Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_56.224146.18ON96396351640.0
KLTH0C11286g6.18ON95194731030.0
TDEL0G045106.18ON96995924170.0
NCAS0D026506.18ON95096223660.0
ZYRO0C07854g6.18ON94494623620.0
NDAI0I022606.18ON96795823480.0
Suva_15.1806.18ON94894523110.0
Smik_15.1746.18ON94594523030.0
YOR005C (DNL4)6.18ON94494222860.0
Kpol_1032.76.18ON96594522720.0
CAGL0E02695g6.18ON94695222660.0
KAFR0A050506.18ON94894422650.0
Skud_15.1666.18ON94794322500.0
KNAG0F028706.18ON95495622010.0
TBLA0G010406.18ON97296221180.0
TPHA0M002606.18ON96696820950.0
ACR008W6.18ON98194520910.0
KLLA0D01089g6.18ON90793920760.0
ACL155W7.343ON6974112853e-25
Kwal_56.246167.343ON7153962844e-25
NDAI0A019407.343ON7653972792e-24
TPHA0D045707.343ON7364102612e-22
TBLA0E020507.343ON7203972603e-22
CAGL0I03410g7.343ON7243802568e-22
KLTH0H01408g7.343ON7233982541e-21
Kpol_2001.717.343ON7262902487e-21
SAKL0F10912g7.343ON6932782452e-20
ZYRO0F11572g7.343ON7314052424e-20
Suva_4.827.343ON7553992425e-20
TDEL0C020407.343ON7053992415e-20
NCAS0A141107.343ON7533982353e-19
KNAG0C037407.343ON7273522343e-19
KLLA0D12496g7.343ON7003842319e-19
YDL164C (CDC9)7.343ON7552782282e-18
Skud_4.937.343ON7552782273e-18
Smik_4.747.343ON8453972231e-17
KAFR0B008307.343ON7104052202e-17
KNAG0F019006.228ON457232950.012
ZYRO0E07150g6.228ON449220930.019
CAGL0I09570g6.228ON449131890.053
AFL107W6.228ON463219880.075
NCAS0D041006.228ON449217870.11
TPHA0E027706.228ON450106870.11
SAKL0A04114g6.228ON465104860.13
Smik_7.1416.228ON459223860.15
Ecym_63411.276ON76761840.31
YGL130W (CEG1)6.228ON459223830.32
Suva_7.1336.228ON459224810.49
KAFR0K023606.228ON457217810.51
KLLA0B02200g6.228ON466128810.56
NCAS0G014802.29ON82692810.67
Skud_7.1426.228ON459221800.77
ZYRO0G15180g1.276ON68839791.2
TDEL0D014401.276ON603164781.4
AFR095C1.276ON67024772.0
KLTH0H03850g6.228ON468128762.1
TDEL0E053706.228ON457106752.5
Ecym_21886.228ON461104753.1
TDEL0A007202.29ON678106753.5
YNL216W (RAP1)2.29ON827113735.6
YLR320W (MMS22)4.136ON145448736.7
KLLA0E22617g1.459ON1033181727.0
TBLA0E042408.238ON2156148727.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_56.22414
         (963 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_56.22414 s56 complement(117198..120089) [2892 bp, 963 aa] {...  1993   0.0  
KLTH0C11286g Chr3 (926742..929597) [2856 bp, 951 aa] {ON} simila...  1199   0.0  
TDEL0G04510 Chr7 (819479..822388) [2910 bp, 969 aa] {ON} Anc_6.1...   935   0.0  
NCAS0D02650 Chr4 (508606..511458) [2853 bp, 950 aa] {ON} Anc_6.1...   915   0.0  
ZYRO0C07854g Chr3 (595546..598380) [2835 bp, 944 aa] {ON} simila...   914   0.0  
NDAI0I02260 Chr9 complement(514711..517614) [2904 bp, 967 aa] {O...   909   0.0  
Suva_15.180 Chr15 complement(308983..311829) [2847 bp, 948 aa] {...   894   0.0  
Smik_15.174 Chr15 complement(301851..304688) [2838 bp, 945 aa] {...   891   0.0  
YOR005C Chr15 complement(334509..337343) [2835 bp, 944 aa] {ON} ...   885   0.0  
Kpol_1032.7 s1032 complement(12295..15192) [2898 bp, 965 aa] {ON...   879   0.0  
CAGL0E02695g Chr5 complement(254591..257431) [2841 bp, 946 aa] {...   877   0.0  
KAFR0A05050 Chr1 (1003515..1006361) [2847 bp, 948 aa] {ON} Anc_6...   877   0.0  
Skud_15.166 Chr15 complement(294550..297393) [2844 bp, 947 aa] {...   871   0.0  
KNAG0F02870 Chr6 (543177..546041) [2865 bp, 954 aa] {ON} Anc_6.1...   852   0.0  
TBLA0G01040 Chr7 complement(258966..261884) [2919 bp, 972 aa] {O...   820   0.0  
TPHA0M00260 Chr13 complement(50326..53226) [2901 bp, 966 aa] {ON...   811   0.0  
ACR008W Chr3 (368913..371858) [2946 bp, 981 aa] {ON} Syntenic ho...   810   0.0  
KLLA0D01089g Chr4 complement(97438..100161) [2724 bp, 907 aa] {O...   804   0.0  
ACL155W Chr3 (81492..83585) [2094 bp, 697 aa] {ON} Syntenic homo...   114   3e-25
Kwal_56.24616 s56 (1076178..1078325) [2148 bp, 715 aa] {ON} YDL1...   114   4e-25
NDAI0A01940 Chr1 complement(432302..434599) [2298 bp, 765 aa] {O...   112   2e-24
TPHA0D04570 Chr4 (996539..998749) [2211 bp, 736 aa] {ON} Anc_7.3...   105   2e-22
TBLA0E02050 Chr5 (498038..500200) [2163 bp, 720 aa] {ON} Anc_7.3...   104   3e-22
CAGL0I03410g Chr9 complement(289606..291780) [2175 bp, 724 aa] {...   103   8e-22
KLTH0H01408g Chr8 complement(129752..131923) [2172 bp, 723 aa] {...   102   1e-21
Kpol_2001.71 s2001 (195103..197283) [2181 bp, 726 aa] {ON} (1951...   100   7e-21
SAKL0F10912g Chr6 complement(854430..856511) [2082 bp, 693 aa] {...    99   2e-20
ZYRO0F11572g Chr6 (949236..951431) [2196 bp, 731 aa] {ON} simila...    98   4e-20
Suva_4.82 Chr4 complement(152544..154811) [2268 bp, 755 aa] {ON}...    98   5e-20
TDEL0C02040 Chr3 complement(352579..354696) [2118 bp, 705 aa] {O...    97   5e-20
NCAS0A14110 Chr1 (2774465..2776726) [2262 bp, 753 aa] {ON} Anc_7...    95   3e-19
KNAG0C03740 Chr3 (737968..740151) [2184 bp, 727 aa] {ON} Anc_7.3...    95   3e-19
KLLA0D12496g Chr4 complement(1059684..1061786) [2103 bp, 700 aa]...    94   9e-19
YDL164C Chr4 complement(164987..167254) [2268 bp, 755 aa] {ON}  ...    92   2e-18
Skud_4.93 Chr4 complement(160642..162909) [2268 bp, 755 aa] {ON}...    92   3e-18
Smik_4.74 Chr4 complement(141744..144281) [2538 bp, 845 aa] {ON}...    91   1e-17
KAFR0B00830 Chr2 (157155..159287) [2133 bp, 710 aa] {ON} Anc_7.3...    89   2e-17
KNAG0F01900 Chr6 (367193..368566) [1374 bp, 457 aa] {ON} Anc_6.2...    41   0.012
ZYRO0E07150g Chr5 complement(540507..541856) [1350 bp, 449 aa] {...    40   0.019
CAGL0I09570g Chr9 complement(914062..915411) [1350 bp, 449 aa] {...    39   0.053
AFL107W Chr6 (239635..241026) [1392 bp, 463 aa] {ON} Syntenic ho...    39   0.075
NCAS0D04100 Chr4 (774815..776164) [1350 bp, 449 aa] {ON} Anc_6.2...    38   0.11 
TPHA0E02770 Chr5 (580118..581470) [1353 bp, 450 aa] {ON} Anc_6.2...    38   0.11 
SAKL0A04114g Chr1 (386331..387728) [1398 bp, 465 aa] {ON} highly...    38   0.13 
Smik_7.141 Chr7 (260116..261495) [1380 bp, 459 aa] {ON} YGL130W ...    38   0.15 
Ecym_6341 Chr6 (656835..659138) [2304 bp, 767 aa] {ON} similar t...    37   0.31 
YGL130W Chr7 (266145..267524) [1380 bp, 459 aa] {ON}  CEG1Alpha ...    37   0.32 
Suva_7.133 Chr7 (262417..263796) [1380 bp, 459 aa] {ON} YGL130W ...    36   0.49 
KAFR0K02360 Chr11 complement(481829..483202) [1374 bp, 457 aa] {...    36   0.51 
KLLA0B02200g Chr2 (196341..197741) [1401 bp, 466 aa] {ON} highly...    36   0.56 
NCAS0G01480 Chr7 (266256..268736) [2481 bp, 826 aa] {ON} Anc_2.2...    36   0.67 
Skud_7.142 Chr7 (270563..271942) [1380 bp, 459 aa] {ON} YGL130W ...    35   0.77 
ZYRO0G15180g Chr7 (1223984..1226050) [2067 bp, 688 aa] {ON} simi...    35   1.2  
TDEL0D01440 Chr4 complement(282138..283949) [1812 bp, 603 aa] {O...    35   1.4  
AFR095C Chr6 complement(604687..606699) [2013 bp, 670 aa] {ON} S...    34   2.0  
KLTH0H03850g Chr8 (352972..354378) [1407 bp, 468 aa] {ON} simila...    34   2.1  
TDEL0E05370 Chr5 complement(982429..983802) [1374 bp, 457 aa] {O...    33   2.5  
Ecym_2188 Chr2 (371869..373254) [1386 bp, 461 aa] {ON} similar t...    33   3.1  
TDEL0A00720 Chr1 (119639..121675) [2037 bp, 678 aa] {ON} Anc_2.2...    33   3.5  
YNL216W Chr14 (241689..244172) [2484 bp, 827 aa] {ON}  RAP1Essen...    33   5.6  
YLR320W Chr12 (771940..776304) [4365 bp, 1454 aa] {ON}  MMS22Sub...    33   6.7  
KLLA0E22617g Chr5 complement(2018248..2021349) [3102 bp, 1033 aa...    32   7.0  
TBLA0E04240 Chr5 complement(1074492..1080962) [6471 bp, 2156 aa]...    32   7.6  

>Kwal_56.22414 s56 complement(117198..120089) [2892 bp, 963 aa] {ON}
           YOR005C (DNL4) - ATP dependent DNA ligase [contig 185]
           FULL
          Length = 963

 Score = 1993 bits (5164), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 963/963 (100%), Positives = 963/963 (100%)

Query: 1   MRTKNFGHGQGFRVFMLEANTENLAQQPGEVSQKKPQNFAPSPDFRWLCDELFSKLEEIT 60
           MRTKNFGHGQGFRVFMLEANTENLAQQPGEVSQKKPQNFAPSPDFRWLCDELFSKLEEIT
Sbjct: 1   MRTKNFGHGQGFRVFMLEANTENLAQQPGEVSQKKPQNFAPSPDFRWLCDELFSKLEEIT 60

Query: 61  EDRQKLGKAVTVKRVEVIMYFIKLWRTTVGDNIYPVLRLILPYRDSRAYNIKDYTLVKAV 120
           EDRQKLGKAVTVKRVEVIMYFIKLWRTTVGDNIYPVLRLILPYRDSRAYNIKDYTLVKAV
Sbjct: 61  EDRQKLGKAVTVKRVEVIMYFIKLWRTTVGDNIYPVLRLILPYRDSRAYNIKDYTLVKAV 120

Query: 121 CRSLNLPKDSLTEKRLLNWKQYAPRGTSLSKFCVEEIMKRRKEPQGSQRLTIDALNKCLD 180
           CRSLNLPKDSLTEKRLLNWKQYAPRGTSLSKFCVEEIMKRRKEPQGSQRLTIDALNKCLD
Sbjct: 121 CRSLNLPKDSLTEKRLLNWKQYAPRGTSLSKFCVEEIMKRRKEPQGSQRLTIDALNKCLD 180

Query: 181 ELSKEASAKKWGFNGLSKSPSFQNCLQNMSFSEQRYFFDIILKTRVIGGLEHKFLNCWHP 240
           ELSKEASAKKWGFNGLSKSPSFQNCLQNMSFSEQRYFFDIILKTRVIGGLEHKFLNCWHP
Sbjct: 181 ELSKEASAKKWGFNGLSKSPSFQNCLQNMSFSEQRYFFDIILKTRVIGGLEHKFLNCWHP 240

Query: 241 DAQDYLGVVSDLKVLSETLWNPTMRLGKNELSINIGRAFAPHLAKRLHLSYERVCAKLKQ 300
           DAQDYLGVVSDLKVLSETLWNPTMRLGKNELSINIGRAFAPHLAKRLHLSYERVCAKLKQ
Sbjct: 241 DAQDYLGVVSDLKVLSETLWNPTMRLGKNELSINIGRAFAPHLAKRLHLSYERVCAKLKQ 300

Query: 301 DFIIEEKMDGERIQLHYIERGAKIRFLSRRGTDFTHLYGDSLEHGVISQHLKFKNDVQDC 360
           DFIIEEKMDGERIQLHYIERGAKIRFLSRRGTDFTHLYGDSLEHGVISQHLKFKNDVQDC
Sbjct: 301 DFIIEEKMDGERIQLHYIERGAKIRFLSRRGTDFTHLYGDSLEHGVISQHLKFKNDVQDC 360

Query: 361 VLDGEMVSFDKEKNVVLPFGIVKSTAMEELMNSDTKVDTDGYRPLYMIFDLVYLNGVSLT 420
           VLDGEMVSFDKEKNVVLPFGIVKSTAMEELMNSDTKVDTDGYRPLYMIFDLVYLNGVSLT
Sbjct: 361 VLDGEMVSFDKEKNVVLPFGIVKSTAMEELMNSDTKVDTDGYRPLYMIFDLVYLNGVSLT 420

Query: 421 RLPLHLRKSYLRSILSPVANIVEILSDVRASEPNAIKVSLERAIEMGSEGIILKQFSSPY 480
           RLPLHLRKSYLRSILSPVANIVEILSDVRASEPNAIKVSLERAIEMGSEGIILKQFSSPY
Sbjct: 421 RLPLHLRKSYLRSILSPVANIVEILSDVRASEPNAIKVSLERAIEMGSEGIILKQFSSPY 480

Query: 481 EIGARNDSWIKIKPEYFEELGETMDLVVIGRDPGKKDSLMCGLILADETDGSSVNLASQD 540
           EIGARNDSWIKIKPEYFEELGETMDLVVIGRDPGKKDSLMCGLILADETDGSSVNLASQD
Sbjct: 481 EIGARNDSWIKIKPEYFEELGETMDLVVIGRDPGKKDSLMCGLILADETDGSSVNLASQD 540

Query: 541 DPLRPKQRNPKVISFCNIANGVSDAEFKEIERKTRGLWNLTTACPPPSGLLEFGTKLPTE 600
           DPLRPKQRNPKVISFCNIANGVSDAEFKEIERKTRGLWNLTTACPPPSGLLEFGTKLPTE
Sbjct: 541 DPLRPKQRNPKVISFCNIANGVSDAEFKEIERKTRGLWNLTTACPPPSGLLEFGTKLPTE 600

Query: 601 WIDPRSSLVLEVKARSVDTDELSSKKYKTGSTLRGAYCRALRFNKDWSTCATVQQYEQAK 660
           WIDPRSSLVLEVKARSVDTDELSSKKYKTGSTLRGAYCRALRFNKDWSTCATVQQYEQAK
Sbjct: 601 WIDPRSSLVLEVKARSVDTDELSSKKYKTGSTLRGAYCRALRFNKDWSTCATVQQYEQAK 660

Query: 661 RAHNYHKGKRKSHQISPRKQRKLANVSELYPLLADDSRESIFESNIFQGLQFYILSDYID 720
           RAHNYHKGKRKSHQISPRKQRKLANVSELYPLLADDSRESIFESNIFQGLQFYILSDYID
Sbjct: 661 RAHNYHKGKRKSHQISPRKQRKLANVSELYPLLADDSRESIFESNIFQGLQFYILSDYID 720

Query: 721 SQKKRYEKDQIGTLVRKNSGHVLHNNFVRREEFSRLRIISGKNTVECRSLTEKGYDIIHP 780
           SQKKRYEKDQIGTLVRKNSGHVLHNNFVRREEFSRLRIISGKNTVECRSLTEKGYDIIHP
Sbjct: 721 SQKKRYEKDQIGTLVRKNSGHVLHNNFVRREEFSRLRIISGKNTVECRSLTEKGYDIIHP 780

Query: 781 SWIFDCLNYGSLVKLEPRHCFRTSRKLLENSRQRVDRFGDSFCRPLSYTEFDELVNGQSV 840
           SWIFDCLNYGSLVKLEPRHCFRTSRKLLENSRQRVDRFGDSFCRPLSYTEFDELVNGQSV
Sbjct: 781 SWIFDCLNYGSLVKLEPRHCFRTSRKLLENSRQRVDRFGDSFCRPLSYTEFDELVNGQSV 840

Query: 841 VSPHLSAPEELDGIPLFLFQNFKIYFARVGNDPDQEEYLEKTLRLFGGERSLTLDCCNLV 900
           VSPHLSAPEELDGIPLFLFQNFKIYFARVGNDPDQEEYLEKTLRLFGGERSLTLDCCNLV
Sbjct: 841 VSPHLSAPEELDGIPLFLFQNFKIYFARVGNDPDQEEYLEKTLRLFGGERSLTLDCCNLV 900

Query: 901 VVRVSFKEQKKLFKLVEGLRKRIASTAYSSEVDHRIPHLVSSNWLEACINEQCLVPEEDF 960
           VVRVSFKEQKKLFKLVEGLRKRIASTAYSSEVDHRIPHLVSSNWLEACINEQCLVPEEDF
Sbjct: 901 VVRVSFKEQKKLFKLVEGLRKRIASTAYSSEVDHRIPHLVSSNWLEACINEQCLVPEEDF 960

Query: 961 PPL 963
           PPL
Sbjct: 961 PPL 963

>KLTH0C11286g Chr3 (926742..929597) [2856 bp, 951 aa] {ON} similar
           to uniprot|Q08387 Saccharomyces cerevisiae YOR005C DNL4
           DNA ligase required for nonhomologous end- joining
           (NHEJ) forms stable heterodimer with required cofactor
           Lif1p catalyzes DNA ligation as part of a complex with
           Lif1p and Nej1p involved in meiosis not essential for
           vegetative growth
          Length = 951

 Score = 1199 bits (3103), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 577/947 (60%), Positives = 731/947 (77%), Gaps = 23/947 (2%)

Query: 30  EVSQKKPQNFAPSPDFRWLCDELFSKLEEITEDRQKLGKAVTVKRVEVIMYFIKLWRTTV 89
           ++S+ +P NFAPSPDFRWLC+ELF +L+ I E RQ+LGKAVTVKRVE+I  FIKLWRTTV
Sbjct: 15  KISENEPHNFAPSPDFRWLCEELFHRLDAINEHRQELGKAVTVKRVEIITCFIKLWRTTV 74

Query: 90  GDNIYPVLRLILPYRDSRAYNIKDYTLVKAVCRSLNLPKDSLTEKRLLNWKQYAPRGTSL 149
           GD+ +P LRL+ PYRD RAY+IKD+TL+KAVC++LNL +DSLTE+RLLNWKQYA RGTSL
Sbjct: 75  GDDFFPALRLMFPYRDPRAYHIKDFTLIKAVCKALNLSRDSLTERRLLNWKQYAGRGTSL 134

Query: 150 SKFCVEEIMKRRKEPQGSQRLTIDALNKCLDELSKEASAKK-WGFNGLSKSPSFQNCLQN 208
           SKFCV+EI KRRKEP   ++LTID LN+ LDEL+KEAS KK WG  GLS+S SFQ CL+N
Sbjct: 135 SKFCVQEISKRRKEPLPERQLTIDGLNEKLDELAKEASGKKAWGTTGLSESHSFQFCLKN 194

Query: 209 MSFSEQRYFFDIILKTRVIGGLEHKFLNCWHPDAQDYLGVVSDLKVLSETLWNPTMRLGK 268
           +SF E RYFFDI+LK RVIGGLEHKFL CWHPDAQ YLGVV+DLK+LS+ LWNP++RL K
Sbjct: 195 LSFLELRYFFDIVLKNRVIGGLEHKFLACWHPDAQIYLGVVTDLKILSKKLWNPSVRLDK 254

Query: 269 NELSINIGRAFAPHLAKRLHLSYERVCAKLKQDFIIEEKMDGERIQLHYIERGAKIRFLS 328
            +LSINIG AFAPHLAKRLH+SYER+C+KLK DFI+EEKMDGERIQLHY+  G+ ++FLS
Sbjct: 255 RDLSINIGHAFAPHLAKRLHVSYERICSKLKHDFILEEKMDGERIQLHYVNGGSVLKFLS 314

Query: 329 RRGTDFTHLYGDSLEHGVISQHLKFKNDVQDCVLDGEMVSFDKEKNVVLPFGIVKSTAME 388
           RRG DF+HLYG  +  GVISQ+LK K+DV+DCVLDGEMVS+DK++ ++LPFGIVKS A++
Sbjct: 315 RRGIDFSHLYGQEVARGVISQYLKLKSDVRDCVLDGEMVSYDKKRKIILPFGIVKSAAVD 374

Query: 389 ELMNSDTKVDTDGYRPLYMIFDLVYLNGVSLTRLPLHLRKSYLRSILSPVANIVEILSDV 448
           EL+NS+   + DGYRPLYM+FDLVYLNGVSLT++PLH+RK YL+ ILSPV ++VEIL  +
Sbjct: 375 ELINSEVGNENDGYRPLYMVFDLVYLNGVSLTKVPLHIRKEYLKEILSPVPDVVEILKGI 434

Query: 449 RASEPNAIKVSLERAIEMGSEGIILKQFSSPYEIGARNDSWIKIKPEYFEELGETMDLVV 508
           RA +  AIK  ++RAIEMGSEG+I+KQ SS YE+GARND W+KIKPEYFE+LGETMDLVV
Sbjct: 435 RACDAKAIKNFMQRAIEMGSEGVIVKQASSTYEVGARNDHWVKIKPEYFEDLGETMDLVV 494

Query: 509 IGRDPGKKDSLMCGLILADE----TDGSSVNLASQDDPLRPKQRNPKVISFCNIANGVSD 564
           IGRDPGKKDSLMCGL+++D      +   +    + DP+       K +SFCN+ANGVSD
Sbjct: 495 IGRDPGKKDSLMCGLLVSDSEHILENFGPIEHGKEGDPI------IKCVSFCNVANGVSD 548

Query: 565 AEFKEIERKTRGLWNLTTACPPPSGLLEFGTKLPTEWIDPRSSLVLEVKARSVDTDELSS 624
            EFKEI RKTRG W      PPP  LLEFG+K+P EWIDP++S+V+EVKARSV+  E SS
Sbjct: 549 EEFKEINRKTRGSWVSYKEKPPPLSLLEFGSKIPVEWIDPKNSVVIEVKARSVENSEYSS 608

Query: 625 KKYKTGSTLRGAYCRALRFNKDWSTCATVQQYEQAKRAHNYHKGKRKSHQISPRKQRKLA 684
           K+Y+ GSTL  AYCR +R +KDW+TC +V QY+QAK AHNYH+ KRK HQ+SPR++R   
Sbjct: 609 KRYRAGSTLHSAYCRRIRNDKDWTTCTSVAQYQQAKAAHNYHRYKRKVHQVSPRRKR--- 665

Query: 685 NVSELYPLLADDSRESIFE--SNIFQGLQFYILSDYIDSQKKRYEKDQIGTLVRKNSGHV 742
           NV E++   A +++  +    S+IF+GL FYILSDY+ SQ++RYE+  +   V K+ G +
Sbjct: 666 NVHEIFEYCAGEAKSELDTEGSSIFEGLHFYILSDYVTSQRRRYERGMVAAKVVKHGGLI 725

Query: 743 LHNNFVRREEFSRLRIISGKNTVECRSLTEKGYDIIHPSWIFDCLNYGSLVKLEPRHCFR 802
           + N  +R E  S LRI+SGK T+ECR+L  +GYDII P WIFDC++ G  + +EP+HCF+
Sbjct: 726 VKNIDMRPEHLSYLRIVSGKTTIECRNLVNRGYDIIDPCWIFDCISAGFQLGIEPKHCFQ 785

Query: 803 TSRKLLENSRQRVDRFGDSFCRPLSYTEFDEL----VNGQSVVSPHLSA--PEELDGIPL 856
           TSR+LL+NSRQRVD++GDSF RPL  TEF +L     +  S  S  +S+   ++LD  PL
Sbjct: 786 TSRRLLDNSRQRVDQYGDSFSRPLDTTEFQQLFKFFCSSPSDFSSRISSMLQDDLDEAPL 845

Query: 857 FLFQNFKIYFARVGNDPDQEEYLEKTLRLFGGERSLTLDCCNLVVVRVSFKEQKKLFKLV 916
           FL Q FKIY       P Q   L + + L+GG  S TL+  NLV+V  +    +  +  V
Sbjct: 846 FLLQRFKIYVLAADLIPQQFSILRRKIELYGGVVSETLEGANLVLVPSALSTARTAY-YV 904

Query: 917 EGLRKRIASTAYSSEVDHRIPHLVSSNWLEACINEQCLVPEEDFPPL 963
           + LR++IA  A++   + RIPH+V S WL+ C  EQCLVPEEDF  +
Sbjct: 905 QELRQKIAGNAFAGNTNTRIPHIVRSEWLDTCTTEQCLVPEEDFSSI 951

>TDEL0G04510 Chr7 (819479..822388) [2910 bp, 969 aa] {ON} Anc_6.18
           YOR005C
          Length = 969

 Score =  935 bits (2417), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 485/959 (50%), Positives = 643/959 (67%), Gaps = 31/959 (3%)

Query: 27  QPGEVSQKKPQNFAPSPDFRWLCDELFSKLEEIT-EDRQKLG-KAVTVKRVEVIMYFIKL 84
           Q  E ++K P NFAPSPDF WLC+ELF KLE++  + R+ LG K ++V+  EVI +FI+L
Sbjct: 18  QESESTEKAPPNFAPSPDFIWLCEELFVKLEDVQRQGREHLGNKPLSVRYYEVISHFIRL 77

Query: 85  WRTTVGDNIYPVLRLILPYRDSRAYNIKDYTLVKAVCRSLNLPKDSLTEKRLLNWKQYAP 144
           WR TVG+NI+P L L LPYRD R YNIKDYTLVKA+C  L LPK S TEKRLL WK+ A 
Sbjct: 78  WRKTVGNNIFPALVLSLPYRDRRIYNIKDYTLVKAICSYLALPKQSATEKRLLKWKRRAT 137

Query: 145 RGTSLSKFCVEEIMKRRKEPQGSQRLTIDALNKCLDELSKEASAKKWGFNGLSKSPSFQN 204
           RG  LS FCVEEI KR+ EP   +R+TID LN+CLD L +E +AK  GF GLS SP+F  
Sbjct: 138 RGVRLSNFCVEEIRKRKSEPSPGRRITIDKLNECLDHLVEERNAKG-GFKGLSDSPTFNF 196

Query: 205 CLQNMSFSEQRYFFDIILKTRVIGGLEHKFLNCWHPDAQDYLGVVSDLKVLSETLWNPTM 264
           CLQNMSF E R+FFDI+LK RVIGG EHK LNCWHPDA DYL VVSDL+ ++  LW+P  
Sbjct: 197 CLQNMSFIELRFFFDIVLKNRVIGGQEHKLLNCWHPDALDYLSVVSDLETVASRLWDPEH 256

Query: 265 RLGKNELSINIGRAFAPHLAKRLHLSYERVCAKLKQDFIIEEKMDGERIQLHYIERGAKI 324
           RL +++LSIN+G AF P LAK++ +SYE++C KL  DF+IEEKMDGERIQ+HY++ GAKI
Sbjct: 257 RLRRDDLSINLGYAFVPQLAKKMTISYEKICTKLNNDFLIEEKMDGERIQVHYMDYGAKI 316

Query: 325 RFLSRRGTDFTHLYGDSLEHGVISQHLKFKNDVQDCVLDGEMVSFDKEKNVVLPFGIVKS 384
           RFLSRRG D+T LYG++L+ G ++ +L F ++V+DCVLDGEM++FD ++NVVLPFG+VKS
Sbjct: 317 RFLSRRGVDYTQLYGENLQSGTVANYLNFDSNVRDCVLDGEMITFDTDRNVVLPFGMVKS 376

Query: 385 TAMEELMNSDTKVDTDGYRPLYMIFDLVYLNGVSLTRLPLHLRKSYLRSILSPVANIVEI 444
           +A + L  S   + + G+RP+ M+ DLVYLNGVSL +LPL+ RK +L  +L P  + VEI
Sbjct: 377 SARQAL--STEGICSQGHRPMLMVLDLVYLNGVSLIKLPLYQRKEFLNRVLKPCPHAVEI 434

Query: 445 LSDVRASEPNAIKVSLERAIEMGSEGIILKQFSSPYEIGARNDSWIKIKPEYFEELGETM 504
           L  VR SE  AI+ SLE++I MGSEGI+LK + + YEIGARND WIK+KPEY E+ GE +
Sbjct: 435 LPYVRCSEHTAIRKSLEKSISMGSEGIVLKSYKARYEIGARNDYWIKVKPEYLEQFGENL 494

Query: 505 DLVVIGRDPGKKDSLMCGLILAD----------ETDGSSVNLASQDDPLRPKQRNPKV-- 552
           DLV+IGR PGKKDSLMCGL + +          + + + VNL S+ D L        +  
Sbjct: 495 DLVIIGRTPGKKDSLMCGLAVYEGEEDLNEIEAKRESAIVNLDSEGDELDDTDGKKIIKY 554

Query: 553 -ISFCNIANGVSDAEFKEIERKTRGLWNLTTACPPPSGLLEFGTKLPTEWIDPRSSLVLE 611
            ISFC IANG+S  EFKEI+RKTRG W  +    P + LL FG+K+P EWIDP++S++LE
Sbjct: 555 FISFCVIANGISQQEFKEIDRKTRGAWVKSDQRLPSADLLRFGSKIPEEWIDPKNSIMLE 614

Query: 612 VKARSVDTDELSSKKYKTGSTLRGAYCRALRFNKDWSTCATVQQYEQAKRAHNYHKGKRK 671
           VKARS+D  E S KK+  G TL G YCR +R +KDW+ C +  +  Q +R H    G   
Sbjct: 615 VKARSLDNTESSKKKFAAGCTLHGGYCRRIRDDKDWTGCYSFSELWQ-ERLHKSSTGVGS 673

Query: 672 SHQISPRKQRKLANVSELYPLLADDSRESIFESNIFQGLQFYILSDYID-SQKKRYEKDQ 730
            ++   +K +      + +   A    +    +NIF+GLQFY+LSDYID S+  R  K +
Sbjct: 674 FNKQYSKKMKSKKRKIDPFSGQAAKKHDVFDSTNIFKGLQFYVLSDYIDVSRNVRITKSE 733

Query: 731 IGTLVRKNSGHVLHNNFVRREEFSRLRIISGKNTVECRSLTEKGYDIIHPSWIFDCLNYG 790
              L+ +NSG ++ N   +    S+ RIISGK T ECR+L E+GYDI+ P WI DC+   
Sbjct: 734 FDDLILQNSGKLVRNLISKHHSESQFRIISGKYTAECRALIERGYDILSPQWILDCIRNR 793

Query: 791 SLVKLEPRHCFRTSRKLLENSRQRVDRFGDSFCRPLSYTEFDELVN-GQSVVSPHL--SA 847
            +VKLEPRHCF  S +L+     RVD +GDSF  P++  + D L++       P+L   A
Sbjct: 794 MVVKLEPRHCFNVSSELMTIVNGRVDEYGDSFVNPITEQQLDNLIDTNMKQTEPNLMREA 853

Query: 848 PEELDGIPLFLFQNFKIYF-ARVGNDPDQEEYLEKTLRLFGGERSLTLDCCNLVVVRVSF 906
             ELD +PLFLF    +Y   +V N  D    L    +L GG  +  +  CNL+++    
Sbjct: 854 NSELDVVPLFLFSTRAVYIPPQVFNAVDAYG-LTSKFKLHGGSIASDIPSCNLIIMP--- 909

Query: 907 KEQKKLF--KLVEGLRKRIASTAYSSEVDHRIPHLVSSNWLEACINEQCLVPEEDFPPL 963
            E ++L    LVE +R+ +      ++    IP++V+ +W+E  I E C VPEEDF P+
Sbjct: 910 NENQRLGTQSLVE-MRQSVLQAMGRNDSTPSIPYIVTPDWVEKSIEENCQVPEEDFTPV 967

>NCAS0D02650 Chr4 (508606..511458) [2853 bp, 950 aa] {ON} Anc_6.18
           YOR005C
          Length = 950

 Score =  915 bits (2366), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 465/962 (48%), Positives = 651/962 (67%), Gaps = 44/962 (4%)

Query: 24  LAQQPGEVSQKKPQNFAPSPDFRWLCDELFSKLEEITEDR--QKLGKAVTVKRVEVIMYF 81
           L+Q+P  V    P NF+PSP F+WLCDELF KLE+I   R  + +GK VTV+  EVI +F
Sbjct: 7   LSQEPPPVMT--PCNFSPSPAFQWLCDELFVKLEDIQSKRDPKNIGKPVTVRYYEVINHF 64

Query: 82  IKLWRTTVGDNIYPVLRLILPYRDSRAYNIKDYTLVKAVCRSLNLPKDSLTEKRLLNWKQ 141
           I LWR TVG++I+P L LILPYRD R +NI+DYTL+KA+C  L LP++S TEKRLL+WK 
Sbjct: 65  IALWRKTVGNDIFPALILILPYRDRRLFNIRDYTLIKAICAYLKLPRNSFTEKRLLSWKA 124

Query: 142 YAPRGTSLSKFCVEEIMKRRKEPQGSQRLTIDALNKCLDELSKEASAKKWGFNGLSKSPS 201
            A +G  LS+FCV EI KR+ EP+    +TID LN+CLD+L++E ++K  GF  L+ SP+
Sbjct: 125 RAGKGVKLSQFCVNEIKKRKSEPKDKIEITIDRLNECLDKLAEERNSKGRGFKKLADSPT 184

Query: 202 FQNCLQNMSFSEQRYFFDIILKTRVIGGLEHKFLNCWHPDAQDYLGVVSDLKVLSETLWN 261
           F+ CL+NMSF E ++FFDI+LK RVIGG EHKFLN WHPDAQDYL VVSDL+ ++  LW+
Sbjct: 185 FKFCLENMSFIELQFFFDILLKNRVIGGQEHKFLNAWHPDAQDYLSVVSDLRTVTTRLWD 244

Query: 262 PTMRLGKNELSINIGRAFAPHLAKRLHLSYERVCAKLKQDFIIEEKMDGERIQLHYIERG 321
           P +RL  N+L IN G AFAP LAK+L +SYE++C KLK DFIIEEKMDGERIQLHY + G
Sbjct: 245 PEIRLQNNDLVINPGFAFAPQLAKKLSISYEKICMKLKNDFIIEEKMDGERIQLHYQDYG 304

Query: 322 AKIRFLSRRGTDFTHLYGDSLEHGVISQHLKFKNDVQDCVLDGEMVSFDKEKNVVLPFGI 381
            K++F SRRGTD+T+LYG+S+  G I +HLK   DV+DC+LDGEM+++DK +N++LPFG+
Sbjct: 305 EKLKFFSRRGTDYTYLYGESIHDGFIGKHLKLNKDVKDCILDGEMITYDKTQNMILPFGL 364

Query: 382 VKSTAMEELMNSDTKVDTDGYRPLYMIFDLVYLNGVSLTRLPLHLRKSYLRSILSPVANI 441
           VKS+A    M +   +  +GY+PL+M+FDL+++NG SL  +PL++RK YL  I +P  +I
Sbjct: 365 VKSSARS--MLTKDGIMNEGYQPLFMVFDLIFMNGTSLANIPLNVRKEYLNGIFTPEPHI 422

Query: 442 VEILSDVRASEPNAIKVSLERAIEMGSEGIILKQFSSPYEIGARNDSWIKIKPEYFEELG 501
           +E+LS       ++I+ SLE AI MGSEGI+LK++ S Y + +RND WIK+KPEY E+ G
Sbjct: 423 IELLSSYHRFNEDSIRKSLELAISMGSEGIVLKRYDSRYTVASRNDDWIKVKPEYLEQFG 482

Query: 502 ETMDLVVIGRDPGKKDSLMCGLILADETDGSSVNLASQDD----------PLRPKQRNPK 551
           E MDL+VIGRDPGKKDSLMCGL + +E + + +N  + D+          P+  ++   K
Sbjct: 483 ENMDLIVIGRDPGKKDSLMCGLAVVEEDEKADLNENNDDNVIILDDDEDAPVEQERTIHK 542

Query: 552 VISFCNIANGVSDAEFKEIERKTRGLWNLTTACPPPSGLLEFGTKLPTEWIDPRSSLVLE 611
            +SFC IANG+S  EFK+I+RKTRGLWN +   PPP  LL+FGT+LP EWIDP+ S+V+E
Sbjct: 543 FVSFCVIANGLSQEEFKQIDRKTRGLWNRSDEIPPPDTLLQFGTRLPIEWIDPKKSVVIE 602

Query: 612 VKARSVDTDELSSKKYKTGSTLRGAYCRALRFNKDWSTCATVQQYEQAKRAHNYHKGKRK 671
           VKARS+D  E + +K+ TG TL G YCR +R +KDW TC T+ ++ + K   +   G   
Sbjct: 603 VKARSIDAAESNGRKFATGCTLYGGYCRGIREDKDWQTCYTLSEFLRTKNVKSRRNG--- 659

Query: 672 SHQISPRKQRKLANVSELYPLLADDSRES----IFESNIFQGLQFYILSDYIDSQ-KKRY 726
           S Q+    +R+  N  +    + D S E     +  +  F+ L FY++SD  D     R 
Sbjct: 660 SDQVIHGVKRQKKNRRK---YILDQSLEEEGGLLKNTAFFRNLYFYVISDVFDDVLGTRI 716

Query: 727 EKDQIGTLVRKNSGHVLHNNFVRREEFSRLRIISGKNTVECRSLTEKGYDIIHPSWIFDC 786
           EK+++   +++  G ++HN   ++     LRIISGK T EC +L E+GYD+I+P WI DC
Sbjct: 717 EKERMYKYIQEGGGTLIHNIISKQFGTRNLRIISGKLTNECSALIERGYDVINPQWIVDC 776

Query: 787 LNYGSLVKLEPRHCFRTSRKLLENSRQRVDRFGDSFCRPLSYTEFD-------ELVNGQS 839
           +   SL+KLEP++CF  S +L + + +RVD FGDS+  P++  +          LV  Q 
Sbjct: 777 VQSKSLLKLEPKYCFNVSTELKKLTEKRVDTFGDSYEVPITEEQLSTLLETELNLVRVQG 836

Query: 840 VVSPHLSAPEELDGIPLFLFQNFKIYFARVGNDPDQEEYLEKTLRLFGGERSLTLDCCNL 899
           +V+P+  A EEL  IPLFLFQ+  + F     +     +L++ ++L+GG+ +  +  CNL
Sbjct: 837 LVTPY--ADEELIKIPLFLFQDRIMLFP--NTESKTISFLQEKIKLYGGKLTTDIGKCNL 892

Query: 900 VVVRVSFKEQKKLFKLVEGLRKRIASTAYSSEVDHRIPHLVSSNWLEACINEQCLVPEED 959
           +++      Q+ L +  + L K I +   S EV   IP++V+  W+E  I E   VPEED
Sbjct: 893 IILPNG--NQQLLQRTRDLLTKNIMN---SGEV-PTIPYIVNPLWIERSIEENSQVPEED 946

Query: 960 FP 961
           +P
Sbjct: 947 YP 948

>ZYRO0C07854g Chr3 (595546..598380) [2835 bp, 944 aa] {ON} similar
           to uniprot|Q08387 Saccharomyces cerevisiae YOR005C DNL4
           DNA ligase required for nonhomologous end- joining
           (NHEJ) forms stable heterodimer with required cofactor
           Lif1p catalyzes DNA ligation as part of a complex with
           Lif1p and Nej1p involved in meiosis not essential for
           vegetative growth
          Length = 944

 Score =  914 bits (2362), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 466/946 (49%), Positives = 638/946 (67%), Gaps = 30/946 (3%)

Query: 33  QKKPQNFAPSPDFRWLCDELFSKLEEITEDRQKLG--KAVTVKRVEVIMYFIKLWRTTVG 90
           Q KP NFAPSPDF+WLCDELF K++ + +  +  G  K++TVK  E+I +F+KLWR TVG
Sbjct: 8   QNKPHNFAPSPDFKWLCDELFVKIDNVQKQTRDHGAFKSLTVKYFEIISFFVKLWRKTVG 67

Query: 91  DNIYPVLRLILPYRDSRAYNIKDYTLVKAVCRSLNLPKDSLTEKRLLNWKQYAPRGTSLS 150
           DNIYP L LILPYRD R +NIKDYTL+KA+C  L LP +S+TEKRLL WK+ A RG  LS
Sbjct: 68  DNIYPALILILPYRDRRIFNIKDYTLIKAICSFLRLPANSVTEKRLLRWKRRAGRGIKLS 127

Query: 151 KFCVEEIMKRRKEPQGSQRLTIDALNKCLDELSKEASAKKWGFNGLSKSPSFQNCLQNMS 210
            FCVEEI +RR EP   +R+TID LN+CLD+L++E + K  GF  L+ S  F+ CL+NMS
Sbjct: 128 DFCVEEIRRRRSEPLNGERITIDKLNECLDQLAEERNTKGRGFKSLADSSVFKYCLENMS 187

Query: 211 FSEQRYFFDIILKTRVIGGLEHKFLNCWHPDAQDYLGVVSDLKVLSETLWNPTMRLGKNE 270
           F+E +Y+FDIILK+RVIGG EHKFLNCWHPDA+DYL VVSDLK +++ LW+P+ RL  ++
Sbjct: 188 FTEMKYYFDIILKSRVIGGQEHKFLNCWHPDARDYLSVVSDLKTVADKLWDPSHRLKNDD 247

Query: 271 LSINIGRAFAPHLAKRLHLSYERVCAKLKQDFIIEEKMDGERIQLHYIERGAKIRFLSRR 330
           L +N+G  FAP LAKRL++SY++V  +LK DF IEEKMDGERIQLHY++ G K+++ SRR
Sbjct: 248 LGVNLGLPFAPFLAKRLYISYDKVALRLKSDFYIEEKMDGERIQLHYMDYGRKLKWFSRR 307

Query: 331 GTDFTHLYGDSLEHGVISQHLKFKNDVQDCVLDGEMVSFDKEKNVVLPFGIVKSTAMEEL 390
           G D+T+LYG+ +  G ++++L+    V++CVLDGEM+SFD E+N VLPFG+VKS+A + L
Sbjct: 308 GNDYTYLYGEDIGTGTVAKYLQLDPKVRECVLDGEMISFDTEENSVLPFGLVKSSARDSL 367

Query: 391 MNSDTKVDTDGYRPLYMIFDLVYLNGVSLTRLPLHLRKSYLRSILSPVANIVEILSDVRA 450
             +   + T GYRPLYM+ D +YLNGVSL  +PL+ RK YL +IL+P  + VEI+  +  
Sbjct: 368 --TAEGILTQGYRPLYMVIDFLYLNGVSLINVPLNTRKQYLSAILNPCPHAVEIIQSMHC 425

Query: 451 SEPNAIKVSLERAIEMGSEGIILKQFSSPYEIGARNDSWIKIKPEYFEELGETMDLVVIG 510
            +  +IK SLE+AI MGSEGIILK F S YEIGAR D+WIKIKPEY E+ GE +DL+VIG
Sbjct: 426 YDDTSIKSSLEKAIMMGSEGIILKHFKSKYEIGARTDNWIKIKPEYLEQFGENLDLLVIG 485

Query: 511 RDPGKKDSLMCGLILAD-------ETDGSSVNLASQDDPLRPKQRNPKVISFCNIANGVS 563
           RDPGKKDSLMCGL + +       ++D   VNL S+++   P++   K ISFC IANG+S
Sbjct: 486 RDPGKKDSLMCGLAVLEGDEEPGAQSDKQVVNLDSEEEE-EPRKAVKKFISFCTIANGIS 544

Query: 564 DAEFKEIERKTRGLWNLTTACPPPSGLLEFGTKLPTEWIDPRSSLVLEVKARSVDTDELS 623
             EFK+IERKT G W  T    PP  +LEFG+KLP EWI P  S+VLEVKARS+D  E S
Sbjct: 545 QEEFKQIERKTAGKWKNTEDHKPPK-ILEFGSKLPEEWIYPEDSVVLEVKARSLDNTESS 603

Query: 624 SKKYKTGSTLRGAYCRALRFNKDWSTCATVQQYEQAKRAH-NYHKGKRKSHQISPRKQRK 682
            +K+K G TL G YCR +R +K+W+ C T+ +  Q +R      +       +  +K R+
Sbjct: 604 GRKFKVGCTLHGGYCRRIREDKNWTECYTLYELWQERRKKVPLSEDSNNQKPMKSKKIRR 663

Query: 683 LANVSELYPLLADDSRESIFESNIFQGLQFYILSDYIDSQ-KKRYEKDQIGTLVRKNSGH 741
              VS L   L+ D       S+IF GL FY++SDY+ SQ  +R  K+Q+  L+  N G 
Sbjct: 664 PRIVSRLNQTLSCDDEAKT--SSIFDGLIFYVISDYMASQDSERISKEQLCDLISGNGGK 721

Query: 742 VLHNNFVRREEFSRLRIISGKNTVECRSLTEKGYDIIHPSWIFDCLNYGSLVKLEPRHCF 801
           +  N          LRIISGK T+EC++L E+GYDI+ P W+ DC+N G LV +EPRHCF
Sbjct: 722 LTFNVISDHRVKGGLRIISGKYTLECKALIERGYDILSPQWLMDCVNTGFLVTIEPRHCF 781

Query: 802 RTSRKLLENSRQRVDRFGDSFCRPLSYTEFDELVNGQSVVSP----HLSAPEELDGIPLF 857
             S  + + +R RVD FGDS+   ++     +++  +   S      L    +++ IPLF
Sbjct: 782 SVSEDMEKIARTRVDHFGDSYDVEITEDRLRDILTSKEFDSDFSTGSLDVISDVEDIPLF 841

Query: 858 LFQNFKIYFARVGNDPDQEEYLEKTLRLFGGERSLTLDCCNLVVV---RVSFKEQKKLFK 914
           LF   +I F   G      + L+  +RL+GG+ +  ++ CNL++V   +++ +      +
Sbjct: 842 LFSR-RIVFIPEGFSYLDTQLLKHKVRLYGGQLTDNVNQCNLIIVPDGKINLRG-----R 895

Query: 915 LVEGLRKRIASTAYSSEVDHRIPHLVSSNWLEACINEQCLVPEEDF 960
           ++  LR+ +++ A  +E+   IP +V   W++  I E   VPEEDF
Sbjct: 896 IISDLRRLLSTFAAMTELPPAIPWIVIPAWIDRSIEENIQVPEEDF 941

>NDAI0I02260 Chr9 complement(514711..517614) [2904 bp, 967 aa] {ON}
           Anc_6.18 YOR005C
          Length = 967

 Score =  909 bits (2348), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 459/958 (47%), Positives = 637/958 (66%), Gaps = 43/958 (4%)

Query: 36  PQNFAPSPDFRWLCDELFSKLEEI-----TEDRQKLGKAVTVKRVEVIMYFIKLWRTTVG 90
           P NFAPSP FRWLCDELF KLE I     ++  ++  K + V+  EVI +FI LWR TVG
Sbjct: 19  PHNFAPSPSFRWLCDELFVKLERIQQASTSKASKEFQKPINVQYYEVIQHFINLWRKTVG 78

Query: 91  DNIYPVLRLILPYRDSRAYNIKDYTLVKAVCRSLNLPKDSLTEKRLLNWKQYAPRGTSLS 150
           ++IYP L LILPYRD R YN++DYTL+KA+C  L LPK+S TEKRLL+WKQ A R   LS
Sbjct: 79  NDIYPALILILPYRDRRIYNVRDYTLIKAICSYLKLPKNSFTEKRLLSWKQRAGRSVRLS 138

Query: 151 KFCVEEIMKRRKEPQGSQR--LTIDALNKCLDELSKEASAK-KWGFNGLSKSPSFQNCLQ 207
            F V EI KR+ EPQ   R  +TID LN+CLD LS+E ++K   G+ GLS SP+F  CL+
Sbjct: 139 SFIVSEIKKRKSEPQVGTREEITIDKLNQCLDSLSEERNSKGSMGYRGLSDSPTFVFCLE 198

Query: 208 NMSFSEQRYFFDIILKTRVIGGLEHKFLNCWHPDAQDYLGVVSDLKVLSETLWNPTMRLG 267
           NM+F E ++FFDIILK+RVIGG EHKFLN WHPDAQDYL VVSDLK ++  LW+P + L 
Sbjct: 199 NMTFVELQFFFDIILKSRVIGGHEHKFLNVWHPDAQDYLSVVSDLKTVANKLWDPAVHLK 258

Query: 268 KNELSINIGRAFAPHLAKRLHLSYERVCAKLKQDFIIEEKMDGERIQLHYIERGAKIRFL 327
            ++L+IN+G  FAP  AK+L +SYE++CAKLK DF IEEKMDGERIQLHY + G K+ FL
Sbjct: 259 NDDLTINVGSPFAPQSAKKLSISYEKICAKLKHDFFIEEKMDGERIQLHYQDYGNKLSFL 318

Query: 328 SRRGTDFTHLYGDSLEHGVISQHLKFKNDVQDCVLDGEMVSFDKEKNVVLPFGIVKSTAM 387
           SRRGTD+T+LYG+S++ G +S++L   N+VQ+CVLDGEMV+FDKE+N +LPFG+VKS+A 
Sbjct: 319 SRRGTDYTYLYGESIKDGTVSKYLHLDNNVQNCVLDGEMVTFDKERNALLPFGLVKSSAR 378

Query: 388 EELMNSDTKVDTDGYRPLYMIFDLVYLNGVSLTRLPLHLRKSYLRSILSPVANIVEILSD 447
             +  +   V  +GYRPL M+FDLVYLNGVSL  +PL+ RK YL  I +P  +IVE+L  
Sbjct: 379 SII--TQEGVANEGYRPLLMVFDLVYLNGVSLVNIPLYQRKLYLEKIFTPERHIVELLRS 436

Query: 448 VRASEPNAIKVSLERAIEMGSEGIILKQFSSPYEIGARNDSWIKIKPEYFEELGETMDLV 507
            R S+  +IK +LE AI +GSEG++LK ++S Y + +RND WIK+KPEY E+ GE MDL+
Sbjct: 437 KRCSDERSIKNALEHAISIGSEGVVLKHYNSRYTVASRNDDWIKVKPEYLEQFGENMDLI 496

Query: 508 VIGRDPGKKDSLMCGLILADETDGSS-------VNLASQD----------DPLRPKQRNP 550
           VIG+DPGKKDSLMCGL + +E +          VNL SQD          + +  ++   
Sbjct: 497 VIGKDPGKKDSLMCGLAVVEEDEPEIDEDGNEIVNLDSQDSIGEGEDKEGNEIEREKTIK 556

Query: 551 KVISFCNIANGVSDAEFKEIERKTRGLWNLTTACPPPSGLLEFGTKLPTEWIDPRSSLVL 610
           + +SFC+IANG+S  EFK I R T+G W  +   PPPS LLEFG+++P EWIDP+ S+V+
Sbjct: 557 RFVSFCSIANGISQEEFKYIGRITKGCWKKSDEIPPPSDLLEFGSRVPAEWIDPKDSIVI 616

Query: 611 EVKARSVDTDELSSKKYKTGSTLRGAYCRALRFNKDWSTCATVQQYEQAKR---AHNYHK 667
           EVKARS++ DE ++KK+KTG TL G YCR +R +KDW TC T+ +  + KR     N   
Sbjct: 617 EVKARSLNNDEEATKKFKTGITLYGGYCRQIREDKDWKTCYTLSELRRMKRFKLGSNKRA 676

Query: 668 GKRKSHQISPRKQRKLANVSELYPLLADDSRESIFESNIFQGLQFYILSDYIDSQKKRYE 727
               +H +   K+RK   +   +    + +  ++ +S IF GL FY++SD +D+   R  
Sbjct: 677 NNDATHALDSSKRRKARRIDYGFEKYFEQTPTTLDQSRIFDGLYFYVISDVVDATGSRVS 736

Query: 728 KDQIGTLVRKNSGHVLHNNFVRREEFSRLRIISGKNTVECRSLTEKGYDIIHPSWIFDCL 787
           ++++   +    G ++HN   +    ++ RI+ GK T EC+SL ++GYDII P W+ DC+
Sbjct: 737 REELYDKILNRGGVIVHNVIAKHHGENQFRILCGKYTAECQSLIDRGYDIIEPQWVLDCI 796

Query: 788 NYGSLVKLEPRHCFRTSRKLLENSRQRVDRFGDSFCRPLSYTEFDELVNGQSVVSPHLSA 847
               L+KLEP++CF  S +L++ +++RVD FGDSF   +S   F  L+  ++V S   + 
Sbjct: 797 KDDMLLKLEPKYCFNVSEELMKIAKRRVDGFGDSFEAQISEDSFSRLIE-RNVRSLRNAP 855

Query: 848 P----EELDGIPLFLFQNFKIYFARVGNDPDQEEYLEKTLRLFGGERSLTLDCCNLVVVR 903
           P    + +D +PLFLF    I   R+  D      L+  +RL+GG+ +  L  CNLVV+ 
Sbjct: 856 PSIQYDMVDTVPLFLFYGRTI-LLRI-KDKALFTKLKVQIRLYGGKTTGDLASCNLVVI- 912

Query: 904 VSFKEQKKLFKLVEGLRKRIASTAYSSEVDHRIPHLVSSNWLEACINEQCLVPEEDFP 961
                Q+    + + +R  +      ++    +P++V+  W+++ I+E C VPEED P
Sbjct: 913 -----QQNEIAVAKDVRSSLLKLTSDTDKPPVLPYIVTPEWIDSSISEGCQVPEEDHP 965

>Suva_15.180 Chr15 complement(308983..311829) [2847 bp, 948 aa] {ON}
           YOR005C (REAL)
          Length = 948

 Score =  894 bits (2311), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 457/945 (48%), Positives = 625/945 (66%), Gaps = 28/945 (2%)

Query: 35  KPQNFAPSPDFRWLCDELFSKLEEI-TEDRQKLGKAVTVKRVEVIMYFIKLWRTTVGDNI 93
           +P NFAPSPDFRWLC+ELF+K+EE+        GK+V+ +  E+I  F +LWR TVG+NI
Sbjct: 10  EPHNFAPSPDFRWLCEELFAKVEEVLINGTAGTGKSVSFRYYEIISNFTELWRKTVGNNI 69

Query: 94  YPVLRLILPYRDSRAYNIKDYTLVKAVCRSLNLPKDSLTEKRLLNWKQYAPRGTSLSKFC 153
           YP L L LPYRD R YNIKDY L++ VC  L LPK+S TE+RL +WKQ   +G SLS   
Sbjct: 70  YPALILALPYRDRRIYNIKDYVLIRTVCSYLKLPKNSPTEQRLKDWKQRVGKGRSLSSLL 129

Query: 154 VEEIMKRRKEPQGSQRLTIDALNKCLDELSKEASAKKWGFNGLSKSPSFQNCLQNMSFSE 213
           VEEI KRR EP   + +T+D++N  LDELSKE +A   GF  L KS  F +CL+NM+F E
Sbjct: 130 VEEISKRRTEPT-RKSITVDSVNFYLDELSKEMNASGRGFKNLVKSKPFLHCLENMTFVE 188

Query: 214 QRYFFDIILKTRVIGGLEHKFLNCWHPDAQDYLGVVSDLKVLSETLWNPTMRLGKNELSI 273
            ++FFDI+LK RVIGG EHK LNCWHPDAQDYL VVSDL+V++  L++P +RL  ++LSI
Sbjct: 189 LKFFFDILLKNRVIGGQEHKLLNCWHPDAQDYLSVVSDLRVVTSKLYDPDIRLKNDDLSI 248

Query: 274 NIGRAFAPHLAKRLHLSYERVCAKLKQDFIIEEKMDGERIQLHYIERGAKIRFLSRRGTD 333
            +G AFAP LAK+++LSYE++C  L+ DF +EEKMDGERIQ+HY+  G  I+F SRRG D
Sbjct: 249 KVGFAFAPQLAKKVNLSYEKICHALRNDFFVEEKMDGERIQVHYMNYGKSIKFFSRRGID 308

Query: 334 FTHLYGDSLEHGVISQHLKFKNDVQDCVLDGEMVSFDKEKNVVLPFGIVKSTAMEELMNS 393
           +T+LYG +L  G ISQ+LKF + V++CVLDGEMV+FD  + V+LPFG+VK +A E L  +
Sbjct: 309 YTYLYGVNLLSGTISQYLKFSDSVKECVLDGEMVTFDAMRKVILPFGLVKGSAKEALSFN 368

Query: 394 DTKVDTDGYRPLYMIFDLVYLNGVSLTRLPLHLRKSYLRSILSPVANIVEILSDVRASEP 453
           D  ++ + + PLYM+FDL+YLNG SLT LPL+ RK YL SIL P  ++VEI+   R  + 
Sbjct: 369 D--INNNDFHPLYMVFDLLYLNGTSLTPLPLYQRKEYLSSILIPSKSVVEIVRYSRCYDA 426

Query: 454 NAIKVSLERAIEMGSEGIILKQFSSPYEIGARNDSWIKIKPEYFEELGETMDLVVIGRDP 513
            ++K SLE AI +GSEG++LK +SS Y + +RN++WIK+KPEY EE GE +DL++IGRD 
Sbjct: 427 ESVKKSLEVAISLGSEGVVLKHYSSSYNVASRNNNWIKVKPEYLEEFGENLDLIIIGRDS 486

Query: 514 GKKDSLMCGLILADETDGSSVNLASQDDPL----------RPKQRNPKVISFCNIANGVS 563
           GKKDS M GL++ DE +    +     + L           PK+R  KV+SFC+IANG+S
Sbjct: 487 GKKDSFMLGLLVVDEQETGKTDQEGPSEILNDSSTERRATNPKKRVRKVLSFCSIANGIS 546

Query: 564 DAEFKEIERKTRGLWNLTTACPPPSGLLEFGTKLPTEWIDPRSSLVLEVKARSVDTDELS 623
             EFKEI+RKTRG W  T+   PP  +LEFG+KLP EWI+P  S+VLE+K+RS+D  E +
Sbjct: 547 QEEFKEIDRKTRGHWKKTSGLSPPPSILEFGSKLPAEWIEPSESIVLEIKSRSLDNTETN 606

Query: 624 SKKYKTGSTLRGAYCRALRFNKDWSTCATVQQYEQAKRAHN--YHKGKRKSHQISPRKQR 681
            +KY T  TL G YCR +R++KDW+ C T+ +  + +R  +   H+ +    Q+ P+K R
Sbjct: 607 MQKYATNCTLYGGYCRRIRYDKDWTECYTLDELYENRRTKSNPSHQVENLQLQLVPKK-R 665

Query: 682 KLANVSELYPLLADDSRESIFESNIFQGLQFYILSDYIDSQKK-RYEKDQIGTLVRKNSG 740
           K A VS+ +      SRE    S +F GL FY+LSDYI+S    R  + ++  ++ K+ G
Sbjct: 666 KRALVSDPF----QQSREQKPISGVFAGLFFYVLSDYINSVTGVRITRSELNDVIVKHGG 721

Query: 741 HVLHNNFVRREEFSRLRIISGKNTVECRSLTEKGYDIIHPSWIFDCLNYGSLVKLEPRHC 800
            ++HN  ++R     +R+I  K T ECR+L ++GYDI+HP WI DC  Y  L+ +EP +C
Sbjct: 722 KLIHNVILKRHCIGDVRLIGCKLTRECRALIDRGYDILHPRWIMDCTAYNKLLPIEPSYC 781

Query: 801 FRTSRKLLENSRQRVDRFGDSFCRPLSYTEFDELVNGQSVVSPHLSAPE--ELDGIPLFL 858
           F  S KL   +R+RVD FGDSF   +S ++   L   Q  +     A +  EL  IPLFL
Sbjct: 782 FSVSGKLRAVARRRVDCFGDSFENDISESKLSSLQKSQPDLLSTRQADKSFELQIIPLFL 841

Query: 859 FQNFKIYFARVGNDPDQEEYLEKTLRLFGGERSLTLDCCNLVVVRVSFKEQKKLFKLVEG 918
           F N  +Y  R    P  E  LE  +RLFGG+ +      NL++  + + +       +E 
Sbjct: 842 FSNRIVYIPRSKIGPKDEMLLEMKIRLFGGKITDQQSLSNLII--IPYADPIWRGDCLEE 899

Query: 919 LRKRIASTAYSSEVDH--RIPHLVSSNWLEACINEQCLVPEEDFP 961
           +  +I     +S  D   RIP +V+  W++  I+E C VPEEDFP
Sbjct: 900 VHSQINEHVKASNSDTVPRIPRIVTPEWVDHSISENCQVPEEDFP 944

>Smik_15.174 Chr15 complement(301851..304688) [2838 bp, 945 aa] {ON}
           YOR005C (REAL)
          Length = 945

 Score =  891 bits (2303), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/945 (47%), Positives = 622/945 (65%), Gaps = 25/945 (2%)

Query: 32  SQKKPQNFAPSPDFRWLCDELFSKLEEI-TEDRQKLGKAVTVKRVEVIMYFIKLWRTTVG 90
           S  +PQNFAPSPDF+WLC+ELFSK++E+  +     GK+ + K  EV+  F+++WR TVG
Sbjct: 7   SVPEPQNFAPSPDFKWLCEELFSKIDEVQVKGTIGTGKSRSFKYYEVLSNFVEMWRKTVG 66

Query: 91  DNIYPVLRLILPYRDSRAYNIKDYTLVKAVCRSLNLPKDSLTEKRLLNWKQYAPRGTSLS 150
           +NIYP L L LPYRD R YNIKDY L++ +C  L LPK+S TE RL +WKQ   +G +LS
Sbjct: 67  NNIYPALILALPYRDRRIYNIKDYVLIRTICSYLKLPKNSATEGRLKDWKQRVGKGKNLS 126

Query: 151 KFCVEEIMKRRKEPQGSQRLTIDALNKCLDELSKEASAKKWGFNGLSKSPSFQNCLQNMS 210
              VEEI KRR EP G + +TID +N  LDELSK+ S    GF  L KS  F +CL++MS
Sbjct: 127 SLLVEEIAKRRSEPNG-KAITIDGINSTLDELSKDRSTSGRGFKNLVKSSPFLHCLESMS 185

Query: 211 FSEQRYFFDIILKTRVIGGLEHKFLNCWHPDAQDYLGVVSDLKVLSETLWNPTMRLGKNE 270
           F E +YFFDI+LK+RVIGG EHKFL+CWHPDAQDYL VVSDLKV++  L++P +RL  ++
Sbjct: 186 FVELKYFFDILLKSRVIGGQEHKFLSCWHPDAQDYLSVVSDLKVVASKLYDPRVRLKNDD 245

Query: 271 LSINIGRAFAPHLAKRLHLSYERVCAKLKQDFIIEEKMDGERIQLHYIERGAKIRFLSRR 330
           L+I +G AFAP LAK+++L YE++C  L  DF++EEKMDGERIQ+HY+  G  +RF SRR
Sbjct: 246 LTIKVGFAFAPQLAKKVNLPYEKICRALHNDFLVEEKMDGERIQVHYMNYGKSVRFYSRR 305

Query: 331 GTDFTHLYGDSLEHGVISQHLKFKNDVQDCVLDGEMVSFDKEKNVVLPFGIVKSTAMEEL 390
           G D+T+LYG SL  G IS HL F ++V++CVLDGEMV+FD  + V+LPFG+VK +A + L
Sbjct: 306 GIDYTYLYGASLSSGTISHHLDFTDNVRECVLDGEMVTFDARRKVILPFGLVKGSAKDAL 365

Query: 391 -MNSDTKVDTDGYRPLYMIFDLVYLNGVSLTRLPLHLRKSYLRSILSPVANIVEILSDVR 449
             NS   VD   + PLY++FDL+YLNG SLT LPLH RK YL SIL+PV N+VE++   R
Sbjct: 366 SFNSINNVD---FHPLYVVFDLLYLNGTSLTPLPLHQRKEYLESILTPVKNVVEMVRTSR 422

Query: 450 ASEPNAIKVSLERAIEMGSEGIILKQFSSPYEIGARNDSWIKIKPEYFEELGETMDLVVI 509
                +IK SLE AI +GSEG++LK ++S Y + +RN++WIK+KPEY EE GE +DLV+I
Sbjct: 423 CYNVESIKKSLEVAISLGSEGVVLKYYNSSYNVASRNNNWIKVKPEYLEEFGENLDLVII 482

Query: 510 GRDPGKKDSLMCGLILADETD---------GSSVNLASQDDPLRPKQRNPKVISFCNIAN 560
           GRDPGKKDS M GL+L +E +             N +  ++ L  +++  K++SFC++AN
Sbjct: 483 GRDPGKKDSFMLGLLLLNEKEMDKRDQEVSSGIANNSKNENILYSQKKVKKILSFCSVAN 542

Query: 561 GVSDAEFKEIERKTRGLWNLTTACPPPSGLLEFGTKLPTEWIDPRSSLVLEVKARSVDTD 620
           G+S  EFKEI+RKTRG W  T+   PP+ + EFG+K+P EWI+P  S+VLE+K+RS+D  
Sbjct: 543 GISQEEFKEIDRKTRGCWKKTSEVAPPASIFEFGSKIPAEWIEPNESIVLEIKSRSLDNT 602

Query: 621 ELSSKKYKTGSTLRGAYCRALRFNKDWSTCATVQQYEQAKRAH-NYHKGKRKSHQISPRK 679
           E + +KY T  TL G YC+ +RF+KDW+ C T+ +   ++ A  N      KSH    RK
Sbjct: 603 ETNMQKYATSCTLYGGYCKRIRFDKDWTDCFTLNELYDSRSARFNPSYQAEKSHLKLVRK 662

Query: 680 QRKLANVSELYPLLADDSRESIFESNIFQGLQFYILSDYI-DSQKKRYEKDQIGTLVRKN 738
           +R+    S  +    D   E I  S IF GL FY+LSDY+ ++ + R  + ++   + ++
Sbjct: 663 KRREVLTSNTF----DQKTEQIPTSIIFAGLYFYVLSDYVTNASEVRITRGELENAIVRH 718

Query: 739 SGHVLHNNFVRREEFSRLRIISGKNTVECRSLTEKGYDIIHPSWIFDCLNYGSLVKLEPR 798
            G +++N  ++R     +R+IS KNT ECR+L  +GYDI+HPSW+ DC+ Y  L+ +EP 
Sbjct: 719 GGRLIYNIILKRHYIGDVRLISCKNTTECRALINRGYDILHPSWVIDCVAYKKLIPIEPC 778

Query: 799 HCFRTSRKLLENSRQRVDRFGDSFCRPLSYTEFDELVNGQSVVSP--HLSAPEELDGIPL 856
           +CF  S+K+   + +RVD  GDSF   +S T+   L   Q  + P   +    E+   PL
Sbjct: 779 YCFNVSQKMRAVAEKRVDCLGDSFENDISETKLSLLYKSQHNLPPPEEVERDAEVQVFPL 838

Query: 857 FLFQNFKIYFARVGNDPDQEEYLEKTLRLFGGERSLTLDCCNLVVVRVSFKEQKKLFKLV 916
           FLF N  +Y          E+ LE  +RLFGG+ +     CNLV++       +K    +
Sbjct: 839 FLFSNRIVYIPPRKIGMKYEKTLEMKIRLFGGKITDRQSLCNLVIIPYGDPTWRK--DCI 896

Query: 917 EGLRKRIASTAYSSEVDHRIPHLVSSNWLEACINEQCLVPEEDFP 961
           + + ++I     + +   +IP +V+  W++  I   C VPEEDFP
Sbjct: 897 KEVNEQIKEQVKALDTIPKIPRIVAPEWVDHSIYGNCQVPEEDFP 941

>YOR005C Chr15 complement(334509..337343) [2835 bp, 944 aa] {ON}
           DNL4DNA ligase required for nonhomologous end-joining
           (NHEJ), forms stable heterodimer with required cofactor
           Lif1p, interacts with Nej1p; involved in meiosis, not
           essential for vegetative growth
          Length = 944

 Score =  885 bits (2286), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/942 (47%), Positives = 625/942 (66%), Gaps = 26/942 (2%)

Query: 35  KPQNFAPSPDFRWLCDELFSKLEEI-TEDRQKLGKAVTVKRVEVIMYFIKLWRTTVGDNI 93
           +PQNFAPSPDF+WLC+ELF K+ E+        GK+ + K  E+I  F+++WR TVG+NI
Sbjct: 10  EPQNFAPSPDFKWLCEELFVKIHEVQINGTAGTGKSRSFKYYEIISNFVEMWRKTVGNNI 69

Query: 94  YPVLRLILPYRDSRAYNIKDYTLVKAVCRSLNLPKDSLTEKRLLNWKQYAPRGTSLSKFC 153
           YP L L LPYRD R YNIKDY L++ +C  L LPK+S TE+RL +WKQ   +G +LS   
Sbjct: 70  YPALVLALPYRDRRIYNIKDYVLIRTICSYLKLPKNSATEQRLKDWKQRVGKGGNLSSLL 129

Query: 154 VEEIMKRRKEPQGSQRLTIDALNKCLDELSKEASAKKWGFNGLSKSPSFQNCLQNMSFSE 213
           VEEI KRR EP  S+ +TID +N  LD LS +  A   GF  L KS  F +C++NMSF E
Sbjct: 130 VEEIAKRRAEP-SSKAITIDNVNHYLDSLSGDRFASGRGFKSLVKSKPFLHCVENMSFVE 188

Query: 214 QRYFFDIILKTRVIGGLEHKFLNCWHPDAQDYLGVVSDLKVLSETLWNPTMRLGKNELSI 273
            +YFFDI+LK RVIGG EHK LNCWHPDAQDYL V+SDLKV++  L++P +RL  ++LSI
Sbjct: 189 LKYFFDIVLKNRVIGGQEHKLLNCWHPDAQDYLSVISDLKVVTSKLYDPKVRLKDDDLSI 248

Query: 274 NIGRAFAPHLAKRLHLSYERVCAKLKQDFIIEEKMDGERIQLHYIERGAKIRFLSRRGTD 333
            +G AFAP LAK+++LSYE++C  L  DF++EEKMDGERIQ+HY+  G  I+F SRRG D
Sbjct: 249 KVGFAFAPQLAKKVNLSYEKICRTLHDDFLVEEKMDGERIQVHYMNYGESIKFFSRRGID 308

Query: 334 FTHLYGDSLEHGVISQHLKFKNDVQDCVLDGEMVSFDKEKNVVLPFGIVKSTAMEEL-MN 392
           +T+LYG SL  G ISQHL+F + V++CVLDGEMV+FD ++ V+LPFG+VK +A E L  N
Sbjct: 309 YTYLYGASLSSGTISQHLRFTDSVKECVLDGEMVTFDAKRRVILPFGLVKGSAKEALSFN 368

Query: 393 SDTKVDTDGYRPLYMIFDLVYLNGVSLTRLPLHLRKSYLRSILSPVANIVEILSDVRASE 452
           S   VD   + PLYM+FDL+YLNG SLT LPLH RK YL SILSP+ NIVEI+   R   
Sbjct: 369 SINNVD---FHPLYMVFDLLYLNGTSLTPLPLHQRKQYLNSILSPLKNIVEIVRSSRCYG 425

Query: 453 PNAIKVSLERAIEMGSEGIILKQFSSPYEIGARNDSWIKIKPEYFEELGETMDLVVIGRD 512
             +IK SLE AI +GSEG++LK ++S Y + +RN++WIK+KPEY EE GE +DL+VIGRD
Sbjct: 426 VESIKKSLEVAISLGSEGVVLKYYNSSYNVASRNNNWIKVKPEYLEEFGENLDLIVIGRD 485

Query: 513 PGKKDSLMCGLILADETD-----GSS---VNLASQDDPLR-PKQRNPKVISFCNIANGVS 563
            GKKDS M GL++ DE +     G S   V+ +SQ+  ++  ++R  K++SFC+IANG+S
Sbjct: 486 SGKKDSFMLGLLVLDEEEYKKHQGDSSEIVDHSSQEKHIQNSRRRVKKILSFCSIANGIS 545

Query: 564 DAEFKEIERKTRGLWNLTTACPPPSGLLEFGTKLPTEWIDPRSSLVLEVKARSVDTDELS 623
             EFKEI+RKTRG W  T+   PP+ +LEFG+K+P EWIDP  S+VLE+K+RS+D  E +
Sbjct: 546 QEEFKEIDRKTRGHWKRTSEVAPPASILEFGSKIPAEWIDPSESIVLEIKSRSLDNTETN 605

Query: 624 SKKYKTGSTLRGAYCRALRFNKDWSTCATVQQ-YEQAKRAHNYHKGKRKSHQISPRKQRK 682
            +KY T  TL G YC+ +R++K+W+ C T+   YE      N      +S     RK+RK
Sbjct: 606 MQKYATNCTLYGGYCKRIRYDKEWTDCYTLNDLYESRTVKSNPSYQAERSQLGLIRKKRK 665

Query: 683 LANVSELYPLLADDSRESIFESNIFQGLQFYILSDYI-DSQKKRYEKDQIGTLVRKNSGH 741
              +S+ +      +R+ +  SNIF GL FY+LSDY+ +    R  + ++   + ++ G 
Sbjct: 666 RVLISDSF----HQNRKQLPISNIFAGLLFYVLSDYVTEDTGIRITRAELEKTIVEHGGK 721

Query: 742 VLHNNFVRREEFSRLRIISGKNTVECRSLTEKGYDIIHPSWIFDCLNYGSLVKLEPRHCF 801
           +++N  ++R     +R+IS K T EC++L ++GYDI+HP+W+ DC+ Y  L+ +EP +CF
Sbjct: 722 LIYNVILKRHSIGDVRLISCKTTTECKALIDRGYDILHPNWVLDCIAYKRLILIEPNYCF 781

Query: 802 RTSRKLLENSRQRVDRFGDSFCRPLSYTEFDELVNGQSVVSP--HLSAPEELDGIPLFLF 859
             S+K+   + +RVD  GDSF   +S T+   L   Q  + P   L    E+   PLFLF
Sbjct: 782 NVSQKMRAVAEKRVDCLGDSFENDISETKLSSLYKSQLSLPPMGELEIDSEVRRFPLFLF 841

Query: 860 QNFKIYFARVGNDPDQEEYLEKTLRLFGGERSLTLDCCNLVVVRVSFKEQKKLFKLVEGL 919
            N   Y  R      +++ +E  ++LFGG+ +     CNL+++  +    +K    +  +
Sbjct: 842 SNRIAYVPR-RKISTEDDIIEMKIKLFGGKITDQQSLCNLIIIPYTDPILRK--DCMNEV 898

Query: 920 RKRIASTAYSSEVDHRIPHLVSSNWLEACINEQCLVPEEDFP 961
            ++I     +S+   +I  +V+  W++  INE C VPEEDFP
Sbjct: 899 HEKIKEQIKASDTIPKIARVVAPEWVDHSINENCQVPEEDFP 940

>Kpol_1032.7 s1032 complement(12295..15192) [2898 bp, 965 aa] {ON}
           complement(12295..15192) [2898 nt, 966 aa]
          Length = 965

 Score =  879 bits (2272), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 450/945 (47%), Positives = 629/945 (66%), Gaps = 23/945 (2%)

Query: 34  KKPQNFAPSPDFRWLCDELFSKLEEITEDRQKLG--KAVTVKRVEVIMYFIKLWRTTVGD 91
           ++P NF+PSPDF+WLCDELF KL++I    ++L   K   ++  ++I  FI +WR TVG+
Sbjct: 29  EEPHNFSPSPDFKWLCDELFVKLDQIQFRPKELNGSKPKYIEYYDIINNFIDIWRRTVGN 88

Query: 92  NIYPVLRLILPYRDSRAYNIKDYTLVKAVCRSLNLPKDSLTEKRLLNWKQYAPRGTSLSK 151
           +IYP L L +PYRD R YNIK+  L++ VC  L LPK+S TE+RL+ WK  A R   LS 
Sbjct: 89  DIYPALILTIPYRDRRMYNIKESKLIRIVCDYLKLPKNSETERRLMRWKHRADRNVRLST 148

Query: 152 FCVEEIMKRRKEPQGSQRLTIDALNKCLDELSKEASAKKWGFNGLSKSPSFQNCLQNMSF 211
           FCVEEI KR+ EP+   ++TID LN+CLD L  E   K      +S+S +F+ C +NM++
Sbjct: 149 FCVEEIKKRKGEPREKIKITIDKLNECLDNLVLERGYKGSKSQKISESETFKFCFENMTY 208

Query: 212 SEQRYFFDIILKTRVIGGLEHKFLNCWHPDAQDYLGVVSDLKVLSETLWNPTMRLGKNEL 271
            E +YFFDI+LK +++GGLEHKFLNCWHPDAQDYL VVSDLK++S  LWNP  RL  ++L
Sbjct: 209 VELKYFFDILLKDKIVGGLEHKFLNCWHPDAQDYLSVVSDLKIVSSKLWNPEFRLKYDDL 268

Query: 272 SINIGRAFAPHLAKRLHLSYERVCAKLKQDFIIEEKMDGERIQLHYIERGAKIRFLSRRG 331
           +INI  AF P  AKRL  SY+ +  +LK DF IEEKMDGERIQLHY+  GAK++FLSRRG
Sbjct: 269 TINIDHAFTPETAKRLTYSYDTIARRLKNDFFIEEKMDGERIQLHYMNYGAKLKFLSRRG 328

Query: 332 TDFTHLYGDSLEHGVISQHLKFKNDVQDCVLDGEMVSFDKEKNVVLPFGIVKSTAMEELM 391
            D+++LYGD+  +G I ++L F  DV++C+LDGEMV++D  KN +LPFG+VKS+AM+ L 
Sbjct: 329 LDYSYLYGDNRNNGAIGRYLNFHKDVKECILDGEMVTYDSVKNCILPFGLVKSSAMQSLS 388

Query: 392 NSDTKVDTDGYRPLYMIFDLVYLNGVSLTRLPLHLRKSYLRSILSPVANIVEILSDVRAS 451
            SD  ++ DGY PLYM FDLVYLNG SL+ LPLH RK+YL  +L P  + VEIL  +  +
Sbjct: 389 VSD--IEPDGYHPLYMAFDLVYLNGSSLSTLPLHQRKNYLDKLLIPCPDFVEILPALHCN 446

Query: 452 EPNAIKVSLERAIEMGSEGIILKQFSSPYEIGARNDSWIKIKPEYFEELGETMDLVVIGR 511
           + + IK SLE+AIE+GSEGIILK+F S Y +  R+D WIKIKPEY E+ GE MDL+VIGR
Sbjct: 447 DSSLIKSSLEKAIELGSEGIILKRFDSQYLVAKRSDDWIKIKPEYLEQFGENMDLIVIGR 506

Query: 512 DPGKKDSLMCGLILADETDGSSVN------LASQDDPLRPKQRNPKVISFCNIANGVSDA 565
           DPGKKDSLMCGLIL  + +   +         + +  L+P +R  K+ISFCNIANG+S  
Sbjct: 507 DPGKKDSLMCGLILTGDNEPEEITSLDSNPTDTAESFLKPDKR--KIISFCNIANGISQK 564

Query: 566 EFKEIERKTRGLWNLTTACPPPSGLLEFGTKLPTEWIDPRSSLVLEVKARSVDTDELSSK 625
           EF++I+R T G W       PP  L EFGTK P EWI P  S+VLE+KARS++T+E +  
Sbjct: 565 EFRDIDRYTFGHWIKFDDELPPQDLFEFGTKHPIEWIYPEHSVVLEIKARSLETNESARI 624

Query: 626 KYKTGSTLRGAYCRALRFNKDWSTCATVQQYEQAKRAHNYHKGKRKSHQISPRKQRKLAN 685
           KY TGSTL G YCR +R++KDW +C T  ++ +++   N       +  +  RK+R    
Sbjct: 625 KYGTGSTLFGGYCRQIRYDKDWVSCFTYNEFMESRNLKNALVNYPDNKNLIGRKKRPKKR 684

Query: 686 VSELYPLLADDSRESIFESN-IFQGLQFYILSDYID-SQKKRYEKDQIGTLVRKNSGHVL 743
           +      + ++++++  ESN IF+GL FY++SDYID +   R  K  +  LV +++G ++
Sbjct: 685 MFNSLTEIFENTKDAPDESNVIFRGLHFYVISDYIDETDGSRLSKSDLCNLVLEHNGKLV 744

Query: 744 HNNFVRREEFSRLRIISGKNTVECRSLTEKGYDIIHPSWIFDCLNYGSLVKLEPRHCFRT 803
           HN   R +  +RLRIIS K T E  SL E+GYDIIHP WI DC++   LV+L P HCF  
Sbjct: 745 HNPISRIDILNRLRIISMKYTRETTSLIERGYDIIHPQWILDCISNRKLVRLLPSHCFNV 804

Query: 804 SRKLLENSRQRVDRFGDSFCRPLSYTEFDELVNGQSVVS----PHLSAPEELDGIPLFLF 859
           S  L+E ++ RVDR+GDS+   L+  +F+ L+N Q + S      ++  E    IP+ LF
Sbjct: 805 SSSLMEVTKTRVDRYGDSYETSLTEKDFEILINRQVLKSESADKRITEGENHLKIPILLF 864

Query: 860 QNFKIYFAR-VGNDPDQEEYLEKTLRLFGGERSLTLDCCNLVVVRVSFKEQKKLFKLVEG 918
            N + +    + + P  E  L+  + L+GG+    +  CN++V   +  E +K  ++++ 
Sbjct: 865 CNRRFFIPETLPSTPIYE--LKSKVELYGGKLVNKISDCNVIVFTNTHTENRK--EVMKK 920

Query: 919 LRKRIASTAYSSEVDHRIPHLVSSNWLEACINEQCLVPEEDFPPL 963
           +R+ +     +S     +P +V +NW++ACI+E   VPEED+P +
Sbjct: 921 IRRALVCLDPNSMQVPVLPRIVDANWIDACISECVQVPEEDYPAV 965

>CAGL0E02695g Chr5 complement(254591..257431) [2841 bp, 946 aa] {ON}
           similar to uniprot|Q08387 Saccharomyces cerevisiae
           YOR005c DNL4 DNA ligase IV
          Length = 946

 Score =  877 bits (2266), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 439/952 (46%), Positives = 623/952 (65%), Gaps = 21/952 (2%)

Query: 18  EANTENLAQQPGEVSQKKPQNFAPSPDFRWLCDELFSKLEEITEDRQK--LGKAVTVKRV 75
           E   E  A    + ++++  NFAPSPDF WLC++LF+K++ +  +R    L K VT +  
Sbjct: 4   EGGLETGAHDELKGTEEQAVNFAPSPDFLWLCEQLFAKIDHVQFERANNLLTKPVTARYY 63

Query: 76  EVIMYFIKLWRTTVGDNIYPVLRLILPYRDSRAYNIKDYTLVKAVCRSLNLPKDSLTEKR 135
           EVI  F  LWRTTVG+NIYP LRLILPYRD R +NIKDYTL+KA+C  L LPKDS TEK+
Sbjct: 64  EVISNFTTLWRTTVGNNIYPALRLILPYRDRRVFNIKDYTLIKAICAFLKLPKDSSTEKK 123

Query: 136 LLNWKQYAPRGTSLSKFCVEEIMKRRKEPQ--GSQRLTIDALNKCLDELSKEASAKKWGF 193
           L+NWKQ A R   LSKFCVEEI KRR EPQ   ++R+TID LN  LD+L+ E + +   F
Sbjct: 124 LINWKQDAGRSVRLSKFCVEEIKKRRSEPQIDRNERITIDDLNGYLDQLAIERTEQGRSF 183

Query: 194 NGLSKSPSFQNCLQNMSFSEQRYFFDIILKTRVIGGLEHKFLNCWHPDAQDYLGVVSDLK 253
             L+ S     CL +M+F E +YFFDI+LK R +GG EHK LNCWHPDAQDYL VVSDL+
Sbjct: 184 KNLANSDIMNKCLTSMTFLEMQYFFDILLKNRPLGGHEHKLLNCWHPDAQDYLSVVSDLE 243

Query: 254 VLSETLWNPTMRLGKNELSINIGRAFAPHLAKRLHLSYERVCAKLKQDFIIEEKMDGERI 313
            +++ LW+P+ RLG  +L INIG AFAP LA +LH+SY+++  KL  DF IEEKMDGERI
Sbjct: 244 TVAKRLWDPSQRLGNQDLKINIGLAFAPQLATKLHVSYQKIGEKLGWDFFIEEKMDGERI 303

Query: 314 QLHYIERGAKIRFLSRRGTDFTHLYGDSLEHGVISQHLKFKNDVQDCVLDGEMVSFDKEK 373
           Q+HY   G+ I+F SRR TD+T+LYG++L+ G ++  +    +V+DCVLD E+V+FD   
Sbjct: 304 QMHYTNFGSDIKFYSRRATDYTYLYGNNLKTGTLANFINLNKNVKDCVLDCEVVTFDSNN 363

Query: 374 NVVLPFGIVKSTAMEELMNSDTKVDTDGYRPLYMIFDLVYLNGVSLTRLPLHLRKSYLRS 433
            +VLPFG+VKS+A   L  S   +DT G+ PL M+FD++YLNG +L  LP + R+ YL+ 
Sbjct: 364 KIVLPFGMVKSSAKNML--SQDGIDTQGFHPLLMVFDVLYLNGATLVDLPYYKRREYLKQ 421

Query: 434 ILSPVANIVEILSDVRASEPNAIKVSLERAIEMGSEGIILKQFSSPYEIGARNDSWIKIK 493
           IL+P A+ +EI+  +RA++   IK SLE+A+ +GSEGIILK++ S Y I +R+D WIKIK
Sbjct: 422 ILTPTAHRIEIIKSIRANDEQMIKKSLEKALSVGSEGIILKRYDSRYVIASRSDDWIKIK 481

Query: 494 PEYFEELGETMDLVVIGRDPGKKDSLMCGLILADETDGSSVNLASQDDPLRPKQRNPKVI 553
           PEY E+ GE MDLV++GRDP KKDSLM GL+  +E    S  + +        QR    +
Sbjct: 482 PEYLEQFGENMDLVLMGRDPSKKDSLMLGLLDYEEVIQDSPIMVNSQSSEENSQRFRGFV 541

Query: 554 SFCNIANGVSDAEFKEIERKTRGLWNLTTACPPPSGLLEFGTKLPTEWIDPRSSLVLEVK 613
           S C IANG+S+ E+KEI+RKT+GLWN +   PP    ++FG+K+P +WIDP+ SL+LE+K
Sbjct: 542 SLCIIANGISNEEYKEIDRKTKGLWNDSEKIPPLE-YMKFGSKVPRQWIDPKKSLILEIK 600

Query: 614 ARSVDTDELSSKKYKTGSTLRGAYCRALRFNKDWSTCATVQQYEQAKRAHNYHKGKRKSH 673
           ARS+D    S +K+  G TL G YCR +R +K+W TC T+Q++E+AK  +N+ K      
Sbjct: 601 ARSLDNTRSSERKFAAGCTLFGGYCRQIREDKNWKTCYTLQEFERAKSGNNWRKRGSSKP 660

Query: 674 QISPRKQRKLANVSELYPLLADDSRESIFESNIFQGLQFYILSDYIDS-QKKRYEKDQIG 732
           Q    K+R+   +S +   L +D  E    S+IF G+ FY+LSDY D  ++KR +K +I 
Sbjct: 661 QKVISKKRRYNIISSVNKAL-EDFAELEHRSDIFDGMYFYVLSDYFDGVKRKRIKKSEIQ 719

Query: 733 TLVRKNSGHVLHNNFVRREEFSRLRIISGKNTVECRSLTEKGYDIIHPSWIFDCLNYGSL 792
            ++  N G ++ N   R    + LRIIS +NTVEC SL  +GYDII P W+FDCL  G +
Sbjct: 720 KVIVANGGQLVQNVITRNYNLNDLRIISSRNTVECNSLIVRGYDIISPKWVFDCLLSGKI 779

Query: 793 VKLEPRHCFRTSRKLLENSRQRVDRFGDSFCRPLSYTEFDELVNGQSVVS----PHLSAP 848
           +KLEP HCF  S++L++ + +R+D++GD + R ++  E+  L + +   +    P +   
Sbjct: 780 MKLEPSHCFNFSKQLMDYAYKRIDQYGDPYERDINKYEWSSLTSEKICTTAKQQPDVQFD 839

Query: 849 EELDGIPLFLFQNFKIYFARVGNDPDQEEYLEKTLRLFGGERSLTLDCCNLVVVRVSFKE 908
             L  +P FLF    ++     N+  +E ++   +  +GG+ +  L   NLV+V  +  +
Sbjct: 840 NSLMDVPHFLFHGRIVFLLSDNNNIQKESFM---VDAYGGKVTNELSSANLVIVVGAVTQ 896

Query: 909 QKKLFKLVEGLRKRIASTAYSSEVDHRIPHLVSSNWLEACINEQCLVPEEDF 960
           ++     +  +RK+I+S     +   RIP +VS  WL  CI +   V E+++
Sbjct: 897 RR-----INDIRKQISSEVIKQDHPPRIPDMVSEGWLYDCIKQNTQVAEDNY 943

>KAFR0A05050 Chr1 (1003515..1006361) [2847 bp, 948 aa] {ON} Anc_6.18
           YOR005C
          Length = 948

 Score =  877 bits (2265), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 452/944 (47%), Positives = 608/944 (64%), Gaps = 22/944 (2%)

Query: 36  PQNFAPSPDFRWLCDELFSKLEEITEDRQKLGKAVTVKRVEVIMYFIKLWRTTVGDNIYP 95
           P+NFAPSP F+WLC+ELFSKLEE+   R    K +T++  E+I  F+ LWRTTVGD+IYP
Sbjct: 11  PRNFAPSPQFKWLCEELFSKLEEVPNQRHLTTKRITLRYYEIITNFVNLWRTTVGDDIYP 70

Query: 96  VLRLILPYRDSRAYNIKDYTLVKAVCRSLNLPKDSLTEKRLLNWKQYAPRGTSLSKFCVE 155
            L L LPYRD R YN+KDYTL+KA+C  L LPK+S TEKRLLNWKQ A R   LS  CV 
Sbjct: 71  ALILALPYRDRRMYNVKDYTLIKAICTYLKLPKNSFTEKRLLNWKQRADRSVKLSVSCVN 130

Query: 156 EIMKRRKEPQGSQRLTIDALNKCLDELSKEASAKKWGFNGLSKSPSFQNCLQNMSFSEQR 215
           E+ KR+ EP     +T+D LN  LD LS++ + K  G+  LS+S  F  C++ MSF E R
Sbjct: 131 EMRKRKSEPVEKSPITLDELNTLLDFLSQDRNIKGRGYKNLSESSIFTYCIEKMSFMELR 190

Query: 216 YFFDIILKTRVIGGLEHKFLNCWHPDAQDYLGVVSDLKVLSETLWNPTMRLGKNELSINI 275
           YFFDIILK RVIG  EHK LN WHPDA+DYL VVSDLK +   LWNP +RL  +ELSINI
Sbjct: 191 YFFDIILKARVIGPHEHKLLNAWHPDAEDYLSVVSDLKTVCTRLWNPNIRLRHDELSINI 250

Query: 276 GRAFAPHLAKRLHLSYERVCAKLKQDFIIEEKMDGERIQLHYIERGAKIRFLSRRGTDFT 335
           G AFAPHLAK+L +SY+++C KLK DF IEEKMDGERIQ+HY++ G  I+FLSRRG D+T
Sbjct: 251 GYAFAPHLAKKLSISYDKICKKLKNDFFIEEKMDGERIQIHYMDYGNDIKFLSRRGVDYT 310

Query: 336 HLYGDSLEHGVISQHLKFKNDVQDCVLDGEMVSFDKEKNVVLPFGIVKSTAMEELMNSDT 395
           +LYG++L  G I+ +LK   DV++CVLDGEMV++D++++++LPFG+VKS AM  L  +  
Sbjct: 311 YLYGENLSTGTIACYLKLNRDVKECVLDGEMVTYDEDQDILLPFGMVKSAAMNAL--TKE 368

Query: 396 KVDTDGYRPLYMIFDLVYLNGVSLTRLPLHLRKSYLRSILSPVANIVEILSDVRASEPNA 455
           ++    Y PL M+FDLV+LNG SL   PL+ RK YL S+L P    V+I++  R S  N 
Sbjct: 369 EISGQDYHPLLMVFDLVFLNGSSLVEFPLYQRKDYLASVLEPYRARVQIVNFTRCSNENI 428

Query: 456 IKVSLERAIEMGSEGIILKQFSSPYEIGARNDSWIKIKPEYFEELGETMDLVVIGRDPGK 515
           I+ SLE AI +GSEGI+LK ++S Y IG+RNDSWIKIKPEY E+ GE MDL+VIGRD  K
Sbjct: 429 IRKSLEHAISVGSEGIVLKNYNSRYMIGSRNDSWIKIKPEYLEQFGENMDLIVIGRDSAK 488

Query: 516 KDSLMCGLILAD--------ETDGSSVNLASQDDPLRPKQRN---PKVISFCNIANGVSD 564
           KDS  CGL + D        E D   VNL S +      + N    KV+SFC IANG+S 
Sbjct: 489 KDSFYCGLTVLDEEEEKLVEEIDKGVVNLVSDESDYENPENNRHIKKVVSFCMIANGISQ 548

Query: 565 AEFKEIERKTRGLWNLTTACPPPSGLLEFGTKLPTEWIDPRSSLVLEVKARSVDTDELSS 624
            E+KEI RKTRG W  T   PPP  L+EFGT++P EWI+P  S+VLE+KARS+D  E S 
Sbjct: 549 NEYKEIYRKTRGFWKKTEEVPPPPELIEFGTQVPMEWIEPEHSVVLEIKARSLDNTESSC 608

Query: 625 KKYKTGSTLRGAYCRALRFNKDWSTCATVQQYEQAKRAHNYHKGKRKSHQISPRKQRKLA 684
           K++K G TL G YCR +R + DW +  ++ +  + +R  +Y     K   +  +K+RK  
Sbjct: 609 KRFKAGCTLYGGYCRRIRDDVDWKSSFSLAELRRDRRIKHYPGTSEKDTLLKSKKRRKKQ 668

Query: 685 NVSELYPLLADDSRESIFESNIFQGLQFYILSDYIDSQKK-RYEKDQIGTLVRKNSGHVL 743
            ++ L   L  + R+    S IF GL FYILSDY D+ +  R  KD +  L+ +N G + 
Sbjct: 669 LLTPLNQNL--NPRDIQTTSKIFDGLFFYILSDYFDTNENVRISKDDLQKLLLENGGKIS 726

Query: 744 HNNFVRREEFSRLRIISGKNTVECRSLTEKGYDIIHPSWIFDCLNYGSLVKLEPRHCFRT 803
           HN   +RE  S LRI+ GK T EC  L ++GYDI+ P W+ DC+    +VK+EP HCF  
Sbjct: 727 HNIVSKRESKSNLRILCGKYTAECNVLIKRGYDILSPQWVIDCVENKKIVKIEPSHCFSV 786

Query: 804 SRKLLENSRQRVDRFGDSFCRPLSYTEFDELVNGQSVVSPHLSAPE----ELDGIPLFLF 859
           S  L+  + +RVD++GDS+   LS +    ++     +SP L +P     + + +P FLF
Sbjct: 787 SDDLMALAMRRVDKYGDSYESLLSVSRLSYILRSSKDISPDLLSPANMSLDFEKVPYFLF 846

Query: 860 QNFKIYFARVGNDPDQEEYLEKTLRLFGGERSLTLDCCNLVVVRVSFKEQKKLFKLVEGL 919
              K +      D          ++L+GG+    +  CN+V+   +  E   + + ++ +
Sbjct: 847 WRRKAFVMEHNFDKSSIRETILKIQLYGGKVVKNISECNIVIFPKA--EITVIRESMKFI 904

Query: 920 RKRIASTAYSSEVDHRIPHLVSSNWLEACINEQCLVPEEDFPPL 963
           R  +A T  +S     +P +VS  W++A I +   VPEED+ P+
Sbjct: 905 RNTLAKTVSTSVELPMLPRIVSFEWIDASIEKNVQVPEEDYVPM 948

>Skud_15.166 Chr15 complement(294550..297393) [2844 bp, 947 aa] {ON}
           YOR005C (REAL)
          Length = 947

 Score =  871 bits (2250), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 443/943 (46%), Positives = 615/943 (65%), Gaps = 26/943 (2%)

Query: 35  KPQNFAPSPDFRWLCDELFSKLEEI-TEDRQKLGKAVTVKRVEVIMYFIKLWRTTVGDNI 93
           +PQNFAPSPDF+WLC+ELF +++ +        GK+ + K  E+I  F++ WR  VG+NI
Sbjct: 10  EPQNFAPSPDFKWLCEELFVRIDNVRINGTAGTGKSASFKYYEIISNFVESWRKGVGNNI 69

Query: 94  YPVLRLILPYRDSRAYNIKDYTLVKAVCRSLNLPKDSLTEKRLLNWKQYAPRGTSLSKFC 153
           YP L L LPYRD R YNIKDY L++ +C  L LP++S+TE+RL +WKQ   R  +LS   
Sbjct: 70  YPALVLALPYRDRRIYNIKDYILIRTICSYLKLPRNSVTEQRLKSWKQRVSRARNLSSLL 129

Query: 154 VEEIMKRRKEPQGSQRLTIDALNKCLDELSKEASAKKWGFNGLSKSPSFQNCLQNMSFSE 213
           VEEI KRR EP G + +TID +N  LDELSKE S    GF  L  S  F +CL++MSF E
Sbjct: 130 VEEIAKRRPEPNG-KSITIDGVNDYLDELSKERSISGRGFKDLVNSKPFLSCLESMSFVE 188

Query: 214 QRYFFDIILKTRVIGGLEHKFLNCWHPDAQDYLGVVSDLKVLSETLWNPTMRLGKNELSI 273
            +YFFDI+LK RVIGG EH+FLNCWHPDAQDYL VVSDLKV++  L++P +RL  ++LSI
Sbjct: 189 LKYFFDIVLKNRVIGGQEHRFLNCWHPDAQDYLSVVSDLKVVTSKLYDPRVRLKNDDLSI 248

Query: 274 NIGRAFAPHLAKRLHLSYERVCAKLKQDFIIEEKMDGERIQLHYIERGAKIRFLSRRGTD 333
            +G AFAP LAK++ L YE++C  L  DF+IEEKMDGERIQ+HY+  G  I+F SRRG D
Sbjct: 249 KVGFAFAPQLAKKVSLPYEKICRALHNDFLIEEKMDGERIQVHYMNYGKSIKFFSRRGID 308

Query: 334 FTHLYGDSLEHGVISQHLKFKNDVQDCVLDGEMVSFDKEKNVVLPFGIVKSTAMEELMNS 393
           +T+LYG SL  G ISQ+LK  N V++CVLDGEMV+FD  + V+LPFG+VK +A   L  S
Sbjct: 309 YTYLYGASLSSGTISQYLKLTNTVKECVLDGEMVTFDSTRKVILPFGLVKGSAKGVLSCS 368

Query: 394 DTKVDTDGYRPLYMIFDLVYLNGVSLTRLPLHLRKSYLRSILSPVANIVEILSDVRASEP 453
           D  ++   +RPLYM+FDL+YLN +SL  LPLH RK YL SIL+P  N+VEI+   R  + 
Sbjct: 369 D--INNSDFRPLYMVFDLLYLNEISLAPLPLHQRKKYLSSILTPFKNVVEIVQSTRCYDV 426

Query: 454 NAIKVSLERAIEMGSEGIILKQFSSPYEIGARNDSWIKIKPEYFEELGETMDLVVIGRDP 513
            ++K SLE AI +GSEG++LK ++S Y I +RN +WIK+KPEY EE GE +DL++IGRD 
Sbjct: 427 QSVKNSLEVAISLGSEGVVLKYYNSSYNIASRNYNWIKVKPEYLEEFGENLDLIIIGRDS 486

Query: 514 GKKDSLMCGLILADE----------TDGSSVNLAS-QDDPLRPKQRNPKVISFCNIANGV 562
           GKKDS M GL++ DE          +    VN +  + D +  K++  KV+SFC++ANG+
Sbjct: 487 GKKDSFMLGLLVIDEREMEERDQELSSSEVVNDSKIEQDVINSKKKVKKVLSFCSVANGI 546

Query: 563 SDAEFKEIERKTRGLWNLTTACPPPSGLLEFGTKLPTEWIDPRSSLVLEVKARSVDTDEL 622
           S  EFKEI R+TRG W  T+   PPS +L+FG+++P EWI+P  S+VLE+K+RS+D  E 
Sbjct: 547 SHEEFKEINRRTRGHWKRTSDFSPPS-ILQFGSRIPAEWIEPSDSIVLEIKSRSLDNTET 605

Query: 623 SSKKYKTGSTLRGAYCRALRFNKDWSTCATVQQYEQAKRAHNYHKGKRKSHQIS-PRKQR 681
           S ++Y T  TL G YCR +R++KDW+ C T+ Q  + +   +    + ++ Q+    K+R
Sbjct: 606 SIRRYATSCTLYGGYCRRIRYDKDWTDCYTLAQLYEDRPIKSKPNQQDENFQLQLAHKKR 665

Query: 682 KLANVSELYPLLADDSRESIFESNIFQGLQFYILSDYIDSQKK-RYEKDQIGTLVRKNSG 740
           K A +S+ +  +    RE    S+IF GL FY+LSDY+      R  +  +   + K+ G
Sbjct: 666 KRALISDPFHQI----REQKLISSIFAGLFFYVLSDYVTKDTGVRITRAGLEDAIVKHGG 721

Query: 741 HVLHNNFVRREEFSRLRIISGKNTVECRSLTEKGYDIIHPSWIFDCLNYGSLVKLEPRHC 800
            ++HN  ++R     +R+IS K T+ECR L ++GYDI+HPSW+ DC+ Y  L+ +EP +C
Sbjct: 722 KLIHNVILKRHCIGDVRLISCKTTIECRILIDRGYDIVHPSWVMDCIAYKQLIFIEPSYC 781

Query: 801 FRTSRKLLENSRQRVDRFGDSFCRPLSYTEFDELVNGQSVVSP--HLSAPEELDGIPLFL 858
           F  S KL E + +RVD  GDSF   +S  +   L   +  +S    +    E   IPLFL
Sbjct: 782 FSVSHKLREVAEKRVDCLGDSFENNISERKLSLLFKSRQDLSSIGEIGIDSEAQVIPLFL 841

Query: 859 FQNFKIYFARVGNDPDQEEYLEKTLRLFGGERSLTLDCCNLVVVRVSFKEQKKLFKLVEG 918
           F N  +Y  R      +E+ LE  +RLFGGE +     CNL+++      ++K    +E 
Sbjct: 842 FSNRIVYIPRTKTGLREEKLLEMKIRLFGGEITGQQSLCNLIIIPYVDSSRRK--DCIEK 899

Query: 919 LRKRIASTAYSSEVDHRIPHLVSSNWLEACINEQCLVPEEDFP 961
           + ++I     +S    ++  +VS  W++  INE C VPEEDFP
Sbjct: 900 VNEQIKEQMKASHTVPKVARIVSPGWVDHSINENCQVPEEDFP 942

>KNAG0F02870 Chr6 (543177..546041) [2865 bp, 954 aa] {ON} Anc_6.18
           YOR005C
          Length = 954

 Score =  852 bits (2201), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 446/956 (46%), Positives = 617/956 (64%), Gaps = 27/956 (2%)

Query: 30  EVSQKKPQNFAPSPDFRWLCDELFSKLEEI-TEDRQKLGKAVTVKRVEVIMYFIKLWRTT 88
           E  ++ P NFAPSPDF+WLCDELF K + + T+DR+   K +TV+  EV+  F++LWR T
Sbjct: 3   EKVEEGPTNFAPSPDFQWLCDELFVKFDLVATQDRRINLKPITVRYYEVVSNFVQLWRKT 62

Query: 89  VGDNIYPVLRLILPYRDSRAYNIKDYTLVKAVCRSLNLPKDSLTEKRLLNWKQYAPRGTS 148
           VG+N YPVL L LPYRD R YNIKD TL+KA+C  L+LPK S TEK+LLNWKQ A R   
Sbjct: 63  VGNNFYPVLILALPYRDRRTYNIKDVTLIKAICLYLDLPKRSSTEKKLLNWKQRASRNER 122

Query: 149 LSKFCVEEIMKRRKEPQGSQR--LTIDALNKCLDELSKEASAKKWGFNGLSKSPSFQNCL 206
           LS FCV EI KR+  P  S+R  +T+D LN  LD+L+   S++  G   L+ S  F+ CL
Sbjct: 123 LSSFCVAEIRKRKSGPDPSKRQAITLDKLNSILDDLANGKSSRGQGSRTLADSSHFKFCL 182

Query: 207 QNMSFSEQRYFFDIILKTRVIGGLEHKFLNCWHPDAQDYLGVVSDLKVLSETLWNPTMRL 266
           +NMSF E +YFFDI+LK R+IGG EHK LN WHPDA DY  VVSDL  +++ L+ P++RL
Sbjct: 183 ENMSFIELKYFFDILLKVRIIGGHEHKLLNAWHPDAVDYFSVVSDLSSVTKKLYEPSVRL 242

Query: 267 GKNELSINIGRAFAPHLAKRLHLSYERVCAKLKQDFIIEEKMDGERIQLHYIERGAKIRF 326
              +L++ IG AFAPHLAKRL++SYE++  KL  DF IEEKMDGERIQ+HY++ G +I+F
Sbjct: 243 RNEDLTLKIGSAFAPHLAKRLNISYEKILKKLGSDFSIEEKMDGERIQIHYMDYGNEIKF 302

Query: 327 LSRRGTDFTHLYGDSLEHGVISQHLKFKNDVQDCVLDGEMVSFDKEKNVVLPFGIVKSTA 386
           LSRRGTD+T+LYG     G I+ +LK   +V++C+LDGEMV++D+EK ++LPFG+VKS+A
Sbjct: 303 LSRRGTDYTYLYGGDTSTGTIACYLKLNENVKECILDGEMVTYDQEKQMILPFGLVKSSA 362

Query: 387 MEELMNSDTKVDTDGYRPLYMIFDLVYLNGVSLTRLPLHLRKSYLRSILSPVANIVEILS 446
              L  S   +    Y PL+M FDLVYLNG SL  LPL+ RK YL  IL+     V+I+S
Sbjct: 363 KNFL--SKESISNGSYHPLFMAFDLVYLNGTSLVDLPLYQRKDYLSKILTKCNGFVDIVS 420

Query: 447 DVRASEPNAIKVSLERAIEMGSEGIILKQFSSPYEIGARNDSWIKIKPEYFEELGETMDL 506
             R +   +I  SL  AI +GSEGIILK+ +S Y + +RNDSWIKIKP+Y ++ GE MDL
Sbjct: 421 FARCNNLESITKSLAAAISVGSEGIILKKLNSRYMVASRNDSWIKIKPQYLKQFGENMDL 480

Query: 507 VVIGRDPGKKDSLMC--GLILAD-------ETDGSSVNLASQD-DPLRPK-QRNPKVISF 555
           ++IGRDPGKKD+ MC  G+ + D       + +  +++L ++D +P  PK  R  K +SF
Sbjct: 481 IIIGRDPGKKDAFMCALGVTIDDPQPRVLQQEENVNLDLDTEDSEPETPKASRIVKFVSF 540

Query: 556 CNIANGVSDAEFKEIERKTRGLWNLTTACPPPSGLLEFGTKLPTEWIDPRSSLVLEVKAR 615
           C IANG+S+AEFKEI++KTRGLW       PPS  L+FGTK P EWIDP+ SLVLEVK+R
Sbjct: 541 CTIANGISNAEFKEIDQKTRGLWRRFDQVKPPSEYLQFGTKKPVEWIDPKESLVLEVKSR 600

Query: 616 SVDTDELSSKKYKTGSTLRGAYCRALRFNKDWSTCATVQQYEQAKRAHNYHKGKRKSHQI 675
           S+D  E + KKY+ G TL G YCRA+R++KDW+TC TV ++E+  R +   K        
Sbjct: 601 SLDNTESNVKKYRAGVTLFGGYCRAVRYDKDWTTCYTVSEFER-DRQYKLPKVNAGESIT 659

Query: 676 SPRKQRKLANVSELYPLLADDSRESI--FESNIFQGLQFYILSDYIDS-QKKRYEKDQIG 732
           +  K RK  N + +  +++   + +     S+IFQ L F +LSDY+D     R +++ + 
Sbjct: 660 TSNKGRKKRNTTSILGVISPRKKRTPEGEHSDIFQNLHFCVLSDYLDPYTGNRIDRNTLT 719

Query: 733 TLVRKNSGHVLHNNFVRREEFSRLRIISGKNTVECRSLTEKGYDIIHPSWIFDCLNYGSL 792
            L+    G V++N   +  E   LRII     +EC +L ++GYDI+ PSW+ DC+    L
Sbjct: 720 QLIIDYGGKVIYNVLAKEGEEGMLRIICDGFNMECNALIKRGYDILSPSWVLDCIESARL 779

Query: 793 VKLEPRHCFRTSRKLLENSRQRVDRFGDSFCRPLSYTEFDELVNGQSVVSPHLS-APEEL 851
           +KLE  HCF  S++L+E S  RVD + DSF   +S T  D L++      P  S + E L
Sbjct: 780 LKLERNHCFNVSKELMELSSTRVDEYDDSFENEISTTRLDRLIDVHLHNMPSGSFSGENL 839

Query: 852 D----GIPLFLFQNFKIYFARVGNDPDQEEYLEKTLRLFGGERSLTLDCCNLVVVRVSFK 907
           D    G+P  LF +  ++ A           +    +LFGG+ + T++ CNL+++  +  
Sbjct: 840 DFELRGLPPLLFFDRSVFIAETKLSDRIYAKISSETKLFGGQVTHTIEDCNLIIIPNTDD 899

Query: 908 EQKKLFKLVEGLRKRIASTAYSSEVDHRIPHLVSSNWLEACINEQCLVPEEDFPPL 963
           E K   ++++ +R ++AS         RIP +VS  WL   I E   VPEE++  L
Sbjct: 900 EDK--IQVLQKIRGKLASMIQKLNSTERIPPIVSEEWLYQSIKENIQVPEENYSVL 953

>TBLA0G01040 Chr7 complement(258966..261884) [2919 bp, 972 aa] {ON}
           Anc_6.18 YOR005C
          Length = 972

 Score =  820 bits (2118), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 428/962 (44%), Positives = 608/962 (63%), Gaps = 46/962 (4%)

Query: 36  PQNFAPSPDFRWLCDELFSKLEEITEDRQK------LGKAVTVKRVEVIMYFIKLWRTTV 89
           P+NFAPSPDF+WLCDELF K+++I E  +         K ++ +  + I +FIKLWRTT+
Sbjct: 23  PKNFAPSPDFKWLCDELFVKIDKIREQIKNKTANTISNKPISTRYFDTITHFIKLWRTTI 82

Query: 90  GDNIYPVLRLILPYRDSRAYNIKDYTLVKAVCRSLNLPKDSLTEKRLLNWKQYAPRGTSL 149
           GD+I+P LRLILPYRD R YNIKD TL++A+C  L LPK+S+ E+RL+ WK  A R  +L
Sbjct: 83  GDDIFPALRLILPYRDRRVYNIKDLTLIRAICSYLKLPKNSVVERRLIRWKYKADRYETL 142

Query: 150 SKFCVEEIMKRRKEPQGSQ--RLTIDALNKCLDELSKEASAKKWGF---NGLSKSPSFQN 204
           + FC+ EI KR+ EPQ +Q  R++ID LN+ LD+L    + + W     + L +  +F+ 
Sbjct: 143 ATFCIHEISKRKNEPQVTQVERISIDKLNEILDDLV--VNRQNWNNKKRSNLLQVETFKF 200

Query: 205 CLQNMSFSEQRYFFDIILKTRVIGGLEHKFLNCWHPDAQDYLGVVSDLKVLSETLWNPTM 264
           CL+NM+F E +YFFDII+K +++G LE+ FL  WHPD+++YL VVSDL+ LS  LWNP++
Sbjct: 201 CLENMTFIELKYFFDIIVKNKILGSLENMFLKIWHPDSKEYLSVVSDLRTLSNKLWNPSI 260

Query: 265 RLGKNELSINIGRAFAPHLAKRLHLSYERVCAKLKQDFIIEEKMDGERIQLHYIERGAKI 324
           ++  ++LSI +G  FAP LAKRL LSY+ +  +L  DF IEEKMDGERIQLHY+  G  +
Sbjct: 261 KINNSDLSIKVGYIFAPQLAKRLMLSYDTISNRLNNDFFIEEKMDGERIQLHYMNYGETV 320

Query: 325 RFLSRRGTDFTHLYGDSLEHGVISQHLKFKNDVQDCVLDGEMVSFDKEKNVVLPFGIVKS 384
           +F SR GTD+T+LYG+    G I++ L+   +V++CVLDGEMV+FD     VLPFG+VKS
Sbjct: 321 KFFSRHGTDYTYLYGNDKSAGTIAKFLRLHKNVKECVLDGEMVTFDSTSKKVLPFGLVKS 380

Query: 385 TAMEELMNSDTKVDTDGYRPLYMIFDLVYLNGVSLTRLPLHLRKSYLRSILSPVANIVEI 444
           +A  +L   D  +D D + PL+M+FD++YLNG SL  LPL  RK +L ++L+P  + VEI
Sbjct: 381 SASSQLNKKD--IDNDSFHPLFMVFDILYLNGSSLIDLPLFKRKEFLNTVLTPYKDYVEI 438

Query: 445 LSDVRASEPNAIKVSLERAIEMGSEGIILKQFSSPYEIGARNDSWIKIKPEYFEELGETM 504
           LS +R ++   IK  L+ AI +GSEGI+LKQ+ S Y   AR+++WIK+KPEY EE GE M
Sbjct: 439 LSSIRCTDSIQIKKGLDAAISVGSEGIVLKQYISKYIPNARHNNWIKVKPEYLEEFGENM 498

Query: 505 DLVVIGRDPGKKDSLMCGLILADETDGSSVNLA----------SQDDPL--RPKQRNPKV 552
           DL+VIGRD GKKD L+CG+++ +E    S N+           S DD L  +P Q   KV
Sbjct: 499 DLIVIGRDSGKKDCLICGILVTEEKQELSENMKRESEIEIISDSGDDDLDTKPSQGIKKV 558

Query: 553 ISFCNIANGVSDAEFKEIERKTRGLWNLTTACPPPSGLLEFGTKLPTEWIDPRSSLVLEV 612
           ISFC IANG+S  E KEI R TRG W       PP  +LEFGTK P EWI P+ S+VLE+
Sbjct: 559 ISFCTIANGLSQNELKEINRITRGAWKNYNNETPPIDVLEFGTKKPVEWIYPQDSVVLEI 618

Query: 613 KARSVDTDELSSKKYKTGSTLRGAYCRALRFNKDWSTCATVQQ--YEQAKRAHNYHKGKR 670
           KARS+D  + +  KY TG TL G YCR +R +KDW++C T+    Y + KR    +K K+
Sbjct: 619 KARSLDRTDQTQYKYATGCTLYGGYCRQIRQDKDWTSCYTLHDLTYNEIKRHEKKNKNKQ 678

Query: 671 KSHQISPRKQRKLANVSELYPLLADDSRESIFESNIFQGLQFYILSDYI-DSQKKRYEKD 729
              +   RK+ K+ + + + P    +  +    S++F GL FYI+SDYI DS  +R +++
Sbjct: 679 TLIRSYSRKKSKIISPAGMLP----NGTDLRLISDLFHGLYFYIISDYIPDSDAQRIDRE 734

Query: 730 QIGTLVRKNSGHVLHNNFVRREEFSRLRIISGKNTVECRSLTEKGYDIIHPSWIFDCLNY 789
            I +L+ KN G V++N   +    S+LRI+S K+T+EC  L  +GYD+I+ SW+FDCL  
Sbjct: 735 DICSLIIKNGGRVIYNVIAKTYTISKLRILSSKSTIECTDLVRRGYDVINLSWLFDCLQA 794

Query: 790 GSLVKLEPRHCFRTSRKLLENSRQRVDRFGDSFCRPLSYTEFDEL-------VNGQSVVS 842
           G ++ LEP HC   S +LL  +  R+D+FGDS+   L  ++  +L       VN  +   
Sbjct: 795 GVILPLEPAHCLFVSNELLAIATDRIDKFGDSYEATLIDSKLLKLLDSNINKVNRSNSNL 854

Query: 843 PHLSAPEELDGIPLFLFQNFKIYFARVGNDPDQEEYLEKTLRLFGGERSLTLDCCNLVV- 901
             ++  E +D IP+FLF N K +  +        + L   ++L+GG     L+ CN++V 
Sbjct: 855 LLINKDEGVDSIPIFLFTNRKFFLIKEDILLGDRDTLIFQIKLYGGSLVTKLEDCNIIVG 914

Query: 902 VRVSFKEQKKLFKLVEGLRKRIASTAYSSEVDHRIPHLVSSNWLEACINEQCLVPEEDFP 961
           V  S    KKL      LR ++      +     IP  V+ +W+   I     +  ED+P
Sbjct: 915 VCGSQLVNKKL----GDLRCKLVKQYVDANFPQPIPRAVNVSWITESIKAGYQLSPEDYP 970

Query: 962 PL 963
            L
Sbjct: 971 IL 972

>TPHA0M00260 Chr13 complement(50326..53226) [2901 bp, 966 aa] {ON}
           Anc_6.18 YOR005C
          Length = 966

 Score =  811 bits (2095), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 429/968 (44%), Positives = 611/968 (63%), Gaps = 50/968 (5%)

Query: 30  EVSQKKPQNFAPSPDFRWLCDELFSKLEEITEDRQKLG-KAVTVKRVEVIMYFIKLWRTT 88
           + S+++P+NF+PSPDF+WLC+ELF KL+E+    + +  +   ++   VI  FI LWR T
Sbjct: 10  DTSEREPRNFSPSPDFKWLCNELFVKLDEVRLKPKSVDTRPKNIQYDIVINNFIHLWRVT 69

Query: 89  VGDNIYPVLRLILPYRDSRAYNIKDYTLVKAVCRSLNLPKDSLTEKRLLNWKQYAPRGTS 148
           VG++IYP LRLILPYRD R Y I+++TL++ VC  L L K+S+TE+RL  WKQ A R  +
Sbjct: 70  VGNDIYPALRLILPYRDRRNYYIREHTLIRIVCDYLKLQKNSVTEQRLRRWKQKARRSIN 129

Query: 149 LSKFCVEEIMKRRKEPQGSQRLTIDALNKCLDELSKEASAKKW--GFNG--LSKSPSFQN 204
           LS FC++EI KR  EP   +++TID LN  LD LS E S+ K   G +G  LS+  S + 
Sbjct: 130 LSSFCIQEIKKRLSEPVSKEKITIDKLNSILDSLSMERSSSKITNGSSGKKLSQLESIKY 189

Query: 205 CLQNMSFSEQRYFFDIILKTRVIGGLEHKFLNCWHPDAQDYLGVVSDLKVLSETLWNPTM 264
           C +NMSF E  YFFDI++K R+IGGLEHKFLN WHPDA DYL VVS+L +++E LWNP  
Sbjct: 190 CFENMSFIELEYFFDILIKARLIGGLEHKFLNAWHPDANDYLSVVSELNIVTEKLWNPNF 249

Query: 265 RLGKNELSINIGRAFAPHLAKRLHLSYERVCAKLKQDFIIEEKMDGERIQLHYIERGAKI 324
           RL   +L+I +  AF P LAK+++LSYE +  ++   F IEEKMDGERIQ+HY++ G +I
Sbjct: 250 RLNSKDLTIALHNAFEPQLAKKVNLSYEVLSRRMNNKFTIEEKMDGERIQIHYMDYGHQI 309

Query: 325 RFLSRRGTDFTHLYGDSLEHGVISQHLKFKNDVQDCVLDGEMVSFDKEKNVVLPFGIVKS 384
           ++ SRRG D+T+LYG       IS++L+   DV++C+LDGEMVS+DK +N +LPFG+VKS
Sbjct: 310 KYFSRRGNDYTYLYGKDKSTATISKYLQLNEDVKECILDGEMVSYDKSRNCILPFGMVKS 369

Query: 385 TAMEELMNSDTKVD---TDGYRPLYMIFDLVYLNGVSLTRLPLHLRKSYLRSILSPVANI 441
            A   L     K+D    D   PL+++FD+++LNG  LT LPL+ RK YL +IL+P  + 
Sbjct: 370 GAANSL-----KIDGLENDLCSPLFIVFDVLFLNGSPLTNLPLYQRKEYLSNILTPKKSH 424

Query: 442 VEILSDVRASEPNAIKVSLERAIEMGSEGIILKQFSSPYEIGARNDSWIKIKPEYFEELG 501
           +EIL    A +  +I+ +L+ AI +GSEGI+LK++ S Y +G RN+ WIK+KPEY E+ G
Sbjct: 425 IEILKFSIAHDSESIRSALQAAISVGSEGIVLKKYDSLYSVGDRNNDWIKVKPEYLEQFG 484

Query: 502 ETMDLVVIGRDPGKKDSLMCGL-----------ILADET------DGSSVNLASQDDPLR 544
           E +DL+VIGRDPGKKDSLMCG+           IL +E       D  S N   +D P+R
Sbjct: 485 ENLDLIVIGRDPGKKDSLMCGVAVLENEESYEKILQEEVITLTSDDDDSQNNIPEDKPIR 544

Query: 545 PKQRNPKVISFCNIANGVSDAEFKEIERKTRGLWNLTTACPPPSGLLEFGTKLPTEWIDP 604
            K R  K ISFC IANG+S+ EFKEI+RKT G W   +   PP+  LEFGT+LP EWI+P
Sbjct: 545 TK-RITKFISFCVIANGISNEEFKEIDRKTFGCWKKFSDEAPPTDYLEFGTRLPVEWINP 603

Query: 605 RSSLVLEVKARSVDTDELSSKKYKTGSTLRGAYCRALRFNKDWSTCATVQQYEQAKRAHN 664
             S+VLEVKARS++ +E    K+KTG TL GAYCR +R +KD++ C T      A     
Sbjct: 604 HDSVVLEVKARSLENNEALRDKFKTGYTLYGAYCRRIRTDKDFNDCYTFSDLVIATNKKR 663

Query: 665 YHKGKRKSHQISPRKQRKLANVSELYPLLADDSRESIFESNIFQGLQFYILSDYIDSQKK 724
                  +H    +K+ + + V+ L   L+    ++ F S IF GL F+++SDY+DS   
Sbjct: 664 SSSELYGNHSHIKKKRSRTSKVNMLNQTLSIQDDDTGFTSKIFDGLSFFVISDYVDSNSS 723

Query: 725 -RYEKDQIGTLVRKNSGHVLHNNFVRREEFSRLRIISGKNTVECRSLTEKGYDIIHPSWI 783
            R   D++  +++ N G ++ N   +      +RI+S K T EC  L ++GYDIIHP WI
Sbjct: 724 FRLRIDELINIIKVNGGQLIFNLVSQNLNEKYVRIMSCKKTFECNELIKRGYDIIHPKWI 783

Query: 784 FDCLNYGSLVKLEPRHCFRTSRKLLENSRQRVDRFGDSFCRPLSYTEFDELVNGQS---- 839
            DC+    L+  EP HCF  S+ L   S+QRVD  GDS+ + ++  E + L++ ++    
Sbjct: 784 LDCIANDKLLDFEPSHCFNVSQSLSTISKQRVDLLGDSYQKYITEEELELLISSKTPKEQ 843

Query: 840 VVSPHLSAPEELDGIPLFLFQNFKIYFARVGNDPDQ---EEYLEKT---LRLFGGERSLT 893
           + S  L   ++++ IP+FLF N K Y       P Q   E+ L++T   ++L+GG     
Sbjct: 844 LYSNPLQFDQQIEKIPIFLFSNKKAY------TPKQCFSEKLLKETNLYIKLYGGTSVNN 897

Query: 894 LDCCNLVVVRVSFKEQKKLFKLVEGLRKRIASTAYSSEVDHRIPHLVSSNWLEACINEQC 953
           ++ CN+++  +  +  K   + +  +RK ++  A SS     IP +VS  W+E  I +  
Sbjct: 898 INDCNVII--IGDEHSKSSNEKISSIRKELSIHAVSSNNVIPIPRIVSYKWIEKSIAQGT 955

Query: 954 LVPEEDFP 961
            V EEDFP
Sbjct: 956 QVVEEDFP 963

>ACR008W Chr3 (368913..371858) [2946 bp, 981 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR005C (DNL4)
          Length = 981

 Score =  810 bits (2091), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/945 (43%), Positives = 597/945 (63%), Gaps = 31/945 (3%)

Query: 36  PQNFAPSPDFRWLCDELFSKLEEITEDRQKLGKAVTVKRVEVIMYFIKLWRTTVGDNIYP 95
           P NF+PSPDF WLCDELF KLEE+   ++ LGK   V+ +E+   F+ LWR TVG++IYP
Sbjct: 51  PINFSPSPDFCWLCDELFIKLEEVALKKKDLGKPRKVRNLEITSNFVSLWRKTVGNDIYP 110

Query: 96  VLRLILPYRDSRAYNIKDYTLVKAVCRSLNLPKDSLTEKRLLNWKQYAPRGTSLSKFCVE 155
            L L LPY D R+Y +KD TLVKA+C+ + LP++S TE+RLL+WKQ APRG  LS FCVE
Sbjct: 111 ALVLSLPYNDRRSYRVKDVTLVKALCKHMKLPRNSETERRLLHWKQNAPRGVKLSTFCVE 170

Query: 156 EIMKRRKEPQGSQRLTIDALNKCLDELSKEASAKKWGFNGLSKSPSFQNCLQNMSFSEQR 215
           E+ KRR+EP   +R++ID +N  LD+L  E++  KW +  L++SP+F  CL++MS+ E R
Sbjct: 171 ELQKRRREPVVPKRMSIDEVNGMLDKLEHESNVGKWSYISLAESPAFNYCLEHMSYVELR 230

Query: 216 YFFDIILKTRVIGGLEHKFLNCWHPDAQDYLGVVSDLKVLSETLWNPTMRLGKNELSINI 275
           +FFDI+LK  ++ GLE   L+CWHPDA+ Y  VVSDL++++ TL++P  RL KN+LS+ I
Sbjct: 231 FFFDIVLKVPIVSGLESLLLSCWHPDAESYFKVVSDLRIVAHTLYDPNERLEKNDLSVRI 290

Query: 276 GRAFAPHLAKRLHLSYERVCAKLKQDFIIEEKMDGERIQLHYIERGAKIRFLSRRGTDFT 335
           G AFAPH+A+R+ + YE+V  KL  DF +EEKMDG+RIQ+HY++ G  I + SR G ++T
Sbjct: 291 GYAFAPHMAQRVKIPYEKVSTKLGNDFYVEEKMDGDRIQVHYMDYGNSIAYFSRNGINYT 350

Query: 336 HLYGDSLEHGVISQHLKFKNDVQDCVLDGEMVSFDKEKNVVLPFGIVKSTAMEELMNSDT 395
           +LYG++   G IS HLKF   V++C+LDGEMVS+DKE   +LPFG+ KS A  ++    T
Sbjct: 351 YLYGENSSKGSISNHLKFVEGVKECILDGEMVSYDKEMQCILPFGLTKSGASHQVNFETT 410

Query: 396 KVDTDGYRPLYMIFDLVYLNGVSLTRLPLHLRKSYLRSILSPVANIVEILSDVRASEPNA 455
                 YRPLY +FDL+YLNG  LT   +  RK YL  IL P  N+V +LS  R S+  A
Sbjct: 411 GHTEPTYRPLYAVFDLLYLNGQLLTNQDVVKRKEYLEKILIPSKNVVHLLSGPRCSDAEA 470

Query: 456 IKVSLERAIEMGSEGIILKQFSSPYEIGARNDSWIKIKPEYFEELGETMDLVVIGRDPGK 515
           I  +L  A+  GSEGI+LK+  S Y +G R+DSWIKIKPEY E  GE MDLVVIGRD G+
Sbjct: 471 ITAALGAAVAHGSEGIVLKKARSKYSVGKRDDSWIKIKPEYLENFGENMDLVVIGRDKGR 530

Query: 516 KDSLMCGLILADETDGSS-------VNLASQDDPLRPKQRNPKVISFCNIANGVSDAEFK 568
           KDS +C L + D+++ ++        +  S  +P+  + +  K ISFC+IANG+S+ EFK
Sbjct: 531 KDSFICALAVTDDSEKNNPSSYESGSDSDSDSEPIIVQPKIEKFISFCSIANGISNEEFK 590

Query: 569 EIERKTRGLWNLTTACPPPSGLLEFGTKLPTEWIDPRSSLVLEVKARSVDTDELSSKKYK 628
           EI+R TRG W       PP+  +EFGTK P EWIDP++S+VLEVKARS+D +E  S  YK
Sbjct: 591 EIDRLTRGNWFPYDERKPPTDWVEFGTKTPREWIDPKNSVVLEVKARSIDNEESKSDLYK 650

Query: 629 TGSTLRGAYCRALRFNKDWSTCATVQQYEQAKRAHNY----HKGKRKSHQISPRKQRKLA 684
           TGSTL  AYC+ +R +K+WST +TV +Y+ A+ A +Y       K    + SPRK+R   
Sbjct: 651 TGSTLYNAYCKRIRHDKNWSTASTVAEYDTAREARSYFNVSQNAKFGKDRSSPRKRRTFH 710

Query: 685 NVSELYPLLADDSRESIFESNIFQGLQFYILSDYIDSQ-KKRYEKDQIGTLVRKNSGHVL 743
            V ++     D ++ S  +++  +G  FY+ S Y D Q KK  +  +IG  V    G  +
Sbjct: 711 LVGDI-----DVTKPS--KADFLKGYYFYVTSGYFDLQSKKNIDASEIGEAVVSCGGTYI 763

Query: 744 HNNFVRREEFSRLRIISGKNTVECRSLTEKGYDIIHPSWIFDCLNYGSLVKLEPRHCFRT 803
           HN  + R    +L I+  K+T E + L E+GYDIIHP W+ DC+ YG+++++EP++ +  
Sbjct: 764 HNLRI-RASLDKLYILGCKDTRELKMLIERGYDIIHPEWLMDCVKYGTMLQIEPKYVYSA 822

Query: 804 SRKLLENSRQRVDRFGDSFCRPLSYTEFDELVNGQSVVSPHLSAPEELDGIP----LFLF 859
           S +L++ +R + D++G+S+  P++      L N Q  V    ++    D +     L +F
Sbjct: 823 SEELMKQARNQEDKYGESYQLPVTEDTLKALANKQ--VEEGYASEMGTDAVSEYERLLIF 880

Query: 860 QNFKIY-FARVGNDPDQEEYLEKTLRLFGGERSLTLDCCNLVVVRVSFKEQKKLFKLVEG 918
           + +  Y            + ++  +   GGE +  L+   +VV       Q  L    + 
Sbjct: 881 KGWLFYILDDYAYHSSWSDIVKWNIESCGGEVTNDLELATIVVAVKDCFSQLSL----QA 936

Query: 919 LRKRIASTAYSSEVDHRIPHLVSSNWLEACINEQCLVPEEDFPPL 963
           +R  I +    S     IP +V+S W+EAC+  Q LV E+++  +
Sbjct: 937 VRNNIGARITGSNDVQPIPKIVTSEWVEACMEAQYLVDEDEYAAI 981

>KLLA0D01089g Chr4 complement(97438..100161) [2724 bp, 907 aa] {ON}
           similar to uniprot|Q08387 Saccharomyces cerevisiae
           YOR005C DNL4 DNA ligase required for nonhomologous end-
           joining (NHEJ) forms stable heterodimer with required
           cofactor Lif1p catalyzes DNA ligation as part of a
           complex with Lif1p and Nej1p involved in meiosis not
           essential for vegetative growth
          Length = 907

 Score =  804 bits (2076), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 432/939 (46%), Positives = 590/939 (62%), Gaps = 48/939 (5%)

Query: 37  QNFAPSPDFRWLCDELFSKLEEITEDRQKLGKAVTVKRVEVIMYFIKLWRTTVGDNIYPV 96
           +NF+PSP+F+WLCDEL  K+ E +  +  +GK VTV+ +E+I  FIKLWR+TVG+ IYP 
Sbjct: 5   ENFSPSPEFKWLCDELLGKIYETSSKKHLIGKPVTVRYLEIITNFIKLWRSTVGNYIYPA 64

Query: 97  LRLILPYRDSRAYNIKDYTLVKAVCRSLNLPKDSLTEKRLLNWKQYAPRGTSLSKFCVEE 156
           LRLI+P+RD R YN+K+ TL+KA+CR L LPK S TE RLL WKQ A RG  LS FCVEE
Sbjct: 65  LRLIVPFRDRRIYNVKENTLIKALCRYLRLPKSSETENRLLRWKQRAARGVKLSDFCVEE 124

Query: 157 IMKRRKEPQGSQRLTIDALNKCLDELSKEASAKKWGFNGLSKSPSFQNCLQNMSFSEQRY 216
           I KR+K+ +G+ R+TID LN  LDE+S+E + K+ G+  L+ S +F  CL +M+F E ++
Sbjct: 125 IRKRQKDYEGANRITIDELNGYLDEVSQEGNGKRMGYMALTDSRAFNYCLNHMTFMEMKF 184

Query: 217 FFDIILKTRVIGGLEHKFLNCWHPDAQDYLGVVSDLKVLSETLWNPTMRLGKNELSINIG 276
           FFDIILKTRV+ GLE+ FL  WHPDA DYL VVSDL VLS+ L+NP  RL + +LSI I 
Sbjct: 185 FFDIILKTRVLSGLENMFLTAWHPDATDYLSVVSDLDVLSQRLYNPNERLRQTDLSITIS 244

Query: 277 RAFAPHLAKRLHLSYERVCAKLKQDFIIEEKMDGERIQLHYIERGAKIRFLSRRGTDFTH 336
            AF P LAKR HLSYERV +KL+ DFIIEEKMDGER+Q+HYI  G +I++LSRRG DF++
Sbjct: 245 HAFEPQLAKRTHLSYERVASKLQHDFIIEEKMDGERLQIHYINYGEQIKYLSRRGVDFSY 304

Query: 337 LYGDSLEHGVISQHLKFKNDVQDCVLDGEMVSFDKEKNVVLPFGIVKSTAMEELMNSDTK 396
           LYG++   G IS  LK   +V+DC+LDGEM+++D EK++VLPFG+VKS+AM ++ +    
Sbjct: 305 LYGENSSSGPISPSLKLHFNVKDCILDGEMITYDTEKDIVLPFGLVKSSAMNQIQSELAG 364

Query: 397 VD-TDGYRPLYMIFDLVYLNGVSLTRLPLHLRKSYLRSILSPVANIVEILSDVRASEPNA 455
           +  T+ Y+PL++ FDLVYLNG SLT L L  RK YL  IL+PV   VEI+  ++A    A
Sbjct: 365 IAPTESYKPLFVAFDLVYLNGKSLTNLALERRKDYLTKILTPVERSVEIIQYMKAINAEA 424

Query: 456 IKVSLERAIEMGSEGIILKQFSSPYEIGARNDSWIKIKPEYFEELGETMDLVVIGRDPGK 515
           IK SLE+AI MGSEGI+LK   S Y +G+RN  WIKIKPEY E+ GE MDL++IGR+ GK
Sbjct: 425 IKDSLEQAISMGSEGIVLKHLHSKYFVGSRNTDWIKIKPEYLEQFGENMDLLIIGREQGK 484

Query: 516 KDSLMCGLILADETDGSSVNLASQDDPLRPKQRNPKVISFCNIANGVSDAEFKEIERKTR 575
           KDS  CGL ++D  + +                 P+ ISFC IANG+S+ EFK+IERKT 
Sbjct: 485 KDSFFCGLSISDPNEVA---------------EKPRFISFCTIANGLSNEEFKDIERKTW 529

Query: 576 GLWNLTTACPPPSGLLEFGTKLPTEWIDPRSSLVLEVKARSVDTDELSSKKYKTGSTLRG 635
           G W++ +  PP   LL FGTK+P EWI P  S+VLEVKAR++DT E   +KY++G TL  
Sbjct: 530 GKWHIFSEDPPSPNLLGFGTKVPYEWIHPEDSVVLEVKARAIDTKESEKRKYRSGCTLHF 589

Query: 636 AYCRALRFNKDWSTCATVQQYEQAKRAHNYHKGKRKSHQISPRKQRK-------LANVSE 688
            YC+ +R++KDW T A+  ++E  K A N++  KRKSHQ++  K+R        + N SE
Sbjct: 590 GYCKQIRYDKDWKTVASFSEFEDMKDARNFY-NKRKSHQVTDGKKRASKRAKIGIVNSSE 648

Query: 689 LYPLLADDSRESIFESNIFQGLQFYILSDYIDSQK-KRYEKDQIGTLVRKNSGHVLHNNF 747
              L+A         SN F   +F ++SDY DS K +R  ++ + +++ ++ G +++ + 
Sbjct: 649 PTALVAP-------VSNTFSNCRFRVISDYFDSTKRRRISQEDLCSVILEHGGEIVYTSD 701

Query: 748 VRREEFSRLRIISGKNTVECRSLTEKGYDIIHPSWIFDCLNYGSLVKLEPRHCFRTSRKL 807
                   L II  K T EC+ L      II PSWIF C+  G          FR   + 
Sbjct: 702 ENNLPQDNLYIIGEKLTRECKILLNAKNLIIRPSWIFSCIEEGYKTPFTESDIFRGELES 761

Query: 808 LENSRQRVDRFGDSFCRPLSYTEFDELVNGQSVVSPHLSAPEELDGIPLFLFQNFKIYFA 867
             +  Q    F  +    L  T    + N  S     L  PE    +PLFLF N K+   
Sbjct: 762 SMDCSQFYTDFNTASLNHLLETANRGIKNPDS----DLLLPE----VPLFLFSNLKLAVL 813

Query: 868 RVGNDPDQEEY-LEKTLRLFGGERSLTLDCCNLVVVRVSFKEQKKLFKLVEGLRKRIAST 926
              N  D     +E  ++  GGE  + ++  ++++V   F  ++ LF     LR++IAS 
Sbjct: 814 NSENVLDTSILEVEFAIKCHGGEL-VHIENASIIIVFNDFISREDLF----SLRQKIASK 868

Query: 927 AY--SSEVDHRIPHLVSSNWLEACINEQCLVPEEDFPPL 963
           A   S+E   RIP +V  +W    I +  +   E +  L
Sbjct: 869 AVKESTESTPRIPRMVDISWALDSIKDNYIAETEHYQCL 907

>ACL155W Chr3 (81492..83585) [2094 bp, 697 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YDL164C (CDC9)
          Length = 697

 Score =  114 bits (285), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 109/411 (26%), Positives = 177/411 (43%), Gaps = 59/411 (14%)

Query: 257 ETLWNPTMRLGKNELS----INIGRAFAPHLAKRLHLSYERVCAKLKQDFIIEEKMDGER 312
           E + N  ++ G   L     +  G    P LAK      E +     Q F  E K DGER
Sbjct: 307 EMIINAALQYGIMNLPQHCVLTPGIPLKPMLAKPTKSITEVLDRFQGQRFTCEYKYDGER 366

Query: 313 IQLHYIERGAKIRFLSRRGTDFTHLYGDSLEHGVISQHLKFKNDVQDCVLDGEMVSFDKE 372
            Q+H +E G  IR  SR   + T  Y +   H    Q L      +  ++D E V++D E
Sbjct: 367 AQVHLMEDGT-IRIYSRNSENMTERYPEIQFH----QFLANPQTTRSLIIDCEAVAWDNE 421

Query: 373 KNVVLPFGIVKSTAMEELMNSDTKVDTDGYRPLYMIFDLVYLNGVSLTRLPLHLRKSYLR 432
           K  +LPF ++ +   + +   D KV     R     FDL+YLNG SL +  L  R+ +L 
Sbjct: 422 KQKILPFQVLSTRKRKGVELKDVKV-----RVCLFAFDLLYLNGESLLKCSLADRRKHLY 476

Query: 433 SILSPVANIVEILSDVRASEPNAIKVSLERAIEMGSEGIILKQF---SSPYEIGARNDSW 489
           S+L  V   ++  +++   E + ++  LE+++    EG+++K      S YE   R+ +W
Sbjct: 477 SVLKVVPGELQFANEITTMELSELQTYLEQSVSASCEGLMVKMLDGEESQYEPSKRSRNW 536

Query: 490 IKIKPEYFEELGETMDLVVIGR--DPGKKDSLMCGLILADETDGSSVNLASQDDPLRPKQ 547
           +K+K +Y E +G+++DL V+G     GK+     G +L                      
Sbjct: 537 LKLKKDYLEGVGDSLDLAVLGAYYGRGKRTGTYGGFLLG--------------------C 576

Query: 548 RNPKVISF---CNIANGVSDAEFKEIERKTRGLWNLTTACPPPSGLLEFGTKLPTE-WID 603
            NP +  F   C I  G S+   + +  + +      T    P G + +    P + W +
Sbjct: 577 YNPDLEEFETCCKIGTGFSEEVLQSLHAQLK-----DTVIAAPRGDVSYDDSSPPDVWFE 631

Query: 604 PRSSLVLEVKARSVDTDELSSKKYKTGSTLRGA-----YCRALRFNKDWST 649
           P  +++ EV    +  D   S  YK G  + G      + R LR  +D S 
Sbjct: 632 P--AMLFEV----LTADLSLSPVYKAGRDVYGKGISLRFPRFLRIREDKSV 676

>Kwal_56.24616 s56 (1076178..1078325) [2148 bp, 715 aa] {ON} YDL164C
           (CDC9) - DNA ligase [contig 161] FULL
          Length = 715

 Score =  114 bits (284), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 107/396 (27%), Positives = 181/396 (45%), Gaps = 46/396 (11%)

Query: 254 VLSETLWNPTMRLGKNELSINIGRAFAPHLAKRLHLSYERVCAKLKQDFIIEEKMDGERI 313
           V++  L +  M L K+ + +  G    P LAK      E +     Q F  E K DGER 
Sbjct: 328 VINAALEHGIMELEKHCV-LTPGIPLKPMLAKPSKSISEVLDRFQGQRFTCEYKYDGERA 386

Query: 314 QLHYIERGAKIRFLSRRGTDFTHLYGDSLEHGVISQHLKFKNDVQDCVLDGEMVSFDKEK 373
           Q+H +  G+ +R  SR G + T  Y +      IS  +   ++    +LD E V++DK+K
Sbjct: 387 QVHLLPDGS-MRIYSRNGENMTERYPEI----NISDFVAHPDETHTLILDCEAVAWDKDK 441

Query: 374 NVVLPFGIVKSTAMEELMNSDTKVDTDGYRPLYMIFDLVYLNGVSLTRLPLHLRKSYLRS 433
           NV+LPF ++ +   + ++  D KV     R     FD++  N   L    L  R++YL  
Sbjct: 442 NVILPFQVLSTRKRKGVVAEDVKV-----RVCLFAFDILCYNDEPLINKSLAERRTYLER 496

Query: 434 ILSPVANIVEILSDVRASEPNAIKVSLERAIEMGSEGIILKQF---SSPYEIGARNDSWI 490
           IL PV   +++ S+V     + +++ L+++++   EG+++K      S YE   R+ +W+
Sbjct: 497 ILKPVPGELQLASEVTTMSLDEMQLYLDQSVKDCCEGLMVKVLDGEESHYEPSKRSRNWL 556

Query: 491 KIKPEYFEELGETMDLVVIGR--DPGKKDSLMCGLILADETDGSSVNLASQDDPLRPKQR 548
           K+K +Y + +G+++DL V+G     GK+     G +L            +QD        
Sbjct: 557 KLKKDYLQGVGDSLDLCVLGAYYGRGKRTGTYGGFLLG---------CYNQD-------- 599

Query: 549 NPKVISFCNIANGVSDAEFKEIERKTRGLWNLTTACPPPSGLLEFG-TKLPTEWIDPRSS 607
             +  + C I  G SD   + +  K        T  P P     +  +  P  W++P  S
Sbjct: 600 TGEFETCCKIGTGFSDEMLQNLYEKLS-----PTEIPEPKAFYVYSESAQPDVWLEP--S 652

Query: 608 LVLEVKARSVDTDELSSKKYKTGSTLRGAYCRALRF 643
           ++ EV    +  D   S  YK G +  G    +LRF
Sbjct: 653 MLFEV----LTADLSLSPVYKAGGSSYGKGI-SLRF 683

>NDAI0A01940 Chr1 complement(432302..434599) [2298 bp, 765 aa] {ON}
           Anc_7.343 YDL164C
          Length = 765

 Score =  112 bits (279), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 103/397 (25%), Positives = 177/397 (44%), Gaps = 45/397 (11%)

Query: 254 VLSETLWNPTMRLGKNELSINIGRAFAPHLAKRLHLSYERVCAKLKQDFIIEEKMDGERI 313
           V++  L    M L ++  S+  G    P LAK      E +     + F  E K DGER 
Sbjct: 377 VINSCLQYGIMNLNEH-CSLRPGIPLKPMLAKPTKAINEILDRFQGETFTSEYKYDGERA 435

Query: 314 QLHYIERGAKIRFLSRRGTDFTHLYGDSLEHGVISQHLKFKNDVQDCVLDGEMVSFDKEK 373
           Q+H +E G  +R  SR G + T  Y +   H  I   +K +N+ +  +LD E V++DKE+
Sbjct: 436 QVHLLEDGT-MRIYSRNGENMTERYPEI--H--IGDFVKDRNETKTLILDCEAVAWDKEQ 490

Query: 374 NVVLPFGIVKSTAMEELMNSDTKVDTDGYRPLYMIFDLVYLNGVSLTRLPLHLRKSYLRS 433
             +LPF ++ +   ++++  D KV     R     FD++  N   L    L  R+  L  
Sbjct: 491 QKILPFQVLSTRKRKDVLAKDVKV-----RVCLFAFDILCHNSNKLINYSLKERREILHR 545

Query: 434 ILSPVANIVEILSDVRASEPNAIKVSLERAIEMGSEGIILKQF---SSPYEIGARNDSWI 490
           + +P     +  +++  S  + ++  L++++    EG+++K      S YE   R+ +W+
Sbjct: 546 VTTPAPGEFQYATELTTSNLDELQKFLDQSVNDSCEGLMVKMLEGEESHYEPSKRSRNWL 605

Query: 491 KIKPEYFEELGETMDLVVIGR--DPGKKDSLMCGLILADETDGSSVNLASQDDPLRPKQR 548
           K+K +Y E +G+++DL V+G     GK+     G +L    D +                
Sbjct: 606 KLKKDYLEGIGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYNDNTG--------------- 650

Query: 549 NPKVISFCNIANGVSDAEFKEIERKTRGLWNLTTACPPPSGLLEFGTKLPTEWIDPRSSL 608
             +  + C I  G SD   +++  K +     T    P +  +   +  P  W +P  SL
Sbjct: 651 --EFETCCKIGTGFSDEMLQQLHEKLKA----TVIDGPKATYIYDSSAEPDVWFEP--SL 702

Query: 609 VLEVKARSVDTDELSSKKYKTGSTL--RGAYCRALRF 643
           + EV    +  D   S  YK GS+   +G   R  RF
Sbjct: 703 LFEV----LTADLSLSPIYKAGSSAYDKGVSLRFPRF 735

>TPHA0D04570 Chr4 (996539..998749) [2211 bp, 736 aa] {ON} Anc_7.343
           YDL164C
          Length = 736

 Score =  105 bits (261), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 104/410 (25%), Positives = 177/410 (43%), Gaps = 50/410 (12%)

Query: 276 GRAFAPHLAKRLHLSYERVCAKLKQDFIIEEKMDGERIQLHYIERGAKIRFLSRRGTDFT 335
           G    P LAK      E + A   ++FI E K DGER Q+H +E G ++R  SR G + T
Sbjct: 356 GIPLKPMLAKPTKAITEVLNAFQGKEFISEYKYDGERAQVHLLE-GGEMRIYSRNGENMT 414

Query: 336 HLYGDSLEHGVISQHLKFKND---------VQDCVLDGEMVSFDKEKNVVLPFGIVKSTA 386
             Y +      +       ND         V+D +LD E+V++D E+  +LPF ++ +  
Sbjct: 415 ERYPELDVKDFLCVVKAITNDQEGENAIQPVKDIILDCEVVAWDVEQKKILPFQVLTTRK 474

Query: 387 MEELMNSDTKVDTDGYRPLYMIFDLVYLNGVSLTRLPLHLRKSYLRSILSPVANIVEILS 446
            + +   D KV     R     FDL+YLN   +    L  R+  LR +   V    +  +
Sbjct: 475 RKNVDLKDVKV-----RVCLFAFDLLYLNNEGMINKSLRERQEILRKVTVLVPGEFQYAT 529

Query: 447 DVRASEPNAIKVSLERAIEMGSEGIILKQFS---SPYEIGARNDSWIKIKPEYFEELGET 503
            +  S+ + ++  L++A++   EG+++K      S YE   R+ +W+K+K +Y + +G++
Sbjct: 530 SLITSDMDELQTFLDQAVKNSCEGLMVKMLDGEESHYEPSKRSRNWLKLKKDYLDGVGDS 589

Query: 504 MDLVVIGR--DPGKKDSLMCGLILADETDGSSVNLASQDDPLRPKQRNPKVISFCNIANG 561
           +DLVV+G     GK+     G +L         N  +Q+             + C I  G
Sbjct: 590 LDLVVMGAYFGKGKRTGSYGGFLLG------CYNEDTQE-----------FETCCKIGTG 632

Query: 562 VSDAEFKEIERKTRGLWNLTTACPPPSGLLEFGTKLPTEWIDPRSSLVLEVKARSVDTDE 621
            SD    E+      L   T    PP   +   +  P  W   ++ ++ EV    +    
Sbjct: 633 FSD----EMLGNLHTLLQPTEIDNPPMTYIYDSSAEPDVWF--QAKVLFEVLTADLSLSP 686

Query: 622 L---SSKKYKTGSTLRGAYCRALRFNKDWSTCAT----VQQYEQAKRAHN 664
           +    + +Y  G +LR      +R +KD +   T    ++ YE      N
Sbjct: 687 VYKAGNSRYDKGISLRFPRFLRIREDKDVTDGTTSEDIIEFYESQSHIQN 736

>TBLA0E02050 Chr5 (498038..500200) [2163 bp, 720 aa] {ON} Anc_7.343
           YDL164C
          Length = 720

 Score =  104 bits (260), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 106/397 (26%), Positives = 172/397 (43%), Gaps = 49/397 (12%)

Query: 257 ETLWNPTMRLGKNELSINI----GRAFAPHLAKRLHLSYERVCAKLKQDFIIEEKMDGER 312
           E +   +++ G ++L+ +I    G    P LAK      E +       F  E K DGER
Sbjct: 330 EIIITTSLQYGVSQLASHIKLTPGIPLKPMLAKPTKSISEVLDTFQNIQFTSEYKYDGER 389

Query: 313 IQLHYIERGAKIRFLSRRGTDFTHLYGDSLEHGVISQHLKFKNDVQDCVLDGEMVSFDKE 372
            Q+H +  G+ +R  SR G D T  Y +      I  +L         +LD E V++D E
Sbjct: 390 AQVHLLPDGS-MRIYSRNGEDMTQRYPEL----NIQDYLVDSTTTTQLILDCEAVAWDVE 444

Query: 373 KNVVLPFGIVKSTAMEELMNSDTKVDTDGYRPLYMIFDLVYLNGVSLTRLPLHLRKSYLR 432
              +LPF ++ +   + +   D KV     R     FD++  N  SL    L  R+  L 
Sbjct: 445 LQKILPFQVLSTRKRKSVDLKDIKV-----RVCLFAFDILRHNNDSLINNTLRERRDILH 499

Query: 433 SILSPVANIVEILSDVRASEPNAIKVSLERAIEMGSEGIILKQFS---SPYEIGARNDSW 489
           SI  P     +  +++  S  + ++  L++AI+   EG+++K      S YE   R+ +W
Sbjct: 500 SITKPCPGQFQFATELTTSNLDELQTFLDKAIKDSCEGLMVKSLDGTDSHYEPSKRSRNW 559

Query: 490 IKIKPEYFEELGETMDLVVIGR--DPGKKDSLMCGLILADETDGSSVNLASQDDPLRPKQ 547
           +K+K +Y + +G+++DL V+G     GK+     G +LA           +QD       
Sbjct: 560 LKLKKDYLQGMGDSLDLCVLGAYYGRGKRTGTYGGFLLA---------CYNQD------- 603

Query: 548 RNPKVISFCNIANGVSDAEFKEIERKTRGLWNLTTACPPPSGLLEFGTKL-PTEWIDPRS 606
              +  + C I  G SD   + +    +      TA   P     F +   P  W +P  
Sbjct: 604 -TEEFETCCKIGTGFSDEMLQTLYNGLK-----ETAIESPRANFVFDSSAEPDVWFNP-- 655

Query: 607 SLVLEVKARSVDTDELSSKKYKTGSTLRGAYCRALRF 643
           ++V EV    +  D   S  YK GST+ G    +LRF
Sbjct: 656 TMVFEV----LTADLSLSPIYKAGSTVYGKGI-SLRF 687

>CAGL0I03410g Chr9 complement(289606..291780) [2175 bp, 724 aa] {ON}
           highly similar to uniprot|P04819 Saccharomyces
           cerevisiae YDL164c CDC9 DNA ligase
          Length = 724

 Score =  103 bits (256), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 100/380 (26%), Positives = 165/380 (43%), Gaps = 46/380 (12%)

Query: 272 SINIGRAFAPHLAKRLHLSYERVCAKLKQDFIIEEKMDGERIQLHYIERGAKIRFLSRRG 331
           +I  G    P LAK      E +     Q F  E K DGER Q+H ++ G  +R  SR G
Sbjct: 353 TIQPGIPLKPMLAKPTKAINEVLDRFQGQTFTSEYKYDGERAQVHLLKDGT-MRIYSRNG 411

Query: 332 TDFTHLYGDSLEHGVISQHLKFKNDVQDCVLDGEMVSFDKEKNVVLPFGIVKSTAMEELM 391
            + T  Y +      I   L         +LD E V++DKE+N +LPF ++ +   +++ 
Sbjct: 412 ENMTERYPEIQ----IKDFLADPASTTSLILDCEAVAWDKEQNKILPFQVLTTRKRKDVN 467

Query: 392 NSDTKVDTDGYRPLYMIFDLVYLNGVSLTRLPLHLRKSYLRSILSPVANIVEILSDVRAS 451
            ++ KV     R     FD++  N + L   PL  R+  L  +  PV    +  + +  S
Sbjct: 468 INEVKV-----RVCLFAFDILLHNDMRLINEPLSKRREVLHEVTKPVEGEFQYATQMTTS 522

Query: 452 EPNAIKVSLERAIEMGSEGIILKQFS---SPYEIGARNDSWIKIKPEYFEELGETMDLVV 508
             + ++  L+ +++   EG+++K      S YE   R+ +W+K+K +Y E +G+++DL V
Sbjct: 523 NLDELQKFLDESVKNSCEGLMVKMMDGVESYYEPSKRSRNWLKLKKDYLEGVGDSLDLCV 582

Query: 509 IGR--DPGKKDSLMCGLILADETDGSSVNLASQDDPLRPKQRNPKVISFCNIANGVSDAE 566
           +G     GK+     G +L         N  S+D             + C I  G S+  
Sbjct: 583 LGAYFGRGKRTGTYGGFLLG------CYNADSED-----------FETCCKIGTGFSEEM 625

Query: 567 FKEIERKTRGLWNLTTACPPPSGLLEFGTKL-PTEWIDPRSSLVLEVKARSVDTDELSSK 625
            + +  K        T    P G   F +   P  W +P  +++ EV    +  D   S 
Sbjct: 626 LQTLYEKLS-----PTVIDGPKGTYVFDSSAEPDVWFEP--TMLFEV----LTADLSLSP 674

Query: 626 KYKTGSTL--RGAYCRALRF 643
            YK GS++  +G   R  RF
Sbjct: 675 IYKAGSSVYDKGISLRFPRF 694

>KLTH0H01408g Chr8 complement(129752..131923) [2172 bp, 723 aa] {ON}
           similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination
          Length = 723

 Score =  102 bits (254), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 106/398 (26%), Positives = 175/398 (43%), Gaps = 46/398 (11%)

Query: 254 VLSETLWNPTMRLGKNELSINIGRAFAPHLAKRLHLSYERVCAKLKQDFIIEEKMDGERI 313
           V+   L +  M L K+ + +  G    P LAK      E +     Q F  E K DGER 
Sbjct: 336 VIETALEHGIMELDKHCV-LTPGIPLKPMLAKPSKSISEVLDRFQGQRFTCEYKYDGERA 394

Query: 314 QLHYIERGAKIRFLSRRGTDFTHLYGDSLEHGVISQHLKFKNDVQDCVLDGEMVSFDKEK 373
           Q+H +  G+ +R  SR G + T  Y +      IS  +         +LD E V++DKEK
Sbjct: 395 QVHLLPDGS-MRIYSRNGENMTERYPEIR----ISDFIADPARTHTLILDCEAVAWDKEK 449

Query: 374 NVVLPFGIVKSTAMEELMNSDTKVDTDGYRPLYMIFDLVYLNGVSLTRLPLHLRKSYLRS 433
           N +LPF ++ +   + +   D KV     R     FD++  N   L   PL  R++ L  
Sbjct: 450 NTILPFQVLSTRKRKGVAVEDVKV-----RVCLFAFDILCYNDEPLITRPLAERRACLER 504

Query: 434 ILSPVANIVEILSDVRASEPNAIKVSLERAIEMGSEGIILKQFS---SPYEIGARNDSWI 490
            L PV   +++ S+V     + ++  L++A+    EG+++K      S YE   R+ +W+
Sbjct: 505 ALVPVPGELQLASEVTTMSLDELQHYLDQAVRDCCEGLMVKILEGEESHYEPSKRSRNWL 564

Query: 491 KIKPEYFEELGETMDLVVIGR--DPGKKDSLMCGLILADETDGSSVNLASQDDPLRPKQR 548
           K+K +Y + +G+++DL V+G     GK+     G +L            +QD        
Sbjct: 565 KLKKDYLQGVGDSLDLCVLGAYYGRGKRTGTYGGFLL---------GCYNQD-------- 607

Query: 549 NPKVISFCNIANGVSDAEFKEIERKTRGLWNLTTACPPPSGLLEFGTKLPTE-WIDPRSS 607
           + +  + C I  G S+   + +  +        TA P P          P + W +P  +
Sbjct: 608 SGEYETCCKIGTGFSEEMLQTLFDRLS-----PTAIPTPKAFYVHSESAPPDVWFEP--T 660

Query: 608 LVLEVKARSVDTDELSSKKYKTGSTLRGAYCRALRFNK 645
           L+ EV    +  D   S  YK G++  G    +LRF +
Sbjct: 661 LLFEV----LTADLSLSPVYKAGTSSYGKGI-SLRFPR 693

>Kpol_2001.71 s2001 (195103..197283) [2181 bp, 726 aa] {ON}
           (195103..197283) [2181 nt, 727 aa]
          Length = 726

 Score =  100 bits (248), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 78/290 (26%), Positives = 139/290 (47%), Gaps = 13/290 (4%)

Query: 243 QDYLGVVSDLKVLSETLWNPTMRLGKNELSINIGRAFAPHLAKRLHLSYERVCAKLKQDF 302
           +D    V + +++ ++  N  +    N   +  G    P LAK      E + A   ++F
Sbjct: 322 RDAFCQVPNYEIIIQSCLNDGIMELDNNCKLRPGIPLKPMLAKPTKAINEVLDAFQGEEF 381

Query: 303 IIEEKMDGERIQLHYIERGAKIRFLSRRGTDFTHLYGD-SLEHGVISQHLKFKNDVQDCV 361
             E K DGER Q+H +  G ++R  SR G + T  Y +  +E  ++        +V   +
Sbjct: 382 TCEYKYDGERGQVHLLSNG-EMRIYSRNGENMTERYPELHIEDFLVKDESNTDKEVS-LI 439

Query: 362 LDGEMVSFDKEKNVVLPFGIVKSTAMEELMNSDTKVDTDGYRPLYMIFDLVYLNGVSLTR 421
           LD E+V++D E+N +LPF ++ +   + +   D KV     R     FD++Y NG  L  
Sbjct: 440 LDCEVVAWDNEQNKILPFQVLSTRKRKGVELKDVKV-----RVCLFAFDILYYNGEGLIT 494

Query: 422 LPLHLRKSYLRSILSPVANIVEILSDVRASEPNAIKVSLERAIEMGSEGIILKQFS---S 478
             L  R+  L  +   V    +  + +  +E + I+  L++AI+   EG+++K      S
Sbjct: 495 KTLRERRKILHEVTKCVPGEFQYATSLITAELDEIQKFLDQAIKDSCEGLMVKILDGEES 554

Query: 479 PYEIGARNDSWIKIKPEYFEELGETMDLVVIGR--DPGKKDSLMCGLILA 526
            YE   R+ +W+K+K +Y   +G+++DL V+G     GK+     G +L 
Sbjct: 555 RYEPSKRSRNWLKLKKDYLAGVGDSLDLCVMGAYYGKGKRTGTYGGFLLG 604

>SAKL0F10912g Chr6 complement(854430..856511) [2082 bp, 693 aa] {ON}
           similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination
          Length = 693

 Score = 99.0 bits (245), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 78/278 (28%), Positives = 134/278 (48%), Gaps = 16/278 (5%)

Query: 254 VLSETLWNPTMRLGKNELSINIGRAFAPHLAKRLHLSYERVCAKLKQDFIIEEKMDGERI 313
           V++  L +  M + K+   +  G    P LAK      E +     + F  E K DGER 
Sbjct: 305 VINTCLEHGIMEVNKH-CVLKPGIPLKPMLAKPSKSITEVLDRFHGEKFTCEYKYDGERA 363

Query: 314 QLHYIERGAKIRFLSRRGTDFTHLYGDSLEHGVISQHLKFKNDVQDCVLDGEMVSFDKEK 373
           Q+H +  G+ +   SR G + T  Y +   H  I  +L         +LD E V++D E+
Sbjct: 364 QVHLLPDGS-MNIYSRNGENMTERYPEL--H--IRDYLADPETTHSLILDCEAVAWDTEQ 418

Query: 374 NVVLPFGIVKSTAMEELMNSDTKVDTDGYRPLYMIFDLVYLNGVSLTRLPLHLRKSYLRS 433
             +LPF I+ +   + +   D KV     R     FD++  NG SL    L  R+ YL+ 
Sbjct: 419 GKILPFQILSTRKRKGVEAKDVKV-----RVCLFAFDMLCYNGQSLINNSLLERREYLQR 473

Query: 434 ILSPVANIVEILSDVRASEPNAIKVSLERAIEMGSEGIILKQF---SSPYEIGARNDSWI 490
           +L PV    +  +++ +S    ++  LE++++   EG+++K      S YE   R+ +W+
Sbjct: 474 VLKPVTGQFQFANELNSSNLEDVQKYLEQSVKDACEGLMVKVLEGEESHYEPSKRSRNWL 533

Query: 491 KIKPEYFEELGETMDLVVIGR--DPGKKDSLMCGLILA 526
           K+K +Y + +G+++DL V+G     GK+     G +L 
Sbjct: 534 KLKKDYLQGVGDSLDLCVLGAYYGRGKRTGTYGGFLLG 571

>ZYRO0F11572g Chr6 (949236..951431) [2196 bp, 731 aa] {ON} similar
           to uniprot|P04819 Saccharomyces cerevisiae YDL164C CDC9
           DNA ligase found in the nucleus and mitochondria an
           essential enzyme that joins Okazaki fragments during DNA
           replication also acts in nucleotide excision repair base
           excision repair and recombination
          Length = 731

 Score = 97.8 bits (242), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 101/405 (24%), Positives = 175/405 (43%), Gaps = 50/405 (12%)

Query: 257 ETLWNPTMRLGKNEL----SINIGRAFAPHLAKRLHLSYERVCAKLKQDFIIEEKMDGER 312
           E + N  +  G ++L     +  G    P LAK      E +     Q F+ E K DGER
Sbjct: 343 EIVINTCLEHGISQLHKHCQLTPGIPLKPMLAKPTKAITEVLDRFQGQLFVSEYKYDGER 402

Query: 313 IQLHYIERGAKIRFLSRRGTDFTHLYGDSLEHGVISQHLKFKNDVQDCVLDGEMVSFDKE 372
            QLH +  G  +R  SR G + T  Y +      +S         +  +LD E V++DKE
Sbjct: 403 AQLHLLPDGT-MRIYSRNGENMTERYPEIDIRDFLSDP-----STESLILDCEAVAWDKE 456

Query: 373 KNVVLPFGIVKSTAMEELMNSDTKVDTDGYRPLYMIFDLVYLNGVSLTRLPLHLRKSYLR 432
           +  +LPF ++ +   +++   D KV     R     FDL+  NG  L    L  R+  L+
Sbjct: 457 QGKILPFQVLSTRKRKDVDAKDVKV-----RVCLFAFDLLCHNGEPLINKSLRERQDDLQ 511

Query: 433 SILSPVANIVEILSDVRASEPNAIKVSLERAIEMGSEGIILKQFSSP---YEIGARNDSW 489
            +  PV       + +  +    ++  L+++++   EG+++K    P   YE   R+ +W
Sbjct: 512 KVTKPVDGEFRYANKLITANIEELQHFLDQSVKDSCEGLMVKMLDGPESHYEPSKRSRNW 571

Query: 490 IKIKPEYFEELGETMDLVVIGR--DPGKKDSLMCGLILADETDGSSVNLASQDDPLRPKQ 547
           +K+K +Y   +G+++DL V+G     GK+     G +L            +QD       
Sbjct: 572 LKLKKDYLNGVGDSLDLCVLGAYYGRGKRTGTYGGFLLG---------CYNQD------- 615

Query: 548 RNPKVISFCNIANGVSDAEFKEIERKTRGLWNLTTACPPPSGLLEFGT-KLPTEWIDPRS 606
              +  + C I  G S+   +++  + +      TA   P+    + + + P  W +P  
Sbjct: 616 -TGEYETCCKIGTGFSEELLQQLYDRLK-----PTAMEAPAAFYVYDSAQQPDVWFEP-- 667

Query: 607 SLVLEVKARSVDTDEL---SSKKYKTGSTLRGAYCRALRFNKDWS 648
           +L+ EV A  +    +    S +Y  G +LR  + R LR   D S
Sbjct: 668 TLLFEVLAADLSLSPVYKAGSAQYDKGISLR--FPRFLRIRDDKS 710

>Suva_4.82 Chr4 complement(152544..154811) [2268 bp, 755 aa] {ON}
           YDL164C (REAL)
          Length = 755

 Score = 97.8 bits (242), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 102/399 (25%), Positives = 175/399 (43%), Gaps = 49/399 (12%)

Query: 254 VLSETLWNPTMRLGKNELSINIGRAFAPHLAKRLHLSYERVCAKLKQDFIIEEKMDGERI 313
           V++  L +  M L K   ++  G    P LAK      E +     + F  E K DGER 
Sbjct: 367 VINSCLEHGIMNLDKF-CTLKPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERA 425

Query: 314 QLHYIERGAKIRFLSRRGTDFTHLYGDSLEHGVISQHLKFKNDVQDCVLDGEMVSFDKEK 373
           Q+H ++ G  +R  SR G + T  Y +      I+  ++  +  ++ +LD E V++DKE+
Sbjct: 426 QVHLLDDGT-MRIYSRNGENMTERYPEI----KITDFIQDLDATKNLILDCEAVAWDKEQ 480

Query: 374 NVVLPFGIVKSTAMEELMNSDTKVDTDGYRPLYMIFDLVYLNGVSLTRLPLHLRKSYLRS 433
             +LPF ++ +   +++  SD KV     R     FD++  NG  L    L  R+  L  
Sbjct: 481 GKILPFQVLSTRKRKDVELSDVKV-----RVCLFAFDVLCHNGERLINKSLRERRECLTK 535

Query: 434 ILSPVANIVEILSDVRASEPNAIKVSLERAIEMGSEGIILKQFSSP---YEIGARNDSWI 490
           +   V    +  + +     + ++  L+ ++    EG+++K    P   YE   R+ +W+
Sbjct: 536 VTKVVPGEFQYATQIVTDNLDELQKFLDESVNQSCEGLMVKMLEGPESHYEPSKRSRNWL 595

Query: 491 KIKPEYFEELGETMDLVVIGR--DPGKKDSLMCGLILADETDGSSVNLASQDDPLRPKQR 548
           K+K +Y E +G+++DL V+G     GK+     G +L            +QD        
Sbjct: 596 KLKKDYLEGVGDSLDLCVLGAYYGRGKRTGTYGGFLLG---------CYNQD-------- 638

Query: 549 NPKVISFCNIANGVSDAEFKEI-ERKTRGLWNLTTACPPPSGLLEFGTKLPTEWIDPRSS 607
             +  + C I  G SD   +++ ER T  + +      P +  +   +  P  W +P + 
Sbjct: 639 TGEFETCCKIGTGFSDESLQQLHERLTPTIID-----GPKATFVFDSSAEPDVWFEPTTL 693

Query: 608 LVLEVKARSVDTDELS-SKKYKTGSTL--RGAYCRALRF 643
                    V T +LS S  YK GST   +G   R  RF
Sbjct: 694 F-------EVLTADLSLSPIYKAGSTTFAKGVSLRFPRF 725

>TDEL0C02040 Chr3 complement(352579..354696) [2118 bp, 705 aa] {ON}
           Anc_7.343 YDL164C
          Length = 705

 Score = 97.4 bits (241), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 100/399 (25%), Positives = 171/399 (42%), Gaps = 50/399 (12%)

Query: 257 ETLWNPTMRLGKNELS----INIGRAFAPHLAKRLHLSYERVCAKLKQDFIIEEKMDGER 312
           E + N  +  G  EL     +  G    P LAK      E +     Q F  E K DGER
Sbjct: 316 EIVINACLDYGIMELDKHCRLRPGIPLKPMLAKPTKSITEVLDRFQGQTFTSEYKYDGER 375

Query: 313 IQLHYIERGAKIRFLSRRGTDFTHLYGDSLEHGVISQHLKFKNDVQDCVLDGEMVSFDKE 372
            Q+H +E G  +R  SR G + T  Y +      ++     K  + DC    E V++DK 
Sbjct: 376 AQVHLLEDGT-MRIYSRNGENMTERYPEISIRDFVADLEHTKTLILDC----EAVAWDKV 430

Query: 373 KNVVLPFGIVKSTAMEELMNSDTKVDTDGYRPLYMIFDLVYLNGVSLTRLPLHLRKSYLR 432
           +  +LPF ++ +   +++   D KV     R     FD++  NG       L  R+  L 
Sbjct: 431 QQKILPFQVLSTRKRKDVEAKDVKV-----RVCLFAFDIICHNGERQINKSLRERRELLA 485

Query: 433 SILSPVANIVEILSDVRASEPNAIKVSLERAIEMGSEGIILKQFSSP---YEIGARNDSW 489
            +  PVA   +   ++  S    ++  L+++++   EG+++K    P   YE   R+ +W
Sbjct: 486 QVTKPVAGEFQYAVELTTSSVEELQKFLDQSVKDSCEGLMVKMLDGPESHYEPSKRSRNW 545

Query: 490 IKIKPEYFEELGETMDLVVIGR--DPGKKDSLMCGLILADETDGSSVNLASQDDPLRPKQ 547
           +K+K +Y + +G+++DL V+G     GK+     G +L            +QD       
Sbjct: 546 LKLKKDYLDGVGDSLDLCVLGAYYGRGKRTGTYGGFLLG---------CYNQD------- 589

Query: 548 RNPKVISFCNIANGVSDAEFKEIERKTRGLWNLTTACPPPSGLLEFGTKLPTEWIDPRSS 607
            + +  + C I  G SD   +++  +    ++ TT   P +  +   +  P  W +P + 
Sbjct: 590 -SGEFETCCKIGTGFSDEMLQQLYER----FSKTTLDGPKATYVFDSSAEPDVWFEPTTL 644

Query: 608 LVLEVKARSVDTDELS-SKKYKTGSTL--RGAYCRALRF 643
                    V T +LS S  YK G++   +G   R  RF
Sbjct: 645 F-------EVLTADLSLSPVYKAGASTYDKGVSLRFPRF 676

>NCAS0A14110 Chr1 (2774465..2776726) [2262 bp, 753 aa] {ON}
           Anc_7.343 YDL164C
          Length = 753

 Score = 95.1 bits (235), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 100/398 (25%), Positives = 172/398 (43%), Gaps = 48/398 (12%)

Query: 257 ETLWNPTMRLGKNEL----SINIGRAFAPHLAKRLHLSYERVCAKLKQDFIIEEKMDGER 312
           E + N  ++ G  EL    S+  G    P LAK      E +     + F  E K DGER
Sbjct: 364 EIVINSCLKYGIMELETHCSLRPGIPLKPMLAKPTKAINEILDRFQGEIFTSEYKYDGER 423

Query: 313 IQLHYIERGAKIRFLSRRGTDFTHLYGDSLEHGVISQHLKFKNDVQDCVLDGEMVSFDKE 372
            Q+H +  G  +R  SR G + T  Y +      I+  L     + DC    E V++D E
Sbjct: 424 AQVHLLSDGT-MRIYSRNGENMTERYPEIHIRDFIADPLVTSTLILDC----EAVAWDNE 478

Query: 373 KNVVLPFGIVKSTAMEELMNSDTKVDTDGYRPLYMIFDLVYLNGVSLTRLPLHLRKSYLR 432
           +N +LPF ++ +   +++   D KV     +     FD++  N   L    L  R+  L+
Sbjct: 479 QNKILPFQVLSTRKRKDVDLKDVKV-----KVCLFAFDILCHNDEKLINKSLRERRQILQ 533

Query: 433 SILSPVANIVEILSDVRASEPNAIKVSLERAIEMGSEGIILKQFS---SPYEIGARNDSW 489
            +   V    +  +++ +S  + ++  L++++    EG+++K      S YE   R+ +W
Sbjct: 534 EVTKSVTGEFQYATEMTSSNLDELQKFLDQSVHDSCEGLMVKMLDGIESHYEPSKRSRNW 593

Query: 490 IKIKPEYFEELGETMDLVVIGR--DPGKKDSLMCGLILADETDGSSVNLASQDDPLRPKQ 547
           +K+K +Y E +G+++DL VIG     GK+  +  G +L            +QD       
Sbjct: 594 LKLKKDYLEGIGDSLDLCVIGAYYGRGKRTGMYGGFLLG---------CYNQD------- 637

Query: 548 RNPKVISFCNIANGVSDAEFKEIERKTRGLWNLTTACPPPSGLLEFGTKLPTEWIDPRSS 607
              +  + C I  G SD   +++  +       T    P +  +   +  P  W +P  +
Sbjct: 638 -TGEFETCCKIGTGFSDEMLQQLYTR----LTPTVLDGPKATFVYDSSAEPDVWFEP--T 690

Query: 608 LVLEVKARSVDTDELSSKKYKTGSTL--RGAYCRALRF 643
           L+ EV    +  D   S  YK GS+   +G   R  RF
Sbjct: 691 LLFEV----LTADLSLSPIYKAGSSTYDKGISLRFPRF 724

>KNAG0C03740 Chr3 (737968..740151) [2184 bp, 727 aa] {ON} Anc_7.343
           YDL164C
          Length = 727

 Score = 94.7 bits (234), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 90/352 (25%), Positives = 157/352 (44%), Gaps = 46/352 (13%)

Query: 300 QDFIIEEKMDGERIQLHYIERGAKIRFLSRRGTDFTHLYGDSLEHGVISQHLKFKNDVQD 359
           Q F  E K DGER Q+H +E G  +R  SR G + T  Y +      ++     K+ + D
Sbjct: 384 QKFTCEYKYDGERAQVHLLEDGT-MRIYSRNGENMTERYPEIHIRDFVTDLSHTKSLILD 442

Query: 360 CVLDGEMVSFDKEKNVVLPFGIVKSTAMEELMNSDTKVDTDGYRPLYMIFDLVYLNGVSL 419
           C    E V++DKE+N +LPF ++ +   +++  ++ KV     R     FD++  N   L
Sbjct: 443 C----EAVAWDKEQNKILPFQVLSTRKRKDVDINEIKV-----RVCLFAFDILLHNDEKL 493

Query: 420 TRLPLHLRKSYLRSILSPVANIVEILSDVRASEPNAIKVSLERAIEMGSEGIILKQFS-- 477
               L  R+  L SI   V    +  +++  +    ++  L+++++   EG+++K     
Sbjct: 494 INKSLQERRDILHSITKEVTGEFQFATEMTTTNLEELQSFLDQSVKNSCEGLMVKMLEGE 553

Query: 478 -SPYEIGARNDSWIKIKPEYFEELGETMDLVVIGR--DPGKKDSLMCGLILADETDGSSV 534
            S YE   R+ +W+K+K +Y   +G+++DL V+G     GK+     G +L         
Sbjct: 554 ESHYEPSKRSRNWLKLKKDYLAGVGDSLDLCVLGAYFGRGKRTGNYGGFLLG-------- 605

Query: 535 NLASQDDPLRPKQRNPKVISFCNIANGVSDAEFKEIERKTRGLWNLTTACPPPSGLLEFG 594
              +QD          +  + C I  G SD   +++  + +     +T    P     F 
Sbjct: 606 -CYNQD--------TGEFETACKIGTGFSDEVLQQLHERLK-----STVIDLPKATYVFD 651

Query: 595 -TKLPTEWIDPRSSLVLEVKARSVDTDELSSKKYKTGSTL--RGAYCRALRF 643
            +  P  W +P  +L+ EV    +  D   S  YK GS+   +G   R  RF
Sbjct: 652 PSAEPDVWFEP--TLLFEV----LTADLSLSPVYKAGSSTYDKGVSLRFPRF 697

>KLLA0D12496g Chr4 complement(1059684..1061786) [2103 bp, 700 aa]
           {ON} similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination,
          Length = 700

 Score = 93.6 bits (231), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 94/384 (24%), Positives = 168/384 (43%), Gaps = 48/384 (12%)

Query: 257 ETLWNPTMRLGKNELSINI----GRAFAPHLAKRLHLSYERVCAKLKQDFIIEEKMDGER 312
           E + N  ++ G   L+ +I    G    P LAK      E +       F  E K DGER
Sbjct: 311 EMIINVALQYGIMNLNQHIKLRPGIPLQPMLAKPTKSISEVLDRFQGTKFTCEYKYDGER 370

Query: 313 IQLHYIERGAKIRFLSRRGTDFTHLYGDSLEHGVISQHLKFKNDVQDCVLDGEMVSFDKE 372
            Q+H    G+ ++  SR G D T  Y +      +  ++K     +  ++D E V++D+E
Sbjct: 371 AQVHLCRDGS-MKIYSRNGEDMTERYPEI----DVKHYVKDLGATKSFIVDSEAVAWDQE 425

Query: 373 KNVVLPFGIVKSTAMEELMNSDTKVDTDGYRPLYMIFDLVYLNGVSLTRLPLHLRKSYLR 432
           +  +LPF ++ +   + +   D KV     R     FD++ LN   L     H R+  L 
Sbjct: 426 QGKILPFQVLSTRKRKGVELKDVKV-----RVCLYAFDILCLNDEPLINKSFHERRQILL 480

Query: 433 SILSPVANIVEILSDVRASEPNAIKVSLERAIEMGSEGIILKQFS---SPYEIGARNDSW 489
              +      +  +++  +  + ++  L+++++   EG+++K      S YE   R+ +W
Sbjct: 481 DTFNGTQGQFDFANELTTTNFDELQKYLDQSVKDSCEGLMVKMLEGEESHYEPSKRSRNW 540

Query: 490 IKIKPEYFEELGETMDLVVIGR--DPGKKDSLMCGLILADETDGSSVNLASQDDPLRPKQ 547
           +K+K +Y E +G+++DLVV+G     GK+     G +L         NL S++       
Sbjct: 541 LKLKKDYLEGVGDSLDLVVLGAYYGRGKRTGTYGGFLLG------CYNLDSEE------- 587

Query: 548 RNPKVISFCNIANGVSDAEFKEIERKTRGLWNLTTACPPPSGLLEFGTKLPTE-WIDPRS 606
                 + C I  G SD   +++  K +      T    PS  + + +  P + W +P  
Sbjct: 588 ----FETCCKIGTGFSDEMLQDLYTKLKD-----TTVEHPSTNVIYDSSAPADVWFEP-- 636

Query: 607 SLVLEVKARSVDTDELSSKKYKTG 630
           S++ EV    +  D   S  YK G
Sbjct: 637 SMLFEV----LTADLSLSPVYKAG 656

>YDL164C Chr4 complement(164987..167254) [2268 bp, 755 aa] {ON}
           CDC9DNA ligase found in the nucleus and mitochondria, an
           essential enzyme that joins Okazaki fragments during DNA
           replication; also acts in nucleotide excision repair,
           base excision repair, and recombination
          Length = 755

 Score = 92.4 bits (228), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 71/278 (25%), Positives = 132/278 (47%), Gaps = 16/278 (5%)

Query: 254 VLSETLWNPTMRLGKNELSINIGRAFAPHLAKRLHLSYERVCAKLKQDFIIEEKMDGERI 313
           V++  L +  M L K   ++  G    P LAK      E +     + F  E K DGER 
Sbjct: 367 VINSCLEHGIMNLDKY-CTLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERA 425

Query: 314 QLHYIERGAKIRFLSRRGTDFTHLYGDSLEHGVISQHLKFKNDVQDCVLDGEMVSFDKEK 373
           Q+H +  G  +R  SR G + T  Y +      I+  ++  +  ++ +LD E V++DK++
Sbjct: 426 QVHLLNDGT-MRIYSRNGENMTERYPEI----NITDFIQDLDTTKNLILDCEAVAWDKDQ 480

Query: 374 NVVLPFGIVKSTAMEELMNSDTKVDTDGYRPLYMIFDLVYLNGVSLTRLPLHLRKSYLRS 433
             +LPF ++ +   +++  +D KV     +     FD++  N   L    L  R+ YL  
Sbjct: 481 GKILPFQVLSTRKRKDVELNDVKV-----KVCLFAFDILCYNDERLINKSLKERREYLTK 535

Query: 434 ILSPVANIVEILSDVRASEPNAIKVSLERAIEMGSEGIILKQFSSP---YEIGARNDSWI 490
           +   V    +  + +  +  + ++  L+ ++    EG+++K    P   YE   R+ +W+
Sbjct: 536 VTKVVPGEFQYATQITTNNLDELQKFLDESVNHSCEGLMVKMLEGPESHYEPSKRSRNWL 595

Query: 491 KIKPEYFEELGETMDLVVIGR--DPGKKDSLMCGLILA 526
           K+K +Y E +G+++DL V+G     GK+     G +L 
Sbjct: 596 KLKKDYLEGVGDSLDLCVLGAYYGRGKRTGTYGGFLLG 633

>Skud_4.93 Chr4 complement(160642..162909) [2268 bp, 755 aa] {ON}
           YDL164C (REAL)
          Length = 755

 Score = 92.0 bits (227), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 73/278 (26%), Positives = 131/278 (47%), Gaps = 16/278 (5%)

Query: 254 VLSETLWNPTMRLGKNELSINIGRAFAPHLAKRLHLSYERVCAKLKQDFIIEEKMDGERI 313
           V++  L +  M L K   ++  G    P LAK      E +     + F  E K DGER 
Sbjct: 367 VINSCLNHGIMNLDKY-CTLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERA 425

Query: 314 QLHYIERGAKIRFLSRRGTDFTHLYGDSLEHGVISQHLKFKNDVQDCVLDGEMVSFDKEK 373
           Q+H +  G  +R  SR G + T  Y +      I+  ++  N  ++ +LD E V++DKE+
Sbjct: 426 QVHLLNDGT-MRIYSRNGENMTERYPEI----KITDFIQDLNSTKNLILDCEAVAWDKEQ 480

Query: 374 NVVLPFGIVKSTAMEELMNSDTKVDTDGYRPLYMIFDLVYLNGVSLTRLPLHLRKSYLRS 433
             +LPF I+ +   +++   D KV     +     FD++  N   L    L  R+ +L  
Sbjct: 481 KKILPFQILSTRKRKDVELHDVKV-----KVCLFAFDILCYNDERLINKSLRERREHLAK 535

Query: 434 ILSPVANIVEILSDVRASEPNAIKVSLERAIEMGSEGIILKQFSSP---YEIGARNDSWI 490
           +   V    +  + +  +  + ++  L+ ++    EG+++K    P   YE   R+ +W+
Sbjct: 536 VTKVVPGEFQYATQIITNNLDELQKFLDESVNNSCEGLMVKMLDGPESHYEPSKRSRNWL 595

Query: 491 KIKPEYFEELGETMDLVVIGR--DPGKKDSLMCGLILA 526
           K+K +Y E +G+++DL V+G     GK+     G +L 
Sbjct: 596 KLKKDYLEGVGDSLDLCVLGAYYGRGKRTGTYGGFLLG 633

>Smik_4.74 Chr4 complement(141744..144281) [2538 bp, 845 aa] {ON}
           YDL164C (REAL)
          Length = 845

 Score = 90.5 bits (223), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 98/397 (24%), Positives = 172/397 (43%), Gaps = 45/397 (11%)

Query: 254 VLSETLWNPTMRLGKNELSINIGRAFAPHLAKRLHLSYERVCAKLKQDFIIEEKMDGERI 313
           V++  L +  M L K   ++  G    P LAK      E +     + F  E K DGER 
Sbjct: 457 VINSCLEHGIMNLDK-YCTLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERA 515

Query: 314 QLHYIERGAKIRFLSRRGTDFTHLYGDSLEHGVISQHLKFKNDVQDCVLDGEMVSFDKEK 373
           Q+H +  G  +R  SR G + T  Y +      I+  ++  +  ++ +LD E V++DK++
Sbjct: 516 QVHLLNDGT-MRIYSRNGENMTERYPEI----KITDFIQDLDITKNLILDCEAVAWDKDQ 570

Query: 374 NVVLPFGIVKSTAMEELMNSDTKVDTDGYRPLYMIFDLVYLNGVSLTRLPLHLRKSYLRS 433
             +LPF ++ +   +++  +D KV     R     FD++  N   L  + L  R+ YL  
Sbjct: 571 AKILPFQVLSTRKRKDVELNDVKV-----RVCLFAFDILCHNDERLINMSLRERREYLTK 625

Query: 434 ILSPVANIVEILSDVRASEPNAIKVSLERAIEMGSEGIILKQFS---SPYEIGARNDSWI 490
           +   V    +  + +  +  + ++  L+ ++    EG+++K      S YE   R+ +W+
Sbjct: 626 VTKVVPGEFQYATQIITNNLDELQKFLDESVNHSCEGLMVKMLDGSESHYEPSKRSRNWL 685

Query: 491 KIKPEYFEELGETMDLVVIGR--DPGKKDSLMCGLILADETDGSSVNLASQDDPLRPKQR 548
           K+K +Y E +G+++DL V+G     GK+     G +L            +QD        
Sbjct: 686 KLKKDYLEGVGDSLDLCVLGAYYGRGKRTGTYGGFLLG---------CYNQD-------- 728

Query: 549 NPKVISFCNIANGVSDAEFKEIERKTRGLWNLTTACPPPSGLLEFGTKLPTEWIDPRSSL 608
             +  + C I  G SD    E+ +        T    P +  +   +  P  W +P +  
Sbjct: 729 TGEFETCCKIGTGFSD----EMLQLLHARLTPTIIDGPKATYVFDSSAEPDVWFEPTT-- 782

Query: 609 VLEVKARSVDTDELSSKKYKTGSTL--RGAYCRALRF 643
           + EV    +  D   S  YK GST   +G   R  RF
Sbjct: 783 LFEV----LTADLSLSPIYKAGSTTFDKGVSLRFPRF 815

>KAFR0B00830 Chr2 (157155..159287) [2133 bp, 710 aa] {ON} Anc_7.343
           YDL164C
          Length = 710

 Score = 89.4 bits (220), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 95/405 (23%), Positives = 174/405 (42%), Gaps = 47/405 (11%)

Query: 257 ETLWNPTMRLGKNEL----SINIGRAFAPHLAKRLHLSYERVCAKLKQDFIIEEKMDGER 312
           E + N  ++ G   L    S+  G    P LAK      E         F  E K DGER
Sbjct: 320 EIVINSCLKYGIMNLDEHCSLRPGIPLKPMLAKPTKTIMEVFDRFQNIHFTSEYKYDGER 379

Query: 313 IQLHYIERGAKIRFLSRRGTDFTHLYGDSLEHGVISQHLKFKNDVQDCVLDGEMVSFDKE 372
            Q+H +  G+ +R  SR G + T  Y +      ++  +K  N  +  ++D E V++D+E
Sbjct: 380 AQVHLMNDGS-MRIYSRNGENMTERYPEI----NVTDFIKDLNLTKSLIIDCEAVAWDRE 434

Query: 373 KNVVLPFGIVKSTAMEELMNSDTKVDTDGYRPLYMIFDLVYLNGVSLTRLPLHLRKSYLR 432
           +  +LPF ++ +   +++   D KV     R     FD++  N   L    L  R+  L 
Sbjct: 435 EKKILPFQVLSTRKRKDVDIKDIKV-----RICLFAFDILCHNDEKLINKSLRERREILH 489

Query: 433 SILSPVANIVEILSDVRASEPNAIKVSLERAIEMGSEGIILKQFS---SPYEIGARNDSW 489
           S+   V        ++  +  + +++ L+++++   EG+++K      S YE   R+ +W
Sbjct: 490 SVTREVHGEFTYAKELSTNNLDELQLFLDQSVKDSCEGLMVKVLDGEDSHYEPSKRSRNW 549

Query: 490 IKIKPEYFEELGETMDLVVIGR--DPGKKDSLMCGLILADETDGSSVNLASQDDPLRPKQ 547
           +K+K +Y + +G+++DL V+G     GK+     G +L            +QD       
Sbjct: 550 LKLKKDYLDGVGDSLDLCVLGAFYGRGKRTGTYGGFLLG---------CYNQD------- 593

Query: 548 RNPKVISFCNIANGVSDAEFKEIERKTRGLWNLTTACPPPSGLLEFGTKLPTEWIDPRSS 607
              +  + C I  G SD   + +  + +     TT   P +  +   +  P  W +P  +
Sbjct: 594 -TGEFETACKIGTGFSDEVLQSLYDRLKS----TTIDGPKATYIYDSSAQPDVWFEP--T 646

Query: 608 LVLEVKARSVDTDEL---SSKKYKTGSTLRGAYCRALRFNKDWST 649
           L+ EV    +    +    +  Y  G +LR  + R +R  +D S 
Sbjct: 647 LLFEVLTADLSMSPIYKAGASTYSKGISLR--FPRFIRLREDKSV 689

>KNAG0F01900 Chr6 (367193..368566) [1374 bp, 457 aa] {ON} Anc_6.228
           YGL130W
          Length = 457

 Score = 41.2 bits (95), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 52/232 (22%), Positives = 100/232 (43%), Gaps = 46/232 (19%)

Query: 284 AKRLHLSYERVCAKLK-QDFIIEEKMDGERIQLHYIER---GAKIRFLSRRGTDFTHLYG 339
           ++ +   +  +  KL+ QD+ + EK DG R+ +  +     G +  F+  R  ++  + G
Sbjct: 42  SQPISFQHSDIAEKLQTQDYYVCEKTDGLRVLMFILLNPVTGEQGCFMIDRENNYYLVNG 101

Query: 340 DSLEHGVISQHLKFKNDVQD-CVLDGEMVSFDKEKNVVLPFGIVKSTAMEELMNSDTKVD 398
                    +  +    +QD  ++DGE+V    + N V        T ++EL        
Sbjct: 102 FRFPKLPKKKKEELLETLQDGTLIDGELVV---QTNPV--------TKLQELR------- 143

Query: 399 TDGYRPLYMIFDLVYLNGVSLTRLPLHLRKSYL-RSILSPVANIVEILSDVRASEP---- 453
                  Y++FD + +NG SL + P   R ++L +    P  ++     D  ++ P    
Sbjct: 144 -------YLMFDCLAINGRSLIQSPTSSRLAHLGKEFFKPYYDLRSFYPDHCSTFPLKLS 196

Query: 454 --------NAIKV--SLERAIEMGSEGIILKQFSSPYEIGARNDSWIKIKPE 495
                     +KV  SL++   M S+G+I     +PY++G ++   +K KPE
Sbjct: 197 MKHMDFSYELVKVAQSLDKLPHM-SDGLIFTPVRAPYQVGGKDSLLLKWKPE 247

>ZYRO0E07150g Chr5 complement(540507..541856) [1350 bp, 449 aa] {ON}
           highly similar to uniprot|Q01159 Saccharomyces
           cerevisiae YGL130W CEG1 mRNA guanylyltransferase (mRNA
           capping enzyme), alpha subunit
          Length = 449

 Score = 40.4 bits (93), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 51/220 (23%), Positives = 89/220 (40%), Gaps = 51/220 (23%)

Query: 298 LKQDFIIEEKMDGERIQLHYI------ERGAKIRFLSRRGTDFTHLYGDSLEHGVISQHL 351
           L+QD+ + EK DG R+ +  +      E+G    F+  R  +F  + G            
Sbjct: 57  LEQDYYVCEKTDGLRVLMLILINPVTREQGC---FMIDRENNFYLVNGFRFPRLPHKDKK 113

Query: 352 KFKNDVQD-CVLDGEMVSFDKEKNVVLPFGIVKSTAMEELMNSDTKVDTDGYRPLYMIFD 410
           +    +QD  +LDGE+V              +++  M +L               Y++FD
Sbjct: 114 ELLETLQDGTLLDGELV--------------IQTNPMTKLKELR-----------YLMFD 148

Query: 411 LVYLNGVSLTRLPLHLRKSYL-RSILSPVANIVEILSDVRASEPNAIKV----------- 458
            + +NG  LT  P   R ++L +    P  ++  +  D   + P  I +           
Sbjct: 149 CLAINGRCLTPSPTSSRLAHLGKEFFKPYFDLRLVYPDQCVTFPFKISMKHMSFSYDLLK 208

Query: 459 ---SLERAIEMGSEGIILKQFSSPYEIGARNDSWIKIKPE 495
              SLE+   M S+G+I     +PY +G ++   +K KPE
Sbjct: 209 VANSLEKLPHM-SDGLIFTPVKTPYFVGGKDSLLLKWKPE 247

>CAGL0I09570g Chr9 complement(914062..915411) [1350 bp, 449 aa] {ON}
           highly similar to uniprot|Q01159 Saccharomyces
           cerevisiae YGL130w mRNA guanylyltransferase
          Length = 449

 Score = 38.9 bits (89), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 35/131 (26%), Positives = 60/131 (45%), Gaps = 24/131 (18%)

Query: 406 YMIFDLVYLNGVSLTRLPLHLRKSYL-RSILSPVANIVEILSDVRASEP----------- 453
           Y++FD + +NG SL + P   R ++L +    P  ++  I  D  A+ P           
Sbjct: 144 YLMFDCLAINGRSLVQSPTSSRLAHLGKEFYKPYYDLRSIYPDKCATFPFKLSMKHMDFS 203

Query: 454 -NAIKV--SLERAIEMGSEGIILKQFSSPYEIGARNDSWIKIKPE--------YFEELGE 502
            + +KV  SL++   + S+G+I     +PY +G ++   +K KPE           E+  
Sbjct: 204 YSLVKVANSLDKLPHL-SDGLIFTPVRTPYAVGGKDSLLLKWKPEQENSVDFKLILEIPM 262

Query: 503 TMDLVVIGRDP 513
           T D  V  +DP
Sbjct: 263 TEDNSVAKKDP 273

>AFL107W Chr6 (239635..241026) [1392 bp, 463 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGL130W (CEG1)
          Length = 463

 Score = 38.5 bits (88), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 51/219 (23%), Positives = 87/219 (39%), Gaps = 49/219 (22%)

Query: 298 LKQDFIIEEKMDGERIQLHYI------ERGAKIRFLSRRGTDFTHLYGDSLEHGVISQHL 351
           L QD+ + EK DG R  +  I      E+G    FL  R  ++  L G        +   
Sbjct: 57  LAQDYYVCEKTDGLRALMLIIMNPVTKEQGC---FLIDRENNYYLLNGFRFPRLPRANRK 113

Query: 352 KFKNDVQDCVL-DGEMVSFDKEKNVVLPFGIVKSTAMEELMNSDTKVDTDGYRPLYMIFD 410
           +    +QD  L DGE+V                +T + EL               Y++FD
Sbjct: 114 ELLETLQDGTLVDGELV-----------VQTNPATRLRELR--------------YLMFD 148

Query: 411 LVYLNGVSLTRLPLHLRKSYL-RSILSPVANIVEILSDVRASEPNAIKV-------SLER 462
            + +NG +L + P   R ++L +    P  ++     D  A+ P  + +        L+R
Sbjct: 149 CLAINGRALVQSPTSSRLAHLGKEFYKPYYDLRAYYPDRCATFPFKLSMKHMNFSFDLDR 208

Query: 463 A------IEMGSEGIILKQFSSPYEIGARNDSWIKIKPE 495
                  +   S+G+I     +PY +G ++ + +K KPE
Sbjct: 209 VAGSLDKLPHVSDGLIFTAVDTPYTVGGKDSTLLKWKPE 247

>NCAS0D04100 Chr4 (774815..776164) [1350 bp, 449 aa] {ON} Anc_6.228
           YGL130W
          Length = 449

 Score = 38.1 bits (87), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 47/217 (21%), Positives = 88/217 (40%), Gaps = 45/217 (20%)

Query: 298 LKQDFIIEEKMDGERIQLHYIER---GAKIRFLSRRGTDFTHLYGDSLEHGVISQHLKFK 354
           + QD+ + EK DG R+ +  +     G +  F+  R  ++  + G         +  +  
Sbjct: 57  MSQDYYVCEKTDGLRVLMFILINPITGEQGSFMIDRENNYYLVNGFKFPKLPQKKKEELL 116

Query: 355 NDVQD-CVLDGEMVSFDKEKNVVLPFGIVKSTAMEELMNSDTKVDTDGYRPLYMIFDLVY 413
             +QD  +LDGE+V              +++  M +L               Y++FD + 
Sbjct: 117 ETLQDGTLLDGELV--------------IQTNPMTKLKELR-----------YLMFDCLA 151

Query: 414 LNGVSLTRLPLHLRKSYL-RSILSPVANIVEILSDVRASEPNAIKV-------------- 458
           +NG SL + P   R ++L +    P  ++  I  +   + P  I +              
Sbjct: 152 INGRSLMQSPTSSRLAHLGKDFFKPYYDLRSIYPNHCNTFPFKISMKHMDFSYALVKVAN 211

Query: 459 SLERAIEMGSEGIILKQFSSPYEIGARNDSWIKIKPE 495
           SL++   + S+G+I      PY IG ++   +K KPE
Sbjct: 212 SLDKLPHL-SDGLIFTPVKMPYNIGGKDSYLLKWKPE 247

>TPHA0E02770 Chr5 (580118..581470) [1353 bp, 450 aa] {ON} Anc_6.228
           YGL130W
          Length = 450

 Score = 38.1 bits (87), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 51/106 (48%), Gaps = 18/106 (16%)

Query: 406 YMIFDLVYLNGVSLTRLPLHLRKSYL-RSILSPVANIVEILSDVRASEPNAIKVSLERA- 463
           Y++FD + +NG +LT  P   R ++L +    P  ++  I  D   + P   K+S+++  
Sbjct: 143 YLMFDCLTMNGRNLTHSPTSSRLAHLGKEFYKPYFDMRSIFPDRCINFP--FKISMKQMN 200

Query: 464 --------------IEMGSEGIILKQFSSPYEIGARNDSWIKIKPE 495
                         +   S+G+I    ++PY +GA++   +K KPE
Sbjct: 201 FSYDLVNVYKTLDKLPHLSDGLIFTPVNTPYVVGAKDSYLLKWKPE 246

>SAKL0A04114g Chr1 (386331..387728) [1398 bp, 465 aa] {ON} highly
           similar to uniprot|Q01159 Saccharomyces cerevisiae
           YGL130W CEG1 mRNA guanylyltransferase (mRNA capping
           enzyme), alpha subunit
          Length = 465

 Score = 37.7 bits (86), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 47/104 (45%), Gaps = 14/104 (13%)

Query: 406 YMIFDLVYLNGVSLTRLPLHLRKSYL-RSILSPVANIVEILSDVRASEPNAIKVSLER-- 462
           Y++FD + +NG SL + P   R ++L +    P  ++  +  D   + P  I V L    
Sbjct: 145 YLMFDCLAINGRSLLQSPTSSRLAHLCKDFFRPYYDLRSLYPDHCTNFPFKISVKLMHFS 204

Query: 463 -----------AIEMGSEGIILKQFSSPYEIGARNDSWIKIKPE 495
                       +   S+G+I    ++PY +G ++   +K KPE
Sbjct: 205 YDLVKVASTLDKLPHVSDGLIFTPVTTPYYVGGKDSFLLKWKPE 248

>Smik_7.141 Chr7 (260116..261495) [1380 bp, 459 aa] {ON} YGL130W
           (REAL)
          Length = 459

 Score = 37.7 bits (86), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 49/223 (21%), Positives = 88/223 (39%), Gaps = 57/223 (25%)

Query: 298 LKQDFIIEEKMDGERIQLHYI---ERGAKIRFLSRRGTDFTHLYGDSLEHGVISQHLKFK 354
           L QD+ + EK DG R+ +  +     G +  F+  R  ++  + G         +  +  
Sbjct: 61  LAQDYYVCEKTDGLRVLMFIVINPVTGEQGCFMIDRENNYYLVNGFRFPKLPQKKKEELL 120

Query: 355 NDVQD-CVLDGEMVSFDKEKNVVLPFGIVKSTAMEELMNSDTKVDTDGYRPLYMIFDLVY 413
             +QD  +LDGE+V              +++  M +L               Y++FD + 
Sbjct: 121 ETLQDGTLLDGELV--------------IQTNPMTKLQELR-----------YLMFDCLA 155

Query: 414 LNGVSLTRLPLHLRKSYL-RSILSPVANIVEILSDVRASEPN-----AIKVSLERA---- 463
           +NG  LT+ P   R ++L +    P         D+RA+ PN       K+S++      
Sbjct: 156 INGRCLTQSPTSSRLAHLGKEFFKPYF-------DLRAAFPNRCTTFPFKISMKHMDFSY 208

Query: 464 -----------IEMGSEGIILKQFSSPYEIGARNDSWIKIKPE 495
                      +   S+G+I     +PY  G ++   +K KPE
Sbjct: 209 QLVKVAKSLDKLPHLSDGLIFTPVKAPYTAGGKDSLLLKWKPE 251

>Ecym_6341 Chr6 (656835..659138) [2304 bp, 767 aa] {ON} similar to
           Ashbya gossypii AFR095C
          Length = 767

 Score = 37.0 bits (84), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 32/61 (52%), Gaps = 2/61 (3%)

Query: 738 NSGHVLHNNFVRREEFS--RLRIISGKNTVECRSLTEKGYDIIHPSWIFDCLNYGSLVKL 795
           +S   L N+F++  E S   + I         ++  E+G  I+HP W+ DC   G+++++
Sbjct: 137 HSYRCLTNHFIKDIECSAQSVFITDCATGARAKAAREEGVPIVHPKWVMDCTKRGAVLEM 196

Query: 796 E 796
           E
Sbjct: 197 E 197

>YGL130W Chr7 (266145..267524) [1380 bp, 459 aa] {ON}  CEG1Alpha
           (guanylyltransferase) subunit of the mRNA capping
           enzyme, a heterodimer (the other subunit is CET1, an RNA
           5'-triphosphatase) involved in adding the 5' cap to
           mRNA; the mammalian enzyme is a single bifunctional
           polypeptide
          Length = 459

 Score = 36.6 bits (83), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 48/223 (21%), Positives = 87/223 (39%), Gaps = 57/223 (25%)

Query: 298 LKQDFIIEEKMDGERIQLHYI---ERGAKIRFLSRRGTDFTHLYGDSLEHGVISQHLKFK 354
           L  D+ + EK DG R+ +  +     G +  F+  R  ++  + G         +  +  
Sbjct: 61  LAHDYYVCEKTDGLRVLMFIVINPVTGEQGCFMIDRENNYYLVNGFRFPRLPQKKKEELL 120

Query: 355 NDVQD-CVLDGEMVSFDKEKNVVLPFGIVKSTAMEELMNSDTKVDTDGYRPLYMIFDLVY 413
             +QD  +LDGE+V              +++  M +L               Y++FD + 
Sbjct: 121 ETLQDGTLLDGELV--------------IQTNPMTKLQELR-----------YLMFDCLA 155

Query: 414 LNGVSLTRLPLHLRKSYL-RSILSPVANIVEILSDVRASEPN-----AIKVSLERA---- 463
           +NG  LT+ P   R ++L +    P         D+RA+ PN       K+S++      
Sbjct: 156 INGRCLTQSPTSSRLAHLGKEFFKPYF-------DLRAAYPNRCTTFPFKISMKHMDFSY 208

Query: 464 -----------IEMGSEGIILKQFSSPYEIGARNDSWIKIKPE 495
                      +   S+G+I     +PY  G ++   +K KPE
Sbjct: 209 QLVKVAKSLDKLPHLSDGLIFTPVKAPYTAGGKDSLLLKWKPE 251

>Suva_7.133 Chr7 (262417..263796) [1380 bp, 459 aa] {ON} YGL130W
           (REAL)
          Length = 459

 Score = 35.8 bits (81), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 53/224 (23%), Positives = 90/224 (40%), Gaps = 59/224 (26%)

Query: 298 LKQDFIIEEKMDGERIQLHYI---ERGAKIRFLSRRGTDFTHLYGDSLEHGVISQHLKFK 354
           L  D+ + EK DG R+ +  +     G +  F+  R  ++  + G         +  +  
Sbjct: 61  LSHDYYVCEKTDGLRVLMFIVINPVTGEQGCFMIDRENNYYLVNGFRFPRLPQKKKEELL 120

Query: 355 NDVQD-CVLDGEMVSFDKEKNVVLPFGIVKSTAMEELMNSDTKVDTDGYRPLYMIFDLVY 413
             +QD  +LDGE+V    + N V        T ++EL               Y++FD + 
Sbjct: 121 ETLQDGTLLDGELVI---QTNPV--------TKLQELR--------------YLMFDCLA 155

Query: 414 LNGVSLTRLPLHLRKSYL-RSILSPVANIVEILSDVRASEPN------------------ 454
           +NG  L + P   R ++L +    P         D+RA+ PN                  
Sbjct: 156 INGRCLVQSPTSSRLAHLGKEFFKPYF-------DLRAAYPNRCTTFPFKISMKHMDFSY 208

Query: 455 -AIKV--SLERAIEMGSEGIILKQFSSPYEIGARNDSWIKIKPE 495
             +KV  SLE+   + S+G+I     +PY  G ++   +K KPE
Sbjct: 209 QLVKVAKSLEKLPHL-SDGLIFTPVKAPYTAGGKDSLLLKWKPE 251

>KAFR0K02360 Chr11 complement(481829..483202) [1374 bp, 457 aa] {ON}
           Anc_6.228 YGL130W
          Length = 457

 Score = 35.8 bits (81), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 47/217 (21%), Positives = 90/217 (41%), Gaps = 45/217 (20%)

Query: 298 LKQDFIIEEKMDGERIQLHYI---ERGAKIRFLSRRGTDFTHLYGDSLEHGVISQHLKFK 354
           L  D+ + EK DG R+ +  +     G +  F+  R  ++  + G         +  +  
Sbjct: 57  LSHDYYVCEKTDGLRVLMLIVINPVTGEQGCFMVDRENNYYLVNGFRFPKLPKKRKEELL 116

Query: 355 NDVQD-CVLDGEMVSFDKEKNVVLPFGIVKSTAMEELMNSDTKVDTDGYRPLYMIFDLVY 413
             +QD  ++DGE+V    + N V        T ++EL               Y++FD + 
Sbjct: 117 ETLQDGTLIDGELVI---QTNPV--------TKLQELR--------------YLMFDCLA 151

Query: 414 LNGVSLTRLPLHLRKSYL-RSILSPVANIVEILSDVRASEPNAIKV-------------- 458
           +NG  + + P   R ++L +    P  ++  +  D  ++ P  I +              
Sbjct: 152 INGRCIIQSPTSSRLAHLGKEFFKPYYDLRSVYRDHCSTFPFKISMKHMDFSYDLVRVAN 211

Query: 459 SLERAIEMGSEGIILKQFSSPYEIGARNDSWIKIKPE 495
           SL++   M S+G+I     +PY +G ++   +K KPE
Sbjct: 212 SLDKLPHM-SDGLIFTPVKNPYYVGGKDSFLLKWKPE 247

>KLLA0B02200g Chr2 (196341..197741) [1401 bp, 466 aa] {ON} highly
           similar to uniprot|Q01159 Saccharomyces cerevisiae
           YGL130W CEG1 mRNA guanylyltransferase (mRNA capping
           enzyme), alpha subunit
          Length = 466

 Score = 35.8 bits (81), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 30/128 (23%), Positives = 57/128 (44%), Gaps = 22/128 (17%)

Query: 406 YMIFDLVYLNGVSLTRLPLHLRKSYL-RSILSPVANIVEILSDVRASEPNAIKVSLER-- 462
           Y++FD + +NG SL + P   R ++L +    P  ++     D  ++ P   K+S++   
Sbjct: 145 YLMFDCLAVNGRSLVQSPTSSRLAHLGKEFFKPYYDLRSYFPDRCSTFP--FKISMKHMN 202

Query: 463 -------------AIEMGSEGIILKQFSSPYEIGARNDSWIKIKPEYFEELGETMDLVVI 509
                        ++   S+G+I     + Y IG ++   +K KP    E+  T+D  +I
Sbjct: 203 FSYDLAKVAKTLDSLPHVSDGLIFTPVQAAYHIGGKDSYLLKWKP----EVENTVDFKLI 258

Query: 510 GRDPGKKD 517
              P  +D
Sbjct: 259 IEPPVVED 266

>NCAS0G01480 Chr7 (266256..268736) [2481 bp, 826 aa] {ON} Anc_2.29
           YNL216W
          Length = 826

 Score = 35.8 bits (81), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 22/92 (23%), Positives = 48/92 (52%), Gaps = 9/92 (9%)

Query: 704 SNIFQGLQFYILSDYIDSQKKRYEKDQIGTLVRKNSGHVLHNNFVRREEFSRLRIISGKN 763
           S +FQG+ F++  +  D+    ++ DQ+  L+  +SG+VL +      + S + +IS  N
Sbjct: 120 STLFQGMNFFMNRNN-DAHDSAHDVDQLARLIMAHSGNVLASLPEDTTDVSNVYVISPYN 178

Query: 764 TVECRSLTEKGYDIIHPSWIFDCLNYGSLVKL 795
             +  ++T        P++I  C++  +L+ +
Sbjct: 179 DTKLPTVT--------PTYIKACVSNNTLLNI 202

>Skud_7.142 Chr7 (270563..271942) [1380 bp, 459 aa] {ON} YGL130W
           (REAL)
          Length = 459

 Score = 35.4 bits (80), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 47/221 (21%), Positives = 86/221 (38%), Gaps = 57/221 (25%)

Query: 300 QDFIIEEKMDGERIQLHYI---ERGAKIRFLSRRGTDFTHLYGDSLEHGVISQHLKFKND 356
            D+ + EK DG R+ +  +     G +  F+  R  ++  + G         +  +    
Sbjct: 63  HDYYVCEKTDGLRVLMFIVINPVTGEQGCFMIDRENNYYLVNGFRFPRLPQKKKEELLET 122

Query: 357 VQD-CVLDGEMVSFDKEKNVVLPFGIVKSTAMEELMNSDTKVDTDGYRPLYMIFDLVYLN 415
           +QD  +LDGE+V              +++  M +L               Y++FD + +N
Sbjct: 123 LQDGTLLDGELV--------------IQTNPMTKLQELR-----------YLMFDCLAIN 157

Query: 416 GVSLTRLPLHLRKSYL-RSILSPVANIVEILSDVRASEPN-----AIKVSLERA------ 463
           G  LT+ P   R ++L +    P         D+RA+ PN       K+S++        
Sbjct: 158 GRCLTQSPTSSRLAHLGKEFFKPYF-------DLRAAYPNRCTTFPFKISMKHMDFSYQL 210

Query: 464 ---------IEMGSEGIILKQFSSPYEIGARNDSWIKIKPE 495
                    +   S+G+I     +PY  G ++   +K KPE
Sbjct: 211 VKVAKSLDKLPHLSDGLIFTPVKAPYTAGGKDSLLLKWKPE 251

>ZYRO0G15180g Chr7 (1223984..1226050) [2067 bp, 688 aa] {ON} similar
           to uniprot|P47027 Saccharomyces cerevisiae YJL090C DPB11
           Essential BRCT repeat protein required on the
           prereplicative complex at replication origins for
           loading DNA polymerases to initiate DNA synthesis also
           required for S/M checkpoint control
          Length = 688

 Score = 35.0 bits (79), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 12/39 (30%), Positives = 21/39 (53%)

Query: 765 VECRSLTEKGYDIIHPSWIFDCLNYGSLVKLEPRHCFRT 803
           +  ++  E G  IIHP W+ DC    +L++ +P +   T
Sbjct: 163 IRVKAAMELGIPIIHPKWVLDCHKRNALLEFDPYYLLET 201

>TDEL0D01440 Chr4 complement(282138..283949) [1812 bp, 603 aa] {ON}
           Anc_1.276 YJL090C
          Length = 603

 Score = 34.7 bits (78), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 37/164 (22%), Positives = 66/164 (40%), Gaps = 37/164 (22%)

Query: 712 FYILSDYIDSQKKRYEKDQIGTLVRK------NSGHVLHNNFVRREEFSRLRIISGKNTV 765
           FYI    I S    Y  DQ+ ++ +       NS H + +   R ++ + + I       
Sbjct: 119 FYIFIGRIAS----YPVDQLESMCQAMKCYKCNSSHFVKDCKSRHDQKTVVFISDTLQGA 174

Query: 766 ECRSLTEKGYDIIHPSWIFDCLNYGSLVKLEPRHCFRTSRKLLENS------RQRVDRFG 819
             ++  E+G  I+H  WI DC    + ++ +P   +     + EN+      R+  + +G
Sbjct: 175 RVQAAIEQGIPIVHYKWILDCQRRNATLEYDP---YYLVSNIPENTPFEKIGRESCECWG 231

Query: 820 DSFCRPLSYTEFDELVNGQSVVSPHLSAPEELDGIPLFLFQNFK 863
           D    P        L+ G + V+P ++           LFQ FK
Sbjct: 232 DLINPP-------PLLQGTAAVNPSVN-----------LFQKFK 257

>AFR095C Chr6 complement(604687..606699) [2013 bp, 670 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL090C
           (DPB11)
          Length = 670

 Score = 34.3 bits (77), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 9/24 (37%), Positives = 18/24 (75%)

Query: 773 KGYDIIHPSWIFDCLNYGSLVKLE 796
           +G  ++HP W+ DC+  G++V++E
Sbjct: 176 QGVAVVHPKWVTDCVRRGAVVEME 199

>KLTH0H03850g Chr8 (352972..354378) [1407 bp, 468 aa] {ON} similar
           to uniprot|Q01159 Saccharomyces cerevisiae YGL130W CEG1
           mRNA guanylyltransferase (mRNA capping enzyme), alpha
           subunit
          Length = 468

 Score = 33.9 bits (76), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 29/128 (22%), Positives = 58/128 (45%), Gaps = 20/128 (15%)

Query: 406 YMIFDLVYLNGVSLTRLPLHLRKSYL-RSILSPVANIVEILSDVRASEPNAIKV------ 458
           Y++FD + +NG  + + P   R ++L +    P  ++  +     A+ P  I +      
Sbjct: 144 YLMFDCLAINGRCIVQSPTSSRLAHLGKEFFKPYYDLRSLYPAQCATFPFKISMKHMSFS 203

Query: 459 --------SLERAIEMGSEGIILKQFSSPYEIGARNDSWIKIKPEYFEELGETMDLVVIG 510
                   SL++   + S+G+I    ++PY +G ++   +K KP    E   T+D  +I 
Sbjct: 204 VDLVKVANSLDKLPHV-SDGLIFTPVTTPYVVGGKDSLLLKWKP----ETENTVDFKMIL 258

Query: 511 RDPGKKDS 518
             P  +D+
Sbjct: 259 DIPKAEDT 266

>TDEL0E05370 Chr5 complement(982429..983802) [1374 bp, 457 aa] {ON}
           Anc_6.228 YGL130W
          Length = 457

 Score = 33.5 bits (75), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 23/106 (21%), Positives = 49/106 (46%), Gaps = 18/106 (16%)

Query: 406 YMIFDLVYLNGVSLTRLPLHLRKSYL-RSILSPVANIVEILSDVRASEPNAIKVSLER-- 462
           Y++FD + +NG  +T  P   R ++L +    P  ++  + ++   + P   K+S++   
Sbjct: 144 YLMFDCLAINGRCITPSPTSSRLAHLGKEFFKPYYDLRSLFAEQCVTFP--FKLSMKHMN 201

Query: 463 -------------AIEMGSEGIILKQFSSPYEIGARNDSWIKIKPE 495
                        ++   S+G+I      PY +G+++   +K KPE
Sbjct: 202 FSYDLLKVANSLSSLPHESDGLIFTPVKLPYSVGSKDSYLLKWKPE 247

>Ecym_2188 Chr2 (371869..373254) [1386 bp, 461 aa] {ON} similar to
           Ashbya gossypii AFL107W
          Length = 461

 Score = 33.5 bits (75), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 23/104 (22%), Positives = 50/104 (48%), Gaps = 14/104 (13%)

Query: 406 YMIFDLVYLNGVSLTRLPLHLRKSYL-RSILSPVANIVEILSDVRASEP----------- 453
           Y++FD + +NG SL + P   R ++L +    P  ++  +  D  ++ P           
Sbjct: 144 YLMFDCLAINGRSLVQSPTSSRLAHLGKEFFKPYYDLRSVYPDHCSNFPFKLSMKHMNFS 203

Query: 454 -NAIKV-SLERAIEMGSEGIILKQFSSPYEIGARNDSWIKIKPE 495
            + +K+ S    +   S+G+I    ++ Y +G ++ + +K KP+
Sbjct: 204 YDLVKIASTLDKLPHVSDGLIFTPVNTSYNVGGKDSNLLKWKPQ 247

>TDEL0A00720 Chr1 (119639..121675) [2037 bp, 678 aa] {ON} Anc_2.29
           YNL216W
          Length = 678

 Score = 33.5 bits (75), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 25/106 (23%), Positives = 46/106 (43%), Gaps = 12/106 (11%)

Query: 691 PLLADDSRESIFESNIFQGLQFYILSDYIDSQKKRYEKDQIGTLVRKNSGHVLHNNFVRR 750
           P    D+ E   E  +F G++FY+        + R    Q+G L+    G V+       
Sbjct: 4   PAEFQDASEDQQEDGLFSGMRFYLNCGADSGAESR----QLGDLIESRGGEVVDKLPEDV 59

Query: 751 EEFSRLRIISGKNTVECRSLTEKGYDIIHPSWIFDCLNYGSLVKLE 796
           +E  +L +++  N     ++T        P++I  C   G+L+K+E
Sbjct: 60  KEGEKLYVVALYNDTRLPTVT--------PAYIKACCENGTLLKIE 97

>YNL216W Chr14 (241689..244172) [2484 bp, 827 aa] {ON}
           RAP1Essential DNA-binding transcription regulator that
           binds at many loci; involved in either transcription
           activation or repression, chromatin silencing, and
           telomere length maintenance; conserved protein with an
           N-terminal BRCT domain, a central region with homology
           to the Myb DNA binding domain, and a C-terminal
           Rap1-specific protein-interaction domain (RCT domain)
          Length = 827

 Score = 32.7 bits (73), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 30/113 (26%), Positives = 49/113 (43%), Gaps = 16/113 (14%)

Query: 694 ADDSRESIFESNIFQGLQFYILSDYIDSQKKRYEKDQIGTLVRKNSGHVLHNNFVRREEF 753
           AD+ +E +        ++FY+  D  D+     + DQ+  L+R N G VL +    RE  
Sbjct: 114 ADEKKEQV-SGPPLSNMKFYLNRD-ADAHDSLNDIDQLARLIRANGGEVLDSK--PRESK 169

Query: 754 SRLRIISGKNTVECRSLTEKGYDIIHPSWIFDCLNYGSLVKLE----PRHCFR 802
             + I+S  N     ++T        P++I  C    SL+ +E    P   FR
Sbjct: 170 ENVFIVSPYNHTNLPTVT--------PTYIKACCQSNSLLNMENYLVPYDNFR 214

>YLR320W Chr12 (771940..776304) [4365 bp, 1454 aa] {ON}  MMS22Subunit
            of an E3 ubiquitin ligase complex involved in replication
            repair; stabilizes protein components of the replication
            fork, such as the fork-pausing complex and leading strand
            polymerase, preventing fork collapse and promoting
            efficient recovery during replication stress; required
            for accurate meiotic chromosome segregation
          Length = 1454

 Score = 32.7 bits (73), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 30/48 (62%)

Query: 669  KRKSHQISPRKQRKLANVSELYPLLADDSRESIFESNIFQGLQFYILS 716
            K  ++ +S  K++ ++ +  LYP L   S+E+IFES+ F  LQ Y+ S
Sbjct: 995  KEFTNLVSKMKRKSVSMLKFLYPSLVAMSQENIFESSFFLLLQVYLKS 1042

>KLLA0E22617g Chr5 complement(2018248..2021349) [3102 bp, 1033 aa]
           {ON} similar to uniprot|P40352 Saccharomyces cerevisiae
           YJR035W RAD26 Protein involved in transcription-coupled
           repair nucleotide excision repair of UV-induced DNA
           lesions homolog of human CSB protein
          Length = 1033

 Score = 32.3 bits (72), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 40/181 (22%), Positives = 71/181 (39%), Gaps = 35/181 (19%)

Query: 602 IDPRSSLVLEVKARSVDTDELSSKKYKTGSTLRGAYCRALRFNKDWSTCATVQQYEQAKR 661
           I  R SLV +      D   L+++    G  L GA  R + F+ DW+    +Q  E+A R
Sbjct: 678 IGSRQSLVDKFNNEPYDVFLLTTRVGGLGINLTGA-NRIIIFDPDWNPSTDMQARERAWR 736

Query: 662 AHNYHKGKRKSHQISPRKQRKLANVSELYPLLADDSRESIFESNIFQGL----------- 710
                             Q++   +  L  ++A    E I+   IF+             
Sbjct: 737 IG----------------QKREVTIYRL--MIAGSIEEKIYHRQIFKQFLSNKILKDPKQ 778

Query: 711 -QFYILSDYID----SQKKRYEKDQIGTLVRKNSGHVLHNNFVRREEFSRLRIISGKNTV 765
            +F+ ++D  D         YE ++    + K +G++  N     ++F +L  ISG + +
Sbjct: 779 KRFFKMNDLHDLFTLGGDNGYETEEFNQEIVKQTGNIKQNKTSETDDFDKLSQISGVHKL 838

Query: 766 E 766
           E
Sbjct: 839 E 839

>TBLA0E04240 Chr5 complement(1074492..1080962) [6471 bp, 2156 aa] {ON}
            Anc_8.238 YER172C
          Length = 2156

 Score = 32.3 bits (72), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 38/148 (25%), Positives = 64/148 (43%), Gaps = 13/148 (8%)

Query: 114  YTLVKAVCRSLNLPKDSLTEKRLLNWKQYAPRGTSLSKFCVEEIMKRRKEPQ--GSQRLT 171
            Y   K VC S+ LP D +   +  NW         ++++C+     + K+PQ   S +  
Sbjct: 1586 YLSTKRVCISI-LP-DIVKFAQSSNWDLVKADEDDIAEYCL-----KIKDPQLISSIKNG 1638

Query: 172  IDALNKCLDELSKEASAKKWGFNGLSKSPSFQNCLQNMSFSEQRYFFDIILKTRVIGGLE 231
            I  L   +++  +E   + + +  LS         +N S S       IIL T     LE
Sbjct: 1639 IGLLYSGMNKQDQEIVEELYSYGALS----LLLISKNFSHSTPPLKSIIILGTSYYSALE 1694

Query: 232  HKFLNCWHPDAQDYLGVVSDLKVLSETL 259
            H++LN    +  D +G  SD  V+++ L
Sbjct: 1695 HRYLNYSVSEILDMIGSCSDNSVMNKAL 1722

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.406 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 104,540,367
Number of extensions: 4700867
Number of successful extensions: 12668
Number of sequences better than 10.0: 72
Number of HSP's gapped: 12837
Number of HSP's successfully gapped: 72
Length of query: 963
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 844
Effective length of database: 39,836,145
Effective search space: 33621706380
Effective search space used: 33621706380
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 71 (32.0 bits)