKRSVVLT 753

Query: 741  VTGGE-KQVPVKVFKRSLRFIQAFLTLFSDAHPMTFVPVDELLRELRALSQ---SRILIL 796
                E  Q  +      L+ ++A   L    HP TF P++ELL EL  + +   SR L+ 
Sbjct: 754  SRSKEDAQELIGSEAFELKNLKALFRLLLKQHPFTFFPLEELLDELSVVEKTASSRSLMK 813

Query: 797  NKMDTKRFLKRCSVTLSMVSQE-----RLFADAFTDXXXXXXXXXXXXXXXXFTQNMKMM 851
            +   +K   K      SMV  E      L + A  +                     K M
Sbjct: 814  SSFCSKVLKKLTYCLDSMVEMELLPTAALQSVALLERHIAKEKVTVDEEKLKRRSKDKKM 873

Query: 852  EPEEVRSIQSILKFNLSEISXXXXXXXXXXXXXVFEGLKGKDLSEA---CMTFGAKCKYV 908
            +PE + +I + LK+ L  +              +   LK KD+SE+     T GA+    
Sbjct: 874  QPESIGTITTFLKYILESLLKLKGTIIELRKFSILSKLKSKDISESKNIVCTLGAEVSSK 933

Query: 909  TQGKI----QSFDH-FLNVQAPNLFDFEGIANNIALCELCSSLLCKHIGQVLNDDIPKWW 963
              G+      + D+ FL  Q+ +L  F+     I   E C S +   I  +L+  IP+WW
Sbjct: 934  KIGRAMVRYSTIDNKFLGEQSFDLLVFQ-----IHFFESCLSSIINSIDHLLHLKIPEWW 988

Query: 964  HTYGELLSLRRE----YKKSFPDANRPHVSEN-----------SGLFGSYIETKRTKLEQ 1008
              YG+LL L +E      +       P+ S N            G+ G++IE KR K ++
Sbjct: 989  KCYGQLLELSKEDPSVLARESDHKQTPNASNNVGTSTTDHTSGMGVLGTFIEGKRIKNQE 1048

Query: 1009 SYAARINHTSVRLSEISTKINQDNERLAVELNNFINFKNEFLKSAIKEH-ADTNIKRLRE 1067
               A I+    RL  +  +I+ +N  + +E   FINF+++F+ SA+ E     NI  L++
Sbjct: 1049 RTRAAISDLQRRLKLLDNEIDTNNTLVVIEYCIFINFQSKFIHSAMLEKWVKLNINLLKK 1108

Query: 1068 QLVCSEE 1074
             L+ S+E
Sbjct: 1109 SLLDSKE 1115

>NCAS0H00820 Chr8 (148184..151624) [3441 bp, 1146 aa] {ON} Anc_6.20
            YML002W
          Length = 1146

 Score =  462 bits (1188), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 322/1122 (28%), Positives = 549/1122 (48%), Gaps = 107/1122 (9%)

Query: 15   AVFNCPTPLNSSLKKVFSAIEKVRFVLIAPPTELLLEYEDLESGLPLQDLCY-ATGFVSD 73
            ++FNCP P NS LKK++++++   F+L+ PPTE LL Y D ++ + L+DLCY    F+  
Sbjct: 16   SIFNCPNPSNSPLKKLYASLKDKSFILLVPPTETLLNYTDTKTKIQLEDLCYHNVDFIGA 75

Query: 74   HIVL-------------LDGREGLQE-EEYKTLSGKTILLRSQQGIIFTAAAFDTRRRCR 119
            HI+L              DG   L   E++ TL+G  IL++ +   +   +    R++ +
Sbjct: 76   HILLPPKDSISSSSSTIDDGYTRLASIEQFDTLNGDNILVKWRNNFLVLLSGSPNRQKIK 135

Query: 120  IQRAELLTNFNEYLKGDTTFPIIHVDFPLTGRLAR-RDEWQCFRVTKNQEHTNGPKNSGK 178
            I+R ++L NFN+YL+G T F ++H+D PL   + R  DE +CF       H N   +S  
Sbjct: 136  IERIQVLPNFNDYLQGSTYFILVHIDKPLMKDVIRLNDELECFDTL--TLHDNDGDSSPD 193

Query: 179  LSHGDNNIS------LEQLLRINPEYGESLNDIVKAQRISLNSSVTGTTHLASHFVQTCK 232
                  ++S       E ++  N  + +   D +   +     S T      + F Q   
Sbjct: 194  ARPLIQDMSQHERSQFENIINTNDTWNKRFKDWMNEYK----DSTTAEEPNETLFKQIVA 249

Query: 233  KALDVVRAYPAFQVLPNLPICVHEYIELNLYDDYWAQLTNSLRDSEIESSSDYSLLKHIS 292
             A + +++   F+   +L   +HEY+E+NLYD  W Q+T       ++  +  + +K+IS
Sbjct: 250  VAYNELKSNKIFKGFGHLRRLIHEYLEINLYDHLWLQITTL---CALDDETKGTRIKNIS 306

Query: 293  VSQVPSFLYPSNPEKFDLRLITQAEKNVKGAVESFRKIAVTNCHSAKAKVIIETLQTLSR 352
            + ++    Y    E F L  IT+ EKN+  +  S  K+   N  + K++ +I TLQ L+ 
Sbjct: 307  IEEIDDKFY----EMFPLDFITKLEKNMVRSTNSINKLNGKNSFNEKSENLIATLQILTN 362

Query: 353  SLLVDDRAVT-------------IDADTLVSLFVVVVCHAQVK--DLRSHLFYLQEFTKD 397
                 D  +              IDADTL++L ++++C +++   DL+ ++FYL++F  D
Sbjct: 363  M----DNPIGELNQENEKGANNLIDADTLINLLILIICRSEINIVDLKRNIFYLKKFNYD 418

Query: 398  TNLVTFGILAYGMSTLEAVLCYFESPEKVASLEKYCRANLSHWKSISEGSIDLNADTTVP 457
             NL+ FGIL+Y +ST E V+  FE+  +   L+ Y          I E  I ++    VP
Sbjct: 419  ENLINFGILSYTISTFEIVIYSFENIVEYDKLKSYSE--------IIEKLIKVDDLKKVP 470

Query: 458  ----LDDLLKIRTSDGQSCLAVCLQHRRTEEFELIKNTREAWFPLEDLLHDETTDGSNLL 513
                 +  L  R+  G+S L  C+ + +TE+F  +    E  F ++++L D   +G+ LL
Sbjct: 471  KTIKWEQFLTFRSDTGESILFSCITNNQTEKFLDLLVDYEEIFSMDNILDDANVEGTTLL 530

Query: 514  IHMLESGCDRLAVMLINTLISNCTKDELIAFLNHTNKYQRSCGHYLMHAPQLIDLVGDIL 573
            +  L     +++++LIN L+ NC+  +++ ++N  +K+ R+ GHYL++  +++ ++G  +
Sbjct: 531  MQALIYRNFKISMVLINLLLRNCSNKQIMEYINKIDKFNRNVGHYLINELEILKIIGKYV 590

Query: 574  NWEQRDCNGHTPLFAIVRAYDRPDYFDMVSAAYRAAVGQSKVRNSRFRVSNHTDDKGNTL 633
            NW+QRD  G TPLF I R YD+P+Y +++S  +   +        +F++S+H D K N++
Sbjct: 591  NWKQRDLVGRTPLFTIFRGYDQPNYDEVISTVFDITLNWYAENGLKFQMSDHYDLKDNSI 650

Query: 634  LHVIKSDVSILLA----DPF-IDVNATNAKGLTPLMVYVRYNRIGNVRTILQDQRLIIGK 688
            LH+++S++ IL      + F ID+N  N KG TPLM+YV+Y+R+ NV+ IL D RL+  +
Sbjct: 651  LHILRSNIDILFTYSKRNHFEIDINKRNYKGFTPLMIYVKYHRLSNVKLILGDDRLLFNR 710

Query: 689  HQSGAYLSCFDYVKNPAVLKELGKYASYLPFEFS-INVHSVK-REGDEWVLWITVTGGEK 746
            +Q   Y +CFDY  +  +  ELGK+A      F  I +HS+K R        +T    +K
Sbjct: 711  YQRELYTTCFDYATDSTISNELGKHALQNNTVFGRIYIHSLKVRSSTNATFSLTFPLPDK 770

Query: 747  QVPVKVFKRSLRFIQAFLTLFSDAHPMTFVPVDELLRELRALSQS--------RILILNK 798
            +         ++ I + L +      ++ +P+D +++ L  L+          +I +L  
Sbjct: 771  ENETGTVNIKVKAIISLLKVIRKKSQISLLPLDRIIKVLVKLTSKENNKIIVRKIEMLRN 830

Query: 799  MDTKRFLKRCSVTLSMVSQERLFADAFTDXXXXXXXXXXXXXXXXFTQN-----MKMMEP 853
                R L  C  TL        +    TD                   N      K ++P
Sbjct: 831  QSLLRRLTDCLDTLLFFDIGIDYLSLITDETKLLGWVTNENTKLKHNVNKTHGEKKSLKP 890

Query: 854  EEVRSIQSILKFNLSEISXXXXXXXXXXXXXVFEGLKGKDLSEACMTF-----GAKCKYV 908
            E++  IQS LKFN+ E+               F  LK  D+ E+ + F       K   +
Sbjct: 891  EDINIIQSFLKFNVKELYNVLLNVKTLEKLLNFIHLKSIDVKESRLAFVHLVKSIKNDQI 950

Query: 909  TQGKIQSFDHFLNVQA--PNLFDFEGIANNIALCELCSSLLCKHIGQVLNDDIPKWWHTY 966
             Q   +S +  + +Q+     ++   I + +   + C+ +L  +I  +L   IP WW  Y
Sbjct: 951  AQATNRSLEPIIEMQSLENQYYNNTLIRDELDFLKACTLILTGNIEDILRTQIPNWWKLY 1010

Query: 967  GELLSLRREYKKSFPD--------ANRPHVSE------NSGLFGSYIETKRTKLEQSYAA 1012
            GELL L + Y K FP          +  H +E      N G+FG  IE +R K  +    
Sbjct: 1011 GELLELNKHYNKLFPPNHYNNTLATDNQHSAEVSNDVNNGGVFGGLIENQRNKAVKKLKT 1070

Query: 1013 RINHTSVRLSEISTKINQDNERLAVELNNFINFKNEFLKSAI 1054
             I+     L  +  +I + +E LA ELN ++ FK  F K AI
Sbjct: 1071 DIDQLKYSLEILGNEIFRKHEMLAEELNKYMEFKGVFFKKAI 1112

>CAGL0L07634g Chr12 complement(840409..843801) [3393 bp, 1130 aa] {ON}
            some similarities with uniprot|Q04257 Saccharomyces
            cerevisiae YML002w and some similarities with
            uniprot|Q04257 Saccharomyces cerevisiae YML003w
          Length = 1130

 Score =  453 bits (1166), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 335/1097 (30%), Positives = 530/1097 (48%), Gaps = 83/1097 (7%)

Query: 15   AVFNCPTPLNSSLKKVFSAI-EKVRFVLIAPPTELLLEYEDLESGLPLQDLCYATGFVSD 73
            A+ NC  P +S LKK+++ + +K +++++ PPTELLL Y D ES   L DLCY   F S 
Sbjct: 19   AICNCGEPNSSPLKKLYTQLGKKDKYLILVPPTELLLYYSDKESNSELHDLCYTPNFASA 78

Query: 74   HIVLLD--------GREGLQ----EEEY-----KTLSGKTILLRSQQGII--FTAAAFDT 114
            HI+LLD        G E +     E+ Y     K +      +  +  +I  F       
Sbjct: 79   HILLLDATDTEVNNGDEAVLIKNIEKRYDVHFIKAMDQSWKFINWKNRVIYEFNKLGDQI 138

Query: 115  RRRCRIQRAELLTNFNEYLKG-DTTFPIIHVD-FPLTGRLA----------RRDEWQCFR 162
            + R +I   E +  FN Y+K  D T  I+++D   L G L           R    +   
Sbjct: 139  KNRAKILDIESIPIFNNYMKTTDNTITIMYIDDVFLNGTLECNLRSDIDLLRSPSMRSIP 198

Query: 163  VTKNQEHTNGPKNSGKLSHGDNNISLEQLLRINPEYGESLNDIVKAQRISLNSSVTGTTH 222
              K     N  K S    +  +  + + +LR+N  +        +  R+  N        
Sbjct: 199  TAKRPSLIN--KKSTDYENSKSKATFDSILRVNKHWSSKFEQHFQKFRLLANQDDLPI-- 254

Query: 223  LASHFVQTCKKALDVVRAYPAFQVLPNLPICVHEYIELNLYDDYWAQLTNSLRDSEIESS 282
                F    ++  + + +   F+ + +L   ++EY+ELNL+DD W  +    ++ EI   
Sbjct: 255  --DVFHNIIEEMHEEMVSDNLFKNIVDLRNIIYEYVELNLFDDIWKMILRMNKEVEI--- 309

Query: 283  SDYSLLKHISVSQVPSFLYPSNPEKFDLRLITQAEKNVKGAVESFRKIAVTNCHSAKAKV 342
             D +   +IS+ QV S    +   KF L  +  AE+N+K A +S +KI   + + +KA +
Sbjct: 310  -DLNPFGNISIYQVDSEFLSTEYSKFFLENVITAERNIKEASKSLQKIESASNYKSKANI 368

Query: 343  IIETLQTLSRSLLVDDRA------------VTIDADTLVSLFVVVVCHAQVKDLRSHLFY 390
            +I TL+TL+ +   D  +            + IDAD L++LFV+V C AQ+K+L+ HL Y
Sbjct: 369  LILTLRTLTGNKENDGYSSKNDDGNLSFFPLAIDADRLMNLFVLVTCRAQIKNLKCHLSY 428

Query: 391  LQEFTKDTNLVTFGILAYGMSTLEAVLCYFES---PEKVASLEKYCRANLSHWKSISEGS 447
            LQ F  + +   FGIL Y +STLEAV+CYFE     E    L  +C +N    K +S   
Sbjct: 429  LQNFYNNDSDTKFGILGYALSTLEAVVCYFEQLKEKENYRKLIDFCNSNERLVKVLSSTK 488

Query: 448  IDLNADTTVPL------DDLLKIRTSDGQSCLAVCLQHRRTEEFELIKNTREAWFPLEDL 501
                 +T   L      +  L+ R S GQS LA+C+ H R +    I N  E  FP+EDL
Sbjct: 489  ---KYETNAALYFLRKYEGSLRYRDSLGQSLLALCIIHGRNDFLYHILNEYETLFPIEDL 545

Query: 502  LHDETTDGSNLLIHMLESGCDRLAVMLINTLISNCTKDELIAFLNHTNKYQRSCGHYLMH 561
            L DE+ DGS LLI  ++      A +L+N L  NCT+ ELIA++N  +  +R+ GH+L +
Sbjct: 546  LADESIDGSTLLIQAVKHDNQYSASLLLNILKDNCTEIELIAYINRHDINKRTAGHFLTN 605

Query: 562  APQLIDLVGDILNWEQRDCNGHTPLFAIVRAYDRPDYFDMVSAAYRAAVGQSKVRNSRFR 621
              +++ L+G  +NW Q+D  G TPLF I R+YD+ +Y +MVS +   A     +    F 
Sbjct: 606  ELEVLKLMGKYINWVQKDNAGQTPLFTIFRSYDQDNYDEMVSQSMEYATNWYGLNGKNFN 665

Query: 622  VSNHTDDKGNTLLHVIKSDVSILLADPFIDVNATNAKGLTPLMVYVRYNRIGNVRTILQD 681
              +H D KGNTLLH++K ++ ILLAD  I+VNATN  G TPLM  +RY R  N+R +L D
Sbjct: 666  YLDHVDKKGNTLLHILKCNLPILLADKHINVNATNRSGQTPLMTSIRYKRTENIRDLLCD 725

Query: 682  QRLIIGKHQSGAYLSCFDYVKNPAVLKELGKYASYLPFEFSINVHSVKREGDEWVLWITV 741
             RL +   Q    L+ FD+ K+  +   LG++        ++  H++K     W L +TV
Sbjct: 726  PRLRVDITQKNNALTAFDFSKDDEITHLLGEHELLNSPWLAVYAHTLKYTNSRWNLSLTV 785

Query: 742  TGGEKQVPVKVFKRSLRFIQAFLTLFSDAHPMTFVPVDELLRELRALSQSRILILNKMDT 801
                K  P K    +L+ ++  L +    +   F+PV EL+ +L + ++ R   L ++  
Sbjct: 786  KL--KDAP-KTTNFTLKTLRGILRVVIKNNMTVFLPVQELVEDLISFNRIRFSELMRIKV 842

Query: 802  KRFLKRCSVTLS-MVSQERLFADAFTDXXXXXXXXXXXXXXXXFTQNMKMMEPEEVRSIQ 860
               L   S  LS +V  + L  + F                   T     + PE++  IQ
Sbjct: 843  LEMLPFISFCLSALVHIKVLDLNVFQTEENAIKWVKMNGSVDKKTNQTSDITPEDISMIQ 902

Query: 861  SILKFNLSEISXXXXXXXXXXXXXVFEGLKGKDLSEACMTFGAKCKYVTQGKIQSFDHF- 919
            + LKFN++EI              +F  LK KDL  +   +      ++  + +S   + 
Sbjct: 903  NFLKFNITEIERTKNKLEIAEKLSLFSRLKSKDLLNSNENYVTIVSQLSSKRFRSTLKYS 962

Query: 920  ------LNVQAPNLFDFEGIANNIALCELCSSLLCKHIGQVLNDDIPKWWHTYGELLSLR 973
                  L+V+A      + + + I   ++C+  L  HI  +    I  WWH YGELL+  
Sbjct: 963  AEDTKLLSVRAE-----KALLSKITYLKICAQKLHNHILSITTTMISNWWHIYGELLNAH 1017

Query: 974  REYKKSFPD-ANRPHVSENSGLFGSYIETKRTKLEQSYAARINHTSVRLSEISTKINQDN 1032
            + Y ++FP+ AN    + +  L       KR KLE+  + +I   + +L+ +   I Q +
Sbjct: 1018 KHYTRAFPELANVTTENRDLALHRMISNPKRIKLEERLSEKIKDITEQLNSVGHDIKQMH 1077

Query: 1033 ERLAVELNNFINFKNEF 1049
            E  A E++ FI+ K +F
Sbjct: 1078 ELAAEEVSRFIDLKTKF 1094

>YML002W Chr13 (264541..266754) [2214 bp, 737 aa] {ON} Putative
            protein of unknown function; expression induced by heat
            and by calcium shortage
          Length = 737

 Score =  426 bits (1095), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 251/724 (34%), Positives = 394/724 (54%), Gaps = 20/724 (2%)

Query: 361  VTIDADTLVSLFVVVVCHAQVKDLRSHLFYLQEFTKDTNLVTFGILAYGMSTLEAVLCYF 420
            +T+DADTL+SLFV+VVC ++ K L+SHL+YLQ F+ +++   FGIL Y +STLEAV+CYF
Sbjct: 15   MTMDADTLISLFVLVVCRSEQKHLKSHLYYLQNFSNNSSSTKFGILGYAVSTLEAVVCYF 74

Query: 421  ESPEK----VASLEKYCRANLSHWKSISEGSIDLNADTTVPLDDLLKIRTSDGQSCLAVC 476
            E   K    VA     C    +    +S  +     +      D+L  R   GQS L++C
Sbjct: 75   EDFNKNTGNVAKANTLCEKTKNLLDKLSCENPTNEVEDLATYKDILTYRNEQGQSILSIC 134

Query: 477  LQHRRTEEFELIKNTREAWFPLEDLLHDETTDGSNLLIHMLESGCDRLAVMLINTLISNC 536
            + + +      I +  E  FP+EDLL DET DGS LLI  +++G    A +LI  ++ NC
Sbjct: 135  ITNHKNYILLDILSEYENDFPVEDLLEDETIDGSTLLIESIKAGNLEAAKVLIKIMLFNC 194

Query: 537  TKDELIAFLNHTNKYQRSCGHYLMHAPQLIDLVGDILNWEQRDCNGHTPLFAIVRAYDRP 596
            T++EL++++N T+KY R+  HYL H   ++  +G+ ++W++++ +G TPLF+I R+YD+P
Sbjct: 195  TEEELVSYINKTDKYARTVAHYLTHEMDILKSIGNYIDWKRKNSSGQTPLFSIFRSYDQP 254

Query: 597  DYFDMVSAAYRAAVGQSKVRNSRFRVSNHTDDKGNTLLHVIKSDVSILLADPFIDVNATN 656
            +Y +MV  A+  A    +  NS F   +HTD+KGN+LLHV+K+++ ILL    +D+N  N
Sbjct: 255  NYEEMVKTAFDIANTWYRKHNSLFDYLDHTDNKGNSLLHVLKTNIPILLQLTKLDINEEN 314

Query: 657  AKGLTPLMVYVRYNRIGNVRTILQDQRLIIGKHQSGAYLSCFDYVKNPAVLKELGKYASY 716
             KGLTPLMVYV+Y R+ N+  I +D+RLI+ K Q+  + +CFDY K+ +VL ++G+    
Sbjct: 315  YKGLTPLMVYVKYKRLSNIDAITKDRRLILEKVQNSTFFTCFDYAKDHSVLSKIGERGVK 374

Query: 717  LPFEFSINVHSVKREGDEWVLWIT-VTGGEKQVPVKVFKRSLRFIQAFLTLFSDAHPMTF 775
                  I  HS++         IT V+  EK     V   +++ IQ  L      +P TF
Sbjct: 375  DSLFGLIYFHSLRYHNLNATTNITSVSNAEKPFATTVI--NMKTIQGLLRSILKDNPFTF 432

Query: 776  VPVDELLRELRALSQSRILILNKMDTKRFLKR---CSVTLSMVSQ--ERLFADAFTDXXX 830
            +P++  + E+  L++S + I+ K D    L +   C   L  + +  E LF D  +    
Sbjct: 433  LPLNTYIDEISHLNRSDLTIIGKTDVTSLLHQLTNCFNVLLFLKKIPENLFTDEASILYW 492

Query: 831  XXXXXXXXXXXXXFTQNMKMMEPEEVRSIQSILKFNLSEISXXXXXXXXXXXXXVFEGLK 890
                           +N K MEPEE+  IQS L+FN  EIS             +F  LK
Sbjct: 493  MRINTSKRNQKPSGKENPKTMEPEEINMIQSFLRFNFDEISSFKASLNILRKVLIFINLK 552

Query: 891  GKDLSEACMTFGAKCKYVTQGKIQSFDHFLNVQAPNLF---DFEGIANNIALCELCSSLL 947
              D  +A        + +   +  S    + +   N+F       +  N+   E C+  L
Sbjct: 553  SDDFEDAYKGLNEMGRKLINSEASSAFKGI-ITNHNMFSELSLAALLENVRFLEQCTIQL 611

Query: 948  CKHIGQVLNDDIPKWWHTYGELLSLRREYKKSFPDANRPHVSENS---GLFGSYIETKRT 1004
               +  +L + IP WW  YGE L+L + Y+K+FP+  +P  + ++      G +IETKR 
Sbjct: 612  SSFVQIILFEKIPNWWKHYGEFLALHKSYRKAFPNMVKPKSASDTSSRAPLGGFIETKRE 671

Query: 1005 KLEQSYAARINHTSVRLSEISTKINQDNERLAVELNNFINFKNEFL-KSAIKEHADTNIK 1063
            + EQ  A +I  +S  L E+ ++I   +ERLA EL+N++ F+   L + ++   A TNI 
Sbjct: 672  QSEQRLAVQIKASSKMLKELGSEIFVAHERLAEELSNYMEFRKACLDQRSLVAFATTNIS 731

Query: 1064 RLRE 1067
             L+E
Sbjct: 732  VLQE 735

>TPHA0J00330 Chr10 (72684..76007) [3324 bp, 1107 aa] {ON} Anc_6.20
            YML002W
          Length = 1107

 Score =  431 bits (1107), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 324/1112 (29%), Positives = 538/1112 (48%), Gaps = 63/1112 (5%)

Query: 1    MPYYLPVLLNPLINAVFNCPTPLNSSLKKVFSAIEKVRFVLIAPPTELLLEYEDLESGLP 60
            M Y++PVL NPLINAVFNCP P  S  KK+++ +    F+L+ P   +LL Y+D  S + 
Sbjct: 1    MAYFMPVLKNPLINAVFNCPDPHASPFKKLYNELRDKDFLLLVPNDFILLYYKDSTSNIS 60

Query: 61   LQDLCYATGFVSDHIVLLDGREGLQE---------EEY-KTLSGKTILLRSQQGIIFTAA 110
             ++LCY   FV+ HI++LD      +         + Y K+L+GK +LLR  Q +     
Sbjct: 61   FRELCYTYDFVAAHILILDKNSSTDKISSSNQKNGDVYLKSLNGKEVLLR--QSLCIPIK 118

Query: 111  AFDTRRRCRIQRAELLTNFNEYLKGDTTFPIIHVDFPL-TGRLARRDEWQCFRVTKNQE- 168
             + ++R+ +++ A LLTNFN+YL G   F I+H+D+PL        DE + F  ++    
Sbjct: 119  GYFSKRKSQMRDATLLTNFNDYLHGSGHFGIMHIDYPLGVSDWTLIDELKGFEESRELPF 178

Query: 169  HTNGPKNSGKLSHGDNN----ISLEQLLRINPEYGESLNDIVKAQRISLNSSVTGTTHLA 224
            H+      G L   + N    +   QL +   ++   L   +K  +     ++    ++ 
Sbjct: 179  HSQDKDKPGLLQRTEENKADRVKFIQLFQERKDWTIELEKYLKKYQ-----AMEPLQNIG 233

Query: 225  SH-FVQTCKKALDVVRAYPAFQVLPNLPICVHEYIELNLYDDYWAQLTNSLRDSEIESSS 283
            S  F        + ++    FQ   NL    +EYIE  LY D W +L    RD  +    
Sbjct: 234  SELFHDIVNMIYNTLKEEQRFQRFTNLYDIAYEYIESLLYQDIWNKLQEHYRDKIL---- 289

Query: 284  DYSLLKHISVSQVPSFLYPSNPEKFDLRLITQAEKNVKGAVESFRKIAVTNCHSAKAKVI 343
            D+ L+  +S+  + +  Y    + F L  I   E  +  AV  F+ I   N +S K  VI
Sbjct: 290  DFRLVSQLSLDMLDTTFYNRTFKNFQLIDIVNMEACMVQAVSVFKGIKSANSYSKKVDVI 349

Query: 344  IETLQTL----SRSLLVDD---RAVTIDADTLVSLFVVVVCHAQVKDLRSHLFYLQEFTK 396
             +TL  +    S   + D+   +   IDADTLVSLF +++C A V+D+  H+ YLQ F K
Sbjct: 350  FKTLNIITGKNSDDTIRDNTLPKLPLIDADTLVSLFALLLCRAGVEDVFLHVQYLQSFYK 409

Query: 397  DTNLVTFGILAYGMSTLEAVLCYFESPEKVASLEKYCRANLSHWKSISEGSIDLNA--DT 454
            D N V FG L Y +ST+EA L YF       S     R  L     + +  I + +  D 
Sbjct: 410  DENTVKFGALGYTLSTIEATLSYFYE----LSNSDESRIQLQKLSLLEDFLIKIRSQHDD 465

Query: 455  TVPLD---DLLKIRTSDGQSCLAVCLQHRRTEEF-ELIKNTREAWFPLEDLLHDETTDGS 510
             +P++   D  + RT  G+S L++ + +++ E   E + N  E  FPL+DLL+D    GS
Sbjct: 466  LIPINQFKDYFRYRTQYGESILSLLIANKKNEALCEALLNF-EDIFPLDDLLYDTDVSGS 524

Query: 511  NLLIHMLESGCDRLAVMLINTLISNCTKDELIAFLNHTNKYQRSCGHYLMHAPQLIDLVG 570
             LLI  L+      A +LI    ++CT  EL+ + N T+K +R+  HY+    ++++ +G
Sbjct: 525  TLLIKCLKERNLEAAEILIEIFQNSCTNSELLNYYNKTDKTKRTLAHYITDEIEILEKIG 584

Query: 571  DILNWEQRDCNGHTPLFAIVRAYDRPDYFDMVSAAYRAAVGQSKVRNSRFRVSNHTDDKG 630
              +NW  +D  G T LF I R+YD+  Y   +  A   A+   K  +  F+VS+HTD  G
Sbjct: 585  KYINWTLKDLKGRTALFTIFRSYDQTTYSSTIKIALDQALLWYKNNDIIFKVSDHTDLFG 644

Query: 631  NTLLHVIKSDVSILLADPFIDVNATNAKGLTPLMVYVRYNRIGNVRTILQDQRLIIGKHQ 690
            ++LLH++KS VS+LL    +D+N  N KG+TPLM YV+YNRI N++TIL+D RLII K Q
Sbjct: 645  DSLLHILKSQVSLLLKFEDLDINIPNLKGMTPLMTYVKYNRIDNIKTILEDGRLIIKKLQ 704

Query: 691  SGAYLSCFDYVKNPAVLKEL-GKYASYLPFEFSINVHSVKREGDEWVLWITVTGGEKQVP 749
               YL+C DY KN  V   L  K +  + FE +  +   + E   W L I+V   + +  
Sbjct: 705  KDKYLNCLDYGKNFTVFNLLAAKLSKDVIFE-NAYISYARYEKSHWYLCISVQKDDLEYT 763

Query: 750  VKVFKRSLRFIQAFLTLFSDAHPMTFVPVDELLRELRALSQSR-ILILNKMDTKRFLKRC 808
              + K  L+     +      +   F+P  ++L  L+ + +   IL + ++  K +L   
Sbjct: 764  TNIIK--LKKYYNLINAMQKIYKSDFIPYSDMLDCLKKIIEGHNILPIRRLKIKNYLNFL 821

Query: 809  SVTLS-MVSQERLFADAFTDXXXXXXXXXXXXXXXXFT----QNMKMMEPEEVRSIQSIL 863
            S  LS ++  E++      D                 +     + K +  E++ +I++  
Sbjct: 822  SHGLSALLYFEKIDPLTLLDENLIIKWISSKLQQQEKSIDDHSSFKPLSAEDINNIKAFC 881

Query: 864  KFNLSEISXXXXXXXXXXXXXVFEGLKGKDLSEACMTFGAKCKYVTQGKIQSFDHFLNVQ 923
             F+  EI              +F  +K  DL+ +         Y +  +I      L   
Sbjct: 882  DFSFQEIGKTNNVIQSFLKLSIFGEIKNTDLNTSYDILERLGSYFSNNEISRTLGDLQSI 941

Query: 924  APNLFD---FEGIANNIALCELCSSLLCKHIGQVLNDDIPKWWHTYGELLSLRREYKKSF 980
            +P++     +  ++ +I   + C+ +L   +   + D +  W     +LL  R+EY   F
Sbjct: 942  SPHVHSSMVYYELSQDILFMKKCTLILTSKLASFIKDKLSIWLKKNTKLLEHRKEYSIKF 1001

Query: 981  PDANRP--HVSENSGLFG-SYIETKRTKLEQSYAARINHTSVRLSEISTKINQDNERLAV 1037
              +N    ++SEN+ +F  ++  T R + E+     +      L ++ T+I   +E LA 
Sbjct: 1002 LQSNEETGNLSENTSVFRYAWNVTYRKEEERRLKFAMLELERDLKKLGTEIRVKHEELAE 1061

Query: 1038 ELNNFINFKNEFLKS-AIKEHADTNIKRLREQ 1068
            E ++++  K++F  +  +++    N+  L+EQ
Sbjct: 1062 EFSDYVRMKSKFNSNLLVRKFVSLNLAHLKEQ 1093

>TBLA0A07260 Chr1 (1807831..1811445) [3615 bp, 1204 aa] {ON} Anc_6.20
            YML002W
          Length = 1204

 Score =  344 bits (882), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 313/1202 (26%), Positives = 555/1202 (46%), Gaps = 160/1202 (13%)

Query: 8    LLNPLINAVFNC--PTPLNSSLKKVFSAIEKVRFVLIAPPTELLLEYEDLES-------- 57
            +LNPLI  +F+      LN  LKK+F  ++ ++FVL+APPT++LL Y D  +        
Sbjct: 5    ILNPLIEVLFHSEGTDTLNGPLKKLFEKLKLLKFVLLAPPTDILLNYLDSSNITPRNPYN 64

Query: 58   ---GLPLQDLCYAT-GFVSDHIVLLDGREGLQEE-EYKTLSGKTILLRSQQG-------- 104
                 PL+DLC  +  F++ HI+L D +    ++   ++++GKTI ++   G        
Sbjct: 65   GSNAKPLEDLCMNSYDFIASHILLYDSKVIKNDQCVMESINGKTITIKRVTGNGALNNGE 124

Query: 105  --IIFTAAAFDT-RRRCRIQRAELLTNFNEYLKGDTTFPIIHVDFPLTGRLARRDEWQCF 161
              +I  +  ++T ++  +I + +L  NFN YL+G   +PI ++D+PL   + + +    F
Sbjct: 125  MLVITPSKNYNTPKKMLKIIKMDLWHNFNSYLQGMENYPIWYIDYPLYPNIIKNEFLTAF 184

Query: 162  --RVTKNQEHTN--GPKNSGKLSHGDNNISLEQLLRINPEYGES----LNDIVKAQRIS- 212
              ++ + +++++   P N  + +  D N  +  + ++ P+  +S       ++K  R+  
Sbjct: 185  DRKLIETEQYSDIAQPVNDLENTTKDQNHKIRNISKLEPDISQSDRGGFTKLIKDDRVIW 244

Query: 213  ---LNSSVTGTTHLASHFVQTCKKALD---------VVRAYPA--FQVLP---------- 248
               +NS    T H+     +   +A+D         +VR      F+ L           
Sbjct: 245  QPLINSYRATTKHIEQ--AEGLPQAIDENQTDVNIEMVRDINCDLFEQLKDEKRYNFLSH 302

Query: 249  -NLPICVHEYIELNLYDDYWAQLTNSLRDSEIESSSDYSLLKHISVSQVPSFLYPSNPEK 307
             NL   ++E+IE+ L+DD W +++    +S+     D+S L +ISV+++    Y +N  K
Sbjct: 303  DNLMELIYEFIEIKLHDDIWGRISFKFTESDF----DFSKLSNISVNKLLLNFYSTNNFK 358

Query: 308  -FDLRLITQAEKNVKGAVESFRKIAVTNCHSAKAKVIIETLQTLSRSLLVDDRAVTIDAD 366
             F L  I   EK +  AV  F+K         K+  +I+TLQ L+ + L D       AD
Sbjct: 359  NFKLHDIVMMEKKISRAVTYFQKFINGITFQEKSTALIKTLQILTINKLTD-------AD 411

Query: 367  TLVSLFVVVVCHAQVKDLRSHLFYLQEFTKDTNLVTFGILAYGMSTLEAVLCYFE--SPE 424
            TL+ L  +V+C  +V++L+SHLFYLQ F  D N + FGIL Y +STLEA+  YF+  S  
Sbjct: 412  TLIGLLSIVICRLKVRNLKSHLFYLQNFAADPNTIKFGILGYSISTLEAITYYFDHISHS 471

Query: 425  KVASLEKYCRANLSHWKSISEGSIDLNADTTVPLDDLLKIRTSDGQSCLAVCLQHRRTEE 484
              A L  +C    + + +I      L+       +D+L  R+ +G+S L++C+ + + + 
Sbjct: 472  HKADLIAFCDKLHNLYDTILNNIKSLD-------NDILSYRSQNGESLLSLCIINNKMDI 524

Query: 485  FELIKNTREAWFPLEDLLHDETTDGSNLLIHMLESGCDRLAVMLINTLISNCTKDELIAF 544
            F  +  T E  FP+ED+L D   +GS+LL+   +      + +L+  L ++C ++EL  F
Sbjct: 525  FLELLTTYEHSFPIEDILDDSDLNGSSLLMQACKYNNYVASEILVTILKNSCNEEELRIF 584

Query: 545  LNHTNKYQRSCGHYLMHAPQLIDLV--GDILNWEQRDCNGHTPLFAIVRAYDRPDYFDMV 602
            LN T+K+ RS  HY      ++ L   G++++WE +D    TPL  I + +        +
Sbjct: 585  LNKTDKFNRSVAHYFNMKNSILILTEFGNLIDWELKDIKKLTPLLTIFKVHKVNYNESFI 644

Query: 603  SAAYRAAVGQSKVRNSRFRVSNHTDDKGNTLLHVIKSDVSILLADP----FIDVNATNAK 658
               +R  +   K+ N  F +  H D  GN LLHV+K  ++ L+ +P     I++NA N K
Sbjct: 645  KILFRVVLTWYKIHNKPFNLKAHVDQNGNNLLHVMKDYINCLIENPELCETININANNNK 704

Query: 659  GLTPLMVYVRYNRIGNVRTILQDQRLIIGKHQ-------SGAYLSCFDYVKNPAVLKELG 711
            GL+P MVY + NR  N+R IL++  LI  + Q       +  Y S  +++     L+ L 
Sbjct: 705  GLSPFMVYFKTNRYDNIRIILKNPTLITSEGQLPFLITSTNLYNSKVNHLLATHFLRTLD 764

Query: 712  -KYASYLPFEFSINVHSVKREGDEWVLWITVTGGEKQVPV------KVFKRSLRFIQAFL 764
              Y       F+    S       W++ I++   E + P       +     L+ I++ L
Sbjct: 765  FAYICLHSLRFNDPSSSTSGTSLAWLVDISILEKESEFPTSHPSICRTKTLKLKTIKSLL 824

Query: 765  TLFSDAHPMTFVPV-------DELLRELRALSQSR-------ILILNKMDTKRFLKRCSV 810
              F   +  + +P+       ++L++   ++S +         L+++K++ +  LK  S 
Sbjct: 825  HHFIRKYKYSSLPLKSALEFCNDLIKSNNSISWTSNRHFLPLSLLIDKLEIQYNLKLISN 884

Query: 811  TLSMVSQ----------ERLFADAFTDXXXXXXXXXXXXXXXXFTQN-------MKMMEP 853
             L+ +            + L   AF                     N        K  +P
Sbjct: 885  CLNFLFITTDFDFTLLFDELKLQAFLKINNKKLKESNSSNKFSHKNNSDQTTELSKAYQP 944

Query: 854  EEVRSIQSILKFNLSEISXXXXXXXXXXXXXVFEGLKGKDLSEACMTFGAKCKYVTQGKI 913
            E++ +IQ+ +KFNL E+              +    K  DL+ +   F      +    +
Sbjct: 945  EDINAIQTFIKFNLGELENFKNTITTIKDVSILIKYKIMDLNSSQFFFQKNTLKIGINNL 1004

Query: 914  QSFDHFLNVQAP--------------NLFDFEGIANNIALCELC--SSLLCK---HIGQV 954
                 + + Q P              N +D++    N  L  L     L+CK       +
Sbjct: 1005 SEILKYYSTQKPLITNAYTSRKFYDYNSYDYKVEFLNKLLENLIFFEKLVCKLYYDFEDL 1064

Query: 955  LNDDIPKWWHTYGELLSLRREYKKSFPDANRPHVSENSGLFGSYIETKR-----TKLEQS 1009
             N  I  WW+ YG LL    +Y K +P+  +  ++ N   F +  + +      T  E++
Sbjct: 1065 SNGTIKTWWYHYGRLLDYEAQYNKHYPNR-KIDINNNFESFNTMFDKRVNFDSITHFERN 1123

Query: 1010 YAARINHTSVRLSEISTKINQDNERLAVELNNFINFKNEFLKSAIKEHADTN-IKRLREQ 1068
                I +TS  L   + KI   +E LA+ELNNF+NFKN+F++  I + +    IK L++ 
Sbjct: 1124 IILNIKNTSTLLRRFNNKIKFLHENLAIELNNFMNFKNKFIREYIIKFSTIEVIKILKDN 1183

Query: 1069 LV 1070
            ++
Sbjct: 1184 II 1185

>NDAI0D00800 Chr4 (177862..181443) [3582 bp, 1193 aa] {ON} Anc_6.20
           YML002W
          Length = 1193

 Score =  330 bits (846), Expect = 5e-95,   Method: Compositional matrix adjust.
 Identities = 238/867 (27%), Positives = 434/867 (50%), Gaps = 89/867 (10%)

Query: 15  AVFNCPTPLNSSLKKVFSAIEKVRFVLIAPPTELLLEYEDLESGLPLQDLCY-ATGFVSD 73
           AVFNCP P +S  KK+F+ ++  +F+L+ PPT  LL Y D    L L +LCY  + F+  
Sbjct: 16  AVFNCPDPSHSPFKKLFTTLKNQQFILLVPPTSTLLNYTDSYYKLSLNELCYHNSDFLGS 75

Query: 74  HIVLL--------DGREGLQEEEYKTLSGKTILLRSQQGIIFTAAAFDTRRRCRIQRAEL 125
           HI+          D      +EE+  L+G   +++ +  IIFT   F   +R +I +   
Sbjct: 76  HILTWSNAIDSNKDSTTTNDDEEFDNLNGNKFIIKWKHNIIFTRGNFSNDQRFKILKIHP 135

Query: 126 LTNFNEYLKGDTTFPIIHVDFPLT-GRLARRDEWQCF----RVTKNQE-HTNGPKNSGKL 179
           LTNFN+Y  G   F +I +D P+T   L   D  +C     R  K+QE  T   ++  + 
Sbjct: 136 LTNFNDYFHGSKEFFLIFIDKPITVSSLIANDSLKCLLPNTRDLKSQEKETPLVQDLSQQ 195

Query: 180 SHGDNNISLEQLLRINPEYGESLNDIVKAQRISLNSSVTGTTHLASHFVQTCKKALDVVR 239
           S      S E  L  N  +      +    +I  +S +     L    V      +D  +
Sbjct: 196 SKS----SFENDLNKNEAWNLKFGILSNNYKIE-SSELEPNHKLFRELVNEAFIEIDSKK 250

Query: 240 AYPAFQVLPN--LPICVHEYIELNLYDDYWAQLTNSLRDSEIESSSDYS---LLKHISVS 294
            +   +   +  L    H+Y+E +LYD+ W+++   + +S    + D     L+KH S+ 
Sbjct: 251 FFQKKKNFTSDQLFQLTHDYMERHLYDEIWSRIWKMMMNSVKNYADDQKAQHLIKHFSIV 310

Query: 295 QVPSFLYPSNPEKFDLRLITQAEKNVKGAVESFRKIAVTNCHSAKAKVIIETLQTLSRSL 354
           ++    Y    + F L+ +   EKN+K +V    K+  T  ++ K+ ++IE+LQ ++ S 
Sbjct: 311 EIDPNFY----DIFPLKFVPMLEKNLKHSVTCINKLKSTKSYTEKSTILIESLQIITDSN 366

Query: 355 LVDDRA-------VTIDADTLVSLFVVVVCHAQV--KDLRSHLFYLQEFTKDTNLVTFGI 405
              + +         IDAD L++L  +V+  + +   DL+++L+YL+ F+ D +  +FGI
Sbjct: 367 TGGEESKDKNKSGYLIDADNLLNLLTLVILQSNITLHDLKANLYYLKYFSTDESSSSFGI 426

Query: 406 LAYGMSTLEAVLCYFESPEKVASLEKYCRANLSHWKSISEGS---------IDLNADTTV 456
           L Y ++T   V               +   N+  W  + E S          DL+  ++ 
Sbjct: 427 LNYTIATFHMV--------------SHVLENVIDWDRLKEKSDLIEELIMTDDLSTLSST 472

Query: 457 PLDD---LLKIRTSDGQSCLAVCLQHRRTEEFELIKNTREAWFPLEDLLHDETTDGSNLL 513
             +D   LL  R S+G+S LA+ + +++ ++F       E    ++ + +D++ D S LL
Sbjct: 473 FENDKKTLLMYRNSNGESLLALSIINKQNKKFTQYLIEYEDILNMDIISNDQSMDSSTLL 532

Query: 514 IHMLESGCDRLAVMLINTLISNC-TKDELIAFLNHTNKYQRSCGHYLMHAPQLIDLVGDI 572
           +  + S     A++L+  L  NC  + ELI+++N  + + R+ GHYL+    ++ ++G  
Sbjct: 533 LQAIRSNNFEAAIILVKLLFQNCRNQKELISYINQVDIHNRNIGHYLVINLTILKIIGQF 592

Query: 573 LNWEQRDCNGHTPLFAIVRAYDRPDYFDMVSAAYRAAVGQSKVRNSRFRVSNHTDDKGNT 632
           +NW+Q+D NG TPLF I R+YD+ +Y ++V   ++ A+      N +F++++H D  GN+
Sbjct: 593 INWKQKDVNGRTPLFTIFRSYDQSNYDELVCQVFQIAIKWYAANNLKFQMNDHDDSNGNS 652

Query: 633 LLHVIKSDVSILL-----ADPFIDVNATNAKGLTPLMVYVRYNRIGNVRTILQDQRLIIG 687
           LLH++++++SILL      +  I++N  N KG TPLM+Y +Y R  N+R I+++++LI  
Sbjct: 653 LLHILQNNISILLDYAKDQNIPINLNKMNCKGFTPLMMYFKYKRYDNIRMIIKEEKLIFN 712

Query: 688 KHQSGAYLSCFDYVKNPAVLKELGKY-ASYLPFEFSINVHSVKREGDEWV-----LWITV 741
           K QS  ++ CFDY  + +++ ++G++  S       I V S+K++          L+I  
Sbjct: 713 KFQSPNFIDCFDYSVDSSIMNDIGEFLLSNGQLFGKIIVLSLKKQMSTVPSLPRGLYINY 772

Query: 742 TGGEKQVPVKVFKRSLRF--IQAFLTLFSDAHPMTFVPVDELLRELRALSQSR------- 792
           T    +       ++++F  +  FL +    + ++F+P+D LL E ++    +       
Sbjct: 773 TILIDEADKSTLTKTMKFTSLVKFLKIMKRKYAISFLPLDTLLNESQSFLDKKSKNNNNL 832

Query: 793 ----ILILNKMDTKRFLKRCSVTLSMV 815
               +  + K+  +RFLKR +  L ++
Sbjct: 833 RTIPLRYIEKLRIRRFLKRLNTCLDVL 859

 Score = 82.4 bits (202), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 68/260 (26%), Positives = 113/260 (43%), Gaps = 44/260 (16%)

Query: 856  VRSIQSILKFNLSEISXXXXXXXXXXXXXVFEGLKGKDLSEACMTFGAKCKYVTQGKIQS 915
            +  IQ+ LKFNL+E++             +F  LK  D+ +A + F    K +   ++ S
Sbjct: 919  INIIQNFLKFNLNELNTISMNLKVLSKLVIFMNLKTLDIHDAQIRFNGLVKGLNNKEVPS 978

Query: 916  F-DHFLNVQAPNLFD------FEGIANNIALCELCSSLLCKHIGQVLNDDIPKWWHTYGE 968
              +   NV   + +D       E +  +I+    C+  L   +  ++   IP WW  YGE
Sbjct: 979  IIEKSFNVIDSSRYDDDKGVLLESLHEDISFFNECTLKLIHDVENIIKIKIPNWWKLYGE 1038

Query: 969  LLSLRREYKKSFPD----ANRP---------------------------HVSE-----NS 992
            LL L + Y K+FP+    A R                            H SE     N+
Sbjct: 1039 LLELNKYYHKNFPNCVVHARRTDLLSGNNANTNTNTNTNTNTNSPQRLHHHSEHQNNSNN 1098

Query: 993  GLFGSYIETKRTKLEQSYAARINHTSVRLSEISTKINQDNERLAVELNNFINFKNEFL-K 1051
            G+F + IE ++ KLE+  +  I+ T   L  + + +   +E LA ELN ++ FKN F  +
Sbjct: 1099 GVFANLIENQKNKLERKTSHHIDETISLLESLGSGLLNKHEHLAEELNRYMEFKNRFFGR 1158

Query: 1052 SAIKEHADTNIKRLREQLVC 1071
            + +K     +IK L E ++ 
Sbjct: 1159 NIMKNFVGEDIKLLEEHVLV 1178

>YML003W Chr13 (263483..264355) [873 bp, 290 aa] {OFF} Putative
           protein of unknown function
          Length = 290

 Score =  186 bits (473), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 101/289 (34%), Positives = 157/289 (54%), Gaps = 19/289 (6%)

Query: 3   YYLPVLLNPLINAVFNCPTPLNSSLKKVFSAIEKVRFVLIAPPTELLLEYEDLESGLPLQ 62
           Y+LP LLNPL+NA+FNCP P  S LKK+F+ ++  RF+L+APP+E LL Y D++S LPL 
Sbjct: 4   YHLPTLLNPLVNAIFNCPEPERSPLKKLFANLKTRRFILLAPPSEYLLNYHDVKSKLPLH 63

Query: 63  DLCYATGFVSDHIVLLDGREGL----QEEEYKTLSGKTILLRSQQGIIFTAAAFDTRRRC 118
           DLCY   F++ +I+L+     +    ++  Y+TL GKT++++ +  +I     F  RRR 
Sbjct: 64  DLCYNAEFINSYILLMTENSYINTNSRDSHYETLDGKTVVIQWKNNVIHALNGFHIRRRL 123

Query: 119 RIQRAELLTNFNEYLKGDTTFPIIHVDFPLTGRLARRDEWQCFRVTKNQEHTNGPKNSGK 178
           +I   ++L NFN+Y +G   F I+ +D PL       D  QCF       +   PKN+  
Sbjct: 124 KILETKILPNFNDYFEGAADFIILFIDQPLNCEFVPNDYLQCF-----HNYEKIPKNAHA 178

Query: 179 L------SHGDNNISLEQLLRINPEYGESLNDIVKAQRISLNSSVTGTTHLASHFVQTCK 232
           +      S      S E +L I+P     L  +  + R    +   G     S F    +
Sbjct: 179 MPNLSIDSFQQERSSFENILHIHPARLTQLGQLFSSYR----TLAPGDDPSRSIFESIVQ 234

Query: 233 KALDVVRAYPAFQVLPNLPICVHEYIELNLYDDYWAQLTNSLRDSEIES 281
           +A D +++   F+   NL   +H+Y ELNLYDD W++LT   +  E+++
Sbjct: 235 QAFDGMKSDSLFKNFSNLYDLIHDYFELNLYDDIWSRLTTHFKGHEVDT 283

>KAFR0L00400 Chr12 (72520..75348) [2829 bp, 942 aa] {ON} Anc_6.20
            YML002W
          Length = 942

 Score =  198 bits (504), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 217/827 (26%), Positives = 378/827 (45%), Gaps = 111/827 (13%)

Query: 259  ELNLYDDYWAQLTNSLRDSEIESSSDYSLLKHISVSQVPSFLYPSNP-EKFDLRLITQAE 317
            E  LY   W +L +   + +   + D     +IS  ++    Y S P  KF LR +   E
Sbjct: 179  EARLYSSIWNKLVHQTSEPQ---NIDKFYGCYISFHELNINDYYSLPFNKFSLRDVVFIE 235

Query: 318  KNVKGAVESFRKIAVTNCHSAKAKVIIETLQTLSRSLLVDDRAVTIDADTLVSLFVVVVC 377
              V  A + F K+  +     K  +++ T   L+  L      + IDAD L++  ++++ 
Sbjct: 236  NVVDLACKEFVKLRESLSFDEKIDILLSTFNILTSKL----PQLEIDADNLLNFMLIIIN 291

Query: 378  HAQVKDLRSHLFYLQEFTKDTNLVTFGILAYGMSTLEAVLCYFESPEKVASLEKYCRANL 437
              ++ +L  H  YLQ F    N   FGIL Y +STL AVL Y ++     +L+K+ R   
Sbjct: 292  RVKLNNLNEHFHYLQNFNFKQN-KDFGILNYAISTLGAVLYYIDN-----NLDKFKR--- 342

Query: 438  SHWKSISEGSIDLNADTTVPLDDLLKIRTSDGQSCLAVCLQHRRTEEF-------ELIKN 490
             +  +I +  I          ++ LK R  +G+S L  C+  +  +         E IKN
Sbjct: 343  -YTDAIQDSKIS---------EEKLKYRNENGESYLCHCIITKDNDTLRELLFSSEYIKN 392

Query: 491  TREAWFPLEDLLHDETTDGSNLLIHMLESGCDRLAVMLINTLISNCTKDELIAFLNHTNK 550
                 FP+ED+L D+T DGS LL+  ++      A +LIN +I+N T DE+  ++N  ++
Sbjct: 393  -----FPMEDILDDQTIDGSTLLMVAVKCLNTTAASILINIIINNGTPDEIRTYVNSVDE 447

Query: 551  YQRSCGHYLMHAPQLIDLVGDILNWEQRDC-NGHTPLFAIVRAYDRP--DYFDMVSAAYR 607
              R+ GH++ +   L+  +G  LNW  +D   G TPLF I R+YD+    Y  M   ++R
Sbjct: 448  NNRNVGHFITNQYYLLCKIGPYLNWNCKDKRTGQTPLFNIFRSYDQSIKSYKKMSRRSFR 507

Query: 608  AAVGQSKVRNSRFRVSNHTDDKGNTLLHVIKSDVSILLADPFIDVNATNAKGLTPLMVYV 667
             A+         F++  H D+  NTLLH++K+++ ++L    + +N+ N+ G+TPLMV+ 
Sbjct: 508  FAMDSGD-----FQLKKHIDNSNNTLLHILKTNIQMILPHASLFINSPNSLGMTPLMVFC 562

Query: 668  RYNRIGNVRTILQDQ---RLIIGKHQS--GAYLSCFDYVKNPAVLKELGKYA--SYLPFE 720
            +Y R+ N++ +L  +   R+ I + Q    A+ +CF    +  +L  LGK+A  +Y  F 
Sbjct: 563  KYRRLYNIQILLSSKFKDRVSIFETQQVHNAWSNCFSLTNDDQILNLLGKFAIKNYSIFG 622

Query: 721  FSINVHSVKREGDEWVLWITVTGGEKQVPVKV---FK---RSLRF----IQAF--LTLFS 768
             +   HS+K+      L  +  G + Q  VK+   F+   +++RF    I+A   + L S
Sbjct: 623  -NCFTHSLKQ-----FLHKSKHGNKNQYSVKITLKFEKKYKTIRFNIKTIKALINMVLTS 676

Query: 769  DAHPMTFVPVDELLRELRAL-----SQSRILILNKMDTKRFLKRCSVTLSMVSQERLFAD 823
            ++H  +F+P+ ++  EL  +     ++S+IL +N ++    +    + L +V +E    +
Sbjct: 677  NSHVSSFLPLYKVFNELNGIASMISTKSKILFINNLNV---ILDTILFLELVPREGFILE 733

Query: 824  AFTDXXXXXXXXXXXXXXXXFTQNMKMMEPEEVRSIQSILKFNLSEISXXXXXXXXXXXX 883
            A                        K ++ E++  I + LKFNL+E++            
Sbjct: 734  A-----RLKDYLRNQRKIKTVATKSKKLQIEDINMISNFLKFNLNELNAFKNGVKKILRQ 788

Query: 884  XVFEGLKGKDLSEACMTFGAKCKYVTQGKIQSFDHFLNVQAPNLFDFEGIANNIALCELC 943
                 LK          F  +  Y+           LN    NL ++  + +N  + E  
Sbjct: 789  MNSINLK---------LFDQRISYMDLLHCPDVVVHLNNPLWNL-NYNILISNFQILENS 838

Query: 944  SSLLCKHIGQVLNDDIPKWWHTYGELLSLRREYKKSFPDANRPHVSENSGLFGSYIETKR 1003
                   +    N+ I KWW    EL++L +    S  D           L  S+   K 
Sbjct: 839  IDNTLHFLKVFQNEKIRKWWKLNNELINLTKLASNSDDD-----------LLRSFFNRK- 886

Query: 1004 TKLEQSYAARINHTSVRLSEISTKINQDNERLAVELNNFINFKNEFL 1050
                +  +  I+     ++E++  I   +E LAVE+NNF+ FK  F+
Sbjct: 887  ----EKLSIEIDDKIRSINELNCDIFVSHELLAVEINNFMKFKPLFI 929

>TBLA0C01300 Chr3 complement(285536..286324) [789 bp, 262 aa] {ON} 
          Length = 262

 Score = 35.8 bits (81), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 35/59 (59%), Gaps = 12/59 (20%)

Query: 241 YPAFQVLPNLPICVHEYIELN--LYDDYWAQLTNSLRDSE--------IESSSDYSLLK 289
           YP FQVLP+   CV+E I++N   ++++  +L N L D E        I++  DY+LL+
Sbjct: 183 YPGFQVLPSF--CVYETIKMNNGTFNNWADKLRNYLDDLETKKRIPYRIQNGGDYNLLE 239

>SAKL0F13244g Chr6 (1046281..1046895) [615 bp, 204 aa] {ON} similar to
            uniprot|P25046 Saccharomyces cerevisiae YBL093C ROX3 RNA
            polymerase II holoenzyme component
          Length = 204

 Score = 33.9 bits (76), Expect = 1.4,   Method: Composition-based stats.
 Identities = 22/78 (28%), Positives = 39/78 (50%), Gaps = 4/78 (5%)

Query: 1001 TKRTKLEQSYAARINHTSVRLSEISTKINQDNERLAVELNNFINFKNEFLKSAIKEHADT 1060
            TK  KL +SY  +IN  S + S I TK N +      E++  I   N  + +++    + 
Sbjct: 55   TKAVKLRKSYKNQINDLSGKFSSIPTKENTNGG----EISRIIFQNNPDMMNSVHNSNNM 110

Query: 1061 NIKRLREQLVCSEEALYD 1078
            N ++ R+ +   + AL+D
Sbjct: 111  NREQWRDAMTQRDSALFD 128

>CAGL0C01309g Chr3 (136270..139602) [3333 bp, 1110 aa] {ON} similar
           to uniprot|P40480 Saccharomyces cerevisiae YIL112w
          Length = 1110

 Score = 33.5 bits (75), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 28/53 (52%), Gaps = 3/53 (5%)

Query: 631 NTLLHVIK---SDVSILLADPFIDVNATNAKGLTPLMVYVRYNRIGNVRTILQ 680
           N  L  +K    D++ L       +N  N +G+TPLM+ V  N +G V+ +L+
Sbjct: 574 NAFLEAVKFGHEDIASLFLAFGAKINKFNKEGMTPLMIAVGRNHLGTVKLLLE 626

>Kpol_483.10 s483 (21646..25002) [3357 bp, 1118 aa] {ON}
           (21646..25002) [3357 nt, 1119 aa]
          Length = 1118

 Score = 32.7 bits (73), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 44/95 (46%), Gaps = 14/95 (14%)

Query: 206 VKAQRISLNSSVTGTTHLASHFVQTCKKALDVVRAYPA-FQVLPNLPICVHEYIELNLYD 264
           +K ++I L+    G  H  ++F Q    A+DV+R     F+V P  PI    YI +    
Sbjct: 488 IKRKKIELDRGKQGNHHFLNNFNQPVNIAVDVIRKNSKRFKVEPIGPIG--SYISVKHGY 545

Query: 265 DYWA--------QLTNSLRDSEIESSSDYSLLKHI 291
           + WA        Q+ NS   S+ E   D +LLK +
Sbjct: 546 EKWARPIQKFLGQILNSFIVSDFE---DLALLKRL 577

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.136    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 111,218,491
Number of extensions: 4839056
Number of successful extensions: 14054
Number of sequences better than 10.0: 44
Number of HSP's gapped: 14319
Number of HSP's successfully gapped: 52
Length of query: 1089
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 969
Effective length of database: 39,721,479
Effective search space: 38490113151
Effective search space used: 38490113151
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 71 (32.0 bits)