Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_56.224116.17ON68968934500.0
KLTH0C11308g6.17ON69069023500.0
SAKL0E01100g6.17ON71071717210.0
Ecym_30216.17ON67469715560.0
ACR009W6.17ON68070614960.0
KLLA0D01067g6.17ON66069514600.0
TDEL0G045206.17ON67970014470.0
ZYRO0C07876g6.17ON68169913920.0
Kpol_1045.726.17ON69572513201e-173
TPHA0J003106.17ON67571312421e-161
Skud_5.276.17ON61555812121e-158
YEL062W (NPR2)6.17ON61554511871e-154
Smik_5.256.17ON61552511861e-154
TBLA0G010106.17ON71074811921e-154
KNAG0M011406.17ON59450411571e-150
NCAS0H008706.17ON61269811201e-144
CAGL0L13288g6.17ON64670111011e-141
NDAI0D008606.17ON66651610831e-138
KAFR0L003806.17ON54069210421e-133
Suva_5.56.17ON61935810271e-130
Suva_16.1186.190ON61432820.31
NDAI0B008605.50ON555103800.54
KNAG0K003605.50ON530103790.67
Smik_16.475.50ON534110790.69
Skud_7.5935.50ON534110780.81
Skud_2.1363.223ON116877752.3
AAR091W3.444ON93270724.5
YBR023C (CHS3)3.223ON116577725.1
NCAS0J014304.243ON41931707.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_56.22411
         (689 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_56.22411 s56 complement(115007..117076) [2070 bp, 689 aa] {...  1333   0.0  
KLTH0C11308g Chr3 (929710..931782) [2073 bp, 690 aa] {ON} simila...   909   0.0  
SAKL0E01100g Chr5 complement(83492..85624) [2133 bp, 710 aa] {ON...   667   0.0  
Ecym_3021 Chr3 complement(40454..42478) [2025 bp, 674 aa] {ON} s...   603   0.0  
ACR009W Chr3 (371964..374006) [2043 bp, 680 aa] {ON} Syntenic ho...   580   0.0  
KLLA0D01067g Chr4 complement(94114..96096) [1983 bp, 660 aa] {ON...   566   0.0  
TDEL0G04520 Chr7 (822826..824865) [2040 bp, 679 aa] {ON} Anc_6.1...   561   0.0  
ZYRO0C07876g Chr3 (598500..600545) [2046 bp, 681 aa] {ON} simila...   540   0.0  
Kpol_1045.72 s1045 (167094..169181) [2088 bp, 695 aa] {ON} (1670...   513   e-173
TPHA0J00310 Chr10 complement(68890..70917) [2028 bp, 675 aa] {ON...   483   e-161
Skud_5.27 Chr5 (33530..35377) [1848 bp, 615 aa] {ON} YEL062W (REAL)   471   e-158
YEL062W Chr5 (34407..36254) [1848 bp, 615 aa] {ON}  NPR2Subunit ...   461   e-154
Smik_5.25 Chr5 (36761..38452,38453..38605) [1845 bp, 615 aa] {ON...   461   e-154
TBLA0G01010 Chr7 complement(253690..255822) [2133 bp, 710 aa] {O...   463   e-154
KNAG0M01140 Chr13 complement(204691..206475) [1785 bp, 594 aa] {...   450   e-150
NCAS0H00870 Chr8 (158877..160715) [1839 bp, 612 aa] {ON} Anc_6.1...   436   e-144
CAGL0L13288g Chr12 complement(1420781..1422721) [1941 bp, 646 aa...   428   e-141
NDAI0D00860 Chr4 (193625..195625) [2001 bp, 666 aa] {ON} Anc_6.1...   421   e-138
KAFR0L00380 Chr12 complement(69525..71147) [1623 bp, 540 aa] {ON...   405   e-133
Suva_5.5 Chr5 (10147..12006) [1860 bp, 619 aa] {ON} YEL062W (REAL)    400   e-130
Suva_16.118 Chr16 (198983..200827) [1845 bp, 614 aa] {ON} YPL189...    36   0.31 
NDAI0B00860 Chr2 complement(196238..197905) [1668 bp, 555 aa] {O...    35   0.54 
KNAG0K00360 Chr11 complement(58785..60377) [1593 bp, 530 aa] {ON...    35   0.67 
Smik_16.47 Chr16 complement(83384..84988) [1605 bp, 534 aa] {ON}...    35   0.69 
Skud_7.593 Chr7 (986994..988598) [1605 bp, 534 aa] {ON} YGR260W ...    35   0.81 
Skud_2.136 Chr2 complement(253644..257150) [3507 bp, 1168 aa] {O...    33   2.3  
AAR091W Chr1 (508403..511201) [2799 bp, 932 aa] {ON} Syntenic ho...    32   4.5  
YBR023C Chr2 complement(284428..287925) [3498 bp, 1165 aa] {ON} ...    32   5.1  
NCAS0J01430 Chr10 complement(253260..254519) [1260 bp, 419 aa] {...    32   7.8  

>Kwal_56.22411 s56 complement(115007..117076) [2070 bp, 689 aa] {ON}
           YEL062W (NPR2) - Non-membrane-embedded, PEST
           sequence-containing protein [contig 185] FULL
          Length = 689

 Score = 1333 bits (3450), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 656/689 (95%), Positives = 656/689 (95%)

Query: 1   MSGHFDGFVPVHCILYTIFHPTEGTKVRHQFPPGCLEASDITFDTIKNYVIPKPQLCNKL 60
           MSGHFDGFVPVHCILYTIFHPTEGTKVRHQFPPGCLEASDITFDTIKNYVIPKPQLCNKL
Sbjct: 1   MSGHFDGFVPVHCILYTIFHPTEGTKVRHQFPPGCLEASDITFDTIKNYVIPKPQLCNKL 60

Query: 61  LTFKYGSFRLVCYPVNVIAPYYARNSFSFDFVFVFPYDCATSPYESAIARLGKMFTVLEE 120
           LTFKYGSFRLVCYPVNVIAPYYARNSFSFDFVFVFPYDCATSPYESAIARLGKMFTVLEE
Sbjct: 61  LTFKYGSFRLVCYPVNVIAPYYARNSFSFDFVFVFPYDCATSPYESAIARLGKMFTVLEE 120

Query: 121 QSQILSKAENSHVYFQLKTRDSHKHTNQEPVNDNELQGTLKNNEASQSESHGYAFEKYHE 180
           QSQILSKAENSHVYFQLKTRDSHKHTNQEPVNDNELQGTLKNNEASQSESHGYAFEKYHE
Sbjct: 121 QSQILSKAENSHVYFQLKTRDSHKHTNQEPVNDNELQGTLKNNEASQSESHGYAFEKYHE 180

Query: 181 ILKDLNGPNKRISVEDLITKIYRDLNNYSECLIPIDSGNAVDIKXXXXXXXXXXXXXXED 240
           ILKDLNGPNKRISVEDLITKIYRDLNNYSECLIPIDSGNAVDIK              ED
Sbjct: 181 ILKDLNGPNKRISVEDLITKIYRDLNNYSECLIPIDSGNAVDIKLFPLLSPPSSCLSFED 240

Query: 241 VPMPTVNLAKLIDVNWDPTMLKIVPYINGTNSIAKVAKLSDSDCNLVVECIRHLLYYNCV 300
           VPMPTVNLAKLIDVNWDPTMLKIVPYINGTNSIAKVAKLSDSDCNLVVECIRHLLYYNCV
Sbjct: 241 VPMPTVNLAKLIDVNWDPTMLKIVPYINGTNSIAKVAKLSDSDCNLVVECIRHLLYYNCV 300

Query: 301 ILADIFQFQNIYAPTSELSRFLTNPALATECQIYVTLDESTHISDLPFERKPSRTTYNNI 360
           ILADIFQFQNIYAPTSELSRFLTNPALATECQIYVTLDESTHISDLPFERKPSRTTYNNI
Sbjct: 301 ILADIFQFQNIYAPTSELSRFLTNPALATECQIYVTLDESTHISDLPFERKPSRTTYNNI 360

Query: 361 PVRNSSSTLDVQRKGREMSIKESSFTAGIDQSGRNQYTPQSHTSSIQCHNVSDASLGNSE 420
           PVRNSSSTLDVQRKGREMSIKESSFTAGIDQSGRNQYTPQSHTSSIQCHNVSDASLGNSE
Sbjct: 361 PVRNSSSTLDVQRKGREMSIKESSFTAGIDQSGRNQYTPQSHTSSIQCHNVSDASLGNSE 420

Query: 421 GGFNNKVFFTSKSCLFDMYRSLSQGQTVKEWYKTHFEKIRAARIDVRRFITFGVIHGLLY 480
           GGFNNKVFFTSKSCLFDMYRSLSQGQTVKEWYKTHFEKIRAARIDVRRFITFGVIHGLLY
Sbjct: 421 GGFNNKVFFTSKSCLFDMYRSLSQGQTVKEWYKTHFEKIRAARIDVRRFITFGVIHGLLY 480

Query: 481 RCYSFPIMKNVGYLEVVKALGLSDGDSSTEGKWLSGNSEPTNNVLSAAEIRIGLEXXXXK 540
           RCYSFPIMKNVGYLEVVKALGLSDGDSSTEGKWLSGNSEPTNNVLSAAEIRIGLE    K
Sbjct: 481 RCYSFPIMKNVGYLEVVKALGLSDGDSSTEGKWLSGNSEPTNNVLSAAEIRIGLESSSSK 540

Query: 541 LRERRFNHFSNADTAEDILNDVYRKLALNENKVEQSSQSGNPMMRMFGNCSDDSSGETSV 600
           LRERRFNHFSNADTAEDILNDVYRKLALNENKVEQSSQSGNPMMRMFGNCSDDSSGETSV
Sbjct: 541 LRERRFNHFSNADTAEDILNDVYRKLALNENKVEQSSQSGNPMMRMFGNCSDDSSGETSV 600

Query: 601 KDVVSTAGSDTRNTVAFDVRRLVNSATAEDRKKGEVMXXXXXXXXXXXXXXXSVRDVENF 660
           KDVVSTAGSDTRNTVAFDVRRLVNSATAEDRKKGEVM               SVRDVENF
Sbjct: 601 KDVVSTAGSDTRNTVAFDVRRLVNSATAEDRKKGEVMRLEEDKRKDELLLLKSVRDVENF 660

Query: 661 DKICTRLGRDREEVEKMLEDLGPYNVVHC 689
           DKICTRLGRDREEVEKMLEDLGPYNVVHC
Sbjct: 661 DKICTRLGRDREEVEKMLEDLGPYNVVHC 689

>KLTH0C11308g Chr3 (929710..931782) [2073 bp, 690 aa] {ON} similar
           to uniprot|P39923 Saccharomyces cerevisiae YEL062W NPR2
           Regulator of nitrogen permeases transcription is induced
           in response to proline and urea contains two PEST
           sequences
          Length = 690

 Score =  909 bits (2350), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/690 (64%), Positives = 538/690 (77%), Gaps = 3/690 (0%)

Query: 1   MSGHFDGFVPVHCILYTIFHPTEGTKVRHQFPPGCLEASDITFDTIKNYVIPKPQLCNKL 60
           MSGHFDGFVPVH I Y++FHPTEGTKVRHQFP GCLE SDITFDTIKNYVIPKPQLCNKL
Sbjct: 1   MSGHFDGFVPVHGIFYSVFHPTEGTKVRHQFPSGCLELSDITFDTIKNYVIPKPQLCNKL 60

Query: 61  LTFKYGSFRLVCYPVNVIAPYYARNSFSFDFVFVFPYDCATSPYESAIARLGKMFTVLEE 120
           LTFKYG FRLVCYPVNV+APYYARNSFSFDFVFVFPYDCATSPYE AI RLGKMFTVLEE
Sbjct: 61  LTFKYGPFRLVCYPVNVVAPYYARNSFSFDFVFVFPYDCATSPYEPAIERLGKMFTVLEE 120

Query: 121 QSQILSKAENSHVYFQLKTRDSHKHTNQEPVNDNELQGTLKNNEASQSESHGYAFEKYHE 180
           QSQILSKAENS VYFQLK R++ KH N E     E   +L   E +Q E+ GYA  KY+E
Sbjct: 121 QSQILSKAENSSVYFQLKARNTQKHGNTETAKGTEQPSSLDIGEIAQPENQGYASAKYYE 180

Query: 181 ILKDLNGPNKRISVEDLITKIYRDLNNYSECLIPIDSGNAVDIKXXXXXXXXXXXXXXED 240
           ILKDL GP+K+I++ DLITKIYRDLN+YSECLIPIDSGNAVDIK              ED
Sbjct: 181 ILKDLEGPSKKIAIGDLITKIYRDLNDYSECLIPIDSGNAVDIKLFPLLSPPSSCFSIED 240

Query: 241 VPMPTVNLAKLIDVNWDPTMLKIVPYINGTNSIAKVAKLSDSDCNLVVECIRHLLYYNCV 300
           VP+ TVNLAKLIDVNWDPTMLKIVP+ING NSIAKVAK SDSD NLVVECI+HL+YYNCV
Sbjct: 241 VPISTVNLAKLIDVNWDPTMLKIVPHINGINSIAKVAKFSDSDVNLVVECIKHLIYYNCV 300

Query: 301 ILADIFQFQNIYAPTSELSRFLTNPALATECQIYVTLDESTHISDLPFERKPSRTTYNNI 360
           IL DIFQF NIYA T+ELSRFLT P LA ECQIYV  +ES H+ +LPFER PSR+   NI
Sbjct: 301 ILTDIFQFSNIYASTNELSRFLTEPTLAAECQIYVAYNESAHLPNLPFERGPSRSGQGNI 360

Query: 361 PVRNSSSTLDVQRKGREMSIKESSFTAGID-QSGRNQYTPQSHTSSIQCHNVSDASLGNS 419
             R+S+ TLD+ RKG++  ++E+SF +G+D  S ++Q+TPQS +SSI  HN SDAS GNS
Sbjct: 361 RDRSSNGTLDILRKGKQTPLRENSFNSGMDFLSNKHQHTPQSRSSSIPYHNTSDASFGNS 420

Query: 420 EGGFNNKVF-FTSKSCLFDMYRSLSQGQTVKEWYKTHFEKIRAARIDVRRFITFGVIHGL 478
           + G   K+  FTSKSCLFD+YRSL+QGQT++EWYKTHFEKIRAARIDVRRFITFGV+HGL
Sbjct: 421 DAGLKGKLMPFTSKSCLFDLYRSLTQGQTIREWYKTHFEKIRAARIDVRRFITFGVLHGL 480

Query: 479 LYRCYSFPIMKNVGYLEVVKALGLSDGDSSTEGKWLSGNSEPTNNVLSAAEIRIGLEXXX 538
           +YR YS+P+++N+G+ E V+ALG ++     + K L   ++P NNVLSAA+IRIGLE   
Sbjct: 481 IYRSYSYPVLRNIGFAESVEALGATNHSRYAKYKHLLKTNQPLNNVLSAADIRIGLENAG 540

Query: 539 XKLRERRFNHFSNADTAEDILNDVYRKLALNENKVEQSSQSGNPMMRMFGNCSDDSSGET 598
            K R  +    S AD AE++L+DVYRKLAL++ K +  +Q  NP+ ++FG  S+DS+ + 
Sbjct: 541 FKARSEKLKQHSTADAAEEVLSDVYRKLALSDKKTDHVAQGNNPISKVFGRNSEDST-DI 599

Query: 599 SVKDVVSTAGSDTRNTVAFDVRRLVNSATAEDRKKGEVMXXXXXXXXXXXXXXXSVRDVE 658
           S ++  ++ GSD +N VAFDVR+ + +++A++R++ E++               SVR V 
Sbjct: 600 STRESANSMGSDIKNKVAFDVRKTLATSSADERRRSEILRSIEEKRNEELILLKSVRSVH 659

Query: 659 NFDKICTRLGRDREEVEKMLEDLGPYNVVH 688
           NFDKICT LG+DRE VE ML +LGPYNV+H
Sbjct: 660 NFDKICTLLGKDRERVESMLSELGPYNVLH 689

>SAKL0E01100g Chr5 complement(83492..85624) [2133 bp, 710 aa] {ON}
           similar to uniprot|P39923 Saccharomyces cerevisiae
           YEL062W NPR2 Regulator of nitrogen permeases
           transcription is induced in response to proline and urea
           contains two PEST sequences
          Length = 710

 Score =  667 bits (1721), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/717 (52%), Positives = 481/717 (67%), Gaps = 37/717 (5%)

Query: 1   MSGHFDGFVPVHCILYTIFHPTEGTKVRHQFPPGCLEASDITFDTIKNYVIPKPQLCNKL 60
           MS HFDGFVP+H + Y++FHPTEGTKVR+QFPP  LE +DI FDTIKNYVIPKPQLCNKL
Sbjct: 1   MSSHFDGFVPIHTVFYSVFHPTEGTKVRYQFPPTNLENNDINFDTIKNYVIPKPQLCNKL 60

Query: 61  LTFKYGSFRLVCYPVNVIAPYYARNSFSFDFVFVFPYDCATSPYESAIARLGKMFTVLEE 120
           LTFKYG +RL CYPVNV A YYARNSF+F+FVFVFPY+CATSPYE A+ARLGKMF VLEE
Sbjct: 61  LTFKYGPYRLACYPVNVNASYYARNSFNFNFVFVFPYNCATSPYEPAVARLGKMFRVLEE 120

Query: 121 QSQILSKAENSHVYFQLKTRDSHKHTNQEPVN--------DNELQGTLKNN-----EASQ 167
           QSQILSKAEN  VYF LK+++S  +++  PV+        D E QGT  NN     E  +
Sbjct: 121 QSQILSKAENDPVYFHLKSQESSTNSSSHPVDQGGSDRPKDTE-QGTGLNNSQDSKEQGK 179

Query: 168 SESHGYAFEKYHEILKDLNGPNKRISVEDLITKIYRDLNNYSECLIPIDSGNAVDIKXXX 227
            E  G A EKYHEI+ DL    KR+S+EDLITK+Y+DLNNYSEC IPIDSGN+VDIK   
Sbjct: 180 IEGQGAAIEKYHEIMDDLEKGKKRLSIEDLITKLYQDLNNYSECFIPIDSGNSVDIKLFP 239

Query: 228 XXXXXXXXXXXEDVPMPTVNLAKLIDVNWDPTMLKIVPYINGTNSIAKVAKLSDSDCNLV 287
                      EDVP+ TVNLAKLIDVNWDPTMLKIVP+ING NSIAK+AK S SD +LV
Sbjct: 240 LLAPPNSCLSFEDVPISTVNLAKLIDVNWDPTMLKIVPFINGVNSIAKIAKFSSSDTDLV 299

Query: 288 VECIRHLLYYNCVILADIFQFQNIYAPTSELSRFLTNPALATECQIYVTLDESTHISDLP 347
           +EC++HL+YYNCV+LADIFQF NIYA TS +S FLT+P LA+ECQ YVT      +  LP
Sbjct: 300 IECVKHLIYYNCVVLADIFQFSNIYASTSLISEFLTDPTLASECQTYVT-SSDLELYRLP 358

Query: 348 FERKPSRTTYNNIPVRNSSSTLDVQRKGREMSIKES-SFTAGID-----QSGRNQYTPQS 401
           FE +P+  + ++   +NSSST+        + ++ S + T  +D      + RN ++  S
Sbjct: 359 FESRPNLLSMHSSRKQNSSSTIHT------VGVRNSPNRTNSLDYPSELSTRRNNFSSSS 412

Query: 402 HTSSIQCHNVSDAS-LGNSEGGFNNKVFFTSKSCLFDMYRSLSQGQTVKEWYKTHFEKIR 460
            +S ++  + S  S  G++     +++   +KSCLFD+YRSL QG+TVKEWYK +FE IR
Sbjct: 413 ASSLMRVRDRSGQSTTGSAVDEQESRLLLPTKSCLFDLYRSLHQGETVKEWYKINFEIIR 472

Query: 461 AARIDVRRFITFGVIHGLLYRCYSFPIMKNVGYLEVVKAL-GLSDGDSSTEGKWLSGNSE 519
              IDVRRFITFG++ GL+YRCY++P+MKN+G LE++K L   SD  S            
Sbjct: 473 DNHIDVRRFITFGIVRGLIYRCYAYPVMKNLGALEMLKTLKSASDSRSLRRKLKFREKKN 532

Query: 520 PTNNVLSAAEIRIGLEXXXXKLRERRFN--HFSNADTAEDILNDVYRKLALNENKVEQSS 577
            TNNV S A+I++ LE          FN  H SN D AE++L D Y+KL++ E+  +   
Sbjct: 533 FTNNVFSTADIKVDLEHSPGGAPAEIFNRKHTSNVDMAEEVLKDAYKKLSIIESMDDNLY 592

Query: 578 QSGNPMMRMFGNCSDDSSG----ETSVKDVVSTAGSDTRNTVAFDVRRLVNSATAEDRKK 633
              NPM R++G+ S +SS     + S K   ST  S+TR+ VAF+  R       +++K+
Sbjct: 593 HVHNPMSRLYGHDSGESSTKGSRKGSRKGSSSTMESETRSKVAFEKGRSPWQVEEDEKKE 652

Query: 634 --GEVMXXXXXXXXXXXXXXXSVRDVENFDKICTRLGRDREEVEKMLEDLGPYNVVH 688
              EV                SV+ V+ FDKIC RL +DREEVE++L+++G YN+++
Sbjct: 653 RTEEVSNLLKEKRHEEFLLLKSVKSVDTFDKICMRLEKDREEVEQLLKEMGHYNIIN 709

>Ecym_3021 Chr3 complement(40454..42478) [2025 bp, 674 aa] {ON}
           similar to Ashbya gossypii ACR009W
          Length = 674

 Score =  603 bits (1556), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/697 (47%), Positives = 456/697 (65%), Gaps = 33/697 (4%)

Query: 1   MSGHFDGFVPVHCILYTIFHPTEGTKVRHQFPPGCLEASDITFDTIKNYVIPKPQLCNKL 60
           MS HFDGFVP+H I Y++FHPTEGTKVR QFPP  LE S I+FDTIKNYVIPKPQLCNKL
Sbjct: 1   MSNHFDGFVPIHSIFYSLFHPTEGTKVRFQFPPDSLENSGISFDTIKNYVIPKPQLCNKL 60

Query: 61  LTFKYGSFRLVCYPVNVIAPYYARNSFSFDFVFVFPYDCATSPYESAIARLGKMFTVLEE 120
           LTFKYGS+RLVCYPVN+ A YYARNSFSFDFVFVFPYD ATSPYE AI RLGKMF VLEE
Sbjct: 61  LTFKYGSYRLVCYPVNINASYYARNSFSFDFVFVFPYDSATSPYEPAIGRLGKMFRVLEE 120

Query: 121 QSQILSKAENSHVYFQLKTRD--SHKHTNQEPVNDNELQGTLKNNEASQSESHGYAFEKY 178
           QSQ+LSK E   +Y+ LKT+D  +    ++EP + N  Q     N+  +   H +AFEKY
Sbjct: 121 QSQVLSKIERDPIYYHLKTQDVKAVDQNSEEPESKNNPQNC---NDKIRRGHHEHAFEKY 177

Query: 179 HEILKDLNGPNKRISVEDLITKIYRDLNNYSECLIPIDSGNAVDIKXXXXXXXXXXXXXX 238
           HEI+K +    K++S+EDLITK+Y DLNNYSECLIP+DSGNA+DIK              
Sbjct: 178 HEIMKHIAMNEKQLSIEDLITKLYEDLNNYSECLIPMDSGNAIDIKLFPLLAPPNSCFSV 237

Query: 239 EDVPMPTVNLAKLIDVNWDPTMLKIVPYINGTNSIAKVAKLSDSDCNLVVECIRHLLYYN 298
           EDVP+  +NL   +DVNWDPTM+KIVPYING NSIAK++K SDSD  LV+EC++HL+YY+
Sbjct: 238 EDVPIAKLNLIDWVDVNWDPTMVKIVPYINGINSIAKISKYSDSDVGLVMECVKHLIYYD 297

Query: 299 CVILADIFQFQNIYAPTSELSRFLTNPALATECQIYVTLDESTHISDLPFERKPSRTTYN 358
           CV+L D+FQF NIYAPTS+LS FLT+P++A ECQ+YV   E + +  LPFE +P+     
Sbjct: 298 CVVLVDMFQFSNIYAPTSQLSEFLTDPSIARECQLYVISSEDSELHQLPFEGRPNANHSR 357

Query: 359 NIPVRNSSSTLDVQRKGREMSIKESSFTAGIDQSGRNQYTPQSHTSSIQCHNVSDASLGN 418
           N     S+ T    ++    + +  SF++  + + +    P ++TS     +++ +S  +
Sbjct: 358 NPTA--STITFGTLKRTIYTNPRPESFSSNTEFAQK----PNANTSLPSEPSITHSSKNS 411

Query: 419 SEGGFNNKVFFT----SKSCLFDMYRSLSQGQTVKEWYKTHFEKIRAARIDVRRFITFGV 474
                NNK        ++SCLFD+YRSLSQGQT+K+WYK +FE IR  RIDVRRFITFGV
Sbjct: 412 EFNHENNKGILNRTLPTRSCLFDLYRSLSQGQTMKDWYKMNFEVIRKNRIDVRRFITFGV 471

Query: 475 IHGLLYRCYSFPIMKNVGYLEVVKALGLSDGDSSTEGKWLSGNSEPTNNVLSAAEIRIGL 534
              L+YRCYS+P+ K++G L+++K        +S    ++S  +  +NNV S A+I +  
Sbjct: 472 FRKLIYRCYSYPVAKSIGTLDMLKRFDY----ASLPNNFMSPKNNNSNNVFSTADICVDF 527

Query: 535 EXXXXKLRERRFNHFSNADTAEDILNDVYRKLALNE---NKVEQSSQSGNPMMRMFGNCS 591
                + R++      N D A+++L D Y+KL+LNE   N ++Q ++S    +      +
Sbjct: 528 -GEPSQFRKKPL--VPNTDAADEVLRDAYKKLSLNERLPNPLDQITRSKKLSLE-----N 579

Query: 592 DDSSGETSVKDVVSTAGSDTRNTVAFDVRRLVNSATAEDRKKGEVMXXXXXXXXXXXXXX 651
           D S+   + K   ST+G+     V FD++  +++   E R +                  
Sbjct: 580 DASANVDNRKLSSSTSGTA---KVLFDMKDRLSNKDFEYRDQNAASTELKRKRQQQFLLL 636

Query: 652 XSVRDVENFDKICTRLGRDREEVEKMLEDLGPYNVVH 688
            S+++V++FDKI  +L  +++EVE++L+  G YN+++
Sbjct: 637 KSIKNVDSFDKIAIKLEINKQEVEELLKATGEYNIIN 673

>ACR009W Chr3 (371964..374006) [2043 bp, 680 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL062W (NPR2)
          Length = 680

 Score =  580 bits (1496), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/706 (45%), Positives = 427/706 (60%), Gaps = 52/706 (7%)

Query: 1   MSGHFDGFVPVHCILYTIFHPTEGTKVRHQFPPGCLEASDITFDTIKNYVIPKPQLCNKL 60
           M   FDGFVP+HCI Y +FHPTEGTKVR QFP   LE S I FDTIKNYVIPK QLCNKL
Sbjct: 8   MPNKFDGFVPIHCIFYALFHPTEGTKVRFQFPSDSLEKSGIRFDTIKNYVIPKSQLCNKL 67

Query: 61  LTFKYGSFRLVCYPVNVIAPYYARNSFSFDFVFVFPYDCATSPYESAIARLGKMFTVLEE 120
           +TFK+GS+RLVCYPVN+ APYYARNSFSF+ VFVFPYD ATSPYE AIARL KM  VLEE
Sbjct: 68  VTFKFGSYRLVCYPVNIKAPYYARNSFSFNLVFVFPYDSATSPYEPAIARLAKMLRVLEE 127

Query: 121 QSQILSKAENSHVYFQLKTRDSHKHTNQEPVNDNELQGTLKNNEASQSESHGYAFEKYHE 180
           QSQ+LSK E   VY+QLKT ++     +   +D++ +    +N   +S +   A  KYHE
Sbjct: 128 QSQMLSKVERDPVYYQLKTGETKAAEQKTEESDSKAKT---HNLDKKSRAQHNATTKYHE 184

Query: 181 ILKDLNGPNKRISVEDLITKIYRDLNNYSECLIPIDSGNAVDIKXXXXXXXXXXXXXXED 240
           I+K +N   K + +EDLITK+Y DLNNYSECLIP+DSGNA+DIK              ED
Sbjct: 185 IMKHINSDEKNLYIEDLITKLYEDLNNYSECLIPMDSGNAIDIKLFPLLTPPNSCLSFED 244

Query: 241 VPMPTVNLAKLIDVNWDPTMLKIVPYINGTNSIAKVAKLSDSDCNLVVECIRHLLYYNCV 300
           VP+  VNL  L+DVNWDPTMLKIVP+ING NSIAK++K SDS   LV+ECI+HL+YY+CV
Sbjct: 245 VPIAKVNLMNLVDVNWDPTMLKIVPFINGINSIAKISKCSDSAVELVMECIKHLVYYDCV 304

Query: 301 ILADIFQFQNIYAPTSELSRFLTNPALATECQIYVTLDESTHISDLPFERKP-------- 352
            L D+FQF NIYAPT+ L  FL +  L  ECQ+YV   E   I  LPFE +P        
Sbjct: 305 ALVDMFQFSNIYAPTNLLRDFLFDFILPRECQVYVVSSEDCEIHRLPFESRPNGGHSRNQ 364

Query: 353 SRTTYNNIPVRNSSST--LDVQRKGREMSIKE---SSFTAGIDQSGRNQYTPQSHTSSIQ 407
           + +T     +R ++ST   D      E S K    SS      QS ++ Y  +S      
Sbjct: 365 TASTNTVYTLRRTTSTNRADSFSSNAEFSQKSSGISSLAQSFTQSNKDYYYNRSRNLESN 424

Query: 408 CHNVSDASLGNSEGGFNNKVFFTSKSCLFDMYRSLSQGQTVKEWYKTHFEKIRAARIDVR 467
           C                 K    ++  LFD+YRSL+QGQT+KEWYK ++  IR  +IDVR
Sbjct: 425 C-----------------KRTLPTRRVLFDLYRSLTQGQTLKEWYKANYSAIRENQIDVR 467

Query: 468 RFITFGVIHGLLYRCYSFPIMKNVGYLEVVKALGLSDGDSSTEGKWLSGNSEPTNNVLSA 527
           R I FGV H L+YRCYS+P+ K++G LE++K         ST   ++   +   NNV S 
Sbjct: 468 RLIIFGVFHRLIYRCYSYPVAKSIGTLELLKRFDY----VSTTDNFIPTGTSAGNNVFST 523

Query: 528 AEIRIGLEXXXXKLRERRFNHFSN-ADTAEDILNDVYRKLALNENKVEQSSQSGNPMMRM 586
           ++IR+  +      R R    F N +D AE++L + Y+KL++     +  + S +P+ + 
Sbjct: 524 SDIRVDFDGSS---RSRNIPPFLNSSDVAEEVLRETYQKLSIK----DILNDSIDPIAKG 576

Query: 587 FGNCSDDSSGE--TSVKDVVSTAGSDTRNTVAFDVRRLVNSATAEDRKKG--EVMXXXXX 642
           +   SD+ +    TS K  +ST  + TR  + FD+R    S   E R++   ++      
Sbjct: 577 YQAPSDNEAAMKGTSRKQSMSTLNT-TR--ITFDIRNRHVSKDNEHREQQNEDIPLLLKK 633

Query: 643 XXXXXXXXXXSVRDVENFDKICTRLGRDREEVEKMLEDLGPYNVVH 688
                     SV+ V++FDKI  RL  ++ EVE++L+  G YN+V+
Sbjct: 634 KRLQEFLLLQSVKSVDSFDKIAVRLEMNKHEVERLLKGTGEYNIVN 679

>KLLA0D01067g Chr4 complement(94114..96096) [1983 bp, 660 aa] {ON}
           similar to uniprot|P39923 Saccharomyces cerevisiae
           YEL062W NPR2 Regulator of nitrogen permeases
           transcription is induced in response to proline and urea
           contains two PEST sequences
          Length = 660

 Score =  566 bits (1460), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/695 (47%), Positives = 433/695 (62%), Gaps = 43/695 (6%)

Query: 1   MSGHFDGFVPVHCILYTIFHPTEGTKVRHQFPPGCLEASDITFDTIKNYVIPKPQLCNKL 60
           M+  FDGFVP+H + YT+FHPTEG+KVR QFPP  LE   I FDTIKNY+IPKPQLCNKL
Sbjct: 1   MTSTFDGFVPIHTVFYTLFHPTEGSKVRFQFPPNSLENGKIDFDTIKNYIIPKPQLCNKL 60

Query: 61  LTFKYGSFRLVCYPVNVIAPYYARNSFSFDFVFVFPYDCATSPYESAIARLGKMFTVLEE 120
           LTFKYG +R+VCYPVNV A YYARNSF+F+FVFVFPYDCATSPYE AIARLGKMF VLEE
Sbjct: 61  LTFKYGEYRIVCYPVNVNARYYARNSFNFNFVFVFPYDCATSPYEPAIARLGKMFKVLEE 120

Query: 121 QSQILSKAENSHVYFQLKTRDSHKHTNQEPVNDNELQGTLKNNEASQSESHGYAFEKYHE 180
           QSQILSK+E + VYFQLK+ DS+        + +   G++  +E +  +S G   EKY E
Sbjct: 121 QSQILSKSEQNPVYFQLKSNDSNA------ADQSTEMGSITISEHTDIKSTGDDGEKYLE 174

Query: 181 ILKDLNGPNKRISVEDLITKIYRDLNNYSECLIPIDSGNAVDIKXXXXXXXXXXXXXXED 240
           I+K+L    K + +EDL+ K++ DLNNYSECLIPID GN++DIK              ED
Sbjct: 175 IIKELAKNQKSLIIEDLLMKLFLDLNNYSECLIPIDEGNSIDIKLFPVRTPPSSNISVED 234

Query: 241 VPMPTVNLAKLIDVNWDPTMLKIVPYINGTNSIAKVAKLSDSDCNLVVECIRHLLYYNCV 300
           VP+  VNL+ +IDVNWDPTM+KIVPYING NS+A++A  + SD  LV ECI+HL+YYNCV
Sbjct: 235 VPIAVVNLSDIIDVNWDPTMVKIVPYINGINSVAQIAVSARSDVELVQECIKHLMYYNCV 294

Query: 301 ILADIFQFQNIYAPTSELSRFLTNPALATECQIYVTLDESTHISDLPFERKPSRTTYNNI 360
           IL+DIFQF NIYAPTSE+  FLTNPA+A  CQ++V  D S   S LPFE +P     NNI
Sbjct: 295 ILSDIFQFSNIYAPTSEIHNFLTNPAVAKACQLFVQGD-SLKQSLLPFEGRP-----NNI 348

Query: 361 -PV-RNSSSTLDVQRKGREMS-IKESSFTAGIDQSGRNQYTPQSHTSSIQCHNVSDASLG 417
            P  R  +ST  V  + R+ +    +  T+ +  + RN  +  S +S  + H   + SL 
Sbjct: 349 YPTGRKQASTSTVHSRRRDSNDTATTGSTSSVRDTHRNYLSSSSTSSYFRAHASENTSLA 408

Query: 418 NSEGGFNNKVFFTSKSCLFDMYRSLSQGQTVKEWYKTHFEKIRAARIDVRRFITFGVIHG 477
             E     K    ++SCLFD+Y+SLSQG+TVK+WYK +FE IR  RIDVR+ I FG+   
Sbjct: 409 TGENQM--KRILPTRSCLFDLYKSLSQGKTVKDWYKQNFEIIRDNRIDVRKLIMFGITRR 466

Query: 478 LLYRCYSFPIMKNVGYLEVVKALGLSDGDSSTEGKWLSGNSEPTNNVLSAAEIRIGLEXX 537
           L+YR  S+PI+KNVG  +++K+L       S E K   G S  + N+ SAA+I++     
Sbjct: 467 LIYRVNSYPIVKNVGTWDILKSL------VSKEPKTHYG-SGSSKNIFSAADIKV----- 514

Query: 538 XXKLRERRFNHFSNADTAEDILNDVYRKLALNENKVEQSSQSGNPMMRMFGNCSDDS-SG 596
               +E   N     D A+++L  +Y+KL+L ++            M  F    DDS S 
Sbjct: 515 -VDTKEEG-NQSDKLDAADELLKSLYQKLSLKQDVPN--------TMSKFARYYDDSPSN 564

Query: 597 ETSVKDVVSTAGSDTRNTVAFDVRRLVNSATAE---DRKKGEVMXXXXXXXXXXXXXXXS 653
               +     + S +   V+FD        T     D   GE +               S
Sbjct: 565 NAFTESTSRKSSSGSHQKVSFDFGTAGQQKTVTEVPDLGDGEKVEVWKKKKEEELILLES 624

Query: 654 VRDVENFDKICTRLGRDREEVEKMLEDLGPYNVVH 688
           + + E FDK+CT+L + R EVE +L+DLG YN+V+
Sbjct: 625 LSNAETFDKVCTKLKKSRHEVELLLKDLGHYNIVN 659

>TDEL0G04520 Chr7 (822826..824865) [2040 bp, 679 aa] {ON} Anc_6.17
           YEL062W
          Length = 679

 Score =  561 bits (1447), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/700 (44%), Positives = 435/700 (62%), Gaps = 34/700 (4%)

Query: 1   MSGHFDGFVPVHCILYTIFHPTEGTKVRHQFPPGCLEASDITFDTIKNYVIPKPQLCNKL 60
           M   F+GF+P+H I Y +FHPTEGTKVR++FPPG LE+ +I FD IKNY+IPKPQLC+KL
Sbjct: 1   MGDQFEGFIPIHTIFYAVFHPTEGTKVRYEFPPGNLESHNINFDAIKNYIIPKPQLCHKL 60

Query: 61  LTFKYGSFRLVCYPVNVIAPYYARNSFSFDFVFVFPYDCATSPYESAIARLGKMFTVLEE 120
           LT KY ++R+  YPV V +P YARN FSF+FVFVFPYDC TSPYE AIARLGKMF VLEE
Sbjct: 61  LTLKYKNYRIASYPVTVNSPIYARNFFSFNFVFVFPYDCQTSPYEPAIARLGKMFKVLEE 120

Query: 121 QSQILSKAENSHVYFQLKTRDSHKHTNQEPVNDNELQGTLKNNEASQSESHGYAFEKYHE 180
           Q+ ILSKAE   +++  K          E  +D + +   +    + S+S  YA EKYH+
Sbjct: 121 QNLILSKAEKDPIFYHFK--------QVEIKDDQDAKSKPEKGSHNLSKSQAYASEKYHK 172

Query: 181 ILKDLNGPNKRISVEDLITKIYRDLNNYSECLIPIDSGNAVDIKXXXXXXXXXXXXXXED 240
           I+ D+   +   S++DL+ ++Y+DLNNYSECLIPID GNAVDIK              ED
Sbjct: 173 IMTDIESADSTFSLKDLVLRVYQDLNNYSECLIPIDEGNAVDIKIFPMMTPPNSNISIED 232

Query: 241 VPMPTVNLAKLIDVNWDPTMLKIVPYINGTNSIAKVAKLSDSDCNLVVECIRHLLYYNCV 300
           VP+ TVNL K+IDVNWDPTMLKIVPYING NSI+K+AKLS SD  LV+ECI+HL+YYNCV
Sbjct: 233 VPVSTVNLNKVIDVNWDPTMLKIVPYINGLNSISKIAKLSVSDPGLVIECIKHLIYYNCV 292

Query: 301 ILADIFQFQNIYAPTSELSRFLTNPALATECQIYVTLDESTHISDLPFERKPSRTTYNNI 360
           +LADIFQF NIYAPTS L  FLT+  L+TECQ YV  +E + +  LPF+R       N+ 
Sbjct: 293 LLADIFQFSNIYAPTSSLRTFLTDSVLSTECQSYVVCEEDSTLPRLPFKR------VNHS 346

Query: 361 PVRNSSSTL-DVQRKGREMSIKESSFTA-GIDQSGRNQYTPQ--SHTSSIQCHNVSDASL 416
              +    L D  R  R    + +S ++ G      N   P   S  S  +    S +S 
Sbjct: 347 ATESVDHELADSHRSQRTSGSRTTSMSSNGKFFPSSNNEMPALISEESLYRTGKHSQSSF 406

Query: 417 GNSEGGFNNKV--FFTSKSCLFDMYRSLSQGQTVKEWYKTHFEKIRAARIDVRRFITFGV 474
            ++    +N +  +  +KSCLFD+YRSLSQG +++EWY  H+  IRA RIDVRRFITFGV
Sbjct: 407 SSNNTNPSNMLARYLPTKSCLFDLYRSLSQGTSLREWYGVHYGTIRANRIDVRRFITFGV 466

Query: 475 IHGLLYRCYSFPIMKNVGYLEVVKALGLSDGDSSTEGKWLSGNSEPTNNVLSAAEIRIGL 534
           I+GL+YRCYS+PIMKN+   ++ K L   D  + T     + N  P+ N+ S ++I+ G+
Sbjct: 467 INGLIYRCYSYPIMKNLEIFDLAKRLHREDISNHTVKHNKAKN--PSKNIFSTSDIKFGV 524

Query: 535 EXXXXKLRERRFNHFS-NADTAEDILNDVYRKLALNENKVEQSSQSGNPMMRMFGNCSDD 593
           E      R+R  +H + N D A+++L +VY+KL++  N  +    S +P+ R++   S  
Sbjct: 525 EYE----RQRNKHHKALNLDIADEVLRNVYKKLSVT-NSTDTRPNSADPIARLYRERSLG 579

Query: 594 SSGETSVKDVVSTAGSDTRNTVAFDVRRLVNS-----ATAEDRKKGEVMXXXXXXXXXXX 648
           S  + S  ++     SD  + V+FD ++ +       +++ D+ K +             
Sbjct: 580 SLADGSTNNIYRLQNSDRPSKVSFDKQQEIGHISKGMSSSNDKVKMD-EEAKLERRERDL 638

Query: 649 XXXXSVRDVENFDKICTRLGRDREEVEKMLEDLGPYNVVH 688
               SV   ++ D IC +L   R +VE ++++LG Y +++
Sbjct: 639 ILLESVEAADSLDTICVKLEMSRYDVEALIQNLGEYKIIN 678

>ZYRO0C07876g Chr3 (598500..600545) [2046 bp, 681 aa] {ON} similar
           to uniprot|P39923 Saccharomyces cerevisiae YEL062W NPR2
           Regulator of nitrogen permeases transcription is induced
           in response to proline and urea contains two PEST
           sequences
          Length = 681

 Score =  540 bits (1392), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/699 (44%), Positives = 432/699 (61%), Gaps = 44/699 (6%)

Query: 1   MSGHFDGFVPVHCILYTIFHPTEGTKVRHQFPPGCLEASDITFDTIKNYVIPKPQLCNKL 60
           M+  F+GFVP+H + Y +FHPT+GT+VR+++PPG LE ++I FD IKNY+IPKPQLC+KL
Sbjct: 15  MTDQFEGFVPIHTLFYAVFHPTKGTQVRYEYPPGNLEYNNINFDAIKNYIIPKPQLCHKL 74

Query: 61  LTFKYGSFRLVCYPVNVIAPYYARNSFSFDFVFVFPYDCATSPYESAIARLGKMFTVLEE 120
           LT KY  +R+VCYPV V +PYYARN FSF+FVFVFPYDC TS YE AIARLGKMF VLEE
Sbjct: 75  LTLKYKGYRIVCYPVTVNSPYYARNFFSFNFVFVFPYDCETSSYEPAIARLGKMFRVLEE 134

Query: 121 QSQILSKAENSHVYFQLKTRDSHKHTNQEPVNDNELQGTLKNNEASQ--SESHGYAFEKY 178
           Q+QILSKAEN  +YF  K  D          N  E  G L   ++ +  ++S G A  KY
Sbjct: 135 QNQILSKAENDPIYFDFKLAD----------NTTEQDGKLNAEKSFKGLTKSQGMALAKY 184

Query: 179 HEILKDLNGPNKRISVEDLITKIYRDLNNYSECLIPIDSGNAVDIKXXXXXXXXXXXXXX 238
           +EI+KDL       SV+DL+ +I++DLNNYSECLIPID GNAVDIK              
Sbjct: 185 NEIMKDLESEKSDFSVQDLVMRIFQDLNNYSECLIPIDEGNAVDIKIFPLKTPPNSCISI 244

Query: 239 EDVPMPTVNLAKLIDVNWDPTMLKIVPYINGTNSIAKVAKLSDSDCNLVVECIRHLLYYN 298
           EDVP+ TVNL  +IDVNWDPTMLKIVPYI+G NSI+K+AKLSDSD +LV+EC++HL+YYN
Sbjct: 245 EDVPISTVNLKTIIDVNWDPTMLKIVPYIDGLNSISKIAKLSDSDVSLVLECVKHLVYYN 304

Query: 299 CVILADIFQFQNIYAPTSELSRFLTNPALATECQIYVTLDESTHISDLPFERKPSRTTYN 358
           CVILADIFQF NIYAPTS + +FLT+P LA+ECQ +VTL   + +S++PFER        
Sbjct: 305 CVILADIFQFSNIYAPTSLIRQFLTDPTLASECQSHVTLAGHSSLSEMPFER-------- 356

Query: 359 NIPVRNSSSTLDVQRKGREMSIKESSFTAGIDQSGRNQYTPQSHTSSIQCHNVSDASLGN 418
              +R        Q K +E   + +S ++  D   +  +   +  +  + +  S +S  +
Sbjct: 357 ---LRKFDLDDMDQSKNQESGSRTTSMSSKSDSKSKRPFFYSAPRNPYRFNQRSQSSFSS 413

Query: 419 SEGGFNNKV--FFTSKSCLFDMYRSLSQGQTVKEWYKTHFEKIRAARIDVRRFITFGVIH 476
           +     + +     +K+CLFD+YR+LSQG TV+EWY  +++ I+   IDVRRFITFGVI 
Sbjct: 414 TNTNVTHDLARHLPTKACLFDLYRTLSQGVTVREWYNLNYQTIKKNDIDVRRFITFGVIK 473

Query: 477 GLLYRCYSFPIMKNVGYLEVVKALGLSD--GDSSTEGKWLSGNSEPTNNVLSAAEIRIGL 534
           GL+YRC+SFP+MK +   ++   L  +      + +GK     +E +  V S +++++G 
Sbjct: 474 GLIYRCFSFPVMKKMSIFDLAHKLHTAGNLNQVTKKGKGQKNLAE-SKYVFSTSDMKLG- 531

Query: 535 EXXXXKLRERRFNHFSNADTAEDILNDVYRKLALNENKVEQSSQSGNPMMRMFGNCSDDS 594
                K+ +    +FS  D A+++L +VY+KL+   N  E  S+   P+ R++   S  S
Sbjct: 532 --EGSKMHQ----NFS-VDIADEVLRNVYKKLS---NTNEPGSRDDYPLSRIYREESHVS 581

Query: 595 SGETSVKDVVSTAGSDTRNTVAFDVRRLVNSATAEDRKKG-----EVMXXXXXXXXXXXX 649
               S  +V      +  + VAFD+ +      +  ++KG     E              
Sbjct: 582 LSALSGDNVSHPKKPERVSKVAFDMNKDDPVPYSLSQQKGKNKEREAAKLDRAKNNQKII 641

Query: 650 XXXSVRDVENFDKICTRLGRDREEVEKMLEDLGPYNVVH 688
              S+   +  DKIC +L + R EVE++L +LG Y +++
Sbjct: 642 LLESIAAADCLDKICVKLEKPRHEVEELLHELGDYKIIN 680

>Kpol_1045.72 s1045 (167094..169181) [2088 bp, 695 aa] {ON}
           (167096..169183) [2088 nt, 696 aa]
          Length = 695

 Score =  513 bits (1320), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 302/725 (41%), Positives = 414/725 (57%), Gaps = 75/725 (10%)

Query: 5   FDGFVPVHCILYTIFHPTEGTKVRHQFPPGCLEASDITFDTIKNYVIPKPQLCNKLLTFK 64
           FDGF P+H I Y++FHPTEG KV +QFPP  L+   I FD+I++YVIPKPQLCNKLLT K
Sbjct: 4   FDGFEPIHTIFYSVFHPTEGPKVCYQFPPNNLDNYSINFDSIRSYVIPKPQLCNKLLTLK 63

Query: 65  YGSFRLVCYPVNVIAPYYARNSFSFDFVFVFPYDCATSPYESAIARLGKMFTVLEEQSQI 124
           YG++R++ YP+ +    YARN+FSF+ VFVFPY+C TSPYES I +LGKMF VLEEQSQ 
Sbjct: 64  YGNYRIIGYPITINCSIYARNNFSFNLVFVFPYECKTSPYESVIVKLGKMFRVLEEQSQF 123

Query: 125 LSKAENSHVYFQLKTRDSHKHTNQEPVNDNE--------------LQGTLKNNEASQSES 170
           LSKAE    YF  K    H   +Q+     E                    +  A+ S+ 
Sbjct: 124 LSKAEKDLAYFDFKAI-LHSSLDQDSKLKPEKDSSGNNNGNSNNSNNDQSNSANATDSKK 182

Query: 171 HG-YAFEKYHEILKDLNGPNKRISVEDLITKIYRDLNNYSECLIPIDSGNAVDIKXXXXX 229
           +  Y FEKY EI + ++      S++D I ++Y+DLNNYSECLIPID+GNAVDIK     
Sbjct: 183 NSSYLFEKYKEIQEFVSNDESDFSIQDFIMRLYQDLNNYSECLIPIDAGNAVDIKLFPLL 242

Query: 230 XXXXXXXXXEDVPMPTVNLAKLIDVNWDPTMLKIVPYINGTNSIAKVAKLSDSDCNLVVE 289
                    EDVP+  VNL ++IDVNWDPTMLKIVP+I+G NSIAK+AKLSDSD  LV+E
Sbjct: 243 RPPPATISIEDVPISRVNLKEIIDVNWDPTMLKIVPHIDGVNSIAKIAKLSDSDTVLVIE 302

Query: 290 CIRHLLYYNCVILADIFQFQNIYAPTSELSRFLTNPALATECQIYVTLDESTHISDLPFE 349
           CI+H +YY CV+++DIFQF NIYAPTS L  FLT+P +ATECQ YVT+ ES+ +  LP E
Sbjct: 303 CIKHFIYYGCVVISDIFQFSNIYAPTSLLRNFLTDPLMATECQTYVTVPESSTLHQLPLE 362

Query: 350 R----KPSRTTYNNIPVRNSSSTLDVQRKGREMSIKESSFTAGIDQSGRNQYTPQSH--T 403
                K      ++  +R S + +D +      S   SS         R+      H   
Sbjct: 363 SLSKLKLDSDGSDSQNLRKSKNGIDSRAASFVSSRGASSHNENSSLYSRSDLYLNRHRSE 422

Query: 404 SSIQCHNVSDASLGNSEGGFNNKVFFTSKSCLFDMYRSLSQGQTVKEWYKTHFEKIRAAR 463
           SSI   N +D + GN +          ++S LFD+YRSLSQG T+KEWYK +F +IR   
Sbjct: 423 SSISSQNTNDLN-GNVKQ-------LPTRSTLFDLYRSLSQGVTLKEWYKENFFEIRNNG 474

Query: 464 IDVRRFITFGVIHGLLYRCYSFPIMKNVGYLEVVKALGLSDGDSSTEGKWLSGNSEPTNN 523
           ID+R+FI FG+I+GLLYRC SFP+  N  + E+ K     D  +  E +      + + +
Sbjct: 475 IDIRKFIIFGIINGLLYRCQSFPVTAN--FEEINKVKKFKDIQNRKETRKDKLQKQLSQD 532

Query: 524 VLSAAEIRIGLEXXXXKLRERRFNHFSNADTAEDILNDVYRKL------------ALNEN 571
           + S ++I++G +      R RR     + D A+ +L +VY+KL            ALN  
Sbjct: 533 IFSTSDIKVGEDLISG--RNRRIQTL-DLDIADSVLKNVYKKLTLKTEEENSSNRALNSQ 589

Query: 572 KVEQSS-----QSGNPMMRM---FGNCSDDSSGETSVKDVVSTAGSDTRNTVAFDVRRLV 623
           ++E+ S     +S NP  ++    G  S  S  + S     +++G  T N    ++ +L 
Sbjct: 590 ELEKKSVQSLFESSNPYSKVPKRPGTLSKVSFQQNSNMQYSASSGDVTENEDINNLEKL- 648

Query: 624 NSATAEDRKKGEVMXXXXXXXXXXXXXXXSVRDVENFDKICTRLGRDREEVEKMLEDLGP 683
                  RK+ E +               ++   EN DKIC  L + R EVE+ML+ L  
Sbjct: 649 -------RKQNEQI------------LLEALESTENLDKICVLLEKPRSEVEEMLKHLVD 689

Query: 684 YNVVH 688
           + V++
Sbjct: 690 FKVIN 694

>TPHA0J00310 Chr10 complement(68890..70917) [2028 bp, 675 aa] {ON}
           Anc_6.17 YEL062W
          Length = 675

 Score =  483 bits (1242), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 292/713 (40%), Positives = 404/713 (56%), Gaps = 62/713 (8%)

Query: 1   MSGHFDGFVPVHCILYTIFHPTEGTKVRHQFPPGCLEASDITFDTIKNYVIPKPQLCNKL 60
           M+  FDGFVP+H I Y++FHPTEGTKV ++FPP  L  S I FD IKNYVIPKPQLC+KL
Sbjct: 1   MNNSFDGFVPIHGIFYSVFHPTEGTKVSYEFPPSNLVKSGINFDAIKNYVIPKPQLCHKL 60

Query: 61  LTFKYGSFRLVCYPVNVIAPYYARNSFSFDFVFVFPYDCATSPYESAIARLGKMFTVLEE 120
           LT KY ++R+V YP+ + +  YARN+FSF+ VFVFPY+C TSPYE  + RLGKMF  LE 
Sbjct: 61  LTLKYNNYRIVGYPIIINSSLYARNNFSFNLVFVFPYECETSPYEPVVERLGKMFCELEG 120

Query: 121 QSQILSKAENSHVYFQLKTRDS---HKHTNQEPVND----------------NELQGTLK 161
           Q Q LSK E    YF  K   +      +N EP N+                +   G+  
Sbjct: 121 QCQFLSKCEKDMAYFDFKLISNLIDQDKSNTEPDNNILSKTNSMILPTISNIDTTVGSTN 180

Query: 162 NNEASQSESHGYAFEKYHEILKDLNGPNKRISVEDLITKIYRDLNNYSECLIPIDSGNAV 221
             + + S+   Y F KY+ I   +     ++S+ D++ ++++DLN+YSEC IPID GNA+
Sbjct: 181 TQDKANSKEVEYLFSKYNVIQNYIKNDKMQLSMNDILMRVFQDLNSYSECYIPIDDGNAI 240

Query: 222 DIKXXXXXXXXXXXXXXEDVPMPTVNLAKLIDVNWDPTMLKIVPYINGTNSIAKVAKLSD 281
           DIK              EDVP+PTVNL K+IDVNWDPTMLKIVPYI+G NSI K+A LS+
Sbjct: 241 DIKLFPTLMPPIDSISVEDVPIPTVNLNKIIDVNWDPTMLKIVPYIDGLNSIFKIANLSN 300

Query: 282 SDCNLVVECIRHLLYYNCVILADIFQFQNIYAPTSELSRFLTNPALATECQIYVTLDEST 341
           SD  LV+ECIRH +YY CVIL+DIFQF NIYAPTS ++ FLT+P LATECQIYVT  E +
Sbjct: 301 SDAMLVIECIRHFVYYGCVILSDIFQFSNIYAPTSSITDFLTDPTLATECQIYVTSPEDS 360

Query: 342 HISDLPFERKPSRTTYNNIPVRNSSSTLDVQRKGREMSIKESSFTAGIDQSGRNQYTPQS 401
            +S LPF +K  +   N      +S         + ++ K SSF +  D+   N  T   
Sbjct: 361 LLSALPF-KKGRKMVKNRRSASIASHFTSSSSLRQNLNSKASSFIS--DEGHHNDDTAYP 417

Query: 402 HTSSI---QCHNVSDASLGNSEGGFNNKVFFTSKSCLFDMYRSLSQGQTVKEWYKTHFEK 458
           +  SI   +  + S  S GN++    N+ +  +KS LFD+YRSLSQG  ++EWY+ +F  
Sbjct: 418 NHDSIYENRRRSESSFSSGNNDEMHQNRNYLPTKSTLFDLYRSLSQGVKLEEWYQINFNS 477

Query: 459 IRAARIDVRRFITFGVIHGLLYRCYSFPIMKNVGYLEVVKAL-GLSDGDSSTEGKWLSGN 517
           IR   ID+RRFI FG+I  ++YRC+S+P+ KN      +  L  L +G    + K  S  
Sbjct: 478 IRDNFIDIRRFIIFGIIKRIIYRCHSYPLPKNYEAFSKLNDLKNLQNGPKIVKNKSQSY- 536

Query: 518 SEPTNNVLSAAEIRIGLEXXXXKLRERRFNHFSNADTAEDILNDVYRKLALNENKVEQ-S 576
              T N+ S ++I+ G++      ++    H  + D A+ +LN+VY+KL+ N       +
Sbjct: 537 ---TYNIFSTSDIKFGVDLYTDTKKKL---HTLDVDVADRVLNNVYKKLSTNGRPTTSIN 590

Query: 577 SQSGNPMMRMFGNCSDDSSGETSVKDVVSTAGSDTRNTVAFDVRRLVNSATAEDRKKGEV 636
            Q  +P    F N S D+                       D+  L+N+   E  K    
Sbjct: 591 GQGQHPSKVAFKNQSYDN-----------------------DLPGLMNNLGIEATKFSRE 627

Query: 637 MXXXXXXXXXXXXXXXSVRDVENFDKICTRLGRDREEVEKMLEDLGPYNVVHC 689
           +               +++  EN D IC+ L   REEVE +L +L  Y +++C
Sbjct: 628 I-----NINDKIYLLDALQSAENLDNICSNLELSREEVETLLNELTEYRIINC 675

>Skud_5.27 Chr5 (33530..35377) [1848 bp, 615 aa] {ON} YEL062W (REAL)
          Length = 615

 Score =  471 bits (1212), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 261/558 (46%), Positives = 349/558 (62%), Gaps = 30/558 (5%)

Query: 1   MSGHFDGFVPVHCILYTIFHPTEGTKVRHQFPPGCLEASDITFDTIKNYVIPKPQLCNKL 60
           M  +F GFVP+H I Y++FHPTEG+K++++FPP  L+   I F+TIKNY+IPKP LC+KL
Sbjct: 1   MQSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPILCHKL 60

Query: 61  LTFKYGSFRLVCYPVNVIAPYYARNSFSFDFVFVFPYDCATSPYESAIARLGKMFTVLEE 120
           +TFKYG++R+VCYPV + +P YARN FSF+FVFVFPYDC TSPYE AI RLGKMF VLEE
Sbjct: 61  ITFKYGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEPAITRLGKMFKVLEE 120

Query: 121 QSQILSKAENSHVYFQLKTRDSH---KHTNQEPVNDNELQGTLKNNEASQSESHGYAFEK 177
           Q+Q+LSK+E   V+F LK  ++      T   P   N    T      S  ++      +
Sbjct: 121 QNQLLSKSEKDAVFFDLKALENSTITPSTAGAPTTSNPSSNTTPTYPTSDKDAKDLRSSR 180

Query: 178 YHEILKDLNGPNKRISVEDLITKIYRDLNNYSECLIPIDSGNAVDIKXXXXXXXXXXXXX 237
           Y+++ KDL  P    S++DL+ +I++DLNNYSECLIPID GNAVDIK             
Sbjct: 181 YNDLTKDLGLPESSFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTCVS 240

Query: 238 XEDVPMPTVNLAKLIDVNWDPTMLKIVPYINGTNSIAKVAKLSDSDCNLVVECIRHLLYY 297
            EDVP+ +VNL K+IDVNWDPTM+ IVPYI+G NSIAK++KLS SD +LV+ECIRHL+YY
Sbjct: 241 LEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSRSDPSLVIECIRHLIYY 300

Query: 298 NCVILADIFQFQNIYAPTSELSRFLTNPALATECQIYVTLDESTHISDLPFERKPSRTTY 357
            CV L+DIFQF NIYAP+S +  FLT+  +A++CQ YV   E + +S LP  +       
Sbjct: 301 KCVTLSDIFQFSNIYAPSSLIRTFLTDQLMASDCQSYVAFPEISKMSSLPLSK------- 353

Query: 358 NNIPVRNSSSTLDVQRKGREMSI---KESSFTAGIDQSGRNQYTPQSHTSSIQCHNV--S 412
           N       S +L V+RK +  SI    +S  T+    S  +Q +  + + S  C +   S
Sbjct: 354 NLDSADRDSPSLFVRRKSKSSSIPSNPDSRTTSFSSNSKVSQNSSLNSSFSSVCKDWRQS 413

Query: 413 DASLGNS--EGGFNNKVFFTSKSCLFDMYRSLSQGQTVKEWYKTHFEKIRAARIDVRRFI 470
             SL +S      N   F  ++SCLFD+YRSLSQG+T+K WY++    ++   IDVRRFI
Sbjct: 414 QTSLSSSNLRANDNRNRFLPTRSCLFDLYRSLSQGRTLKSWYESKHAILKENNIDVRRFI 473

Query: 471 TFGVIHGLLYRCYSFPIMKNVGYLEVVKALGLSDGDSSTEGKWL-------------SGN 517
           TFG+   ++YRCYSFP+M NV   E  +   +   DS  + + L             S N
Sbjct: 474 TFGLERRIIYRCYSFPVMLNVDSRERKEMTRMILKDSLNDDRSLKKKNQDASFSVVGSKN 533

Query: 518 SEPTNNVLSAAEIRIGLE 535
           S   NNV S    ++  E
Sbjct: 534 SGQPNNVKSERPSKVSFE 551

 Score = 37.0 bits (84), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 23/36 (63%)

Query: 653 SVRDVENFDKICTRLGRDREEVEKMLEDLGPYNVVH 688
           S+R  E+FD IC  L + + EVE  L +LG + V++
Sbjct: 579 SIRSAESFDNICVLLSKSKLEVENYLNELGEFKVIN 614

>YEL062W Chr5 (34407..36254) [1848 bp, 615 aa] {ON}  NPR2Subunit of
           SEA (Seh1-associated), Npr2/3, and Iml1p complexes;
           Npr2/3 complex mediates downregulation of TORC1 activity
           upon amino acid limitation; SEA complex is a
           coatomer-related complex that associates dynamically
           with the vacuole; Iml1p complex (Iml1p-Npr2p-Npr3p) is
           required for non-nitrogen-starvation (NNS)-induced
           autophagy; Iml1p interacts primarily with phosphorylated
           Npr2p; homolog of human NPRL2; target of Grr1p; required
           for growth on urea and proline
          Length = 615

 Score =  461 bits (1187), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 250/545 (45%), Positives = 341/545 (62%), Gaps = 27/545 (4%)

Query: 1   MSGHFDGFVPVHCILYTIFHPTEGTKVRHQFPPGCLEASDITFDTIKNYVIPKPQLCNKL 60
           M  +F GFVP+H I Y++FHPTEG+K++++FPP  L+   I F+T KNY+IPKP LC+KL
Sbjct: 1   MLSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTFKNYIIPKPILCHKL 60

Query: 61  LTFKYGSFRLVCYPVNVIAPYYARNSFSFDFVFVFPYDCATSPYESAIARLGKMFTVLEE 120
           +TFKYG++R+VCYPV + +P YARN FSF+FVFVFPYDC TSPYE AI RLGKMF VLEE
Sbjct: 61  ITFKYGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEPAITRLGKMFKVLEE 120

Query: 121 QSQILSKAENSHVYFQLKTRD---SHKHTNQEPVNDNELQGTLKNNEASQSESHGYAFEK 177
           Q+Q+LSK+E   V+F LK  +   +   T       N    T   +  S+ ++      +
Sbjct: 121 QNQLLSKSERDPVFFDLKVLENSTTTPSTAGPSSTPNPSSNTTPTHPTSEKDTKDMRSSR 180

Query: 178 YHEILKDLNGPNKRISVEDLITKIYRDLNNYSECLIPIDSGNAVDIKXXXXXXXXXXXXX 237
           Y +++KDL  P    S++DL+ +I++DLNNYSECLIPID GNAVDIK             
Sbjct: 181 YSDLIKDLGLPQSAFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTCVS 240

Query: 238 XEDVPMPTVNLAKLIDVNWDPTMLKIVPYINGTNSIAKVAKLSDSDCNLVVECIRHLLYY 297
            EDVP+ +VNL K+IDVNWDPTM+ IVPYI+G NSIAK++KLS+SD  LV+ECIRHL+YY
Sbjct: 241 LEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSNSDPGLVIECIRHLIYY 300

Query: 298 NCVILADIFQFQNIYAPTSELSRFLTNPALATECQIYVTLDESTHISDLPFER------- 350
            CV L+DIFQF NIYAP+S +  FLT+P +A++CQ YVT  E + IS+LP  +       
Sbjct: 301 KCVTLSDIFQFSNIYAPSSLIRNFLTDPLMASDCQSYVTFPEVSKISNLPLNKSLGSGDQ 360

Query: 351 -KPSRTTYNNIPVRNSSSTLDVQRKGREMSIKESSFTAGIDQSG---RNQYTPQSHTSSI 406
             PS +        +  S  D +      + + S  ++         ++    Q+  SS 
Sbjct: 361 DSPSFSVRRKSKSSSIPSNPDSRTTSFSSTSRVSQNSSLNSSFSSIYKDWRQSQTSCSSS 420

Query: 407 QCHNVSDASLGNSEGGFNNKVFFTSKSCLFDMYRSLSQGQTVKEWYKTHFEKIRAARIDV 466
             H ++           N   F  ++SCLFD+YRSLSQGQT+K WY++ +  ++   ID+
Sbjct: 421 NIHVIN-----------NRNRFLPTRSCLFDLYRSLSQGQTLKTWYESKYMILKENNIDI 469

Query: 467 RRFITFGVIHGLLYRCYSFPIMKNVGYLEVVKALGLSDGDSSTEGKWLSGNSEPTNNVLS 526
           RRFITFG+   ++YRCYSFP+M N G  E  +   +   D     K L   +   N++LS
Sbjct: 470 RRFITFGLEKRIIYRCYSFPVMINAGSREPKEMTPIITKDLVNNDKLLEKRNH--NHLLS 527

Query: 527 AAEIR 531
           A   R
Sbjct: 528 ATGSR 532

 Score = 39.3 bits (90), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 24/36 (66%)

Query: 653 SVRDVENFDKICTRLGRDREEVEKMLEDLGPYNVVH 688
           S+R+ E FDKIC  L + + EVE  L +LG + V++
Sbjct: 579 SIRNAETFDKICVLLSKPKLEVESYLNELGEFKVIN 614

>Smik_5.25 Chr5 (36761..38452,38453..38605) [1845 bp, 615 aa] {ON}
           YEL062W (REAL)
          Length = 615

 Score =  461 bits (1186), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 247/525 (47%), Positives = 334/525 (63%), Gaps = 25/525 (4%)

Query: 1   MSGHFDGFVPVHCILYTIFHPTEGTKVRHQFPPGCLEASDITFDTIKNYVIPKPQLCNKL 60
           M  +F GFVP+H I Y++FHPTEG+K++++FPP  L+   I F+TIKNY+IPKP LC+KL
Sbjct: 1   MLSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPVLCHKL 60

Query: 61  LTFKYGSFRLVCYPVNVIAPYYARNSFSFDFVFVFPYDCATSPYESAIARLGKMFTVLEE 120
           +TFKYG++R+VCYPV + +P YARN FSF+FVFVFPYDC TSPYE AI RLGKMF VLEE
Sbjct: 61  ITFKYGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEPAITRLGKMFKVLEE 120

Query: 121 QSQILSKAENSHVYFQLKTRDSH---KHTNQEPVNDNELQGTLKNNEASQSESHGYAFEK 177
           Q+Q+LSK+E   V+F LK  ++      T   P   N    T   +  S  ++      +
Sbjct: 121 QNQLLSKSEKDPVFFDLKALENSTIAPSTACPPATSNTSSNTTPTHPTSDKDAKDLRNSR 180

Query: 178 YHEILKDLNGPNKRISVEDLITKIYRDLNNYSECLIPIDSGNAVDIKXXXXXXXXXXXXX 237
           Y++++KD   P    S++DL+ +I++DLNNYSECLIPID GNAVDIK             
Sbjct: 181 YNDLVKDFELPESTFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTCVS 240

Query: 238 XEDVPMPTVNLAKLIDVNWDPTMLKIVPYINGTNSIAKVAKLSDSDCNLVVECIRHLLYY 297
            EDVP+ +VNL K+IDVNWDPTM+ IVPYI+G NSIAK++KLS+SD +LV+ECIRHL+YY
Sbjct: 241 LEDVPLSSVNLEKIIDVNWDPTMMNIVPYIDGLNSIAKISKLSNSDPSLVIECIRHLIYY 300

Query: 298 NCVILADIFQFQNIYAPTSELSRFLTNPALATECQIYVTLDESTHISDLPFER------- 350
            CV L+DIFQF NIYAP+S +  FLT+P +A +CQ YVT  E + IS LP  +       
Sbjct: 301 KCVTLSDIFQFSNIYAPSSSIRNFLTDPLMANDCQYYVTFPEVSKISSLPLNKNLTSGDL 360

Query: 351 -KPS---RTTYNNIPVRNSSSTLDVQRKGREMSIKESSFTAGIDQSGRNQYTPQSHTSSI 406
             PS   R    +  + ++  +            + SS  +    + R+    Q+  SS 
Sbjct: 361 DSPSFSVRRKSKSSSIPSNPGSRTTSFSSTSKVSQNSSINSSFSSAYRDWRQSQTSCSSS 420

Query: 407 QCHNVSDASLGNSEGGFNNKVFFTSKSCLFDMYRSLSQGQTVKEWYKTHFEKIRAARIDV 466
             H      + N     N   F  ++SCLFD+YRSLSQGQT+K WY++ +  I+   ID+
Sbjct: 421 NIH------ISN-----NRNRFLPTRSCLFDLYRSLSQGQTLKAWYESKYMIIKDNNIDI 469

Query: 467 RRFITFGVIHGLLYRCYSFPIMKNVGYLEVVKALGLSDGDSSTEG 511
           RRFITFG+   ++YR YS+P+M +VG  E  +   +   DS  E 
Sbjct: 470 RRFITFGLEKRIIYRSYSYPVMLSVGPRETKETAPIIAKDSPNES 514

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 25/36 (69%)

Query: 653 SVRDVENFDKICTRLGRDREEVEKMLEDLGPYNVVH 688
           SVR  ENFDKIC  LG+ + EVE  L +LG + +++
Sbjct: 579 SVRSAENFDKICVLLGKPKLEVENYLNELGEFKIIN 614

>TBLA0G01010 Chr7 complement(253690..255822) [2133 bp, 710 aa] {ON}
           Anc_6.17 YEL062W
          Length = 710

 Score =  463 bits (1192), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 295/748 (39%), Positives = 416/748 (55%), Gaps = 97/748 (12%)

Query: 1   MSGHFDGFVPVHCILYTIFHPTEGTKVRHQFPPGCLEASDITFDTIKNYVIPKPQLCNKL 60
           M  HF+GFVP+H + Y+IFHPTEGTKVR++FPPG L+  +I FDTIKNY+IPKPQLC+KL
Sbjct: 1   MIDHFEGFVPIHTVFYSIFHPTEGTKVRYEFPPGNLQTYNINFDTIKNYIIPKPQLCHKL 60

Query: 61  LTFKYGSFRLVCYPVNVIAPYYARNSFSFDFVFVFPYDCATSPYESAIARLGKMFTVLEE 120
           LT KYG +RLV YPV + +  YARN FSF+FVFVFP +C TSPYE  IARLGKMF VLEE
Sbjct: 61  LTLKYGDYRLVSYPVTINSSLYARNFFSFNFVFVFPINCETSPYEPIIARLGKMFRVLEE 120

Query: 121 QSQILSKAENSHVYFQLKTRDSHKHTNQEPVNDNELQGTLKNNEASQSESHGYAFEKYHE 180
           Q+Q+LS+AEN  VYF     +SH   + E    + +    KN          ++F K   
Sbjct: 121 QNQLLSRAENDSVYFD----NSHSLLSSE---QDSIMHQDKNTSILGFSRKRFSFSKRPT 173

Query: 181 ILKDLNGPNKR----ISVEDLITKIYRDLNNYSECLIPIDSGNAVDIKXXXXXXXXXXXX 236
            L     P+       SV+DLI +I++DLNNYSECLIPID GN+VDIK            
Sbjct: 174 DLSLSEYPDNESGSNFSVQDLIMRIFQDLNNYSECLIPIDEGNSVDIKIFPSMVPPSISI 233

Query: 237 XXEDVPMPTVNLAKLIDVNWDPTMLKIVPYINGTNSIAKVAKLSDSDCNLVVECIRHLLY 296
             EDVP+  V+L+ ++DVNWDPTMLKIVP+I+  NSI+++A LS+SD + VVECIRHL+Y
Sbjct: 234 SYEDVPVAMVDLSHVMDVNWDPTMLKIVPFIDSINSISRIAALSNSDVDFVVECIRHLVY 293

Query: 297 YNCVILADIFQFQNIYAPTSELSRFLTNPALATECQIYVTLDESTHISDLPFERKPSRTT 356
           Y  VIL+DIFQF NIYAPTS L  FLT+  LAT+CQ YV L ++++   LP E+      
Sbjct: 294 YQLVILSDIFQFTNIYAPTSRLRDFLTDINLATDCQTYVCLPKNSNFGKLPLEKSI---- 349

Query: 357 YNNIPVRNSSSTLDVQRKGREMSIKESSFTAGIDQSGRNQYTPQSHTSSIQCHNVSDASL 416
             N  +   S++        E+   +      +    RN  +  S   S      S+   
Sbjct: 350 --NTDLDEYSNSGSAIYPNNEILENDDRLRWPMYYKPRNSQSSLSSGISSGNERTSN--- 404

Query: 417 GNSEGGFNNKVFFTSKSCLFDMYRSLSQGQTVKEWYKTHFEKIRAARIDVRRFITFGVIH 476
                      +  +KSCLFD+YRSLSQG  + +WY  H+  I   +ID+RRFITFG++ 
Sbjct: 405 -----------YLPTKSCLFDLYRSLSQGTVLHDWYNEHYSLIHFNKIDIRRFITFGLVR 453

Query: 477 GLLYRCYSFPIMKNVGYLEVVKALGL--------SDGD------SSTEGKWLSGNSEPTN 522
           GLLYRCY+ PIMKN G  +++ +L          S+GD      S+   ++L+  ++   
Sbjct: 454 GLLYRCYAIPIMKNAGIFDILSSLTTSQSSNPYHSNGDDKNGTASTANIRFLNSITDSDI 513

Query: 523 NVLSAAEIR------IGLEXXXXKL--------RERRFNHFSNADTAE------------ 556
           + L   EI       I       KL              H S+ D +E            
Sbjct: 514 HDLKDDEINNSGSCGIKPSFDVNKLFINGDDHSETTTVKHNSSRDASEHLFSPPPKRQIL 573

Query: 557 ------DILNDVYRKLALNENKVEQSSQSGNPMMRMFGNCSDDSSGETSVKDVVSTAGSD 610
                  +L+D++RKLA    K + + +S  P+++   +   D S  +   ++V    S+
Sbjct: 574 NSGIADKVLSDIHRKLA----KFDDTPRS--PIVKRKEDTFRDFSNGS---NIVGYGSSN 624

Query: 611 TRNTVAFDVRRLVNSATAEDR---------KKGEVMXXXXXXXXXXXXXXXSVRDVENFD 661
           T N V+F++ R  +S T ++             +++               S+R+ +N D
Sbjct: 625 TGNKVSFNLSR--DSDTTQNNLDHMNPILDSSKDIIAQQQEKNHIRRLLLESLREADNMD 682

Query: 662 KICTRLGRDREEVEKMLEDLGPYNVVHC 689
           KIC +L + R+EVE++L ++G Y +++C
Sbjct: 683 KICIKLQKPRKEVEELLSEIGDYVIINC 710

>KNAG0M01140 Chr13 complement(204691..206475) [1785 bp, 594 aa] {ON}
           Anc_6.17 YEL062W
          Length = 594

 Score =  450 bits (1157), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 237/504 (47%), Positives = 322/504 (63%), Gaps = 27/504 (5%)

Query: 1   MSGHFDGFVPVHCILYTIFHPTEGTKVRHQFPPGCLEASDITFDTIKNYVIPKPQLCNKL 60
           M   F+GFVP+H + YTIFHPTEG+KV +QFPPG L+  DI FD IKNY+IPKPQLC++L
Sbjct: 1   MMSKFEGFVPIHTLFYTIFHPTEGSKVCYQFPPGNLQHYDINFDAIKNYIIPKPQLCHRL 60

Query: 61  LTFKYGSFRLVCYPVNVIAPYYARNSFSFDFVFVFPYDCATSPYESAIARLGKMFTVLEE 120
           LT KYG++R+V YPV V +  YARN F F+FVFVFPY+CATSPYE AI RLGKMF VLEE
Sbjct: 61  LTMKYGNYRIVSYPVAVQSSSYARNYFRFNFVFVFPYECATSPYEPAITRLGKMFRVLEE 120

Query: 121 QSQILSKAENSHVYFQLKTRDSHKHTNQEPVNDNELQGTLKNNEASQSESHGYAFEKYHE 180
           QSQ+LS+AE           DS    ++ P ++N  +       A  S++  ++ +K  E
Sbjct: 121 QSQVLSRAERD---------DSLFKGDKLPFDNNSAKNQAPLTHALISKTKSFSPDKKTE 171

Query: 181 ILKDLNGPNKRISVEDLITKIYRDLNNYSECLIPIDSGNAVDIKXX-XXXXXXXXXXXXE 239
                 G    ISV+DLI +IY+DLNNYSECLIPID GNA+DIK               E
Sbjct: 172 ------GDIHLISVQDLIMRIYQDLNNYSECLIPIDEGNAIDIKIFPLINPPTSVHLSIE 225

Query: 240 DVPMPTVNLAKLIDVNWDPTMLKIVPYINGTNSIAKVAKLSDSDCNLVVECIRHLLYYNC 299
           DVPM  V L K+ID+NWDPTM+ I+P+ING NSI  +A+LSDSD  LV+ECI+HL+YY C
Sbjct: 226 DVPMLVVKLKKIIDLNWDPTMVSILPFINGVNSILNIARLSDSDPELVIECIKHLIYYKC 285

Query: 300 VILADIFQFQNIYAPTSELSRFLTNPALATECQIYVTLDESTHISDLPFERKPSRTTYNN 359
           VI+ DIFQF NIYAP+S ++ FLT+P +A +CQ YVTL +S+ +  +P +     +  N 
Sbjct: 286 VIITDIFQFSNIYAPSSLINEFLTDPTMAYDCQEYVTLPKSSRLIHMPLQTSVPGSRNNK 345

Query: 360 IPVRNSSSTLDVQRKGREMSIKESSFTAGIDQSGRNQYTPQSHTSSIQCHNVSDASLGNS 419
               NS S+  V      +S + +S  +       +    +   SS+       A  G S
Sbjct: 346 HKKSNSLSSTGV------LSWQSNSQYSNNSSEFYSMSNKKRSESSLSSEGTPGA--GRS 397

Query: 420 EGGFNNKVFFTSKSCLFDMYRSLSQGQTVKEWYKTHFEKIRAARIDVRRFITFGVIHGLL 479
           +   ++ +++ ++  LFD+YRSLSQG T+++WY T+F  IR+  IDVR+FI FG I  ++
Sbjct: 398 D---DHTIYYPTRMVLFDLYRSLSQGITLEKWYTTNFTTIRSNYIDVRKFIQFGTIKKII 454

Query: 480 YRCYSFPIMKNVGYLEVVKALGLS 503
           YR  S+P+++      + K +G S
Sbjct: 455 YRVLSYPVLEKRRNSIIAKQMGKS 478

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 28/37 (75%)

Query: 653 SVRDVENFDKICTRLGRDREEVEKMLEDLGPYNVVHC 689
           ++ ++E+FDKIC +LGR R E+  ++ D+G Y V++C
Sbjct: 558 ALDNLESFDKICVQLGRSRVEIANLIADIGEYRVINC 594

>NCAS0H00870 Chr8 (158877..160715) [1839 bp, 612 aa] {ON} Anc_6.17
           YEL062W
          Length = 612

 Score =  436 bits (1120), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 279/698 (39%), Positives = 380/698 (54%), Gaps = 106/698 (15%)

Query: 3   GHFDGFVPVHCILYTIFHPTEGTKVRHQFPPGCLEASDITFDTIKNYVIPKPQLCNKLLT 62
            HF+GF+P+H I Y+IFHPTEGTKV ++FPP  L    I FDTIKNY+IPK QLCN+LLT
Sbjct: 10  NHFEGFMPIHTIFYSIFHPTEGTKVCYEFPPKNLSNFHINFDTIKNYIIPKNQLCNRLLT 69

Query: 63  FKYGSFRLVCYPVNVIAPYYARNSFSFDFVFVFPYDCATSPYESAIARLGKMFTVLEEQS 122
           FKY ++R+V YP+ + APYYARN FSF+FVFVFPY+C TSPYE +IARLGKMF +LEEQS
Sbjct: 70  FKYENYRIVSYPITINAPYYARNFFSFNFVFVFPYECETSPYEPSIARLGKMFKILEEQS 129

Query: 123 QILSKAENSHVYFQLKTRDSHKHTNQEPVNDNELQGTLKNNE--ASQSESHGYAFEKYHE 180
           QILSKAEN  +YF+     +   T   P    ++  + +N         + G  FE   +
Sbjct: 130 QILSKAENDPIYFKSDYVPTEPTTTIIP----QISPSHRNKRNNDHNDNNDGSRFET--D 183

Query: 181 ILKDLNGPNKRISVEDLITKIYRDLNNYSECLIPIDSGNAVDIKX-XXXXXXXXXXXXXE 239
              +      + SV+DLI +IY+DLNNYSECLIPID GN ++IK               E
Sbjct: 184 FFGEEEDGVTKFSVQDLIMRIYQDLNNYSECLIPIDKGNDINIKVFPLLKPPPNHLISLE 243

Query: 240 DVPMPTVNLAKLIDVNWDPTMLKIVPYINGTNSIAKVAKLSDSDCNLVVECIRHLLYYNC 299
           DVPM  +NL  +IDVNWDPTML IVPYING N I+K+AKL+ +D  LV+ECI+HL+YYNC
Sbjct: 244 DVPMSLINLNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECIKHLVYYNC 303

Query: 300 VILADIFQFQNIYAPTSELSRFLTNPALATECQIYVTLDESTHISDLPFE----RKPSRT 355
           VI+ DIFQF N+YAPTS +  FLT+  +AT+CQ YV L   + +S LPFE    ++PS  
Sbjct: 304 VIITDIFQFSNVYAPTSLICSFLTDQEMATQCQNYVVLPIGSKLSHLPFENNGNKQPSTP 363

Query: 356 TYNNIPVRNSSSTLDVQRKGREMSIKESSFTAGIDQSGRNQYTPQSHTSSIQCHNVSDAS 415
                  ++S +T         ++  E S+   I +S  +     +              
Sbjct: 364 -------KHSRTTSLSSSMSGSVNSHEHSYMDTIQKSETSLSLSSTDP------------ 404

Query: 416 LGNSEGGFNNKVF----FTSKSCLFDMYRSLSQGQTVKEWYKTHFEKIRAARIDVRRFIT 471
                   NN  F      +K+CLFD+YRSLS G T++ WY+++   I    +DVR+FI 
Sbjct: 405 --------NNPHFELAHLPTKACLFDLYRSLSYGVTLRSWYQSNATIITENNVDVRKFIK 456

Query: 472 FGVIHGLLYRCYSFPIMKNVGYLEVVKALGLSDGDSSTEGKWLSGNSEPTNNVLSAAEIR 531
           FG+I GL+YRC+S+PI +      + +   L+D D+       SG         SAA   
Sbjct: 457 FGIIRGLIYRCHSYPIPQRPSNEGIQRIERLNDIDAHRLQIRSSG---------SAARSN 507

Query: 532 IGLEXXXXKLRERRFNHFSNADTAEDILNDVYRKLALNENKVEQSSQSGNPMMRMFGNCS 591
            G                 N D A+++L +VY+KL    +KV    +  N  M+      
Sbjct: 508 SGSGSGSSASPSS-----INVDGADELLKNVYKKLE-RHSKVSFMDKEKNESMKT----- 556

Query: 592 DDSSGETSVKDVVSTAGSDTRNTVAFDVRRLVNSATAEDRKKGEVMXXXXXXXXXXXXXX 651
            D  G  S                         + T E+R                    
Sbjct: 557 -DEKGRPS-------------------------TMTKEER----------------SVLL 574

Query: 652 XSVRDVENFDKICTRLGRDREEVEKMLEDLGPYNVVHC 689
            S+  +EN DKIC +LG+ R++VE+ L++LG Y ++ C
Sbjct: 575 KSIESLENLDKICVKLGKSRQQVERWLDELGNYKIITC 612

>CAGL0L13288g Chr12 complement(1420781..1422721) [1941 bp, 646 aa]
           {ON} similar to uniprot|P39923 Saccharomyces cerevisiae
           YEL062w nitrogen permease regulator
          Length = 646

 Score =  428 bits (1101), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 269/701 (38%), Positives = 391/701 (55%), Gaps = 67/701 (9%)

Query: 1   MSGHFDGFVPVHCILYTIFHPTEGTKVRHQFPPGCLEASDITFDTIKNYVIPKPQLCNKL 60
           M+  F+GFV +H I Y+ FHPTEG+KV+  FPP  LE S I FD+IKNYVIPK  LC++L
Sbjct: 1   MASQFEGFVDIHSIFYSTFHPTEGSKVKFDFPPRSLENSGINFDSIKNYVIPKRALCHRL 60

Query: 61  LTFKYGSFRLVCYPVNVIAPYYARNSFSFDFVFVFPYDCATSPYESAIARLGKMFTVLEE 120
           +TFKYG++R+ CYPV V +  YARN FSF+FVFVFP++C TSPYE AI RLGKMF VLE 
Sbjct: 61  ITFKYGNYRIACYPVTVNSSIYARNFFSFNFVFVFPFNCETSPYEPAIERLGKMFRVLEI 120

Query: 121 QSQILSKAENSHVYFQLKTRDSHKHTNQEPVNDNELQGTLKNNEASQSESHGYAFEKYHE 180
           Q+QILSK+EN  + F LK+ D  K+ N +  + N + G   ++  +  +   Y  E+ + 
Sbjct: 121 QNQILSKSENDTIMFNLKSAD--KNFNIDNDSSNYILGDDISSIMTTQQKDKY--ERLNN 176

Query: 181 ILKDLNGPNKRISVEDLITKIYRDLNNYSECLIPIDSGNAVDIKXXXXXXXXXXXXXXED 240
           I+ ++       ++ DL+ ++Y+DLN YSECLIPID GNAVDIK              E 
Sbjct: 177 IISNIKKKPSNFTISDLLMRLYQDLNTYSECLIPIDDGNAVDIKLFPLLTPPTPYISIEH 236

Query: 241 VPMPTVNLAKLIDVNWDPTMLKIVPYINGTNSIAKVAKLSDSDCNLVVECIRHLLYYNCV 300
           VP+  VNL K++DVNWDP ML I+PYING N+I ++++LS ++ +LV+ECIRHL+YY C+
Sbjct: 237 VPISLVNLFKIVDVNWDPIMLTIIPYINGINNIYRISQLSHNEESLVIECIRHLVYYRCI 296

Query: 301 ILADIFQFQNIYAPTSELSRFLTNPALATECQIYVTLDESTHISDLP-FERKPSRTTYN- 358
           +L DIF+F N+YAPTS L  FL +P +ATECQ YV L  ++ ++DL  +      + +N 
Sbjct: 297 VLTDIFEFSNVYAPTSSLRLFLLDPNMATECQSYVMLPINSKMNDLSLYPHHGKHSAFNG 356

Query: 359 NIPVRNSSSTLDVQRKGREMSIKESSFTAGIDQSGRNQYTPQSHTSSIQCHNVSDASLGN 418
           +I  RN+S +  +       S +  S ++ +DQS  N Y  +  +        S  S GN
Sbjct: 357 DIGSRNNSVSTSLYSFNGNDS-RPQSRSSSVDQSQTNFYKNKKQSE-------SSISTGN 408

Query: 419 SEGGFNNKVFFTSKSCLFDMYRSLSQGQTVKEWYKTHFEKIRAARIDVRRFITFGVIHGL 478
           S  G N      ++S LFD+YRSLSQG T+KEWY  + + IR  RIDVRRFITFGV+  +
Sbjct: 409 SNNGQNIHKHLPTRSLLFDLYRSLSQGITLKEWYMQNHKIIRDNRIDVRRFITFGVLRRI 468

Query: 479 LYRCYSFPIMKNVGYLEVVKALGLSDGDSSTEGKWLSGNSEPTNNVLSAAEIRIGLEXXX 538
           +YRC ++ ++ +  +L+ +  L   +   S E                            
Sbjct: 469 IYRCETYSVINSTDHLQNLWKLNELENPISMEN--------------------------- 501

Query: 539 XKLRERRFNHFSNADTAEDILNDVYRKL--------ALNENKVEQSSQSGNPMMRMFGNC 590
             + + + NH  ++  A++ L + Y+KL        AL  +    SS S  P      N 
Sbjct: 502 --ISKLQSNHI-DSLAADEALMNAYKKLSLKVPSKGALKSHNTSHSSFSLTPTAPEMENS 558

Query: 591 SDDSSGETSVKDVVSTAGSDTRNTVAF--DVRRLVNSATAEDRKKGEVMXXXXXXXXXXX 648
               +   S   V   A  + RN   +  +++  +   T +   K +             
Sbjct: 559 QAKRNKRLS--KVSFEALPEDRNGFRWGSNIKTPIQETTWKKLSKMQ-----------RR 605

Query: 649 XXXXSVRDVENFDKICTRLGRDREEVEKMLEDLGPYNVVHC 689
               ++ D E  DKIC  L   R+ V  +L +LG   +++C
Sbjct: 606 IMLKALADAETLDKICVLLEMPRQNVVNILHELGELKLINC 646

>NDAI0D00860 Chr4 (193625..195625) [2001 bp, 666 aa] {ON} Anc_6.17
           YEL062W
          Length = 666

 Score =  421 bits (1083), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 242/516 (46%), Positives = 321/516 (62%), Gaps = 44/516 (8%)

Query: 3   GHFDGFVPVHCILYTIFHPTEGTKVRHQFPPGCLEASDITFDTIKNYVIPKPQLCNKLLT 62
            HF+GF+P+H I Y+IFHPTEGTKVR++FPP  L ASDI FD IKNY+IPK QLCNKLLT
Sbjct: 11  NHFEGFMPIHTIFYSIFHPTEGTKVRYEFPPSNLAASDIHFDAIKNYIIPKKQLCNKLLT 70

Query: 63  FKYGSFRLVCYPVNVIAPYYARNSFSFDFVFVFPYDCATSPYESAIARLGKMFTVLEEQS 122
           FKY ++R+V YP+ + + +YARN FSF+FVFVFPYDC TSPYE AIARLGKMF VLEEQ+
Sbjct: 71  FKYANYRIVSYPITINSDFYARNFFSFNFVFVFPYDCETSPYEPAIARLGKMFKVLEEQN 130

Query: 123 QILSKAENSHVYFQ--------------------------LKTRDSHKHTNQEPVNDNEL 156
           QILSKAEN  +YF+                          +K  ++   T Q+  N N +
Sbjct: 131 QILSKAENDPIYFKSDYTPYQPTLIIPTNNDNDGKRNKKLMKKENTIFSTRQQRSNSNRI 190

Query: 157 --QGTLKNNEASQSESHGYAFEKYHEILKDLNGPNKRISVEDLITKIYRDLNNYSECLIP 214
             + +  N+ ++ + +       Y+ I + LN  N RISV+DLI +IY+DLNNYSECLIP
Sbjct: 191 LEENSNSNSNSNSNSNGNENDNNYNTIEQYLNN-NSRISVQDLIMRIYQDLNNYSECLIP 249

Query: 215 IDSGNAVDIKX-XXXXXXXXXXXXXEDVPMPTVNLAKLIDVNWDPTMLKIVPYINGTNSI 273
           ID GN VDIK               EDVPM  V+L K+ DVNWDPTMLK++P+ING N I
Sbjct: 250 IDDGNNVDIKIFPLLKPPPANSLSIEDVPMSLVDLTKITDVNWDPTMLKLIPFINGINDI 309

Query: 274 AKVAKLSDSDCNLVVECIRHLLYYNCVILADIFQFQNIYAPTSELSRFLTNPALATECQI 333
           +K++KLS+S   LV+ECI+HL+YYNCVI+ DIFQF N Y+ TS +S FLT+P +AT CQ 
Sbjct: 310 SKISKLSNSSPMLVIECIKHLIYYNCVIITDIFQFSNTYSTTSLISTFLTDPNMATLCQN 369

Query: 334 YVTLDESTHISDLPFERKPSRTTYNNIPVRNSSSTLDVQRKGREMSIKESSFTAGI-DQS 392
           YV L   + ++ LPF          +I    S  +    R       K  SF + I   +
Sbjct: 370 YVVLPLGSKLTRLPF----------HIETETSVQSSSAYRHHHNRHEKTPSFGSSITSNN 419

Query: 393 GRNQYTPQSHTSSIQCHNVSDASLGNSEGGFNNKVFFTSKSCLFDMYRSLSQGQTVKEWY 452
           GR+ ++        Q     ++S   S     +     +K  LF++YRSL+Q   +K WY
Sbjct: 420 GRSSFSADDRK---QSETSLNSSNDPSNSNLISTAHLPTKMSLFELYRSLNQRTDLKNWY 476

Query: 453 KTHFEKIRAARIDVRRFITFGVIHGLLYRCYSFPIM 488
           K ++  I    ID+R+FI FG+I GL+YRC+S+PI+
Sbjct: 477 KLNYTTIIENNIDIRKFIKFGIIKGLIYRCHSYPIV 512

 Score = 46.2 bits (108), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 27/37 (72%)

Query: 653 SVRDVENFDKICTRLGRDREEVEKMLEDLGPYNVVHC 689
           S+ +++N DKIC +LGR R ++E+ L + G Y V++C
Sbjct: 630 SISNMDNMDKICVKLGRPRSQIEEWLSEFGDYKVINC 666

>KAFR0L00380 Chr12 complement(69525..71147) [1623 bp, 540 aa] {ON}
           Anc_6.17 YEL062W
          Length = 540

 Score =  405 bits (1042), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 255/692 (36%), Positives = 362/692 (52%), Gaps = 157/692 (22%)

Query: 1   MSGHFDGFVPVHCILYTIFHPTEGTKVRHQFPPGCLEASDITFDTIKNYVIPKPQLCNKL 60
           M+  F+GF P+H I ++IFHPTEG+KV +QFPP  L+A +I FD+IKN+VIPKPQLC++L
Sbjct: 1   MNTQFEGFEPIHTIFFSIFHPTEGSKVCYQFPPENLQAYNINFDSIKNFVIPKPQLCHRL 60

Query: 61  LTFKYGSFRLVCYPVNVIAPYYARNSFSFDFVFVFPYDCATSPYESAIARLGKMFTVLEE 120
           LT +Y ++RLV YPVNV +  YARN FSF+FVF+F YDC T PYE AI RLGKMF  LEE
Sbjct: 61  LTLEYKNYRLVSYPVNVSSSSYARNFFSFNFVFIFSYDCQTLPYEPAIERLGKMFKTLEE 120

Query: 121 QSQILSKAENSHVYFQLKTRDSHKHTNQEPVNDNELQGTLKNNEASQSESHGYAFEKYHE 180
           QSQILSK++ +  +F+                D E                         
Sbjct: 121 QSQILSKSQRTSAFFK----------------DGE------------------------- 139

Query: 181 ILKDLNGPNKRISVEDLITKIYRDLNNYSECLIPIDSGNAVDIKXXXXXXX-XXXXXXXE 239
              D++  + + S++DL+ ++Y+DLNNYSECLIPID GN ++IK               E
Sbjct: 140 ---DVDFVDTKFSIQDLLMRLYQDLNNYSECLIPIDEGNEINIKIFPVLKPPTSVQISIE 196

Query: 240 DVPMPTVNLAKLIDVNWDPTMLKIVPYINGTNSIAKVAKLSDSDCNLVVECIRHLLYYNC 299
           DVP+  VNL K++D+NWDPTML I+P+I+G NSI  ++ LSDSD NLV+ECI+HL+YYNC
Sbjct: 197 DVPLSIVNLDKIVDLNWDPTMLSILPFIDGVNSITNISHLSDSDPNLVIECIKHLIYYNC 256

Query: 300 VILADIFQFQNIYAPTSELSRFLTNPALATECQIYVTLDESTHISDLPFERKPSRTTYNN 359
           VI+ DIFQF NIYAP+S ++ FL +P +A  CQ YV L   + I+DLP            
Sbjct: 257 VIITDIFQFSNIYAPSSLINNFLRDPMIAFNCQSYVVLPPGSKINDLPL----------- 305

Query: 360 IPVRNSSSTLDVQRKGREMSIKESSFTAGIDQSGRNQYTPQSHTSSIQCHNVSDASLGNS 419
                 +S  D +    +M+ K  S +     S  +  +  +  S    H+ S ++L +S
Sbjct: 306 ------ASEQDDEINNSDMTQKALSSSRSSFSSYFSHKSAYARVSETAHHHQSTSTLSSS 359

Query: 420 EGGFNNK---VFFTSKSCLFDMYRSLSQGQTVKEWYKTHFEKIRAARIDVRRFITFGVIH 476
           EG  +N        SK  LFD+YRSL+ G TV+ WYK +F  I+   IDVR+FI FGVI+
Sbjct: 360 EGQQDNPRQGQVLPSKCTLFDLYRSLNYGCTVEAWYKQNFSTIKENHIDVRKFIKFGVIN 419

Query: 477 GLLYRCYSFPIMKNVGYLEVVKALGLSDGDSSTEGKWLSGNSEPTNNVLSAAEIRIGLEX 536
            ++YR + +PIM++  +    K+  LSD  +                VLS ++I+     
Sbjct: 420 KIIYRVHQYPIMEHKTF----KSPLLSDRQNDKI-------------VLSTSDIKF---- 458

Query: 537 XXXKLRERRFNHFSNADTAEDILNDVYRKLALNENKVEQSSQSGNPMMRMFGNCSDDSSG 596
                           D  + ILN +Y KL+                             
Sbjct: 459 ----------------DVGDRILNSIYNKLS----------------------------- 473

Query: 597 ETSVKDVVSTAGSDTRNTVAFDVRRLVNSATAEDRKKGEVMXXXXXXXXXXXXXXXSVRD 656
                             V FD  + + S     R  GE                 ++  
Sbjct: 474 -----------------KVTFDRDKKLESKIGNSRNLGE---------SEKNILFNALER 507

Query: 657 VENFDKICTRLGRDREEVEKMLEDLGPYNVVH 688
            E+FD+IC++LG+ + EVE ++ ++G Y  ++
Sbjct: 508 HESFDRICSKLGKSKNEVESIISEIGEYMTIN 539

>Suva_5.5 Chr5 (10147..12006) [1860 bp, 619 aa] {ON} YEL062W (REAL)
          Length = 619

 Score =  400 bits (1027), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 199/358 (55%), Positives = 259/358 (72%), Gaps = 8/358 (2%)

Query: 1   MSGHFDGFVPVHCILYTIFHPTEGTKVRHQFPPGCLEASDITFDTIKNYVIPKPQLCNKL 60
           M  +F GFVP+H I Y++FHPTEG+K++++FPP  L++  I F+TIKNY+IPKP LC+KL
Sbjct: 1   MQSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKSHGINFNTIKNYIIPKPILCHKL 60

Query: 61  LTFKYGSFRLVCYPVNVIAPYYARNSFSFDFVFVFPYDCATSPYESAIARLGKMFTVLEE 120
           +TFKYG++R+VCYPV + +P YARN FSF+FVFVFPYDC TSPYE AI RLGKMF VLEE
Sbjct: 61  ITFKYGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEPAITRLGKMFKVLEE 120

Query: 121 QSQILSKAENSHVYFQLKTRDSH---KHTNQEPVNDNELQGTLKNNEASQSE-----SHG 172
           Q+Q+LSK+E   V+F LK  ++      T   P   N    T   +  S  +     S+ 
Sbjct: 121 QNQLLSKSERDPVFFDLKAIENSLLTPSTAGPPATSNPSSNTTPTHPTSDKDAKDLRSNR 180

Query: 173 YAFEKYHEILKDLNGPNKRISVEDLITKIYRDLNNYSECLIPIDSGNAVDIKXXXXXXXX 232
           +  EKY++I+KDL  P    S++DL+ +I++DLNNYSECLIPID GNAVDIK        
Sbjct: 181 FNGEKYNDIIKDLGLPESTFSIQDLLMRIFQDLNNYSECLIPIDDGNAVDIKIFPLLRPP 240

Query: 233 XXXXXXEDVPMPTVNLAKLIDVNWDPTMLKIVPYINGTNSIAKVAKLSDSDCNLVVECIR 292
                 EDVP+ +VNL K+IDVNWDPTM+ IVPYI+G NSIAK++K S SD +LV+ECIR
Sbjct: 241 TTCVSLEDVPLSSVNLKKIIDVNWDPTMMGIVPYIDGLNSIAKISKFSHSDPSLVIECIR 300

Query: 293 HLLYYNCVILADIFQFQNIYAPTSELSRFLTNPALATECQIYVTLDESTHISDLPFER 350
           HL+YY CV L+DIFQF NIYAP+S +  FLT+P +AT+CQ YVT  E + +S+LP  +
Sbjct: 301 HLIYYKCVTLSDIFQFSNIYAPSSLIRNFLTDPLMATDCQSYVTFPEISKLSNLPLNK 358

 Score =  112 bits (281), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 74/261 (28%), Positives = 119/261 (45%), Gaps = 78/261 (29%)

Query: 428 FFTSKSCLFDMYRSLSQGQTVKEWYKTHFEKIRAARIDVRRFITFGVIHGLLYRCYSFPI 487
           F  ++SCLFD+YRSLSQGQT+K WY+  F  ++   ID+RRFITFG+   ++YRCYSFP+
Sbjct: 436 FLPTRSCLFDLYRSLSQGQTLKSWYELKFTTLKENNIDIRRFITFGLERSIIYRCYSFPV 495

Query: 488 MKNVGYLEVVKALGLSDGDSSTEGKWLSGNSEPTNNVLSAAEIRIGLEXXXXKLRERRFN 547
           M +VG  +  +   ++  + S E                              L++R +N
Sbjct: 496 MIHVGSRDTKEMTPVATKEPSNEDN---------------------------SLKKRDYN 528

Query: 548 HFSNADTAEDILNDVYRKLALNENKVEQSSQSGNPMMRMFGNCSDDSSGETSVKDVVSTA 607
           H                 L++  +K                     S+ +T+VK      
Sbjct: 529 H----------------SLSVTGSK---------------------STTQTNVK------ 545

Query: 608 GSDTRNTVAFDVRRLVNSATAEDRKKGEVMXXXXXXXXXXXXXXXSVRDVENFDKICTRL 667
            S+  + V+F+++R  + AT +++                     S+R  ENFDKIC  L
Sbjct: 546 -SERPSKVSFEMQRANSLATGKNK-------IPKLSDEEKKILEKSIRSAENFDKICVLL 597

Query: 668 GRDREEVEKMLEDLGPYNVVH 688
           G+ ++EVE  L +LG + V++
Sbjct: 598 GKSKQEVENYLSELGEFKVIN 618

>Suva_16.118 Chr16 (198983..200827) [1845 bp, 614 aa] {ON} YPL189W
           (REAL)
          Length = 614

 Score = 36.2 bits (82), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 25/32 (78%)

Query: 585 RMFGNCSDDSSGETSVKDVVSTAGSDTRNTVA 616
           ++F + S + +G +S+K++VSTAG+ TRN V+
Sbjct: 32  KLFVSSSKNETGSSSIKNIVSTAGATTRNPVS 63

>NDAI0B00860 Chr2 complement(196238..197905) [1668 bp, 555 aa] {ON}
           Anc_5.50
          Length = 555

 Score = 35.4 bits (80), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 45/103 (43%), Gaps = 15/103 (14%)

Query: 16  YTIFHPTEGTKVRHQFPPGCLEASDITFDTI-------KNYVIPKPQLCNKLLTFKYGSF 68
           Y IF P     ++   PP  +    + F  I       KNY    PQL   ++    G+F
Sbjct: 161 YVIFDPIGTNLLKIMGPPTMMSLCLLCFGVISLCTAWVKNY----PQLI--VVRLLLGAF 214

Query: 69  RLVCYP-VNV-IAPYYARNSFSFDFVFVFPYDCATSPYESAIA 109
             + YP +N+ ++  Y R  ++  F F+F   C +S +   IA
Sbjct: 215 EGMIYPAINMYLSVCYRREQYALRFAFIFAAACLSSSFGGLIA 257

>KNAG0K00360 Chr11 complement(58785..60377) [1593 bp, 530 aa] {ON}
           Anc_5.50 YGR260W
          Length = 530

 Score = 35.0 bits (79), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 26/103 (25%), Positives = 46/103 (44%), Gaps = 15/103 (14%)

Query: 16  YTIFHPTEGTKVRHQFPPGCLEASDITFDTI-------KNYVIPKPQLCNKLLTFKYGSF 68
           Y +F P     ++   PP  +    ++F  I       KNY    PQL   ++    G+F
Sbjct: 136 YILFDPIGANLLKIMGPPMMMSLCLLSFGAISLCTAWVKNY----PQLL--VVRLLLGAF 189

Query: 69  RLVCYP-VNV-IAPYYARNSFSFDFVFVFPYDCATSPYESAIA 109
             + YP +N+ ++  Y R  ++  F F+F   C +S +   I+
Sbjct: 190 EGMIYPAINMYLSVLYRREQYAMRFAFIFSAACLSSSFGGLIS 232

>Smik_16.47 Chr16 complement(83384..84988) [1605 bp, 534 aa] {ON}
           YGR260W (REAL)
          Length = 534

 Score = 35.0 bits (79), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 47/110 (42%), Gaps = 15/110 (13%)

Query: 9   VPVHCILYTIFHPTEGTKVRHQFPP-------GCLEASDITFDTIKNYVIPKPQLCNKLL 61
           V V    Y +F P     ++   PP        C  A  +    +KNY    PQL   ++
Sbjct: 133 VTVFFATYVLFDPIGTNLLKIMGPPLMMSICLTCFGAISLGTAWVKNY----PQLI--VV 186

Query: 62  TFKYGSFRLVCYP-VNV-IAPYYARNSFSFDFVFVFPYDCATSPYESAIA 109
               G+F  + YP +N+ ++  Y R  ++  F FVF   C +S +   IA
Sbjct: 187 RLLLGAFEGMIYPAINMYLSVCYRREQYALRFAFVFSAACLSSSFGGLIA 236

>Skud_7.593 Chr7 (986994..988598) [1605 bp, 534 aa] {ON} YGR260W
           (REAL)
          Length = 534

 Score = 34.7 bits (78), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 47/110 (42%), Gaps = 15/110 (13%)

Query: 9   VPVHCILYTIFHPTEGTKVRHQFPP-------GCLEASDITFDTIKNYVIPKPQLCNKLL 61
           V V    Y +F P     ++   PP        C  A  +    +KNY    PQL   ++
Sbjct: 133 VTVFFATYVLFDPIGTNLLKVMGPPLMMSICLTCFGAISLGTAWVKNY----PQLI--VV 186

Query: 62  TFKYGSFRLVCYP-VNV-IAPYYARNSFSFDFVFVFPYDCATSPYESAIA 109
               G+F  + YP +N+ ++  Y R  ++  F FVF   C +S +   IA
Sbjct: 187 RLLLGAFEGMIYPAINMYLSVCYRREQYALRFAFVFSAACLSSSFGGLIA 236

>Skud_2.136 Chr2 complement(253644..257150) [3507 bp, 1168 aa] {ON}
           YBR023C (REAL)
          Length = 1168

 Score = 33.5 bits (75), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 43/77 (55%), Gaps = 8/77 (10%)

Query: 125 LSKAENSHVYFQLKTRDSHKHTNQEP----VNDNELQ--GTLKNNEASQSESHGYAFEKY 178
           L+  +N H Y+  KT++   H +  P    VN N  +  G+L++  + +S++ G   + Y
Sbjct: 49  LNNPDNPHFYYAQKTQEQMSHLDVLPSSTGVNPNATRRSGSLRSKRSVRSKASGRETDGY 108

Query: 179 HEILKDLNGPNKRISVE 195
             +L+D+N  +K+ SV+
Sbjct: 109 --LLQDMNTTDKKDSVK 123

>AAR091W Chr1 (508403..511201) [2799 bp, 932 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR100W (MDR1)
          Length = 932

 Score = 32.3 bits (72), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 37/70 (52%), Gaps = 6/70 (8%)

Query: 569 NENKVEQSSQSGNPMMRMFGNCSDDSSGETSVKDVVSTAGSDTRNTVAFDVRRLVNS--A 626
           +E  +    Q  + + R+F N    SSGE S+ DV+S  G D    V+ D+   +N+  +
Sbjct: 585 SEENLSYQKQKESFLRRLFNNWDITSSGELSLGDVIS--GVD--KLVSNDLMETMNNFFS 640

Query: 627 TAEDRKKGEV 636
             ED KKGEV
Sbjct: 641 LYEDSKKGEV 650

>YBR023C Chr2 complement(284428..287925) [3498 bp, 1165 aa] {ON}
           CHS3Chitin synthase III, catalyzes the transfer of
           N-acetylglucosamine (GlcNAc) to chitin; required for
           synthesis of the majority of cell wall chitin, the
           chitin ring during bud emergence, and spore wall
           chitosan
          Length = 1165

 Score = 32.3 bits (72), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 42/77 (54%), Gaps = 8/77 (10%)

Query: 125 LSKAENSHVYFQLKTRDSHKHTNQEP----VNDNELQ--GTLKNNEASQSESHGYAFEKY 178
           L+  +N H Y+  KT++   H +  P    VN N  +  G+L++  + +S+  G   + Y
Sbjct: 49  LNNPDNPHFYYAQKTQEQMNHLDVLPSSTGVNPNATRRSGSLRSKGSVRSKFSGRETDSY 108

Query: 179 HEILKDLNGPNKRISVE 195
             +L+D+N  +K+ SV+
Sbjct: 109 --LLQDMNTTDKKASVK 123

>NCAS0J01430 Chr10 complement(253260..254519) [1260 bp, 419 aa] {ON}
           Anc_4.243
          Length = 419

 Score = 31.6 bits (70), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 21/31 (67%)

Query: 604 VSTAGSDTRNTVAFDVRRLVNSATAEDRKKG 634
           VS+ GS++RNTV    RR+++  T +  KKG
Sbjct: 354 VSSQGSESRNTVTAADRRMISGVTEKQYKKG 384

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 72,012,256
Number of extensions: 3103661
Number of successful extensions: 10485
Number of sequences better than 10.0: 49
Number of HSP's gapped: 10853
Number of HSP's successfully gapped: 61
Length of query: 689
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 572
Effective length of database: 40,065,477
Effective search space: 22917452844
Effective search space used: 22917452844
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)