Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_56.224216.19ON33733715620.0
KLTH0C11264g6.19ON34628610551e-143
Skud_15.1676.19ON3122849531e-128
TPHA0J003206.19ON3422869531e-128
ACR007W6.19ON3132819501e-128
TDEL0G045006.19ON3012329471e-128
Kpol_1037.246.19ON3663169441e-126
KNAG0M011506.19ON3072319321e-125
YOR006C (TSR3)6.19ON3132829321e-125
Smik_15.1756.19ON3122329291e-125
SAKL0E01144g6.19ON4302339361e-124
KLLA0D01111g6.19ON3142829251e-124
Ecym_30236.19ON3492289251e-124
Suva_15.1816.19ON3362829221e-123
ZYRO0C07832g6.19ON2812309151e-123
CAGL0E02717g6.19ON3252829141e-122
NCAS0H008106.19ON3233198171e-108
NDAI0D007906.19ON4013058101e-105
TBLA0A072506.19ON3043157781e-102
KAFR0L003906.19ON3293217761e-101
CAGL0K05995g6.48ON794108685.9
NDAI0C054008.520ON183883678.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_56.22421
         (337 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_56.22421 s56 complement(120212..121225) [1014 bp, 337 aa] {...   606   0.0  
KLTH0C11264g Chr3 (925534..926574) [1041 bp, 346 aa] {ON} simila...   410   e-143
Skud_15.167 Chr15 complement(297699..298637) [939 bp, 312 aa] {O...   371   e-128
TPHA0J00320 Chr10 complement(71267..72295) [1029 bp, 342 aa] {ON...   371   e-128
ACR007W Chr3 (367875..368816) [942 bp, 313 aa] {ON} Syntenic hom...   370   e-128
TDEL0G04500 Chr7 (818321..819226) [906 bp, 301 aa] {ON} Anc_6.19...   369   e-128
Kpol_1037.24 s1037 complement(54258..55358) [1101 bp, 366 aa] {O...   368   e-126
KNAG0M01150 Chr13 complement(206754..207677) [924 bp, 307 aa] {O...   363   e-125
YOR006C Chr15 complement(337680..338621) [942 bp, 313 aa] {ON}  ...   363   e-125
Smik_15.175 Chr15 complement(304998..305936) [939 bp, 312 aa] {O...   362   e-125
SAKL0E01144g Chr5 complement(88424..89716) [1293 bp, 430 aa] {ON...   365   e-124
KLLA0D01111g Chr4 complement(100315..101259) [945 bp, 314 aa] {O...   360   e-124
Ecym_3023 Chr3 complement(45641..46690) [1050 bp, 349 aa] {ON} s...   360   e-124
Suva_15.181 Chr15 complement(312147..313157) [1011 bp, 336 aa] {...   359   e-123
ZYRO0C07832g Chr3 (594511..595356) [846 bp, 281 aa] {ON} similar...   357   e-123
CAGL0E02717g Chr5 complement(257708..258685) [978 bp, 325 aa] {O...   356   e-122
NCAS0H00810 Chr8 complement(146860..147831) [972 bp, 323 aa] {ON...   319   e-108
NDAI0D00790 Chr4 complement(175697..176902) [1206 bp, 401 aa] {O...   316   e-105
TBLA0A07250 Chr1 complement(1806584..1807498) [915 bp, 304 aa] {...   304   e-102
KAFR0L00390 Chr12 complement(71329..72318) [990 bp, 329 aa] {ON}...   303   e-101
CAGL0K05995g Chr11 (583945..586329) [2385 bp, 794 aa] {ON} simil...    31   5.9  
NDAI0C05400 Chr3 (1249878..1255394) [5517 bp, 1838 aa] {ON} Anc_...    30   8.2  

>Kwal_56.22421 s56 complement(120212..121225) [1014 bp, 337 aa] {ON}
           YOR006C - Hypothetical ORF [contig 185] FULL
          Length = 337

 Score =  606 bits (1562), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/337 (91%), Positives = 309/337 (91%)

Query: 1   MRKGGRSNKGSNKVRTGHSNRSSSGYVETKHGAHNNGRNFPVKLAMWDFDQCDPKRCSGK 60
           MRKGGRSNKGSNKVRTGHSNRSSSGYVETKHGAHNNGRNFPVKLAMWDFDQCDPKRCSGK
Sbjct: 1   MRKGGRSNKGSNKVRTGHSNRSSSGYVETKHGAHNNGRNFPVKLAMWDFDQCDPKRCSGK 60

Query: 61  KLERLGIIKSLRVGQKFQGIVVSPNGKGVVCPNDKQIVEESGAAVVECSWARLNEIPFNK 120
           KLERLGIIKSLRVGQKFQGIVVSPNGKGVVCPNDKQIVEESGAAVVECSWARLNEIPFNK
Sbjct: 61  KLERLGIIKSLRVGQKFQGIVVSPNGKGVVCPNDKQIVEESGAAVVECSWARLNEIPFNK 120

Query: 121 IGGRNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLATELLAHFSWGLGFLE 180
           IGGRNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLATELLAHFSWGLGFLE
Sbjct: 121 IGGRNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLATELLAHFSWGLGFLE 180

Query: 181 LNKELIEVYQKCTDAESVKEAEASWLEKIEREANERRNHSATDDLWMTGNVNRRSPLGND 240
           LNKELIEVYQKCTDAESVKEAEASWLEKIEREANERRNHSATDDLWMTGNVNRRSPLGND
Sbjct: 181 LNKELIEVYQKCTDAESVKEAEASWLEKIEREANERRNHSATDDLWMTGNVNRRSPLGND 240

Query: 241 TESSQEESENSVDTGXXXXXXXXXXYATGNRKRVVKYDNLGNEIYPXXXXXXXXXXXXXX 300
           TESSQEESENSVDTG          YATGNRKRVVKYDNLGNEIYP              
Sbjct: 241 TESSQEESENSVDTGDEEDDDNEDDYATGNRKRVVKYDNLGNEIYPSESSESSEERDDLD 300

Query: 301 XXXXVKYKFDSLGNIIGKEHENGTLNESLSKLTIEGK 337
               VKYKFDSLGNIIGKEHENGTLNESLSKLTIEGK
Sbjct: 301 EQEEVKYKFDSLGNIIGKEHENGTLNESLSKLTIEGK 337

>KLTH0C11264g Chr3 (925534..926574) [1041 bp, 346 aa] {ON} similar
           to uniprot|Q12094 Saccharomyces cerevisiae YOR006C
           Hypothetical ORF
          Length = 346

 Score =  410 bits (1055), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 201/286 (70%), Positives = 234/286 (81%), Gaps = 10/286 (3%)

Query: 9   KGSNKVRTGHSNRSSSGY------VETKHGAHNNGRNFPVKLAMWDFDQCDPKRCSGKKL 62
           KGSNK R  HS++ SSG+      VE+KHGA+ +G+NFPVKLAMWDFDQCDPKRCSGKKL
Sbjct: 8   KGSNKQRGAHSSKPSSGHTSTHRHVESKHGANKSGKNFPVKLAMWDFDQCDPKRCSGKKL 67

Query: 63  ERLGIIKSLRVGQKFQGIVVSPNGKGVVCPNDKQIVEESGAAVVECSWARLNEIPFNKIG 122
           ERLGIIKSLRVGQKFQGIVVSPNGK VVCPND+ IVEE+GAAVVECSWARL+E+PFNKIG
Sbjct: 68  ERLGIIKSLRVGQKFQGIVVSPNGKSVVCPNDRNIVEENGAAVVECSWARLDEVPFNKIG 127

Query: 123 GRNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLATELLAHFSWGLGFLELN 182
           GRNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGR+DLATELL+HFSWGL FLELN
Sbjct: 128 GRNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRLDLATELLSHFSWGLQFLELN 187

Query: 183 KELIEVYQKCTDAESVKEAEASWLEKIEREANERRNHSATDDLWMTGNVNRRSPLGNDTE 242
           KEL+EVYQ+CTDA+S+K+AE +WLE+IE+EA ER+  +  DDLW+TGNVN +   G    
Sbjct: 188 KELLEVYQRCTDADSIKKAEDAWLEQIEKEAQERKARNPGDDLWLTGNVNHKKGHGVTQN 247

Query: 243 SSQEESE--NSVDTGXXXXXXXXXXYATGNRKR--VVKYDNLGNEI 284
            +++E+E  ++ + G           A G       VKYD+LGNEI
Sbjct: 248 ENKDEAEVGSTWEQGENSEYESDESAADGEEAYHGPVKYDSLGNEI 293

>Skud_15.167 Chr15 complement(297699..298637) [939 bp, 312 aa] {ON}
           YOR006C (REAL)
          Length = 312

 Score =  371 bits (953), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 181/284 (63%), Positives = 221/284 (77%), Gaps = 21/284 (7%)

Query: 3   KGGRSNKGSNKVRTGHSNRSSSGYVETKHGAHNNGRNFPVKLAMWDFDQCDPKRCSGKKL 62
           K  R  +G+N    GHS R +  ++E K+      + FPVKLAMWDFD CDPKRCSGKKL
Sbjct: 12  KNERQQRGAN----GHSARQNHKHMEMKYDKSEKMK-FPVKLAMWDFDHCDPKRCSGKKL 66

Query: 63  ERLGIIKSLRVGQKFQGIVVSPNGKGVVCPNDKQIVEESGAAVVECSWARLNEIPFNKIG 122
           ERLG+I+SLRVGQKFQG+VVSPNG+GVVCPND +IVE+ GA+VVECSWARL E+PFNKIG
Sbjct: 67  ERLGLIRSLRVGQKFQGVVVSPNGQGVVCPNDLEIVEQHGASVVECSWARLEEVPFNKIG 126

Query: 123 GRNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLATELLAHFSWGLGFLELN 182
           G+ ERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVG+MD A+ELL+HFSWGLGFL+LN
Sbjct: 127 GKYERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGKMDWASELLSHFSWGLGFLDLN 186

Query: 183 KELIEVYQKCTDAESVKEAEASWLEKIEREANERRNHSATDDLWMTGNVNRRSPLGNDTE 242
           KEL+E+YQ+CTDA+SVK+AE  WLEK+E E  ER++H+   D+WM GN+NRR   GN  +
Sbjct: 187 KELLEIYQRCTDADSVKKAEKEWLEKLEMETQERKSHTKKTDIWMMGNINRR---GNGVQ 243

Query: 243 SSQEES-ENSVDTGXXXXXXXXXXYATGNRKRVVKYDNLGNEIY 285
           S + ES E+S  +G              N ++ ++YD LGN I+
Sbjct: 244 SDELESGEDSEQSGLE------------NSEQPIEYDALGNAIH 275

>TPHA0J00320 Chr10 complement(71267..72295) [1029 bp, 342 aa] {ON}
           Anc_6.19 YOR006C
          Length = 342

 Score =  371 bits (953), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 182/286 (63%), Positives = 217/286 (75%), Gaps = 27/286 (9%)

Query: 3   KGGRSNKGSNKVRTGHSNRSSSGYVETKH-----GAHNNGRNFPVKLAMWDFDQCDPKRC 57
           + G+ ++GSN    GH  R++   +E K      GA++    FPVKLAMWDFD CDPKRC
Sbjct: 12  RSGKPSRGSN----GHHTRTNHKRMEMKFSNAGTGANSKEAGFPVKLAMWDFDHCDPKRC 67

Query: 58  SGKKLERLGIIKSLRVGQKFQGIVVSPNGKGVVCPNDKQIVEESGAAVVECSWARLNEIP 117
           SGKKLERLG+IKSLRVGQKFQGIVVSPNGKGVVCP+DK+ VEE GA+VVECSWARL+E+P
Sbjct: 68  SGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDKETVEEFGASVVECSWARLDEVP 127

Query: 118 FNKIGGRNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLATELLAHFSWGLG 177
           FNKIGG++ERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGR+DLA ELL HFSWGLG
Sbjct: 128 FNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRVDLAAELLEHFSWGLG 187

Query: 178 FLELNKELIEVYQKCTDAESVKEAEASWLEKIEREANERRNHSATDDLWMTGNVNRR-SP 236
           FLELNKEL+E+YQKCTD+ESVK+ E  WLEKI++E  ER++ S   D+W+ GN NR    
Sbjct: 188 FLELNKELLEMYQKCTDSESVKKVEEEWLEKIDKEVQERKSQSREGDIWLQGNTNRDLQD 247

Query: 237 LGNDTESSQEESENSVDTGXXXXXXXXXXYATGNRKRVVKYDNLGN 282
           + +D E   E+                  Y+  N +R ++YDNLGN
Sbjct: 248 MSDDEEFDSEQ-----------------YYSEENTERKIRYDNLGN 276

>ACR007W Chr3 (367875..368816) [942 bp, 313 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR006C
          Length = 313

 Score =  370 bits (950), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 180/281 (64%), Positives = 214/281 (76%), Gaps = 11/281 (3%)

Query: 9   KGSNKVRTGHSNRSSSGYVETKHGAHNNGRNFPVKLAMWDFDQCDPKRCSGKKLERLGII 68
           KGS+K    H+ +S+    E KHG H     FP KLAMWDFD CDPKRCSGKKLERLG+I
Sbjct: 17  KGSSK----HNGKSNQRRTELKHG-HTKETEFPAKLAMWDFDHCDPKRCSGKKLERLGLI 71

Query: 69  KSLRVGQKFQGIVVSPNGKGVVCPNDKQIVEESGAAVVECSWARLNEIPFNKIGGRNERL 128
           KSLR+GQKFQGIVVSPNGK VVCPNDK+IVE+ G +VVECSWARL+EIPF+KIGGR+ERL
Sbjct: 72  KSLRIGQKFQGIVVSPNGKTVVCPNDKEIVEQHGVSVVECSWARLDEIPFSKIGGRHERL 131

Query: 129 LPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLATELLAHFSWGLGFLELNKELIEV 188
           LPYLVAANQVNYGRPWRLNCVEA+AACFAIVGR DLA ELL+HFSWG GFLELN+EL+E 
Sbjct: 132 LPYLVAANQVNYGRPWRLNCVEAIAACFAIVGRTDLAEELLSHFSWGPGFLELNQELLET 191

Query: 189 YQKCTDAESVKEAEASWLEKIEREANERRNHSATDDLWMTGNVNRRSP-----LGNDTES 243
           YQ+CTD  S+K AE +WL+K+E EA +RR  +  +D+WM GNVNR++P     + +  ++
Sbjct: 192 YQQCTDHASIKAAEEAWLQKLEEEAEQRRKQTHEEDIWMMGNVNRKAPNMRSSMLDSDDN 251

Query: 244 SQEESENSVDTGXXXXXXXXXXYATGNRKRVVKYDNLGNEI 284
           S  E  + VD             A G+ KR V YD+LGN I
Sbjct: 252 SDSEYASDVDHDLVSDTEEGEDIAIGS-KRDVTYDSLGNVI 291

>TDEL0G04500 Chr7 (818321..819226) [906 bp, 301 aa] {ON} Anc_6.19
           YOR006C
          Length = 301

 Score =  369 bits (947), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 172/232 (74%), Positives = 201/232 (86%), Gaps = 6/232 (2%)

Query: 3   KGGRSNKGSNKVRTGHSNRSSSGYVETKHGAHNNGRNFPVKLAMWDFDQCDPKRCSGKKL 62
           K G S KGSN    GHS+R +   +E K G  +    FPVKLAMWDFD CDPKRCSGKKL
Sbjct: 12  KNGHSGKGSN----GHSSRQNHKRMEMKRGTEDT--KFPVKLAMWDFDHCDPKRCSGKKL 65

Query: 63  ERLGIIKSLRVGQKFQGIVVSPNGKGVVCPNDKQIVEESGAAVVECSWARLNEIPFNKIG 122
           ERLG+IKSLRVGQKFQGIVVSPNG GVVCP+DK IVEE GA+VVECSWARL+E+PFNKIG
Sbjct: 66  ERLGLIKSLRVGQKFQGIVVSPNGSGVVCPDDKSIVEEHGASVVECSWARLDEVPFNKIG 125

Query: 123 GRNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLATELLAHFSWGLGFLELN 182
           G++ERLLPYLVAANQVNYGRPW+LNCVEALAACFAIVGRMD A+ELL+HFSWGLGFLELN
Sbjct: 126 GKHERLLPYLVAANQVNYGRPWKLNCVEALAACFAIVGRMDWASELLSHFSWGLGFLELN 185

Query: 183 KELIEVYQKCTDAESVKEAEASWLEKIEREANERRNHSATDDLWMTGNVNRR 234
           +EL+E+YQ+CTDA+SVK AE++WL KI++E  ER++ +  +D+WMTGNVNR+
Sbjct: 186 QELLEIYQQCTDADSVKAAESAWLVKIQKEVEERKSQAKDEDIWMTGNVNRK 237

>Kpol_1037.24 s1037 complement(54258..55358) [1101 bp, 366 aa] {ON}
           complement(54258..55358) [1101 nt, 367 aa]
          Length = 366

 Score =  368 bits (944), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 185/316 (58%), Positives = 227/316 (71%), Gaps = 22/316 (6%)

Query: 3   KGGRSNKGSNKVRTGHSNRSSSGYVETKHGAHNNGRN--FPVKLAMWDFDQCDPKRCSGK 60
           + G+ ++GSN    GHS++ +  ++E K    N  ++  FPVKLAMWDFD CDPKRCSGK
Sbjct: 12  RTGKPSRGSN----GHSSKLNHKHMEMKKYGKNISQDDKFPVKLAMWDFDHCDPKRCSGK 67

Query: 61  KLERLGIIKSLRVGQKFQGIVVSPNGKGVVCPNDKQIVEESGAAVVECSWARLNEIPFNK 120
           +LERLG+IKSLRVGQKFQG+VVSPNGKGV+CPND++IVEE GA+VVECSWARL+E+PFNK
Sbjct: 68  RLERLGLIKSLRVGQKFQGVVVSPNGKGVLCPNDREIVEEFGASVVECSWARLDEVPFNK 127

Query: 121 IGGRNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLATELLAHFSWGLGFLE 180
           IGG++ERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMD A ELL++FSWGLGFLE
Sbjct: 128 IGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWAAELLSNFSWGLGFLE 187

Query: 181 LNKELIEVYQKCTDAESVKEAEASWLEKIEREANERRNHSATDDLWMTGNVNRRSPLGND 240
           +N+EL+++YQ+CTD+ESVK+AE  WL KIE+E  ER+  +   D+WM GN NR    G+D
Sbjct: 188 INEELLKIYQQCTDSESVKKAEEEWLAKIEQEIQERKTQARESDIWMMGNTNRNMN-GDD 246

Query: 241 TESSQEESENSVDTGXXXXXXXXXXYATGNRKRVVKYDNLGNEIYPXXXXXXXXXXXXXX 300
            E          + G          Y   N  +  +YDNLGN I                
Sbjct: 247 DE----------EEGNSYEALSGDDYEEENNNKSARYDNLGNII-----ESEEDYDDYDD 291

Query: 301 XXXXVKYKFDSLGNII 316
               V+ K+DSLGNII
Sbjct: 292 EEDRVEVKYDSLGNII 307

>KNAG0M01150 Chr13 complement(206754..207677) [924 bp, 307 aa] {ON}
           Anc_6.19 YOR006C
          Length = 307

 Score =  363 bits (932), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 167/231 (72%), Positives = 198/231 (85%)

Query: 3   KGGRSNKGSNKVRTGHSNRSSSGYVETKHGAHNNGRNFPVKLAMWDFDQCDPKRCSGKKL 62
           +G  +++GS+K   GHS+R +   +E +      G  FPVK+AMWDFD CDPKRCSGKKL
Sbjct: 11  RGDETSRGSHKGSNGHSSRLNHKRMELRQHDGVKGTKFPVKMAMWDFDHCDPKRCSGKKL 70

Query: 63  ERLGIIKSLRVGQKFQGIVVSPNGKGVVCPNDKQIVEESGAAVVECSWARLNEIPFNKIG 122
           ERLG+I SL+VGQKFQGIVVSPNG+GVVCP+D+ IVEE GA+VVECSWARL+E+PFN+IG
Sbjct: 71  ERLGLITSLKVGQKFQGIVVSPNGQGVVCPDDRAIVEEFGASVVECSWARLDEVPFNRIG 130

Query: 123 GRNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLATELLAHFSWGLGFLELN 182
           G++ERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLA++LL++FSWGLGFLELN
Sbjct: 131 GKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLASDLLSNFSWGLGFLELN 190

Query: 183 KELIEVYQKCTDAESVKEAEASWLEKIEREANERRNHSATDDLWMTGNVNR 233
           KEL+EVYQKCTD ESVK+AE  WL KIE EA +R+N +   D+WM GNVNR
Sbjct: 191 KELLEVYQKCTDHESVKKAEEDWLNKIEEEAQQRKNEARDGDIWMMGNVNR 241

>YOR006C Chr15 complement(337680..338621) [942 bp, 313 aa] {ON}
           TSR3Protein required for correct processing of the 20S
           pre-rRNA at site D to generate mature 18S rRNA; green
           fluorescent protein (GFP)-fusion protein localizes to
           both the cytoplasm and the nucleus
          Length = 313

 Score =  363 bits (932), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 179/282 (63%), Positives = 217/282 (76%), Gaps = 19/282 (6%)

Query: 3   KGGRSNKGSNKVRTGHSNRSSSGYVETKHGAHNNGRNFPVKLAMWDFDQCDPKRCSGKKL 62
           K GR  +G+N    GHS+R +   +E K+  ++    FPVKLAMWDFD CDPKRCSGKKL
Sbjct: 12  KNGRPQRGAN----GHSSRQNHRRMEMKYD-NSEKMKFPVKLAMWDFDHCDPKRCSGKKL 66

Query: 63  ERLGIIKSLRVGQKFQGIVVSPNGKGVVCPNDKQIVEESGAAVVECSWARLNEIPFNKIG 122
           ERLG+IKSLRVGQKFQGIVVSPNGKGVVCP+D +IVE+ GA+VVECSWARL E+PFNKIG
Sbjct: 67  ERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDLEIVEQHGASVVECSWARLEEVPFNKIG 126

Query: 123 GRNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLATELLAHFSWGLGFLELN 182
           G++ERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMD A+ELL+HFSWG+GFLELN
Sbjct: 127 GKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASELLSHFSWGMGFLELN 186

Query: 183 KELIEVYQKCTDAESVKEAEASWLEKIEREANERRNHSATDDLWMTGNVNRRSPLGNDTE 242
           KEL+E+YQ+CTD +SVK AE  WL+K+E+E  ER++ +  +D+WM GN+NRR   GN ++
Sbjct: 187 KELLEIYQQCTDCDSVKRAEEEWLQKLEKETQERKSRAKEEDIWMMGNINRR---GNGSQ 243

Query: 243 SSQEESENSVDTGXXXXXXXXXXYATGNRKRVVKYDNLGNEI 284
           S         DT               N  + ++YD+LGN I
Sbjct: 244 S---------DTSESEENSEQSDLEGNN--QCIEYDSLGNAI 274

>Smik_15.175 Chr15 complement(304998..305936) [939 bp, 312 aa] {ON}
           YOR006C (REAL)
          Length = 312

 Score =  362 bits (929), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 167/232 (71%), Positives = 201/232 (86%), Gaps = 5/232 (2%)

Query: 3   KGGRSNKGSNKVRTGHSNRSSSGYVETKHGAHNNGRNFPVKLAMWDFDQCDPKRCSGKKL 62
           K GR  +G+N    GHS+R +   +E K+  +++   FPVKLAMWDFD CDPKRCSGKKL
Sbjct: 12  KNGRPQRGAN----GHSSRQNHRRMEMKY-ENSDKVKFPVKLAMWDFDHCDPKRCSGKKL 66

Query: 63  ERLGIIKSLRVGQKFQGIVVSPNGKGVVCPNDKQIVEESGAAVVECSWARLNEIPFNKIG 122
           ERLG+IKSLRVGQKFQGIVVSPNGKGVVCP+D ++VE+ GA+VVECSWARL E+PFNKIG
Sbjct: 67  ERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDLEVVEQHGASVVECSWARLEEVPFNKIG 126

Query: 123 GRNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLATELLAHFSWGLGFLELN 182
           G++ERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMD A+ELL+HFSWG+GFLELN
Sbjct: 127 GKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASELLSHFSWGMGFLELN 186

Query: 183 KELIEVYQKCTDAESVKEAEASWLEKIEREANERRNHSATDDLWMTGNVNRR 234
           KEL+E+YQ+CTDA+SVK AE  WL+K+E+E  ER++ +  +D+WM GN+NRR
Sbjct: 187 KELLEIYQQCTDADSVKRAEEEWLQKLEKETQERKSQAKEEDIWMMGNINRR 238

>SAKL0E01144g Chr5 complement(88424..89716) [1293 bp, 430 aa] {ON}
           similar to uniprot|Q12094 Saccharomyces cerevisiae
           YOR006C Hypothetical ORF
          Length = 430

 Score =  365 bits (936), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 170/233 (72%), Positives = 201/233 (86%), Gaps = 5/233 (2%)

Query: 3   KGGRSNKGSNKVRTGHSNRSSSGYVETKHGAHNN-GRNFPVKLAMWDFDQCDPKRCSGKK 61
           +  R ++G+N    GHS+R +   +E K G  ++ G  FPVKLAMWDFD CDPKRCSGKK
Sbjct: 12  RSSRPHRGAN----GHSSRLNHKRMEMKRGGDSSAGNKFPVKLAMWDFDHCDPKRCSGKK 67

Query: 62  LERLGIIKSLRVGQKFQGIVVSPNGKGVVCPNDKQIVEESGAAVVECSWARLNEIPFNKI 121
           LERLG+IKSLRVGQKFQGIVVSPNG+GVVCPND+ IVEE GA+VVECSWARL+E+PF +I
Sbjct: 68  LERLGLIKSLRVGQKFQGIVVSPNGRGVVCPNDRVIVEEHGASVVECSWARLDEVPFGRI 127

Query: 122 GGRNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLATELLAHFSWGLGFLEL 181
           GG++ERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGR DLA+ELL++FSWGLGFLEL
Sbjct: 128 GGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLASELLSNFSWGLGFLEL 187

Query: 182 NKELIEVYQKCTDAESVKEAEASWLEKIEREANERRNHSATDDLWMTGNVNRR 234
           NKEL+E+YQ+CTDA+SVK AE +WL+KIE EA +R+  S  +D+WM GNVNRR
Sbjct: 188 NKELLEIYQQCTDADSVKAAEEAWLKKIEEEAQQRKQQSKEEDIWMMGNVNRR 240

>KLLA0D01111g Chr4 complement(100315..101259) [945 bp, 314 aa] {ON}
           similar to uniprot|Q12094 Saccharomyces cerevisiae
           YOR006C Hypothetical ORF
          Length = 314

 Score =  360 bits (925), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 180/282 (63%), Positives = 210/282 (74%), Gaps = 24/282 (8%)

Query: 6   RSNKGSNKVRTGHSNRSSSGYVETKHGAHNNGRNFPVKLAMWDFDQCDPKRCSGKKLERL 65
           RS KGSN    GHS+R +   +E KH   +    FPVKLAMWDFD CDPKRCSGKKLERL
Sbjct: 14  RSQKGSN----GHSSRLNHKRMEMKH-VDSTTSKFPVKLAMWDFDHCDPKRCSGKKLERL 68

Query: 66  GIIKSLRVGQKFQGIVVSPNGKGVVCPNDKQIVEESGAAVVECSWARLNEIPFNKIGGRN 125
           G+IKSLRVGQKFQG+VVSPNGK VVCP+DK +VEE+GA+VVECSWARL+E+PFNKIGG+N
Sbjct: 69  GLIKSLRVGQKFQGVVVSPNGKTVVCPDDKALVEENGASVVECSWARLDEVPFNKIGGKN 128

Query: 126 ERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLATELLAHFSWGLGFLELNKEL 185
           ERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGR DLA +LL++FSWG  FLELNKEL
Sbjct: 129 ERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLAADLLSNFSWGPAFLELNKEL 188

Query: 186 IEVYQKCTDAESVKEAEASWLEKIEREANERRNHSATDDLWMTGNVNRRSPLGNDTESSQ 245
           +++YQ+CTD +SVK AE  WL+KIE+EA ER+  + T+D+WM GNVNR S          
Sbjct: 189 LDIYQQCTDHDSVKAAEEKWLQKIEQEAIERKQQAKTEDIWMIGNVNRASR--------- 239

Query: 246 EESENSVDTGXXXXXXXXXXYATGNR---KRVVKYDNLGNEI 284
                  D            Y  G+     R +KYD+LGN I
Sbjct: 240 -------DLPGSSGEEEEEDYLNGDSLIDVRDIKYDSLGNVI 274

>Ecym_3023 Chr3 complement(45641..46690) [1050 bp, 349 aa] {ON}
           similar to Ashbya gossypii ACR007W
          Length = 349

 Score =  360 bits (925), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 169/228 (74%), Positives = 193/228 (84%), Gaps = 5/228 (2%)

Query: 7   SNKGSNKVRTGHSNRSSSGYVETKHGAHNNGRNFPVKLAMWDFDQCDPKRCSGKKLERLG 66
           S KGSN    GHS+R++   +ETK+ A   G  FPV LAMWDFD CDPKRCSGKKLERLG
Sbjct: 14  SQKGSN----GHSSRTNHRRIETKYNAIQ-GSKFPVTLAMWDFDHCDPKRCSGKKLERLG 68

Query: 67  IIKSLRVGQKFQGIVVSPNGKGVVCPNDKQIVEESGAAVVECSWARLNEIPFNKIGGRNE 126
           +IKSLRV QKFQGIVVSPNGK VVCPND++I E+ G +VVECSWARL EIPF KIGGR+E
Sbjct: 69  LIKSLRVKQKFQGIVVSPNGKTVVCPNDREIAEKYGVSVVECSWARLEEIPFEKIGGRHE 128

Query: 127 RLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLATELLAHFSWGLGFLELNKELI 186
           RLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLA  LL+HFSWGLGFLELNKE++
Sbjct: 129 RLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLAETLLSHFSWGLGFLELNKEIL 188

Query: 187 EVYQKCTDAESVKEAEASWLEKIEREANERRNHSATDDLWMTGNVNRR 234
           E+YQKCTD +S+K AE +WL++IE EA ERR  +  +D+WM GNVNR+
Sbjct: 189 EIYQKCTDHDSIKAAEEAWLKQIETEAMERRKQTKENDIWMMGNVNRK 236

>Suva_15.181 Chr15 complement(312147..313157) [1011 bp, 336 aa] {ON}
           YOR006C (REAL)
          Length = 336

 Score =  359 bits (922), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 174/282 (61%), Positives = 214/282 (75%), Gaps = 19/282 (6%)

Query: 3   KGGRSNKGSNKVRTGHSNRSSSGYVETKHGAHNNGRNFPVKLAMWDFDQCDPKRCSGKKL 62
           K GR  +G+N    GHS+R +   +E K+  ++   NFPVKLAMWDFD CDPKRCSGKKL
Sbjct: 36  KNGRPQRGAN----GHSSRQNHKRMEMKYD-NSEMTNFPVKLAMWDFDHCDPKRCSGKKL 90

Query: 63  ERLGIIKSLRVGQKFQGIVVSPNGKGVVCPNDKQIVEESGAAVVECSWARLNEIPFNKIG 122
           ERLG+IKSLRVGQKFQGIVVSPNG GVVCP+D ++VE+ GA+VVECSWARL E+PFNKIG
Sbjct: 91  ERLGLIKSLRVGQKFQGIVVSPNGNGVVCPDDLEVVEQHGASVVECSWARLEEVPFNKIG 150

Query: 123 GRNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLATELLAHFSWGLGFLELN 182
           G++ERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMD A+ LL+HFSWGLGFL+LN
Sbjct: 151 GKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASGLLSHFSWGLGFLDLN 210

Query: 183 KELIEVYQKCTDAESVKEAEASWLEKIEREANERRNHSATDDLWMTGNVNRRSPLGNDTE 242
           +EL+E+YQKCTD+ SVK+AE  WL+K+E+E  ER++ S  +D+WM GNVNR+        
Sbjct: 211 RELLEIYQKCTDSNSVKKAEEEWLQKLEKETQERKSQSKDEDIWMMGNVNRK-------- 262

Query: 243 SSQEESENSVDTGXXXXXXXXXXYATGNRKRVVKYDNLGNEI 284
                 +N   +               + K+ ++YD+LGN I
Sbjct: 263 ------DNGAQSDESESEEDSDQSELESDKQSIEYDSLGNAI 298

>ZYRO0C07832g Chr3 (594511..595356) [846 bp, 281 aa] {ON} similar to
           uniprot|Q12094 Saccharomyces cerevisiae YOR006C
           Hypothetical ORF
          Length = 281

 Score =  357 bits (915), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 163/230 (70%), Positives = 201/230 (87%), Gaps = 6/230 (2%)

Query: 6   RSNKGSNKVRTGHSNRSSSGYVETKHG--AHNNGRNFPVKLAMWDFDQCDPKRCSGKKLE 63
           R  +G+N    GH+++ +  ++E KHG  +++N  NFPVKL MWDFD CDPKRCSGKKLE
Sbjct: 15  RPGRGAN----GHNSKQNHKHMEMKHGGASNSNKTNFPVKLGMWDFDHCDPKRCSGKKLE 70

Query: 64  RLGIIKSLRVGQKFQGIVVSPNGKGVVCPNDKQIVEESGAAVVECSWARLNEIPFNKIGG 123
           RLG+I+SLRVGQKFQG+VV+PNG GVVCPNDK IVEE GA+VVECSWARL+E+PFN+IGG
Sbjct: 71  RLGLIRSLRVGQKFQGVVVTPNGTGVVCPNDKSIVEEHGASVVECSWARLDEVPFNRIGG 130

Query: 124 RNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLATELLAHFSWGLGFLELNK 183
           R+ERLLPYLVAANQVNYGRPW+LNCVEALAACFAIVGRMD A+ELL++FS+G  FLE+N 
Sbjct: 131 RHERLLPYLVAANQVNYGRPWKLNCVEALAACFAIVGRMDWASELLSNFSYGPSFLEINA 190

Query: 184 ELIEVYQKCTDAESVKEAEASWLEKIEREANERRNHSATDDLWMTGNVNR 233
           EL+E+YQ+CTDAESVK+AE++WLEKIE+E  +R+  +  +D+WMTGNVNR
Sbjct: 191 ELLEIYQQCTDAESVKDAESAWLEKIEKEIKDRKAQAKNEDIWMTGNVNR 240

>CAGL0E02717g Chr5 complement(257708..258685) [978 bp, 325 aa] {ON}
           similar to uniprot|Q12094 Saccharomyces cerevisiae
           YOR006c
          Length = 325

 Score =  356 bits (914), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 181/282 (64%), Positives = 213/282 (75%), Gaps = 16/282 (5%)

Query: 5   GRSNK--GSNKVRTGHSNRSSSGYVETKHGAHNNGRNFPVKLAMWDFDQCDPKRCSGKKL 62
           GRSNK  GSN    GH  R +  ++E K+   +   +FPVKLAMWDFD CDPKRCSGKKL
Sbjct: 14  GRSNKSGGSN----GHHTRRNHRHMEMKYCGGSKDSSFPVKLAMWDFDHCDPKRCSGKKL 69

Query: 63  ERLGIIKSLRVGQKFQGIVVSPNGKGVVCPNDKQIVEESGAAVVECSWARLNEIPFNKIG 122
           ERLG+IKSLRVGQKFQGIVVSPNGK VVCP+D++IVE  GA+VVECSWARL E+PFNKIG
Sbjct: 70  ERLGLIKSLRVGQKFQGIVVSPNGKSVVCPDDREIVEAHGASVVECSWARLEEVPFNKIG 129

Query: 123 GRNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLATELLAHFSWGLGFLELN 182
           G++ERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGR DLA ELL+HFSWGLGFLELN
Sbjct: 130 GKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLAHELLSHFSWGLGFLELN 189

Query: 183 KELIEVYQKCTDAESVKEAEASWLEKIEREANERRNHSATDDLWMTGNVNRRSPLGNDTE 242
           K+L+E YQ+CTD+ES+K+ E  WL++I++E  ER+  + T+D+WM GN NR    GN   
Sbjct: 190 KDLLERYQQCTDSESIKKVEEDWLQQIDQEVQERKLKAQTEDVWMMGNTNR----GNSGL 245

Query: 243 SSQEESENSVDTGXXXXXXXXXXYATGNRKRVVKYDNLGNEI 284
               +SE   +              T  RK  V+YDNLGN I
Sbjct: 246 MPPSDSEEEYEEEAEEEEED-----TTTRKN-VRYDNLGNII 281

>NCAS0H00810 Chr8 complement(146860..147831) [972 bp, 323 aa] {ON}
           Anc_6.19 YOR006C
          Length = 323

 Score =  319 bits (817), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 162/319 (50%), Positives = 217/319 (68%), Gaps = 36/319 (11%)

Query: 5   GRSNKGSNKVRTGHSNRSSSGYVETKHGAH---NNGRNFPVKLAMWDFDQCDPKRCSGKK 61
           GR ++G+N    GHS+R +   +E +   +   +N +  PVKL MWDFD CDPKRCSGKK
Sbjct: 16  GRQHRGAN----GHSSRHNHKNMEMRKHENEDTSNVKKIPVKLGMWDFDHCDPKRCSGKK 71

Query: 62  LERLGIIKSLRVGQKFQGIVVSPNGKGVVCPNDKQIVEESGAAVVECSWARLNEIPFNKI 121
           LERLG+IKSL++GQ+FQG+++SPNGK VV P D  I++E GAAVVECSWARL+EIPF+K+
Sbjct: 72  LERLGLIKSLKIGQRFQGLIISPNGKKVVSPEDADIIKEFGAAVVECSWARLDEIPFSKL 131

Query: 122 ----GGRNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLATELLAHFSWGLG 177
               GG+NERLLPYLVAANQVNYGRPW+LNCVEALAACFAI+GR D A +LL++FSWG+ 
Sbjct: 132 NGGNGGKNERLLPYLVAANQVNYGRPWKLNCVEALAACFAIIGRSDWAADLLSNFSWGMN 191

Query: 178 FLELNKELIEVYQKCTDAESVKEAEASWLEKIEREANERRNHSATDDLWMTGNVNRRSPL 237
           FL LN+EL E+Y +CTD++S++EA+ +WL KI+ EA ER+  +  +D+W+ GN NR +  
Sbjct: 192 FLTLNEELFELYSQCTDSDSIQEAQEAWLNKIDEEAKERKLQAQDNDIWLMGNTNRVNDN 251

Query: 238 GNDTESSQEESENSVDTGXXXXXXXXXXYATGNRKRVVKYDNLGNEIYPXXXXXXXXXXX 297
             D   S  + +   +            Y T   ++ VKYDNLGN I             
Sbjct: 252 LRDLTLSDGDEDEEEED--------AEDYLT---EKSVKYDNLGNVI------------- 287

Query: 298 XXXXXXXVKYKFDSLGNII 316
                  +  ++D+LGN+I
Sbjct: 288 -ESSEDEITLRYDNLGNVI 305

>NDAI0D00790 Chr4 complement(175697..176902) [1206 bp, 401 aa] {ON}
           Anc_6.19 YOR006C
          Length = 401

 Score =  316 bits (810), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 163/305 (53%), Positives = 211/305 (69%), Gaps = 34/305 (11%)

Query: 3   KGGRSNKGSNKVRTGHSNRSSSGYVETKHGAHNNG-------------------RNFPVK 43
           K  R+++G+N    GHS+R +   +E K   HN+                    +  PVK
Sbjct: 58  KNPRAHRGAN----GHSSRHNHKNMEMK--KHNDFTSTQMVNDNDDGIDEIHSVKKIPVK 111

Query: 44  LAMWDFDQCDPKRCSGKKLERLGIIKSLRVGQKFQGIVVSPNGKGVVCPNDKQIVEESGA 103
           L MWDFD CDPKRCSGKKLERLG+IKSL++GQ+FQG+++SPNGK VV P+D  I++E GA
Sbjct: 112 LGMWDFDHCDPKRCSGKKLERLGLIKSLKIGQRFQGLIISPNGKKVVSPDDADIIKEFGA 171

Query: 104 AVVECSWARLNEIPFNKI----GGRNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIV 159
           AVVECSWARL+EIPF+K+    GG+NERLLPYLVAANQVNYGRPW+LNCVEALAACFAI+
Sbjct: 172 AVVECSWARLDEIPFSKLNGGNGGKNERLLPYLVAANQVNYGRPWKLNCVEALAACFAII 231

Query: 160 GRMDLATELLAHFSWGLGFLELNKELIEVYQKCTDAESVKEAEASWLEKIEREANERRNH 219
           GR D A++LL++FSWGL FL+LN+EL E+Y KCTD++SVK A+  WL+KIE+EA ER+  
Sbjct: 232 GRSDWASDLLSNFSWGLNFLKLNEELFELYSKCTDSDSVKAAQEEWLDKIEQEATERKLQ 291

Query: 220 SATDDLWMTGNVNRRSPLGNDTESSQEESENSVDTGXXXXXXXXXXYATGNRKRVVKYDN 279
           +   D+WM GN NR   L  +  S     E+  +            + T N++  ++YDN
Sbjct: 292 AQETDIWMMGNTNR---LDANLRSMNISDEDEEEEEEYDEEEDGGEHITRNKE--LRYDN 346

Query: 280 LGNEI 284
           LGN I
Sbjct: 347 LGNVI 351

>TBLA0A07250 Chr1 complement(1806584..1807498) [915 bp, 304 aa] {ON}
           Anc_6.19 YOR006C
          Length = 304

 Score =  304 bits (778), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 164/315 (52%), Positives = 204/315 (64%), Gaps = 23/315 (7%)

Query: 9   KGSNKVRTGHSNRSS--SGYVETKHG--AHNNGRNFPVKLAMWDFDQCDPKRCSGKKLER 64
           KG NK     SNR S  S   E+KH     +   NFPVKLAMWDFD CDPKRCSGKKLER
Sbjct: 3   KGKNKGHEERSNRKSNNSRRNESKHSLSIKSTKTNFPVKLAMWDFDHCDPKRCSGKKLER 62

Query: 65  LGIIKSLRVGQKFQGIVVSPNGKGVVCPNDKQIVEESGAAVVECSWARLNEIPFNKIGGR 124
            G+ +SLRVGQ+F G+VVSPNGK VV P D++ +E+ G AVVECSWARL+E+PFNK+GG+
Sbjct: 63  TGLAQSLRVGQRFNGMVVSPNGKRVVSPADRETIEQYGIAVVECSWARLDEVPFNKLGGK 122

Query: 125 --NERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLATELLAHFSWGLGFLELN 182
             NE LLPYLVAAN VNYGRPWRLNCVEA AAC AIVG  + A+++L  FSWG  FLELN
Sbjct: 123 PSNEVLLPYLVAANPVNYGRPWRLNCVEAFAACLAIVGFKEYASKVLEGFSWGHAFLELN 182

Query: 183 KELIEVYQKCTDAESVKEAEASWLEKIEREANERRNHSATDDLWMTGNVNRRSPLGNDTE 242
            EL+++Y  CTD+ SV++A+  WLEKIE E  ER+    + D W+ GN NR++   ND +
Sbjct: 183 DELLDIYGNCTDSISVEKAQDEWLEKIELENKERKEKMNSADAWLIGNTNRKNL--NDFD 240

Query: 243 SSQEESENSVDT-GXXXXXXXXXXYATGNRKRVVKYDNLGNEIYPXXXXXXXXXXXXXXX 301
           +S E +E+++ T                N    +KYD+LGN I                 
Sbjct: 241 NSSESTEDNISTVSSADERYDALGNLISNDSHSLKYDSLGNVI--------------ESE 286

Query: 302 XXXVKYKFDSLGNII 316
              +  K+D LGNII
Sbjct: 287 GDALPPKYDKLGNII 301

>KAFR0L00390 Chr12 complement(71329..72318) [990 bp, 329 aa] {ON}
           Anc_6.19 YOR006C
          Length = 329

 Score =  303 bits (776), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 160/321 (49%), Positives = 209/321 (65%), Gaps = 19/321 (5%)

Query: 17  GHSNRSSSGYVETKHGAHNNGRNFPVKLAMWDFDQCDPKRCSGKKLERLGIIKSLRVGQK 76
           GH +R ++  +E K        +FPVKLAMWDFD CDPKRCSGKKLERL +I+SL++ QK
Sbjct: 25  GHHSRHNNKKMEFKQHVSRET-SFPVKLAMWDFDHCDPKRCSGKKLERLNLIRSLKINQK 83

Query: 77  FQGIVVSPNGKGVVCPNDKQIVEESGAAVVECSWARLNEIPFNKIGG-RNERLLPYLVAA 135
           FQGI VSPNGK  V P D+++V E G AVVECSWAR++EIPF+K    + +RLLPYLVAA
Sbjct: 84  FQGITVSPNGKKFVSPEDRELVTEFGCAVVECSWARIDEIPFSKFSTPKLDRLLPYLVAA 143

Query: 136 NQVNYGRPWRLNCVEALAACFAIVGRMDLATELLAHFSWGLGFLELNKELIEVYQKCTDA 195
           NQVNYGRPW+LNCVEA+AAC AIVG MDLA ELL+HFSWG+ FL+LN+EL+E+YQ+CTD+
Sbjct: 144 NQVNYGRPWKLNCVEAIAACLAIVGFMDLAEELLSHFSWGVNFLKLNRELLEIYQQCTDS 203

Query: 196 ESVKEAEASWLEKIEREANERR--NHSATDDLWMTGNVNRRSPLGNDTESSQEESENSVD 253
           + ++ A+ +W+++IE+E  ER+  N++   D+WM+GNVNR            +E     D
Sbjct: 204 DEIEAAQDAWMDQIEKEVQERKASNNAQNVDIWMSGNVNRI--------DESDEDNEDED 255

Query: 254 TGXXXXXXXXXXYATGNRKRVVKYDNLGNEIYPXXXXXXXXXXXXXXXXXXVKYKFDSLG 313
           +               N  R V+YDNLGN I                       K+DSLG
Sbjct: 256 SEDEEVTYDNLGNIIENEPREVRYDNLGNII----EESSEESSGEEEEDEEEDVKYDSLG 311

Query: 314 NIIGKEHENGTLNESLSKLTI 334
           N+I    E+ +L + L  L I
Sbjct: 312 NVI---EESESLQKKLDGLNI 329

>CAGL0K05995g Chr11 (583945..586329) [2385 bp, 794 aa] {ON} similar
           to uniprot|Q06147 Saccharomyces cerevisiae YLR260w
           sphingolipid long chain base kinase
          Length = 794

 Score = 30.8 bits (68), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 26/108 (24%), Positives = 46/108 (42%), Gaps = 19/108 (17%)

Query: 152 LAACFAIVGRMDLATELL-----AHFSWGLGF--LELNKELIEVYQKCTDAESVKEAEAS 204
           L+  + ++   D+ TE +     A F  G+ F  L+  K   ++Y K   A+S  + +  
Sbjct: 548 LSQTYGVIAESDINTEFIRWMGPARFELGVAFNVLQRKKYPCDLYVKYA-AKSKNDLKVH 606

Query: 205 WLEKIEREANERRNHSATDDLWMTGNVNRRSPLGNDTESSQEESENSV 252
           +LE           H     L   G++N  SP   DT+   + +EN +
Sbjct: 607 YLE-----------HKNQGSLTFEGDLNEESPETEDTKQISKSNENEI 643

>NDAI0C05400 Chr3 (1249878..1255394) [5517 bp, 1838 aa] {ON} Anc_8.520
          Length = 1838

 Score = 30.4 bits (67), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 36/83 (43%), Gaps = 15/83 (18%)

Query: 132  LVAANQVNYGRPWRLNCVEAL--------------AACFAIVGRMDLATELLAHFSWGLG 177
            +++ +  N G+PW LN  + +              AAC      +D+   + +H  + L 
Sbjct: 1655 MLSTSSANTGQPWLLNPFDQIEFYPVSEEELDNFTAACDQATFTVDIEPSIFSHKDY-LR 1713

Query: 178  FLELNKELIEVYQKCTDAESVKE 200
            ++E NKE IE + K    E   E
Sbjct: 1714 WVEDNKESIEDFTKAQSGEKANE 1736

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.132    0.394 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 34,154,135
Number of extensions: 1366834
Number of successful extensions: 3200
Number of sequences better than 10.0: 40
Number of HSP's gapped: 3237
Number of HSP's successfully gapped: 42
Length of query: 337
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 227
Effective length of database: 40,868,139
Effective search space: 9277067553
Effective search space used: 9277067553
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 66 (30.0 bits)