Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_56.224036.16ON94394346570.0
KLTH0C11330g6.16ON94194337540.0
SAKL0E01078g6.16ON94895826090.0
Ecym_30206.16ON94494424010.0
ACR010C6.16ON94593123950.0
KLLA0D01045g6.16ON96594923680.0
TDEL0G045306.16ON95892822710.0
TPHA0M002406.16ON93985118470.0
KNAG0M011306.16ON95078416380.0
ZYRO0C07898g6.16ON97465514670.0
YEL061C (CIN8)6.16ON100067014350.0
Skud_5.286.16ON99867014200.0
Smik_5.266.16ON100261314161e-180
NDAI0D008706.16ON106966914081e-178
Suva_5.66.16ON99967013651e-172
Kpol_1032.66.16ON100454813511e-170
NCAS0H008806.16ON100462113431e-169
KAFR0L003706.16ON96362513121e-165
CAGL0B03641g6.16ON98865312811e-160
Kpol_1045.736.16ON96291412581e-157
TBLA0A072306.16ON109762612341e-152
SAKL0F12298g7.387ON11124609591e-112
ACR228C7.387ON11295059581e-112
ZYRO0B03234g7.387ON11385789391e-109
TPHA0J003006.16ON9829889301e-109
Ecym_46887.387ON11345119381e-109
Suva_2.547.387ON11104599281e-108
KAFR0L017107.387ON11515639271e-107
TDEL0C016007.387ON11054519171e-106
Skud_2.417.387ON11104579131e-106
YBL063W (KIP1)7.387ON11115839021e-104
Smik_2.537.387ON11136308941e-103
NDAI0E043007.387ON11864488971e-103
NCAS0E026407.387ON11024508881e-102
TPHA0E008907.387ON12326428642e-98
TBLA0D006407.387ON11424447522e-83
Ecym_34152.633ON6624124816e-50
SAKL0G18920g2.633ON6493604505e-46
ADR145C2.633ON6353564488e-46
Ecym_40665.531ON4784154185e-43
KLTH0G01606g3.528ON8195494147e-41
Kpol_1004.255.531ON5063753992e-40
Kpol_1013.78.678ON6203544016e-40
SAKL0F01760g3.528ON8093523942e-38
TBLA0C053103.479ON6763473851e-37
KLLA0D05951g8.678ON6683503752e-36
TPHA0D012708.678ON6963963743e-36
SAKL0G05016g5.531ON5043223631e-35
TDEL0A062408.678ON6374173662e-35
KLLA0A01606g3.528ON7693543692e-35
KLTH0D11286g8.678ON6783633601e-34
CAGL0M02189g8.678ON6723713583e-34
Kpol_1050.1033.479ON6973693557e-34
Kwal_26.88068.678ON7153543549e-34
ZYRO0F07414g8.678ON6543613502e-33
YPL155C (KIP2)8.678ON7063793503e-33
SAKL0H06490g8.678ON6574353484e-33
NDAI0E02090singletonON6854093469e-33
Skud_16.1278.678ON7063753461e-32
KLTH0G03850g5.531ON4731723362e-32
Smik_6.3528.678ON7153843361e-31
KLLA0B00759g5.531ON4562653254e-31
TPHA0D041903.479ON6723473201e-29
Kwal_47.186085.531ON4791743132e-29
Suva_16.1558.678ON7043803122e-28
Kwal_47.190933.528ON8193603042e-27
KAFR0F042103.528ON6721733013e-27
NCAS0E005503.528ON7841753014e-27
ZYRO0E08668g3.528ON7781753005e-27
CAGL0I07029g3.528ON7051752961e-26
Smik_7.483.528ON8051752962e-26
Skud_7.533.528ON8051752962e-26
KNAG0B005203.528ON7233282942e-26
Suva_7.443.528ON8051752952e-26
YGL216W (KIP3)3.528ON8051752943e-26
Kpol_423.83.528ON8062552943e-26
ZYRO0D12650g5.531ON4782002865e-26
NDAI0I029603.528ON8681782925e-26
TDEL0D059603.528ON7331742916e-26
TBLA0C049603.528ON8011782908e-26
TBLA0C018808.678ON4683382831e-25
TPHA0D034803.528ON8471762881e-25
AER441C3.528ON8181942882e-25
Kpol_1019.112.633ON6475162843e-25
KNAG0A078803.479ON7641552844e-25
CAGL0D04994g3.479ON6921582826e-25
Ecym_12003.528ON8332142837e-25
KAFR0B065903.479ON7061592818e-25
TBLA0C039403.479ON7391762782e-24
KLTH0F14498g3.479ON7021672711e-23
Kpol_505.393.479ON6921592692e-23
SAKL0F03168g3.479ON7061672683e-23
NCAS0C013508.678ON6551792665e-23
NCAS0F034703.479ON6981502612e-22
TDEL0F036403.479ON7041522612e-22
Suva_16.4693.479ON7311472612e-22
TPHA0D032003.479ON7241492585e-22
KLLA0B10956g3.479ON6901472568e-22
ZYRO0B04290g3.479ON7311492561e-21
KAFR0H024108.678ON6584122541e-21
NDAI0B057703.479ON7631552542e-21
Skud_16.4353.479ON7291462523e-21
Smik_16.3883.479ON7291462513e-21
YPR141C (KAR3)3.479ON7291462504e-21
Ecym_44073.479ON7111692488e-21
AGR253W3.479ON7091732433e-20
ACR145W8.678ON6852722326e-19
TPHA0N016502.633ON6823812229e-18
Ecym_23958.678ON6871812229e-18
KNAG0J017208.678ON6251802201e-17
TDEL0B072702.633ON6442032051e-15
Kwal_55.21164singletonOFF5881671843e-13
Kwal_YGOB_55.211643.479ON6571671843e-13
Suva_11.1452.633ON6571291782e-12
YKL079W (SMY1)2.633ON6561141772e-12
Smik_11.1602.633ON6561301683e-11
Skud_11.1482.633ON6561141532e-09
CAGL0L05104g2.633ON6753931461e-08
KNAG0M025402.633ON5221091451e-08
TBLA0C008002.633ON6932441442e-08
NCAS0H031802.633ON6601091253e-06
ZYRO0E01078g2.633ON6681181235e-06
NDAI0C004802.633ON5981711219e-06
TBLA0A008202.633ON8031661221e-05
KAFR0C040202.633ON6671061148e-05
KNAG0H003602.633ON6811291030.001
NCAS0C052002.633ON5721021010.002
NCAS0C028308.401ON874131890.074
TBLA0A074701.25ON558155743.7
KLLA0C15851g3.398ON75192727.8
KAFR0G020608.609ON498107709.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_56.22403
         (943 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_56.22403 s56 (112080..114911) [2832 bp, 943 aa] {ON} YEL061...  1798   0.0  
KLTH0C11330g Chr3 complement(931865..934690) [2826 bp, 941 aa] {...  1450   0.0  
SAKL0E01078g Chr5 (80541..83387) [2847 bp, 948 aa] {ON} similar ...  1009   0.0  
Ecym_3020 Chr3 (37549..40383) [2835 bp, 944 aa] {ON} similar to ...   929   0.0  
ACR010C Chr3 complement(374085..376922) [2838 bp, 945 aa] {ON} S...   927   0.0  
KLLA0D01045g Chr4 (91110..94007) [2898 bp, 965 aa] {ON} similar ...   916   0.0  
TDEL0G04530 Chr7 complement(824970..827846) [2877 bp, 958 aa] {O...   879   0.0  
TPHA0M00240 Chr13 (47407..50226) [2820 bp, 939 aa] {ON} Anc_6.16...   716   0.0  
KNAG0M01130 Chr13 (201705..204557) [2853 bp, 950 aa] {ON} Anc_6....   635   0.0  
ZYRO0C07898g Chr3 complement(600676..603600) [2925 bp, 974 aa] {...   569   0.0  
YEL061C Chr5 complement(36535..39537) [3003 bp, 1000 aa] {ON}  C...   557   0.0  
Skud_5.28 Chr5 complement(35653..38649) [2997 bp, 998 aa] {ON} Y...   551   0.0  
Smik_5.26 Chr5 complement(38891..41899) [3009 bp, 1002 aa] {ON} ...   550   e-180
NDAI0D00870 Chr4 complement(195749..198958) [3210 bp, 1069 aa] {...   546   e-178
Suva_5.6 Chr5 complement(12298..15297) [3000 bp, 999 aa] {ON} YE...   530   e-172
Kpol_1032.6 s1032 (9109..12123) [3015 bp, 1004 aa] {ON} (9109..1...   525   e-170
NCAS0H00880 Chr8 complement(160883..163897) [3015 bp, 1004 aa] {...   521   e-169
KAFR0L00370 Chr12 (66535..69426) [2892 bp, 963 aa] {ON} Anc_6.16...   509   e-165
CAGL0B03641g Chr2 (363897..366863) [2967 bp, 988 aa] {ON} simila...   498   e-160
Kpol_1045.73 s1045 complement(169347..172235) [2889 bp, 962 aa] ...   489   e-157
TBLA0A07230 Chr1 (1803117..1806410) [3294 bp, 1097 aa] {ON} Anc_...   479   e-152
SAKL0F12298g Chr6 complement(958588..961926) [3339 bp, 1112 aa] ...   374   e-112
ACR228C Chr3 complement(758111..761500) [3390 bp, 1129 aa] {ON} ...   373   e-112
ZYRO0B03234g Chr2 complement(263393..266809) [3417 bp, 1138 aa] ...   366   e-109
TPHA0J00300 Chr10 (65794..68742) [2949 bp, 982 aa] {ON} Anc_6.16...   362   e-109
Ecym_4688 Chr4 (1342239..1345643) [3405 bp, 1134 aa] {ON} simila...   365   e-109
Suva_2.54 Chr2 (99000..102332) [3333 bp, 1110 aa] {ON} YBL063W (...   362   e-108
KAFR0L01710 Chr12 complement(308820..312275) [3456 bp, 1151 aa] ...   361   e-107
TDEL0C01600 Chr3 (276912..280229) [3318 bp, 1105 aa] {ON} Anc_7....   357   e-106
Skud_2.41 Chr2 (85542..88874) [3333 bp, 1110 aa] {ON} YBL063W (R...   356   e-106
YBL063W Chr2 (101886..105221) [3336 bp, 1111 aa] {ON}  KIP1Kines...   352   e-104
Smik_2.53 Chr2 (95765..99106) [3342 bp, 1113 aa] {ON} YBL063W (R...   348   e-103
NDAI0E04300 Chr5 complement(965403..968963) [3561 bp, 1186 aa] {...   350   e-103
NCAS0E02640 Chr5 (527838..531146) [3309 bp, 1102 aa] {ON} Anc_7....   346   e-102
TPHA0E00890 Chr5 (181328..185026) [3699 bp, 1232 aa] {ON} Anc_7....   337   2e-98
TBLA0D00640 Chr4 (168893..172321) [3429 bp, 1142 aa] {ON} Anc_7....   294   2e-83
Ecym_3415 Chr3 (782976..784964) [1989 bp, 662 aa] {ON} similar t...   189   6e-50
SAKL0G18920g Chr7 complement(1634668..1636617) [1950 bp, 649 aa]...   177   5e-46
ADR145C Chr4 complement(959805..961712) [1908 bp, 635 aa] {ON} S...   177   8e-46
Ecym_4066 Chr4 (146761..148197) [1437 bp, 478 aa] {ON} similar t...   165   5e-43
KLTH0G01606g Chr7 (116364..118823) [2460 bp, 819 aa] {ON} simila...   164   7e-41
Kpol_1004.25 s1004 (54983..56503) [1521 bp, 506 aa] {ON} (54983....   158   2e-40
Kpol_1013.7 s1013 (11880..13742) [1863 bp, 620 aa] {ON} (11880.....   159   6e-40
SAKL0F01760g Chr6 (146659..149088) [2430 bp, 809 aa] {ON} simila...   156   2e-38
TBLA0C05310 Chr3 (1286959..1288989) [2031 bp, 676 aa] {ON} Anc_3...   152   1e-37
KLLA0D05951g Chr4 (509713..511719) [2007 bp, 668 aa] {ON} simila...   149   2e-36
TPHA0D01270 Chr4 (264339..266429) [2091 bp, 696 aa] {ON} Anc_8.6...   148   3e-36
SAKL0G05016g Chr7 (415990..417504) [1515 bp, 504 aa] {ON} weakly...   144   1e-35
TDEL0A06240 Chr1 (1092814..1094727) [1914 bp, 637 aa] {ON} Anc_8...   145   2e-35
KLLA0A01606g Chr1 (139355..141664) [2310 bp, 769 aa] {ON} simila...   146   2e-35
KLTH0D11286g Chr4 (922942..924978) [2037 bp, 678 aa] {ON} simila...   143   1e-34
CAGL0M02189g Chr13 complement(261290..263308) [2019 bp, 672 aa] ...   142   3e-34
Kpol_1050.103 s1050 complement(235625..237718) [2094 bp, 697 aa]...   141   7e-34
Kwal_26.8806 s26 (950736..952883) [2148 bp, 715 aa] {ON} YPL155C...   140   9e-34
ZYRO0F07414g Chr6 (600148..602112) [1965 bp, 654 aa] {ON} simila...   139   2e-33
YPL155C Chr16 complement(257216..259336) [2121 bp, 706 aa] {ON} ...   139   3e-33
SAKL0H06490g Chr8 complement(571300..573273) [1974 bp, 657 aa] {...   138   4e-33
NDAI0E02090 Chr5 complement(423630..425687) [2058 bp, 685 aa] {O...   137   9e-33
Skud_16.127 Chr16 complement(228817..230937) [2121 bp, 706 aa] {...   137   1e-32
KLTH0G03850g Chr7 (308053..309474) [1422 bp, 473 aa] {ON} some s...   134   2e-32
Smik_6.352 Chr6 (564913..567060) [2148 bp, 715 aa] {ON} YPL155C ...   134   1e-31
KLLA0B00759g Chr2 (59965..61335) [1371 bp, 456 aa] {ON} some sim...   129   4e-31
TPHA0D04190 Chr4 complement(899419..901437) [2019 bp, 672 aa] {O...   127   1e-29
Kwal_47.18608 s47 complement(896394..897833) [1440 bp, 479 aa] {...   125   2e-29
Suva_16.155 Chr16 complement(266334..268448) [2115 bp, 704 aa] {...   124   2e-28
Kwal_47.19093 s47 complement(1092732..1095191) [2460 bp, 819 aa]...   121   2e-27
KAFR0F04210 Chr6 complement(826173..828191) [2019 bp, 672 aa] {O...   120   3e-27
NCAS0E00550 Chr5 complement(93778..96132) [2355 bp, 784 aa] {ON}...   120   4e-27
ZYRO0E08668g Chr5 complement(694586..696922) [2337 bp, 778 aa] {...   120   5e-27
CAGL0I07029g Chr9 (675486..677603) [2118 bp, 705 aa] {ON} simila...   118   1e-26
Smik_7.48 Chr7 (79575..81992) [2418 bp, 805 aa] {ON} YGL216W (REAL)   118   2e-26
Skud_7.53 Chr7 (90098..92515) [2418 bp, 805 aa] {ON} YGL216W (REAL)   118   2e-26
KNAG0B00520 Chr2 (85045..87216) [2172 bp, 723 aa] {ON} Anc_3.528...   117   2e-26
Suva_7.44 Chr7 (79883..82300) [2418 bp, 805 aa] {ON} YGL216W (REAL)   118   2e-26
YGL216W Chr7 (84885..87302) [2418 bp, 805 aa] {ON}  KIP3Kinesin-...   117   3e-26
Kpol_423.8 s423 (11134..13554) [2421 bp, 806 aa] {ON} (11134..13...   117   3e-26
ZYRO0D12650g Chr4 (1071620..1073056) [1437 bp, 478 aa] {ON} some...   114   5e-26
NDAI0I02960 Chr9 complement(699469..702075) [2607 bp, 868 aa] {O...   117   5e-26
TDEL0D05960 Chr4 complement(1079683..1081884) [2202 bp, 733 aa] ...   116   6e-26
TBLA0C04960 Chr3 complement(1210067..1212472) [2406 bp, 801 aa] ...   116   8e-26
TBLA0C01880 Chr3 (441985..443391) [1407 bp, 468 aa] {ON} Anc_8.6...   113   1e-25
TPHA0D03480 Chr4 complement(731687..734230) [2544 bp, 847 aa] {O...   115   1e-25
AER441C Chr5 complement(1480055..1482511) [2457 bp, 818 aa] {ON}...   115   2e-25
Kpol_1019.11 s1019 complement(20458..22401) [1944 bp, 647 aa] {O...   114   3e-25
KNAG0A07880 Chr1 complement(1254698..1256992) [2295 bp, 764 aa] ...   114   4e-25
CAGL0D04994g Chr4 complement(482176..484254) [2079 bp, 692 aa] {...   113   6e-25
Ecym_1200 Chr1 (402658..405159) [2502 bp, 833 aa] {ON} similar t...   113   7e-25
KAFR0B06590 Chr2 complement(1368106..1370226) [2121 bp, 706 aa] ...   112   8e-25
TBLA0C03940 Chr3 complement(946819..949038) [2220 bp, 739 aa] {O...   111   2e-24
KLTH0F14498g Chr6 complement(1188459..1190567) [2109 bp, 702 aa]...   108   1e-23
Kpol_505.39 s505 complement(87351..89429) [2079 bp, 692 aa] {ON}...   108   2e-23
SAKL0F03168g Chr6 (261405..263525) [2121 bp, 706 aa] {ON} simila...   107   3e-23
NCAS0C01350 Chr3 complement(246839..248806) [1968 bp, 655 aa] {O...   107   5e-23
NCAS0F03470 Chr6 complement(695163..697259) [2097 bp, 698 aa] {O...   105   2e-22
TDEL0F03640 Chr6 complement(666365..668479) [2115 bp, 704 aa] {O...   105   2e-22
Suva_16.469 Chr16 complement(811946..814141) [2196 bp, 731 aa] {...   105   2e-22
TPHA0D03200 Chr4 complement(659182..661356) [2175 bp, 724 aa] {O...   103   5e-22
KLLA0B10956g Chr2 (958985..961057) [2073 bp, 690 aa] {ON} simila...   103   8e-22
ZYRO0B04290g Chr2 (353283..355478) [2196 bp, 731 aa] {ON} simila...   103   1e-21
KAFR0H02410 Chr8 complement(460353..462329) [1977 bp, 658 aa] {O...   102   1e-21
NDAI0B05770 Chr2 complement(1400232..1402523) [2292 bp, 763 aa] ...   102   2e-21
Skud_16.435 Chr16 complement(769308..771497) [2190 bp, 729 aa] {...   101   3e-21
Smik_16.388 Chr16 complement(687227..689416) [2190 bp, 729 aa] {...   101   3e-21
YPR141C Chr16 complement(815734..817923) [2190 bp, 729 aa] {ON} ...   100   4e-21
Ecym_4407 Chr4 (846516..848651) [2136 bp, 711 aa] {ON} similar t...   100   8e-21
AGR253W Chr7 (1218744..1220873) [2130 bp, 709 aa] {ON} Syntenic ...    98   3e-20
ACR145W Chr3 (605114..607171) [2058 bp, 685 aa] {ON} Syntenic ho...    94   6e-19
TPHA0N01650 Chr14 complement(356519..358567) [2049 bp, 682 aa] {...    90   9e-18
Ecym_2395 Chr2 complement(766148..768211) [2064 bp, 687 aa] {ON}...    90   9e-18
KNAG0J01720 Chr10 (314395..316272) [1878 bp, 625 aa] {ON} Anc_8....    89   1e-17
TDEL0B07270 Chr2 complement(1280163..1282097) [1935 bp, 644 aa] ...    84   1e-15
Kwal_55.21164 s55 complement(713274..715037) [1764 bp, 588 aa] {...    75   3e-13
Kwal_YGOB_55.21164 s55 complement(713063..713220,713222..715037)...    75   3e-13
Suva_11.145 Chr11 (272862..274835) [1974 bp, 657 aa] {ON} YKL079...    73   2e-12
YKL079W Chr11 (286603..288573) [1971 bp, 656 aa] {ON}  SMY1Prote...    73   2e-12
Smik_11.160 Chr11 (272801..274771) [1971 bp, 656 aa] {ON} YKL079...    69   3e-11
Skud_11.148 Chr11 (271990..273960) [1971 bp, 656 aa] {ON} YKL079...    64   2e-09
CAGL0L05104g Chr12 complement(577023..579050) [2028 bp, 675 aa] ...    61   1e-08
KNAG0M02540 Chr13 (471930..473498) [1569 bp, 522 aa] {ON} Anc_2....    60   1e-08
TBLA0C00800 Chr3 complement(165244..167325) [2082 bp, 693 aa] {O...    60   2e-08
NCAS0H03180 Chr8 (611693..613675) [1983 bp, 660 aa] {ON} Anc_2.633     53   3e-06
ZYRO0E01078g Chr5 (73042..75048) [2007 bp, 668 aa] {ON} similar ...    52   5e-06
NDAI0C00480 Chr3 complement(84502..86298) [1797 bp, 598 aa] {ON}...    51   9e-06
TBLA0A00820 Chr1 (178283..180694) [2412 bp, 803 aa] {ON} Anc_2.6...    52   1e-05
KAFR0C04020 Chr3 (802379..804382) [2004 bp, 667 aa] {ON} Anc_2.6...    49   8e-05
KNAG0H00360 Chr8 (51965..54010) [2046 bp, 681 aa] {ON} Anc_2.633...    44   0.001
NCAS0C05200 Chr3 (1059068..1060786) [1719 bp, 572 aa] {ON} Anc_2...    44   0.002
NCAS0C02830 Chr3 (534302..536926) [2625 bp, 874 aa] {ON} Anc_8.401     39   0.074
TBLA0A07470 Chr1 (1850075..1851751) [1677 bp, 558 aa] {ON} Anc_1...    33   3.7  
KLLA0C15851g Chr3 complement(1378324..1380579) [2256 bp, 751 aa]...    32   7.8  
KAFR0G02060 Chr7 (433290..434786) [1497 bp, 498 aa] {ON} Anc_8.6...    32   9.8  

>Kwal_56.22403 s56 (112080..114911) [2832 bp, 943 aa] {ON} YEL061C
           (CIN8) - 1:1 [contig 185] FULL
          Length = 943

 Score = 1798 bits (4657), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 882/943 (93%), Positives = 882/943 (93%)

Query: 1   MSDDEELNITVAVRCRGRNEKEVKARSSVVVAVPDVTGTNEVSINTTGDTGITAQINSKT 60
           MSDDEELNITVAVRCRGRNEKEVKARSSVVVAVPDVTGTNEVSINTTGDTGITAQINSKT
Sbjct: 1   MSDDEELNITVAVRCRGRNEKEVKARSSVVVAVPDVTGTNEVSINTTGDTGITAQINSKT 60

Query: 61  YTVDKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 120
           YTVDKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE
Sbjct: 61  YTVDKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 120

Query: 121 LSEGAGIIPRVLFKLFDALSAQGDDYMIKCSFIELYNEELKDLLDETPDSSMPKKLRIFD 180
           LSEGAGIIPRVLFKLFDALSAQGDDYMIKCSFIELYNEELKDLLDETPDSSMPKKLRIFD
Sbjct: 121 LSEGAGIIPRVLFKLFDALSAQGDDYMIKCSFIELYNEELKDLLDETPDSSMPKKLRIFD 180

Query: 181 XXXXXXXXXXXXXXXXXPKPNEGSSFGTRRKTRAPSIHRXXXXXXXXXXXXXXXXXAIHI 240
                            PKPNEGSSFGTRRKTRAPSIHR                 AIHI
Sbjct: 181 SVSNVSSNSRASSRNNSPKPNEGSSFGTRRKTRAPSIHRPTKSPVSKPVSPCEPSSAIHI 240

Query: 241 QNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYKKCNGESFRVSK 300
           QNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYKKCNGESFRVSK
Sbjct: 241 QNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYKKCNGESFRVSK 300

Query: 301 MNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSLHIPFRESKLTRLL 360
           MNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSLHIPFRESKLTRLL
Sbjct: 301 MNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSLHIPFRESKLTRLL 360

Query: 361 QDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGSFIMKDVLLKSVTA 420
           QDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGSFIMKDVLLKSVTA
Sbjct: 361 QDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGSFIMKDVLLKSVTA 420

Query: 421 ELVKIKSDLLSTKSKDGIYMSQENYKELTNELENYKTEVEECKRAMEKVSAQNSLLIKEK 480
           ELVKIKSDLLSTKSKDGIYMSQENYKELTNELENYKTEVEECKRAMEKVSAQNSLLIKEK
Sbjct: 421 ELVKIKSDLLSTKSKDGIYMSQENYKELTNELENYKTEVEECKRAMEKVSAQNSLLIKEK 480

Query: 481 RVSNEVNESQKVKLRKLGNNIEFLYDKIDRQHKNEQELSNVVQELMRALHTMQQSLRIYE 540
           RVSNEVNESQKVKLRKLGNNIEFLYDKIDRQHKNEQELSNVVQELMRALHTMQQSLRIYE
Sbjct: 481 RVSNEVNESQKVKLRKLGNNIEFLYDKIDRQHKNEQELSNVVQELMRALHTMQQSLRIYE 540

Query: 541 DQGQRFHTEMERVLYDNIGSFKKSLMDEIEKLKIXXXXXXXXXXXXXXAVTTELTRIFDF 600
           DQGQRFHTEMERVLYDNIGSFKKSLMDEIEKLKI              AVTTELTRIFDF
Sbjct: 541 DQGQRFHTEMERVLYDNIGSFKKSLMDEIEKLKINVDENGDDVEVNVDAVTTELTRIFDF 600

Query: 601 MNSSNIEVFRNYIKKVNDQTPAYFKDIYSQXXXXXXXXXXXXXNLMIHLSSISEEYNNLK 660
           MNSSNIEVFRNYIKKVNDQTPAYFKDIYSQ             NLMIHLSSISEEYNNLK
Sbjct: 601 MNSSNIEVFRNYIKKVNDQTPAYFKDIYSQVESITSVVSSYSSNLMIHLSSISEEYNNLK 660

Query: 661 DYLNEHFFKNNFQEALDVHVDRTYHQLKVSANSIFLKLREMLNEELDTNKEFMMQSLRHA 720
           DYLNEHFFKNNFQEALDVHVDRTYHQLKVSANSIFLKLREMLNEELDTNKEFMMQSLRHA
Sbjct: 661 DYLNEHFFKNNFQEALDVHVDRTYHQLKVSANSIFLKLREMLNEELDTNKEFMMQSLRHA 720

Query: 721 ASEVVAKEMCLLDPVKQAWENSLENINECDKLNNVFENKIGVTVNEIFKTIDQGQKTSQV 780
           ASEVVAKEMCLLDPVKQAWENSLENINECDKLNNVFENKIGVTVNEIFKTIDQGQKTSQV
Sbjct: 721 ASEVVAKEMCLLDPVKQAWENSLENINECDKLNNVFENKIGVTVNEIFKTIDQGQKTSQV 780

Query: 781 TTEDAKSELTRVRAAFSSLQNNGIILQNVDSIKKKHNLLKSQVQDSANYMQAATQKFGEI 840
           TTEDAKSELTRVRAAFSSLQNNGIILQNVDSIKKKHNLLKSQVQDSANYMQAATQKFGEI
Sbjct: 781 TTEDAKSELTRVRAAFSSLQNNGIILQNVDSIKKKHNLLKSQVQDSANYMQAATQKFGEI 840

Query: 841 DNSIQDLLNAQTIPQPQSENPIDGLLEQLNDKSLKPLGPSGKTPMRTVQRSVTNTDQLLP 900
           DNSIQDLLNAQTIPQPQSENPIDGLLEQLNDKSLKPLGPSGKTPMRTVQRSVTNTDQLLP
Sbjct: 841 DNSIQDLLNAQTIPQPQSENPIDGLLEQLNDKSLKPLGPSGKTPMRTVQRSVTNTDQLLP 900

Query: 901 PQKSSYTISPIKEIDGNRRLTSPHKRGVVSDHERPAFKSQRIE 943
           PQKSSYTISPIKEIDGNRRLTSPHKRGVVSDHERPAFKSQRIE
Sbjct: 901 PQKSSYTISPIKEIDGNRRLTSPHKRGVVSDHERPAFKSQRIE 943

>KLTH0C11330g Chr3 complement(931865..934690) [2826 bp, 941 aa] {ON}
           similar to uniprot|P27895 Saccharomyces cerevisiae
           YEL061C CIN8 Kinesin motor protein involved in mitotic
           spindle assembly and chromosome segregation
          Length = 941

 Score = 1450 bits (3754), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 710/943 (75%), Positives = 800/943 (84%), Gaps = 2/943 (0%)

Query: 1   MSDDEELNITVAVRCRGRNEKEVKARSSVVVAVPDVTGTNEVSINTTGDTGITAQINSKT 60
           MS++EELNITVAVRCRGRNEKEVKA+SSVVVAVPDVTGTNEVSINTTGDTGITAQINSKT
Sbjct: 1   MSEEEELNITVAVRCRGRNEKEVKAKSSVVVAVPDVTGTNEVSINTTGDTGITAQINSKT 60

Query: 61  YTVDKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 120
           YTVD+VFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE
Sbjct: 61  YTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 120

Query: 121 LSEGAGIIPRVLFKLFDALSAQGDDYMIKCSFIELYNEELKDLLDETPDSSMPKKLRIFD 180
           LSEGAGIIPRVLFKLFDAL A  DDYMIKCSFIELYNEELKDLLDETPDSSMP+KLRIFD
Sbjct: 121 LSEGAGIIPRVLFKLFDALDAHNDDYMIKCSFIELYNEELKDLLDETPDSSMPRKLRIFD 180

Query: 181 XXXXXXXXXXXXXXXXXPKPNEGSSFGTRRKTRAPSIHRXXXXXXXXXXXXXXXXXAIHI 240
                             KP EGS+ GT+R+ R  ++++                 AIHI
Sbjct: 181 SVTNPNSSRSSSRNSSP-KPPEGSTSGTKRRIRPNTMYKPSRSPTVKPTLSSELNSAIHI 239

Query: 241 QNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYKKCNGESFRVSK 300
           QNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLY+KCNGESFRVSK
Sbjct: 240 QNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYRKCNGESFRVSK 299

Query: 301 MNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSLHIPFRESKLTRLL 360
           MNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADK+ HIPFRESKLTRLL
Sbjct: 300 MNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPFRESKLTRLL 359

Query: 361 QDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGSFIMKDVLLKSVTA 420
           QDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGSFIMKDVL+K+VTA
Sbjct: 360 QDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGSFIMKDVLVKNVTA 419

Query: 421 ELVKIKSDLLSTKSKDGIYMSQENYKELTNELENYKTEVEECKRAMEKVSAQNSLLIKEK 480
           ELVKI+SDLL+TKSKDGIYMSQENYKELTNELENYKTEV+ECKRA+E++S QN LL KEK
Sbjct: 420 ELVKIRSDLLATKSKDGIYMSQENYKELTNELENYKTEVQECKRAIERLSTQNGLLTKEK 479

Query: 481 RVSNEVNESQKVKLRKLGNNIEFLYDKIDRQHKNEQELSNVVQELMRALHTMQQSLRIYE 540
           R++NEVNESQ++K++KL NNI+FLYDKIDRQHKNEQELSNVVQELMRAL TMQ SL++YE
Sbjct: 480 RITNEVNESQRLKIKKLSNNIDFLYDKIDRQHKNEQELSNVVQELMRALRTMQNSLKVYE 539

Query: 541 DQGQRFHTEMERVLYDNIGSFKKSLMDEIEKLKIXXXXXXXXXXXXXXAVTTELTRIFDF 600
           DQG RF TEMERVLY+NIGSFK SL++EIEKLK                +T EL RI+DF
Sbjct: 540 DQGHRFQTEMERVLYENIGSFKHSLLNEIEKLK-GTEEDGFDVDANIDTLTKELNRIYDF 598

Query: 601 MNSSNIEVFRNYIKKVNDQTPAYFKDIYSQXXXXXXXXXXXXXNLMIHLSSISEEYNNLK 660
           +N+S IE+ R ++ K+ +QTP Y +DI +Q             +LM+HLSSISEEYN+LK
Sbjct: 599 INTSTIEICRKFMNKITEQTPTYLQDIRNQVESITHVVGSYSSDLMMHLSSISEEYNHLK 658

Query: 661 DYLNEHFFKNNFQEALDVHVDRTYHQLKVSANSIFLKLREMLNEELDTNKEFMMQSLRHA 720
           DYLNEHFFKNNFQ+ALDVHVDRTYHQLKVSANSIFLKLREM+NEEL+TNKE MMQSL++A
Sbjct: 659 DYLNEHFFKNNFQDALDVHVDRTYHQLKVSANSIFLKLREMMNEELETNKEIMMQSLKNA 718

Query: 721 ASEVVAKEMCLLDPVKQAWENSLENINECDKLNNVFENKIGVTVNEIFKTIDQGQKTSQV 780
           ASEVVAKEM LLDPVKQAWE+SLENINECDKLN+ FE  IG  V ++F+ I++G + S+ 
Sbjct: 719 ASEVVAKEMGLLDPVKQAWESSLENINECDKLNSGFEKDIGSVVRDVFEKINEGLQFSES 778

Query: 781 TTEDAKSELTRVRAAFSSLQNNGIILQNVDSIKKKHNLLKSQVQDSANYMQAATQKFGEI 840
              DA  +L+R + A  +L+ + +I  +++ IKKKHN+LK +VQDSA+YM+AATQKFGEI
Sbjct: 779 AVGDANLDLSRFQDASRALRTDDVIPGSIEEIKKKHNMLKLKVQDSASYMEAATQKFGEI 838

Query: 841 DNSIQDLLNAQTIPQPQSENPIDGLLEQLNDKSLKPLGPSGKTPMRTVQRSVTNTDQLLP 900
           D+SIQ LLN+Q + QP SEN I+GLLEQLN K LKPLGPSGKTPMR  Q  + ++DQL  
Sbjct: 839 DDSIQGLLNSQAVSQPHSENRIEGLLEQLNGKPLKPLGPSGKTPMRITQGCIASSDQLSL 898

Query: 901 PQKSSYTISPIKEIDGNRRLTSPHKRGVVSDHERPAFKSQRIE 943
           P+K SY+ISPI+EIDGNR+ +SP KR +  DHE   F SQ+IE
Sbjct: 899 PRKRSYSISPIREIDGNRKASSPFKRKITIDHENVPFSSQKIE 941

>SAKL0E01078g Chr5 (80541..83387) [2847 bp, 948 aa] {ON} similar to
           uniprot|P27895 Saccharomyces cerevisiae YEL061C CIN8
           Kinesin motor protein involved in mitotic spindle
           assembly and chromosome segregation
          Length = 948

 Score = 1009 bits (2609), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 527/958 (55%), Positives = 676/958 (70%), Gaps = 43/958 (4%)

Query: 5   EELNITVAVRCRGRNEKEVKARSSVVVAVPDVTGTNEVSINTTGDTGITAQINSKTYTVD 64
           +ELNITV+VRCRGRNE+E+KA+SSVVV VPDVTG+NEVSINTT + GITAQ+NSKTYTVD
Sbjct: 15  QELNITVSVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDELGITAQMNSKTYTVD 74

Query: 65  KVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSEG 124
           KVFGPSADQ LIFK IAEPLF DFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELS+ 
Sbjct: 75  KVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSDA 134

Query: 125 AGIIPRVLFKLFDALSAQGDDYMIKCSFIELYNEELKDLLDETPDSSMPKKLRIFDXXXX 184
           AGIIPR+LFKLFD L  Q +DY++KCSFIELYNEELKDLL+E  +S + KKLRIFD    
Sbjct: 135 AGIIPRILFKLFDTLETQDEDYLVKCSFIELYNEELKDLLNEPQESGVIKKLRIFDSNTT 194

Query: 185 XXXXXXXXXXXXXPKPNEGSSFGT-RRKTRAPSIHRXXXXXXX---------------XX 228
                          PN   + GT +R  + P  ++                        
Sbjct: 195 SSNSRNNSRNN---SPNLVGTSGTFKRIFKTPVPYKQQQQHQQHLQQQQQQQPRLINNKQ 251

Query: 229 XXXXXXXXAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLY 288
                   AI+IQNLQEFHI +AK+GI LLQRGL+HRQVASTKMND SSRSHTIFTIMLY
Sbjct: 252 QSLSEQSSAIYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIFTIMLY 311

Query: 289 KKCNGESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSLH 348
           K  NGE FRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADK+ H
Sbjct: 312 KNHNGEVFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAH 371

Query: 349 IPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGSF 408
           IPFRESKLTRLLQDSLGGNTKTALIATISPAKIN+EETSSTLEYATKAKNIKNKPQ+G+ 
Sbjct: 372 IPFRESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKAKNIKNKPQLGTL 431

Query: 409 IMKDVLLKSVTAELVKIKSDLLSTKSKDGIYMSQENYKELTNELENYKTEVEECKRAMEK 468
           +MKD+L+K++T EL KIKSD LSTKSKDGIYM+Q++YKELT++LENYKTEV+ECKR +EK
Sbjct: 432 VMKDILVKNITRELAKIKSDFLSTKSKDGIYMTQDHYKELTSDLENYKTEVQECKREIEK 491

Query: 469 VSAQNSLLIKEKRVSNEVNESQKVKLRKLGNNIEFLYDKIDRQHKNEQELSNVVQELMRA 528
           +++QN LL+K+KR S+EV+E Q++K++ L + I  LYDK+D+QHKNEQ+L   +  L  A
Sbjct: 492 MNSQNVLLLKDKRASHEVSELQRIKIKHLNDKIAHLYDKMDKQHKNEQDLVCTIHTLKDA 551

Query: 529 LHTMQQSLRIYEDQGQRFHTEMERVLYDNIGSFKKSLMDEIEKLKIXXXXXXXXXXXXXX 588
           ++T+Q SL+  ED   +  +EME VLYD++ SFK+S+ +++  +K               
Sbjct: 552 IYTVQNSLKNCEDYQLQCKSEMEDVLYDHVTSFKQSIHEQLAAMKASHSSRHLGIDGNID 611

Query: 589 AVTTELTRIFDFMNSSNIEVFRNYIKKVNDQTPAYFKDIYSQXXXXXXXXXXXXXNLMIH 648
            +  EL+++ + + S++++V R+ ++K+ +  P +F+ I                 L+ +
Sbjct: 612 IIQEELSQVLESICSTSVDVCRSCVEKILESNPKHFESIRRDLLDISTVVDSYSNELVKN 671

Query: 649 LSSISEEYNNLKDYLNEHFFKNNFQEALDVHVDRTYHQLKVSANSIFLKLREMLNEELDT 708
           L  ISEEYNN ++YLNEH FKNN +E L +HVD+TYH LK SA  +F K +EM++  L+ 
Sbjct: 672 LGDISEEYNNFREYLNEHLFKNNHEETLSIHVDKTYHMLKKSAGELFSKFKEMMDSHLEE 731

Query: 709 NKEFMMQSLRHAASEVVAKEMCLLDPVKQAWENSLENINECDKLNNVFENKIGVTVNEIF 768
           NK  M++SL+ A+ EVVAKE+ L  PVKQ WE+SLENIN+CD LNN F++ +   +  + 
Sbjct: 732 NKSLMIKSLKTASDEVVAKEVKLFAPVKQKWESSLENINKCDSLNNTFDSTVKDALRRLE 791

Query: 769 KTIDQGQKTSQVTTEDAKSELTRVRAAFSSLQNNGIILQNVDSIKKKHNLLKSQVQDSAN 828
             I+   + S+ T  D K  L +       L+NN  ++ N++ +K+KH  L+ QV+ +++
Sbjct: 792 GNIEGSLEFSKNTAGDVKDSLKKFDGISEVLKNNTKVVNNINEVKEKHTFLRDQVERTSS 851

Query: 829 YMQAATQKFGEIDNSIQDLLNAQTIPQPQSENP--IDGLLEQLNDKSLKPLGPSGKTPMR 886
           Y++AA +KF  ID  I+ +++ + +P     N   ++ +LEQL    LKP+G + +TP  
Sbjct: 852 YIEAANEKFEGIDQFIRQIIDKK-LPTHLVGNGELVNVMLEQLGKTHLKPIGSASRTP-- 908

Query: 887 TVQRSVTNTDQLLPPQKSSYTISPIKEIDGN-RRLTSPHKRGVVSDHERPAFKSQRIE 943
                            SS ++SP+K +D N     SP KR  V + E    KSQRI+
Sbjct: 909 -----------------SSRSVSPMKTLDNNIFNGISPSKRK-VDETENDRSKSQRIK 948

>Ecym_3020 Chr3 (37549..40383) [2835 bp, 944 aa] {ON} similar to
           Ashbya gossypii ACR010C
          Length = 944

 Score =  929 bits (2401), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 485/944 (51%), Positives = 641/944 (67%), Gaps = 21/944 (2%)

Query: 1   MSDD--EELNITVAVRCRGRNEKEVKARSSVVVAVPDVTGTNEVSINTTGDTGITAQINS 58
           M DD  EELNITVAVRCRGRNE+E+KA+S+VVV VPDVTG+NEVSINTTGD GI  ++NS
Sbjct: 13  MLDDGNEELNITVAVRCRGRNEREIKAKSAVVVTVPDVTGSNEVSINTTGDIGIAGKMNS 72

Query: 59  KTYTVDKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYD 118
           +TYTVD+VFGPSADQ LIFK IAEPLF DFIKGYNCTVLVYGMTSTGKTYTMTGDE+LYD
Sbjct: 73  RTYTVDQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYD 132

Query: 119 GELSEGAGIIPRVLFKLFDALSAQGDDYMIKCSFIELYNEELKDLLDETPDSSMPKKLRI 178
           GELS+ AGIIPRVLF+LFD L A   D+++KCS+IELYNEELKDLLD+TPD S  K+LRI
Sbjct: 133 GELSDSAGIIPRVLFRLFDTLEATESDHLVKCSYIELYNEELKDLLDDTPDYS--KRLRI 190

Query: 179 FDXXXXXXXXXXXXXXXXXPKPNEG--SSFGTRRKTRAPSIHRXXXXXXXXXXXXXXXXX 236
           FD                 PK  +G  SS   RR T  P+                    
Sbjct: 191 FDSNTITNSRAGSQNNS--PKEQDGTSSSMAKRRYTHIPT---KPKRPSLNKQLLYEQSS 245

Query: 237 AIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYKKCNGESF 296
           AI+IQNLQEFHI +A+EGI +LQ+GL+HRQVASTKMND SSRSHTIFTIMLYK   GE F
Sbjct: 246 AIYIQNLQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKSYEGELF 305

Query: 297 RVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSLHIPFRESKL 356
           R+SKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKS+HIPFRESKL
Sbjct: 306 RISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSIHIPFRESKL 365

Query: 357 TRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGSFIMKDVLLK 416
           TRLLQDSLGGNTKTALIATISPAKIN++ETSSTLEYATKAKNIKN+PQ+GSF+MKD+L+K
Sbjct: 366 TRLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNIKNRPQLGSFMMKDILVK 425

Query: 417 SVTAELVKIKSDLLSTKSKDGIYMSQENYKELTNELENYKTEVEECKRAMEKVSAQNSLL 476
           S+++EL K+KSD LSTK+K+GIYMS E+Y+E+ N+LENY+TE++E KR +E  S+QNSLL
Sbjct: 426 SISSELSKLKSDFLSTKAKEGIYMSHEHYQEMVNDLENYQTEIQESKRQVESFSSQNSLL 485

Query: 477 IKEKRVSNEVNESQKVKLRKLGNNIEFLYDKIDRQHKNEQELSNVVQELMRALHTMQQSL 536
           +K+K+ S ++NE Q +K+ +L N IE+L DKI+RQH+NE +L + + +L  ALHTM+ SL
Sbjct: 486 LKDKKASQQLNELQDMKITRLQNTIEYLCDKIERQHRNEIDLVSTIHKLKEALHTMKGSL 545

Query: 537 RIYEDQGQRFHTEMERVLYDNIGSFKKSLMDEIEKLKIXXXXXXXXXXXXXXAVTTELTR 596
           + YE    R   +++ VLY  I S+++S+   +E +K                + T    
Sbjct: 546 QNYETHELRLQNDIKEVLYQGITSYRESMDQHLETVKTRMLDKNLSINHNMDEIRTIFHE 605

Query: 597 IFDFMNSSNIEVFRNYIKKVNDQTPAYFKDIYSQXXXXXXXXXXXXXNLMIHLSSISEEY 656
             D + S+  ++  N +K V DQ    ++                   L   L+ ++EE 
Sbjct: 606 TLDSVRSAGSDMCTNIVKIVKDQPSTSYQQFKEALGDLDTKVQTYSVTLTNKLTEMTEEN 665

Query: 657 NNLKDYLNEHFFKNNFQEALDVHVDRTYHQLKVSANSIFLKLREMLNEELDTNKEFMMQS 716
           NN+K+YL+EHF KNN QE LD+ +++ YH+ K +++++   +  M+   ++ ++  M+ S
Sbjct: 666 NNMKEYLDEHFLKNNNQEMLDLRMEKAYHKSKTASDALISSVVSMMESHMEESRNLMLSS 725

Query: 717 LRHAASEVVAKEMCLLDPVKQAWENSLENINECDKLNNVFENKIGVTVNEIFKTIDQGQK 776
           ++ A SE++ KE+ +  PVK+ W  S ENINECD  +  FENK    +  + +  D    
Sbjct: 726 MKDAVSEMIDKELEMFQPVKERWVLSFENINECDAAHQQFENKSTKLLTNLKELADNSVV 785

Query: 777 TSQVTTEDAKSELTRVRAAFSSLQNNGIILQNVDSIKKKHNLLKSQVQDSANYMQAATQK 836
            +    +  +  +T              I++ ++ I  KH +L+   +++  Y + +++ 
Sbjct: 786 AADDVAKQVQENVTNFEGIVRQASAKESIVKQMNDINDKHKMLEDHFENNIKYFKESSKG 845

Query: 837 FGEIDNSIQDLLNAQTIPQPQSENPIDGLLEQLNDKSLKPLGPSGKTPMRTVQRSVTNTD 896
           F E+D SI+ ++   + P+      I+ LLE++N +S  P+  +GKTPMR   ++     
Sbjct: 846 FEEMDCSIKKIIREMS-PEVGDIKQIEALLERVNSRSFGPIASTGKTPMRPELKNPI--- 901

Query: 897 QLLPPQKSSYTISPIKEIDGNRRLTSPH-KRGVVS-DHERPAFK 938
               P+  S ++SPIK +D N     P  KRG +  + + PA K
Sbjct: 902 ----PKTRSRSMSPIKSLDTNVVHVVPLIKRGTMDIEVDGPAMK 941

>ACR010C Chr3 complement(374085..376922) [2838 bp, 945 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YEL061C
           (CIN8)
          Length = 945

 Score =  927 bits (2395), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 470/931 (50%), Positives = 637/931 (68%), Gaps = 13/931 (1%)

Query: 1   MSDD--EELNITVAVRCRGRNEKEVKARSSVVVAVPDVTGTNEVSINTTGDTGITAQINS 58
           M DD  EELNITVAVRCRGRNE+E+KA+SSVVV VPDVTG+NEVSINTT + GI A++NS
Sbjct: 13  MLDDAQEELNITVAVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDEVGIAAKMNS 72

Query: 59  KTYTVDKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYD 118
           +TYTVDKVFGPSADQ LIFK IAEPLF DF+KGYNCTVLVYGMTSTGKTYTMTGDE+LYD
Sbjct: 73  RTYTVDKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLYD 132

Query: 119 GELSEGAGIIPRVLFKLFDALSAQGDDYMIKCSFIELYNEELKDLLDETPDSSMPKKLRI 178
           G+LS+ AGIIPR++FKLFDAL A   D+++KCS+IELYNEELKDLLDE+ DSS  K+LRI
Sbjct: 133 GQLSDSAGIIPRIMFKLFDALEATDSDFLVKCSYIELYNEELKDLLDESHDSS--KRLRI 190

Query: 179 FDXXXXXXXXXXXXXXXXXPKPNEGSSFGTRRKTRAPSIHRXXXXXXXXXXXXXXXXXAI 238
           FD                  +P    +  +RR+ R P +                    I
Sbjct: 191 FDSSSMNHSSRASSQSNSPREPEVAHNGFSRRRQRPPPV--KANRMSATKQQLSESGSGI 248

Query: 239 HIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYKKCNGESFRV 298
           ++QN+QEFHI++A+EGI +LQ+GL+HRQVASTKMND SSRSHTIFTIMLYK C+GE FRV
Sbjct: 249 YVQNVQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKNCDGELFRV 308

Query: 299 SKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSLHIPFRESKLTR 358
           SKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKS+HIPFRESKLTR
Sbjct: 309 SKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSIHIPFRESKLTR 368

Query: 359 LLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGSFIMKDVLLKSV 418
           LLQDSLGGNTKTALIATISPAKIN++ETSSTLEYA KAKNIKN+PQ+G+ +MKD+L+K++
Sbjct: 369 LLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNIKNRPQLGALMMKDILVKNI 428

Query: 419 TAELVKIKSDLLSTKSKDGIYMSQENYKELTNELENYKTEVEECKRAMEKVSAQNSLLIK 478
           ++EL KIKSD LSTKSKDGIYMS E+Y+E+ N+LEN +TE++E KR +E +++QN+LL+K
Sbjct: 429 SSELAKIKSDFLSTKSKDGIYMSHEHYQEIVNDLENCQTEIQESKRQIESLTSQNNLLLK 488

Query: 479 EKRVSNEVNESQKVKLRKLGNNIEFLYDKIDRQHKNEQELSNVVQELMRALHTMQQSLRI 538
           +K+ S EV E Q  K++KL + IE+LYDKI+RQH NE EL+  + +L  ALHTMQ SL+ 
Sbjct: 489 DKKASQEVTELQNSKIKKLQSTIEYLYDKIERQHHNETELATTIHKLKEALHTMQGSLKS 548

Query: 539 YEDQGQRFHTEMERVLYDNIGSFKKSLMDEIEKLKIXXXXXXXXXXXXXXAVTTELTRIF 598
           YE    R   +++ VLY  I S+++S+   +EK+K+               +TT      
Sbjct: 549 YETHELRLQNDIKEVLYQGITSYRESMNQHLEKVKVSMLDKNLSIKENINNITTIFDDTL 608

Query: 599 DFMNSSNIEVFRNYIKKVNDQTPAYFKDIYSQXXXXXXXXXXXXXNLMIHLSSISEEYNN 658
             + ++  ++    +K + +    Y K+                  L   L+ ISEE N+
Sbjct: 609 KSVEANGSDMCDTLVKLIKETPSMYLKEFNETVSSLKSELSSYSNALTNKLTEISEENNH 668

Query: 659 LKDYLNEHFFKNNFQEALDVHVDRTYHQLKVSANSIFLKLREMLNEELDTNKEFMMQSLR 718
           L++YL++H FKN+ QE LD+ ++  Y ++K  ++ +  KL  M+   ++ ++  M+ S++
Sbjct: 669 LREYLDQHLFKNSTQEVLDLRMESVYQKVKNDSDQLLSKLVSMVGAHVEESRTLMVNSMK 728

Query: 719 HAASEVVAKEMCLLDPVKQAWENSLENINECDKLNNVFENKIGVTVNEIFKTIDQGQKTS 778
              +E++  E  L  P++  W  S +NIN+CD  +  FE K    ++++ +  D   K+S
Sbjct: 729 DTVNEIIDNERSLFQPIRDRWIASCDNINQCDASHQNFEAKSTSGLDKLKELSDASLKSS 788

Query: 779 QVTTEDAKSELTRVRAAFSSLQNNGIILQNVDSIKKKHNLLKSQVQDSANYMQAATQKFG 838
           +     AK            L  +  + + +  I  KH +L+    D+  Y + +++ F 
Sbjct: 789 EDAVNKAKHRTDSFHDFVQKLCCDQSLKKQMHDISDKHRMLEDHFDDNVKYFKESSKGFE 848

Query: 839 EIDNSIQDLLNAQTIPQPQSENPIDGLLEQLNDKSLKPLGPSGKTPMRTVQRSVTNTDQL 898
           ++D SI+ +++  + P+      ++ L+E++N ++  P+ P+GKTP R V ++       
Sbjct: 849 DMDCSIKKIIHEMS-PEVGDIKSVETLMERINARTFSPVRPTGKTPSRQVLKNA------ 901

Query: 899 LPPQKSSYTISPIKEIDGNRRLTSPHKRGVV 929
           +  + SS ++SPIK +D N R+ SP KRG +
Sbjct: 902 ITSKASSRSMSPIKTLDTNVRIISPVKRGTI 932

>KLLA0D01045g Chr4 (91110..94007) [2898 bp, 965 aa] {ON} similar to
           uniprot|Q8J1G7 Ashbya gossypii ACR010C CIN8 Kinesin-like
           protein CIN8 and some similarites with YEL061C
           uniprot|P27895 Saccharomyces cerevisiae YEL061C CIN8
           Kinesin motor protein involved in mitotic spindle
           assembly and chromosome segregation
          Length = 965

 Score =  916 bits (2368), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 479/949 (50%), Positives = 649/949 (68%), Gaps = 36/949 (3%)

Query: 5   EELNITVAVRCRGRNEKEVKARSSVVVAVPDVTGTNEVSINTTGDTGITAQINSKTYTVD 64
           +ELNITVAVRCRGRNEKE+KA+SSVVV  PDV G NEVSINT+GD GITA++NSKTYTVD
Sbjct: 11  DELNITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGITARMNSKTYTVD 70

Query: 65  KVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSEG 124
           KVFGPSADQ L+FK IA+P+F DFIKGYNCT+LVYGMTSTGKTYTMTGDE+LYDGELSE 
Sbjct: 71  KVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGELSEA 130

Query: 125 AGIIPRVLFKLFDALSAQGDDYMIKCSFIELYNEELKDLLDETPDSSM--PKKLRIFDXX 182
           AGIIPRVLFKLFD L  Q  DYM+KCSFIELYNEELKDLLD+  DS     +KLRI+D  
Sbjct: 131 AGIIPRVLFKLFDTLEVQESDYMVKCSFIELYNEELKDLLDDGQDSGGNNSRKLRIYDSL 190

Query: 183 XXXXXXXXXXXXXXXPKPNEGSSFGTRRKTRAPSIHR----------------------- 219
                             +   +   +R+ RA ++++                       
Sbjct: 191 NSSNNVTNVNSRSSSRSNSPTVNLEAKRRIRAGALYKPKPKLPTQSQSNGQQQQQQQQQQ 250

Query: 220 XXXXXXXXXXXXXXXXXAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRS 279
                            AI+IQ+LQEFHI DAKEG+RLLQ+GL HRQVASTKMNDVSSRS
Sbjct: 251 QQQQQQQTQGQVNEQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRS 310

Query: 280 HTIFTIMLYKKCNGESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVI 339
           HTIFT+ LYK  NGE+FRVSK+NLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVI
Sbjct: 311 HTIFTLTLYKNFNGETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVI 370

Query: 340 NSLADKSLHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNI 399
           NSLADK+ HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNI
Sbjct: 371 NSLADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNI 430

Query: 400 KNKPQVGSFIMKDVLLKSVTAELVKIKSDLLSTKSKDGIYMSQENYKELTNELENYKTEV 459
           KNKPQ+GSF+MKD+L+K+++ EL K+KSD LSTKSK+GIYMS  +Y E+ N++ENYKTE+
Sbjct: 431 KNKPQLGSFMMKDILVKNISHELAKLKSDFLSTKSKEGIYMSHLHYNEVMNDIENYKTEI 490

Query: 460 EECKRAMEKVSAQNSLLIKEKRVSNEVNESQKVKLRKLGNNIEFLYDKIDRQHKNEQELS 519
           +E +R +EK+S+QN LL K+K+ S +  ESQ++++R L +++++LY+KID +HKNE EL+
Sbjct: 491 QESRREIEKLSSQNQLLHKDKKSSQDTIESQRLQIRNLQSSMDYLYEKIDLKHKNEIELT 550

Query: 520 NVVQELMRALHTMQQSLRIYEDQGQRFHTEMERVLYDNIGSFKKSLMDEIEKLKIXXXXX 579
           N++ +L  A+  MQ +L+ +ED  QR  ++++++LYDNI  +++ +  +++ LK      
Sbjct: 551 NMIMKLKDAVRNMQGALKTHEDHEQRLQSDIQKMLYDNILEYRRKIETKLDNLKQQALEQ 610

Query: 580 XXXXXXXXXAVTTELTRIFDFMNSSNIEVFRNYIKKVNDQTPAYFKDIYSQXXXXXXXXX 639
                     V   L  + + +    I +  N  +KV    P +F  + S+         
Sbjct: 611 SFTIDDDINNVKDSLETLLETVKKDAIIMCENLAQKVVGDQPKFFNSMLSELNDMFSKVD 670

Query: 640 XXXXNLMIHLSSISEEYNNLKDYLNEHFFKNNFQEALDVHVDRTYHQLKVSANSIFLKLR 699
                L   LS I+ E NNLK YL+ HFF+NN QE L+VH D+TYHQL +S+  +  K+ 
Sbjct: 671 EHTDRLKEGLSQITAENNNLKAYLDTHFFRNNHQEILNVHADKTYHQLNLSSKHLMSKIT 730

Query: 700 EMLNEELDTNKEFMMQSLRHAASEVVAKEMCLLDPVKQAWENSLENINECDKLNNVFENK 759
            ++++ ++ N+  +M +L+ A +EV+ +EM   +PV++ WE S  +IN CD L+N F++ 
Sbjct: 731 NIISDHVEQNRTLLMDTLKTATTEVITQEMSHFEPVRKTWEQSFNHINVCDSLSNKFKDD 790

Query: 760 IGVTVNEIFKTIDQGQKTSQVTTEDAKSELTRV--RAAFSSLQNNGIILQNVDSIKKKHN 817
              ++N +   ++   + S +  +  K  L     R   +++  N  I   VD IK KH+
Sbjct: 791 TTESLNSLKSHMESTVRESSLIADKIKDNLCHFQDRNDIANMTTN--INGTVDDIKNKHS 848

Query: 818 LLKSQVQDSANYMQAATQKFGEIDNSIQDLLNAQTIPQPQSENPIDGLLEQLNDKSLKPL 877
           +L+ +++ + +++ A+++ F  ID+S++ ++N + +P+ ++E   D L++ ++  S+ P+
Sbjct: 849 VLRDELEKNVSFIHASSEGFKAIDSSLKRIMNFR-MPEGKTETLADDLIKHIDSSSVAPV 907

Query: 878 GPSGKTPMRTVQRSVTNTDQL---LPPQKSSYTI---SPIKEIDGNRRL 920
             SGKTP+R + +S T    L   + P KSS+     SP+K    + R+
Sbjct: 908 ASSGKTPLRPLLKSETKQRSLSKSVSPAKSSHATIINSPLKRKSSDSRI 956

>TDEL0G04530 Chr7 complement(824970..827846) [2877 bp, 958 aa] {ON}
           Anc_6.16 YEL061C
          Length = 958

 Score =  879 bits (2271), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 464/928 (50%), Positives = 636/928 (68%), Gaps = 30/928 (3%)

Query: 3   DDEELNITVAVRCRGRNEKEVKARSSVVVAVPDVTGTNEVSINTTGDTGITAQINSKTYT 62
           D EELNITVAVRCRGRNE+E+KA+SSVVV+VPDVTG+NEVSINTTGD GITAQINSKTYT
Sbjct: 11  DVEELNITVAVRCRGRNEREIKAKSSVVVSVPDVTGSNEVSINTTGDVGITAQINSKTYT 70

Query: 63  VDKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELS 122
           VD+VFGPSA+Q L+F+ IAEPLF DFIKGYNCTVLVYGMTSTGKTYTMTGDE+LYDGELS
Sbjct: 71  VDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGELS 130

Query: 123 EGAGIIPRVLFKLFDALSAQGDDYMIKCSFIELYNEELKDLLDETPDSSMPKKLRIFDXX 182
           E AGIIPR+LFKLF+ L  Q +DY++KCSF+ELYNEELKDLL ++ + +  +KLRIFD  
Sbjct: 131 ESAGIIPRILFKLFETLELQKEDYVVKCSFVELYNEELKDLLGDSQEIASSRKLRIFDSN 190

Query: 183 XXXXXXXXXXXXXXXPKPNEG----------SSFGTRRKTRAPSIHRXXXXXXXXXXXXX 232
                                          ++F  +R   APS+               
Sbjct: 191 TMSAATNSMSTGNSTKNSRNNSPRSSSELPTATFLRKRWKTAPSV-------TQSHQNSQ 243

Query: 233 XXXXAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYKKCN 292
                I+IQNLQ+FHI +AKEGI+LLQ+GL+HRQVA+TKMND SSRSHTIFTI LYK+ N
Sbjct: 244 DQNAGIYIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSSRSHTIFTITLYKEYN 303

Query: 293 GESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSLHIPFR 352
           GE FRVSKMNLVDLAGSENISRSGAQ+QRAKEAGSINQSLLTLGRVINSL DKSLH+PFR
Sbjct: 304 GEIFRVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLTDKSLHVPFR 363

Query: 353 ESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGSFIMKD 412
           ESKLTRLLQDSLGGNTKTALIATISPAKINSEET STL+YA KAKNIKNKPQ+GS IMKD
Sbjct: 364 ESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYAAKAKNIKNKPQLGSVIMKD 423

Query: 413 VLLKSVTAELVKIKSDLLSTKSKDGIYMSQENYKELTNELENYKTEVEECKRAMEKVSAQ 472
           +L+K++T EL KIK+DLLSTKSK+GIYMSQ+NYKELTN+LE+YKTEV+ECKRA+E +++Q
Sbjct: 424 ILVKNITGELAKIKADLLSTKSKEGIYMSQDNYKELTNDLESYKTEVKECKRAIETLTSQ 483

Query: 473 NSLLIKEKRVSNEVNESQKVKLRKLGNNIEFLYDKIDRQHKNEQELSNVVQELMRALHTM 532
           N+LL+K+K+ SNEVN+ Q++KL+ + + +  LY K ++Q+K EQ L      L   + TM
Sbjct: 484 NTLLLKDKKASNEVNDLQRIKLQNMRDAMSDLYSKAEKQNKREQNLVATASTLKTTVGTM 543

Query: 533 QQSLRIYEDQGQRFHTEMERVLYDNIGSFKKSLMDEIEKLKIXXXXXXXXXXXXXXAVTT 592
           Q  ++ +E + +   ++M  +  +     K++++  I  ++               ++  
Sbjct: 544 QSIIKEHERRERDIESKMGDLFNNEFARVKQTILSNIRDIEQQIDWENIGVQGNIDSIRG 603

Query: 593 ELTRIFDFMNSSNIEVFRNYIKKVNDQTPAYFKDIYSQXXXXXXXXXXXXXNLMIHLSSI 652
           E++++ +       +++++ ++K+ D+TP +F+    +             +L  +LS +
Sbjct: 604 EISKLLERAQQQTDDMYKDCVEKILDETPGHFQLAAEKVSEVEKLIATCHRDLTENLSDV 663

Query: 653 SEEYNNLKDYLNEHFFKNNFQEALDVHVDRTYHQLKVSANSIFLKLREMLNEELDTNKEF 712
           SEE+NNL+ YLN+HFFKNN +E L  H+DRTYH ++ SA+ +F + +EM++  L+ NK+ 
Sbjct: 664 SEEFNNLRQYLNDHFFKNNHEEILVSHIDRTYHHIQTSADDLFQQFKEMMDNHLEKNKDL 723

Query: 713 MMQSLRHAASEVVAKEMCLLDPVKQAWENSLENINECDKLNNVFENKIGVTVNEIFKTID 772
           M++SL+ A  +V+ KEM L +P K+ WE+S + IN+CD +N  F+N +   +  I  T+ 
Sbjct: 724 MLESLKTATYDVIRKEMQLFEPQKKKWEDSFKYINKCDSINFAFQNGVKSPLLGIKSTLG 783

Query: 773 QGQKTSQVTTEDAKSELTRVRAAFSSLQNNGIILQNVDSIKKKHNLLKSQVQDS----AN 828
             Q+    T    K ++    +  S L N+ +  +    I  K +LL   ++ S    ++
Sbjct: 784 SSQEAINKTITKVKEQMDEHESPASMLSNSRVFSEQFSGILNKQSLLHESLKKSVIITSD 843

Query: 829 YMQAATQKFGEIDNSIQDLLNAQTIPQPQSENPIDGLLEQLNDKSLKPLGPSGKTPMRTV 888
           +  A  +    ID+ + +     ++   + E+ +DG+L ++++++L  L    ++P+R  
Sbjct: 844 HADAVDKLKEAIDHVVSE--RGSSMEGERVEH-VDGILRRMDEQNLLYL---DRSPLRPA 897

Query: 889 QRSVTNTDQLLPPQKS---SYTISPIKE 913
              +  +++  P + S   S + SP K+
Sbjct: 898 NFKMNKSERNSPNRSSPCKSVSHSPCKQ 925

>TPHA0M00240 Chr13 (47407..50226) [2820 bp, 939 aa] {ON} Anc_6.16
           YEL061C
          Length = 939

 Score =  716 bits (1847), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/851 (46%), Positives = 549/851 (64%), Gaps = 24/851 (2%)

Query: 3   DDEELNITVAVRCRGRNEKEVKARSSVVVAVPDVTGTNEVSINTTGD--TGITAQINSKT 60
           D +E+NI VAVRCRGRN++E+K++SSV+V+VPDV G+NE+SINT+ D  +G+TAQ+NSKT
Sbjct: 11  DTDEMNIMVAVRCRGRNKREIKSKSSVIVSVPDVMGSNEISINTSDDIVSGLTAQLNSKT 70

Query: 61  YTVDKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 120
           YTVDKVFGPSA+Q LIF+ IAEPLF DF++GYNCTVLVYGMTSTGKTYTMTGDE+LY G+
Sbjct: 71  YTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLYKGD 130

Query: 121 LSEGAGIIPRVLFKLFDALSAQGDDYMIKCSFIELYNEELKDLLDETPDSSMPKKLRIFD 180
           LS+ AGIIPRVLFKLF+ +  Q D+Y+IKCSFIELYNEELKDLL ++ ++ + KKLRIFD
Sbjct: 131 LSDSAGIIPRVLFKLFETIEFQSDNYVIKCSFIELYNEELKDLLIDSNNTKL-KKLRIFD 189

Query: 181 XXXXXXXXXXXXXXXXXPKPNEGSSFGTRRKTRAPSIHRXXXXXXXXXXXXXXXXXAIHI 240
                               + G            + +                    HI
Sbjct: 190 SNLSKSSNNNNISRQNSHFIS-GMDLRKNPINPINNSNDNTAIQNGNASIYIQNLEEFHI 248

Query: 241 QNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYKKCNGESFRVSK 300
           +N        A+EGI+LLQ+GL++RQVASTKMNDVSSRSHTIFTI LYK+  GE F++SK
Sbjct: 249 KN--------AREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYKEHKGEIFKISK 300

Query: 301 MNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSLHIPFRESKLTRLL 360
           MNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINS+ADK++HIPFRESKLTRLL
Sbjct: 301 MNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIADKNIHIPFRESKLTRLL 360

Query: 361 QDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGSFIMKDVLLKSVTA 420
           QDSLGGNTKTALIATISPAK+N+EET STLEYATKAK+IKNKPQ+GS IMKDV LK +  
Sbjct: 361 QDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIKNKPQLGSIIMKDVRLKDLNN 420

Query: 421 ELVKIKSDLLSTKSKDGIYMSQENYKELTNELENYKTEVEECKRAMEKVSAQNSLLIKEK 480
           EL KIK DL STK KDG+YM+Q +YK+LTN+LE+YKTE++EC R ++ +  QN+LL+K+K
Sbjct: 421 ELAKIKRDLTSTKQKDGVYMTQNHYKDLTNDLESYKTEIQECDRIVKSLELQNALLLKDK 480

Query: 481 RVSNEVNESQKVKLRKLGNNIEFLYDKIDRQHKNEQELSNVVQELMRALHTMQQSLRI-- 538
           + SNEVN+ Q++ L ++ N +  +   ++ QHK EQ L   V+EL    H+ ++SL++  
Sbjct: 481 KASNEVNKLQELNLNEMTNTLSNIQTTLEIQHKKEQIL---VEELA---HSREKSLKMKT 534

Query: 539 ----YEDQGQRFHTEMERVLYDNIGSFKKSLMDEIEKLKIXXXXXXXXXXXXXXAVTTEL 594
               Y ++ +R  + M+ +  D +   K+ L++ +  +                 +  ++
Sbjct: 535 VIKEYSEKEERIQSNMKSIFNDELIKLKELLIENLNGIAKENLIVQTNVKDNIKLIKDDV 594

Query: 595 TRIFDFMNSSNIEVFRNYIKKVNDQTPAYFKDIYSQXXXXXXXXXXXXXNLMIHLSSISE 654
             I       + ++F  + +++  +TP   +   S              NL  +L SI +
Sbjct: 595 ISIVTESQELSKKLFLEFSQQIIKETPLILEMFSSDVKKNQELNETYFANLFENLESIKQ 654

Query: 655 EYNNLKDYLNEHFFKNNFQEALDVHVDRTYHQLKVSANSIFLKLREMLNEELDTNKEFMM 714
           +Y+ L +Y +  FFK+N    ++ HV+ T   ++ S + IF + ++ +    + N++ ++
Sbjct: 655 QYSKLNEYFSNDFFKSNHVTIVNDHVNTTKAIIEKSVSDIFKQFQQNMEAFAEQNEKLIL 714

Query: 715 QSLRHAASEVVAKEMCLLDPVKQAWENSLENINECDKLNNVFENKIGVTVNEIFKTIDQG 774
           ++L+  +S+++  EM      K  W+ S + IN CD LNN + +++   +  +   +   
Sbjct: 715 ENLKTVSSDLIQNEMNSFKEHKSEWDISFKKINHCDYLNNSYHDQMHTYLRNMKGKLQSS 774

Query: 775 QKTSQVTTEDAKSELTRVRAAFSSLQNNGIILQNVDSIKKKHNLLKSQVQDSANYMQAAT 834
            +  +      KS +  + +    L  +  I  N + I  K + L   +Q S N  Q + 
Sbjct: 775 DEIIKKHMNQIKSNVDSLNSTPKLLNTDRAIGDNYNQIISKRDKLHDHLQISLNSTQNSL 834

Query: 835 QKFGEIDNSIQ 845
             F EI  SIQ
Sbjct: 835 LVFDEICKSIQ 845

>KNAG0M01130 Chr13 (201705..204557) [2853 bp, 950 aa] {ON} Anc_6.16
           YEL061C
          Length = 950

 Score =  635 bits (1638), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/784 (45%), Positives = 499/784 (63%), Gaps = 21/784 (2%)

Query: 5   EELNITVAVRCRGRNEKEVKARSSVVVAVPDVTGTNEVSINTTGDTGITAQINSKTYTVD 64
           +++NITVAVRCRGRN++E++A+S +VV VPDVT T EVSINT+G +GI AQ+ +KTYTVD
Sbjct: 23  DDINITVAVRCRGRNKREIEAKSPIVVTVPDVTTTPEVSINTSGGSGIEAQLQAKTYTVD 82

Query: 65  KVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGD-ERLYDGELSE 123
           KV+GP + Q L+F+  AEPLF DF++GYNCT+LVYGMTSTGKTYTMTGD E   +G+++ 
Sbjct: 83  KVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGAEGDVNG 142

Query: 124 GAGIIPRVLFKLFDALSAQGDDYMIKCSFIELYNEELKDLLDETPD---------SSMP- 173
            AGI PR+L KLF+ L    DDY++KCSF+ELYNE+L+DLL E  D         S  P 
Sbjct: 143 QAGIAPRILVKLFECLQ---DDYVVKCSFVELYNEDLRDLLSEGQDDFSNGTENSSKQPE 199

Query: 174 -----KKLRIFDXXXXXXXXXXXXXXXXXPKPNEGSSFGTRRKTRAPSIHRXXXXXXXXX 228
                KKLRIFD                  K          +  R  S+           
Sbjct: 200 SLNASKKLRIFDSNNSRSNSPVTNTNNPTHKARSDYLKKKLKSNRKKSLDDMSLNANAGG 259

Query: 229 XXXXX-XXXAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIML 287
                     I+IQNL++FHI  AKEG++LLQRGL+ RQVA+TK+NDVSSRSHTIFTI L
Sbjct: 260 KTHVPPTQTGIYIQNLKDFHISTAKEGLQLLQRGLQRRQVATTKLNDVSSRSHTIFTITL 319

Query: 288 YKKCNGESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSL 347
           YKK   + +R+SK+NLVDLAGSEN++++GA N RAKE+GSINQSLLTLGRVINSLADKS 
Sbjct: 320 YKKFKDDLYRLSKINLVDLAGSENVNKAGALNLRAKESGSINQSLLTLGRVINSLADKSA 379

Query: 348 HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGS 407
           HIPFRESKLTRLLQDSLGGNTKT LIATISPAKI +EET STLEYA+KAKNIKNKPQ+GS
Sbjct: 380 HIPFRESKLTRLLQDSLGGNTKTVLIATISPAKIAAEETCSTLEYASKAKNIKNKPQLGS 439

Query: 408 FIMKDVLLKSVTAELVKIKSDLLSTKSKDGIYMSQENYKELTNELENYKTEVEECKRAME 467
           FI+KD+LLK V+ EL+K+++DL  TKSK+GIY+SQ+NYKE+ ++L+N+KTE+ E KR  +
Sbjct: 440 FIIKDILLKDVSQELIKMRADLWCTKSKEGIYVSQKNYKEMVDDLDNFKTELTELKRTND 499

Query: 468 KVSAQNSLLIKEKRVSNEVNESQKVKLRKLGNNIEFLYDKIDRQHKNEQELSNVVQELMR 527
            +  +N LL KEK+   E  +S K +L  L + ++ + +K+ + +    +LS  V ++ R
Sbjct: 500 SLVQENELLGKEKKSGAERADSLKSELDNLRSQLKSVTNKLAQTNTQNTKLSEQVTDMNR 559

Query: 528 ALHTMQQSLRIYEDQGQRFHTEMERVLYDNIGSFKKSLMDEIEKLKIXXXXXXXXXXXXX 587
               ++  + +Y+ + +    + +R+L D + +    ++ + + LK              
Sbjct: 560 IQTELKSLIEVYQQKHETSKHKFQRLLKDELATLTAKILSQWDTLK-NVNSGNYQIHTHI 618

Query: 588 XAVTTELTRIFDFMNSSNIEVFRNYIKKVNDQTPAYFKDIYSQXXXXXXXXXXXXXNLMI 647
            ++  E+  + +    +   ++++ I  +  +TP  F+ I                 +  
Sbjct: 619 DSIRGEVMNLLETTKENAETLYKSCIDDLLKETPKIFQLISDNVGDIRGMTEEHYTEMAR 678

Query: 648 HLSSISEEYNNLKDYLNEHFFKNNFQEALDVHVDRTYHQLKVSANSIFLKLREMLNEELD 707
           + S +SEE+N  K YL+  FF+NN  E +  H D     ++  ++ +   ++  +   L 
Sbjct: 679 NFSDLSEEFNTFKQYLDGQFFQNNHIEMIQTHQDIVASNMQKMSDDLLQSVQNSIQNYLS 738

Query: 708 TNKEFMMQSLRHAASEVVAKEMCLLDPVKQAWENSLENINECDKLNNVFENKIGVTVNEI 767
           TN + +  S+   A +V+ KEM L  P K  WE S++ IN+ D L+N F N +  +V++I
Sbjct: 739 TNAQMVTNSINDVAMDVINKEMDLFAPKKSKWEESIDLINQSDSLSNKFRNNMTKSVDDI 798

Query: 768 FKTI 771
              I
Sbjct: 799 ASVI 802

>ZYRO0C07898g Chr3 complement(600676..603600) [2925 bp, 974 aa] {ON}
           some similarities with uniprot|P27895 Saccharomyces
           cerevisiae YEL061C CIN8 Kinesin motor protein involved
           in mitotic spindle assembly and chromosome segregation
          Length = 974

 Score =  569 bits (1467), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/655 (46%), Positives = 433/655 (66%), Gaps = 9/655 (1%)

Query: 237 AIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYKKCNGESF 296
            ++IQNLQ+FHI  A++G++LLQ+GLR+RQVA+TKMND SSRSHTIFTI LY++  GE F
Sbjct: 276 GVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQGEMF 335

Query: 297 RVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSLHIPFRESKL 356
           +VSKMNLVDLAGSENISRSGAQ+QRAKEAGSINQSLLTLGRVINSLADKS H+PFRESKL
Sbjct: 336 KVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSAHVPFRESKL 395

Query: 357 TRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGSFIMKDVLLK 416
           TRLLQDSLGGNTKTALIATISPAKINSEET STL+YA+KAKNIKN+PQ+ SFIMKD+L+K
Sbjct: 396 TRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNRPQLRSFIMKDILVK 455

Query: 417 SVTAELVKIKSDLLSTKSKDGIYMSQENYKELTNELENYKTEVEECKRAMEKVSAQNSLL 476
           ++TAEL K+KSDLLSTK ++G+YMSQ+NYKE+TN+LE+YKTE++E KR +E++S+QNSLL
Sbjct: 456 NITAELAKVKSDLLSTKLREGVYMSQDNYKEITNDLESYKTEIQESKRIIERLSSQNSLL 515

Query: 477 IKEKRVSNEVNESQKVKLRKLGNNIEFLYDKIDRQHKNEQELSNVVQELMRALHTMQQSL 536
           +K+K+ SNEVNE Q++KL+ + + +  L +K++ QHK EQEL ++   L   L   Q  +
Sbjct: 516 LKDKKASNEVNELQRIKLQNMKDVMSGLSEKLESQHKKEQELVDMTCNLKSTLSLTQSVI 575

Query: 537 RIYEDQGQRFHTEMERVLYDNIGSFKKSLMDEIEKLK-------IXXXXXXXXXXXXXXA 589
           + Y  + ++    M+ +L      F++ L++ IE ++       I               
Sbjct: 576 KEYGQREKQISERMQMILGQEFLQFRQMLVNNIEDIRTNHSGNDILHEGEQNGIQQNLNV 635

Query: 590 VTTELTRIFDFMNSSNIEVFRNYIKKVNDQTPAYFKDIYSQXXXXXXXXXXXXXNLMIHL 649
           +  E+  +         ++++++I+K+ ++ P  F+ I ++              L  +L
Sbjct: 636 LRQEVVELLGLAQKRAEKMYKDWIEKILEEAPTVFQAISNKVDQVEVTVNTYHQRLTENL 695

Query: 650 SSISEEYNNLKDYLNEHFFKNNFQEALDVHVDRTYHQLKVSANSIFLKLREMLNEELDTN 709
           S ISE YNNLK Y N+HFFKNN +E L+ H+D+TY QL+ SA+ +  K ++M+++ L  N
Sbjct: 696 SDISEGYNNLKQYFNDHFFKNNHEEVLNSHIDKTYQQLQFSADGLLQKFKQMMDDHLKDN 755

Query: 710 KEFMMQSLRHAASEVVAKEMCLLDPVKQAWENSLENINECDKLNNVFENKIGVTVNEIFK 769
           K  MM+SL+ A +E + KEM L +P ++ WE S + IN CD ++N F   +   +++I  
Sbjct: 756 KTLMMKSLQSATTEAIDKEMQLFEPQRKKWEESFDLINNCDSISNGFNGDMRSALSDIKS 815

Query: 770 TIDQGQKTSQVTTEDAKSELTRVRAAFSSLQNNGIILQNVDSIKKKHNLLKSQVQDSANY 829
           T          +    K E+     A + L  N ++ + +  I  K + L++ +  S   
Sbjct: 816 TFGSSTDVISRSVSKVKDEVKGYEDASTILDGNEVVKRQIADIINKDSSLRNGLYKSIKS 875

Query: 830 MQAATQKFGEIDNSIQDLLNAQTIPQPQSENPIDGLLEQLNDKSLKPLGPSGKTP 884
            Q     F E+   I++ + ++     Q++      L Q +++S  PL P+   P
Sbjct: 876 SQGHISAFDELKERIRNTIASENSTLHQNKIATTPPLGQNSERS--PLKPTVLQP 928

 Score =  281 bits (720), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 133/178 (74%), Positives = 160/178 (89%)

Query: 3   DDEELNITVAVRCRGRNEKEVKARSSVVVAVPDVTGTNEVSINTTGDTGITAQINSKTYT 62
           D EELNITVAVR RGRNE+E++A+SSVVV+VPDV G++EV+INTT D GITAQ+NSKTY 
Sbjct: 11  DAEELNITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGITAQMNSKTYA 70

Query: 63  VDKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELS 122
           VDKVFGPSA+Q LIFK IAEPLF DF+KGYNCTVLVYGMTSTGKTYTMTGDE+LY+ ELS
Sbjct: 71  VDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDELS 130

Query: 123 EGAGIIPRVLFKLFDALSAQGDDYMIKCSFIELYNEELKDLLDETPDSSMPKKLRIFD 180
           + AGIIPR+LFKLF+ L  + +DY++KCSF+ELYNEELKDLLD++ ++S  +KLRI+D
Sbjct: 131 DSAGIIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLLDDSVENSSMRKLRIYD 188

>YEL061C Chr5 complement(36535..39537) [3003 bp, 1000 aa] {ON}
           CIN8Kinesin motor protein involved in mitotic spindle
           assembly and chromosome segregation
          Length = 1000

 Score =  557 bits (1435), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/670 (45%), Positives = 428/670 (63%), Gaps = 8/670 (1%)

Query: 237 AIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYKKCNGESF 296
            I+IQNLQEFHI +A EG+ LLQ+GL+HRQVASTKMND SSRSHTIFTI LYKK   E F
Sbjct: 315 GIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELF 374

Query: 297 RVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSLHIPFRESKL 356
           R+SKMNLVDLAGSENI+RSGA NQRAKEAGSINQSLLTLGRVIN+L DKS HIPFRESKL
Sbjct: 375 RISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKSGHIPFRESKL 434

Query: 357 TRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGSFIMKDVLLK 416
           TRLLQDSLGGNTKTALIATISPAK+ SEET STLEYA+KAKNIKNKPQ+GSFIMKD+L+K
Sbjct: 435 TRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSFIMKDILVK 494

Query: 417 SVTAELVKIKSDLLSTKSKDGIYMSQENYKELTNELENYKTEVEECKRAMEKVSAQNSLL 476
           ++T EL KIKSDLLSTKSK+GIYMSQ++YK L ++LE+YK EV+ECKR +E ++++N+LL
Sbjct: 495 NITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKREIESLTSKNALL 554

Query: 477 IKEKRVSNEVNESQKVKLRKLGNNIEFLYDKIDRQHKNEQELSNVVQELMRALHTMQQSL 536
           +K+K  S E  +SQ  ++  L   I+ L  ++D+QHK E E+S+   +L +    MQ +L
Sbjct: 555 VKDKLKSKETIQSQNCQIESLKTTIDHLRAQLDKQHKTEIEISDFNNKLQKLTEVMQMAL 614

Query: 537 RIYEDQGQRFHTEMERVLYDNIGSFKKSLMDEIEKLKIXXXXXXXXXXXXXXAVTTELTR 596
             Y+ +    + + E  +   I   K +L  ++  ++                +  E+  
Sbjct: 615 HDYKKRELDLNQKFEMHITKEIKKLKSTLFLQLNTMQQESILQETNIQPNLDMIKNEVLT 674

Query: 597 IFDFMNSSNIEVFRNYIKKVNDQTPAYFKDIYSQXXXXXXXXXXXXXNLMIHLSSISEEY 656
           +   M      ++++ +KK+ +++P +F  +  +             N+  +LS ISEE 
Sbjct: 675 LMRTMQEKAELMYKDCVKKILNESPKFFNVVIEKIDIIRVDFQKFYKNIAENLSDISEEN 734

Query: 657 NNLKDYLNEHFFKNNFQEALDVHVDRTYHQLKVSANSIFLKLREMLNEELDTNKEFMMQS 716
           NN+K YL  HFFKNN QE L+ HVD TY  ++   N      +++LN+ LD NK+ +MQ+
Sbjct: 735 NNMKQYLKNHFFKNNHQELLNRHVDSTYENIEKRTNEFVENFKKVLNDHLDENKKLIMQN 794

Query: 717 LRHAASEVVAKEMCLLDPVKQAWENSLENINECDKLNNVFENKIGVTVNEIFKTIDQGQK 776
           L  A S V+ +EM L +P +  WENS + IN+CD +NN F N +  T+++I  T+D    
Sbjct: 795 LTTATSAVIDQEMDLFEPKRVKWENSFDLINDCDSMNNEFYNSMAATLSQIKSTVDTSSN 854

Query: 777 TSQVTTEDAKSELTRVRAAFSSLQNNGIILQNVDSIKKKHNLLKSQVQDSANYMQAATQK 836
           +   +    K ++     A S L+NN       + +  KHN+LK  +++S     +    
Sbjct: 855 SMNESISVMKGQVEESENAISLLKNNTKFNDQFEQLINKHNMLKDNIKNSITSTHSHITN 914

Query: 837 FGEIDNSIQDLL-NAQTIPQPQSENPIDGLLEQLNDKSLKPLGPSGKTPMRTVQRSVTNT 895
             +I N+I++++ N         +  I+ +L+++      P   S K P+R    +  + 
Sbjct: 915 VDDIYNTIENIMKNYGNKENATKDEMIENILKEI------P-NLSKKMPLRLSNINSNSV 967

Query: 896 DQLLPPQKSS 905
             ++ P+K +
Sbjct: 968 QSVISPKKHA 977

 Score =  295 bits (756), Expect = 8e-85,   Method: Compositional matrix adjust.
 Identities = 137/185 (74%), Positives = 153/185 (82%), Gaps = 8/185 (4%)

Query: 4   DEELNITVAVRCRGRNEKEVKARSSVVVAVPDVTGTNEVSINTTGDTGITAQINSKTYTV 63
           +EELNITVAVRCRGRNE+E+  +SSVVV VPD+TG+ E+SINTTGDTGITAQ+N+K YTV
Sbjct: 32  NEELNITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTV 91

Query: 64  DKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSE 123
           DKVFGP A Q LIF  +A PLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDE+LY+GELS+
Sbjct: 92  DKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSD 151

Query: 124 GAGIIPRVLFKLFDALSAQGDDYMIKCSFIELYNEELKDLLDETP--------DSSMPKK 175
            AGIIPRVL KLFD L  Q +DY++KCSFIELYNEELKDLLD           D    KK
Sbjct: 152 AAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDSNSNGSSNTGFDGQFMKK 211

Query: 176 LRIFD 180
           LRIFD
Sbjct: 212 LRIFD 216

>Skud_5.28 Chr5 complement(35653..38649) [2997 bp, 998 aa] {ON}
           YEL061C (REAL)
          Length = 998

 Score =  551 bits (1420), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/670 (45%), Positives = 427/670 (63%), Gaps = 8/670 (1%)

Query: 237 AIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYKKCNGESF 296
            I+IQNLQEFHI +A EG+ LLQRGL+HRQVASTKMND SSRSHTIFTI LYKK   E F
Sbjct: 313 GIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELF 372

Query: 297 RVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSLHIPFRESKL 356
           R+SKMNLVDLAGSENI+RSGA NQRAKEAGSINQSLLTLGRVIN+L D+S HIPFRESKL
Sbjct: 373 RISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRSGHIPFRESKL 432

Query: 357 TRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGSFIMKDVLLK 416
           TRLLQDSLGGNTKTALIATISPAK+ SEET STLEYA+KAKNIKNKPQ+G+F+MKD+L+K
Sbjct: 433 TRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFMMKDILVK 492

Query: 417 SVTAELVKIKSDLLSTKSKDGIYMSQENYKELTNELENYKTEVEECKRAMEKVSAQNSLL 476
           ++T EL KIKSDLLSTKSK+GIYMSQ++YK L ++LE++K EV+ECKR +E ++++NSLL
Sbjct: 493 NITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECKREIESLASKNSLL 552

Query: 477 IKEKRVSNEVNESQKVKLRKLGNNIEFLYDKIDRQHKNEQELSNVVQELMRALHTMQQSL 536
           +K+K  S E  +SQ  ++  L   I  L  ++D+QHK E E+S    +L +    MQ +L
Sbjct: 553 VKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEISGFNNKLQKMTEVMQVAL 612

Query: 537 RIYEDQGQRFHTEMERVLYDNIGSFKKSLMDEIEKLKIXXXXXXXXXXXXXXAVTTELTR 596
           + Y+ +    + + E  +   I S K +L  +++ ++                V  E+  
Sbjct: 613 QDYKKRELDLNKKFETHISKEIKSLKTALFLQLDNMQQKNIFQETDIQPNLDMVKNEVLT 672

Query: 597 IFDFMNSSNIEVFRNYIKKVNDQTPAYFKDIYSQXXXXXXXXXXXXXNLMIHLSSISEEY 656
           + + M      ++++ +KK+ +++P +F  I  +             N+  +LS ISEE 
Sbjct: 673 LMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRIEFQNFYKNIAENLSDISEEN 732

Query: 657 NNLKDYLNEHFFKNNFQEALDVHVDRTYHQLKVSANSIFLKLREMLNEELDTNKEFMMQS 716
           NNLK YL  HFFKNN QE L+ H+D TY  ++   N      +  LN+ L+ NK+ +MQ+
Sbjct: 733 NNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVENFKMTLNDHLEENKKLIMQN 792

Query: 717 LRHAASEVVAKEMCLLDPVKQAWENSLENINECDKLNNVFENKIGVTVNEIFKTIDQGQK 776
           + +A S V+ +EM L +P +  WENS + IN+CD +NN F N +  T+++I KT+D    
Sbjct: 793 MTNATSAVIDQEMDLFEPRRAKWENSFDLINKCDSMNNEFYNNMAATLSQIKKTVDTSSN 852

Query: 777 TSQVTTEDAKSELTRVRAAFSSLQNNGIILQNVDSIKKKHNLLKSQVQDSANYMQAATQK 836
           +   +    K ++     A S L+NN         +  KH +LK  ++ S     +    
Sbjct: 853 SMNESISVMKGQVEESENAISLLKNNTKFNDQFKQLISKHIILKDNIESSITSTHSHITN 912

Query: 837 FGEIDNSIQDLL-NAQTIPQPQSENPIDGLLEQLNDKSLKPLGPSGKTPMRTVQRSVTNT 895
             +I N+I+D++ N         +  ID +L+++      P   S + P+R    +  + 
Sbjct: 913 VDDIYNTIEDIMTNHGNKENATKDEMIDNILKEI------P-NLSKRLPLRISNINGCSV 965

Query: 896 DQLLPPQKSS 905
             ++ P+K +
Sbjct: 966 QDIISPKKHT 975

 Score =  293 bits (750), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 137/185 (74%), Positives = 153/185 (82%), Gaps = 8/185 (4%)

Query: 4   DEELNITVAVRCRGRNEKEVKARSSVVVAVPDVTGTNEVSINTTGDTGITAQINSKTYTV 63
           +EELNITVAVRCRGRNE+E+  +SSVVV VPD+TG+ EVSINTTGDTGITAQ+N+K YTV
Sbjct: 34  NEELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAKRYTV 93

Query: 64  DKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSE 123
           DKVFGP A Q LIF+ +A PLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDE+LY+GEL++
Sbjct: 94  DKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELND 153

Query: 124 GAGIIPRVLFKLFDALSAQGDDYMIKCSFIELYNEELKDLLDETP--------DSSMPKK 175
            AGIIPRVL KLFD L  Q  DY++KCSFIELYNEELKDLLD           D    KK
Sbjct: 154 AAGIIPRVLLKLFDTLELQQSDYVVKCSFIELYNEELKDLLDNNSNGSSNNGFDGQFMKK 213

Query: 176 LRIFD 180
           LRIFD
Sbjct: 214 LRIFD 218

>Smik_5.26 Chr5 complement(38891..41899) [3009 bp, 1002 aa] {ON}
           YEL061C (REAL)
          Length = 1002

 Score =  550 bits (1416), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 293/613 (47%), Positives = 402/613 (65%)

Query: 237 AIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYKKCNGESF 296
            I+IQNLQEFHI +A EG++LLQ+GL+HRQVASTKMND SSRSHTIFTI LYKK   E F
Sbjct: 317 GIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELF 376

Query: 297 RVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSLHIPFRESKL 356
           R+SKMNLVDLAGSENI+RSGA NQRAKEAGSINQSLLTLGRVIN+L DKS HIPFRESKL
Sbjct: 377 RISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKSGHIPFRESKL 436

Query: 357 TRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGSFIMKDVLLK 416
           TRLLQDSLGGNTKTALIATISPAK+ SEET STLEYA+KAKNIKNKPQ+G+FIMKD+L+K
Sbjct: 437 TRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMKDILVK 496

Query: 417 SVTAELVKIKSDLLSTKSKDGIYMSQENYKELTNELENYKTEVEECKRAMEKVSAQNSLL 476
           ++T EL KIKSDLLSTKSK+GIYM+Q++YK L ++LE+YK EV+ECKR +E ++++NSLL
Sbjct: 497 NITMELAKIKSDLLSTKSKEGIYMNQDHYKNLNSDLESYKNEVQECKREIESLTSKNSLL 556

Query: 477 IKEKRVSNEVNESQKVKLRKLGNNIEFLYDKIDRQHKNEQELSNVVQELMRALHTMQQSL 536
           +KEK  S E  +SQ  ++  L   I+ L  ++D+QHK E E+S    +L +    MQ +L
Sbjct: 557 VKEKLKSKETIQSQNSQIESLKATIDHLRTQLDKQHKTELEISGFNSKLQKLTEVMQMAL 616

Query: 537 RIYEDQGQRFHTEMERVLYDNIGSFKKSLMDEIEKLKIXXXXXXXXXXXXXXAVTTELTR 596
           + Y+ +    + + E  +   I + K +L  ++  L+                +  E+  
Sbjct: 617 QDYKRRELDLNKKFETHITTEIKNMKTTLFSQLSTLQQRNILQETDIQPNLDIIKNEVLT 676

Query: 597 IFDFMNSSNIEVFRNYIKKVNDQTPAYFKDIYSQXXXXXXXXXXXXXNLMIHLSSISEEY 656
           + + M      ++++ +KK+ +++P +F  I  +             N+  +LS ISEE 
Sbjct: 677 LMETMQEKAELMYKDCVKKILNESPKFFNAIVEKIDIIGVDFERFYKNIAENLSDISEEN 736

Query: 657 NNLKDYLNEHFFKNNFQEALDVHVDRTYHQLKVSANSIFLKLREMLNEELDTNKEFMMQS 716
           NNLK Y   HFF+NN QE L  HVD TY +++   N      ++ LN+ L+ NK+ +M++
Sbjct: 737 NNLKQYFTNHFFRNNHQELLSHHVDSTYEKIEKKTNQFVENFKKALNDHLEENKKLIMKN 796

Query: 717 LRHAASEVVAKEMCLLDPVKQAWENSLENINECDKLNNVFENKIGVTVNEIFKTIDQGQK 776
           L    S V+ +EM L +P +  WE+S + INECD +NN F N +  T+++I  T+D    
Sbjct: 797 LTTTTSAVIDQEMSLFEPKRVKWEHSFDLINECDSMNNEFYNSMATTLSQIKSTVDTSSN 856

Query: 777 TSQVTTEDAKSELTRVRAAFSSLQNNGIILQNVDSIKKKHNLLKSQVQDSANYMQAATQK 836
           +   +    K ++     A S L+NN         +  KH +LK  ++ S     +    
Sbjct: 857 SMNKSISVMKGQVEESENAISLLKNNIKFNDQFKQLINKHTILKDNIESSITSTNSHITN 916

Query: 837 FGEIDNSIQDLLN 849
             +I N+I+ ++N
Sbjct: 917 IDDIYNTIEKIMN 929

 Score =  295 bits (756), Expect = 7e-85,   Method: Compositional matrix adjust.
 Identities = 137/185 (74%), Positives = 153/185 (82%), Gaps = 8/185 (4%)

Query: 4   DEELNITVAVRCRGRNEKEVKARSSVVVAVPDVTGTNEVSINTTGDTGITAQINSKTYTV 63
           +EELNITVAVRCRGRNE+E+  +SSVVV VPD+TG+ E+SINTTGDTGITAQ+N+K YTV
Sbjct: 32  NEELNITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTV 91

Query: 64  DKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSE 123
           DKVFGP A Q LIF  +A PLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDE+LY+GELS+
Sbjct: 92  DKVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSD 151

Query: 124 GAGIIPRVLFKLFDALSAQGDDYMIKCSFIELYNEELKDLLDETP--------DSSMPKK 175
            AGIIPRVL KLFD L  Q +DY++KCSFIELYNEELKDLLD           D    KK
Sbjct: 152 SAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDNNSNSSSNNGFDGQFMKK 211

Query: 176 LRIFD 180
           LRIFD
Sbjct: 212 LRIFD 216

>NDAI0D00870 Chr4 complement(195749..198958) [3210 bp, 1069 aa] {ON}
            Anc_6.16
          Length = 1069

 Score =  546 bits (1408), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 306/669 (45%), Positives = 435/669 (65%), Gaps = 20/669 (2%)

Query: 237  AIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYKKCNGESF 296
             I+IQNLQEFHI +AKEG+ LLQ+GL++RQVASTKMND SSRSHTIFTI LYK+  G  F
Sbjct: 346  GIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHTIFTITLYKEHQGTLF 405

Query: 297  RVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSLHIPFRESKL 356
            R+SKMNLVDLAGSENI+RSGA NQRAKE GSINQSLLTLGRVINSLAD++ HIPFRESKL
Sbjct: 406  RLSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTLGRVINSLADRNNHIPFRESKL 465

Query: 357  TRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGSFIMKDVLLK 416
            TRLLQDSLGGNTKTALIATISPAK+ SEET STLEYA+KAKNIKNKPQ+GS I KD+LLK
Sbjct: 466  TRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSIISKDILLK 525

Query: 417  SVTAELVKIKSDLLSTKSKDGIYMSQENYKELTNELENYKTEVEECKRAMEKVSAQNSLL 476
            ++T EL ++KSDLLSTKSK+GIYMSQE+Y++L NEL+N+KTE +E KR +E++S+QN+LL
Sbjct: 526  NITTELSQVKSDLLSTKSKEGIYMSQEHYQKLMNELDNHKTEADESKRIIERLSSQNALL 585

Query: 477  IKEKRVSNEVNESQKVKLRKLGNNIEFLYDKIDRQHKNEQELSNVVQELMRALHTMQQSL 536
            +K+KR SNEVNE Q++KL K  ++I  L +KI+ Q+  EQ L + V +L  +  T ++ +
Sbjct: 586  LKDKRTSNEVNELQRIKLSKFQDSINMLQEKIEIQNGKEQMLVSSVSKLQTSCDTFKKMI 645

Query: 537  RIYEDQGQRFHTEMERVLYDNIGSFKKSLMDEIEKLKIXXXXXXXXXXXXXXAVTTELTR 596
              YE Q     +++E++L D++ S +  L D   K+K                +  E+ +
Sbjct: 646  ENYECQQIDVKSKIEQILEDDLLSLRNLLQDHQNKIKTLNSGTDFDIGSNLDMIQNEVIK 705

Query: 597  IFDFMNSSNIEVFRNYIKKVNDQTPAYFKDIYSQXXXXXXXXXXXXXNLMIHLSSISEEY 656
            +         + ++ +I+    QTP  FK I                 +  +LS ISEEY
Sbjct: 706  MLGTTQEKAEKTYKQFIEGFLKQTPENFKKIGEDINDINIKIQNHHAAVAQNLSDISEEY 765

Query: 657  NNLKDYLNEHFFKNNFQEALDVHVDRTYHQLKVSANSIFLKLREMLNEELDTNKEFMMQS 716
            NNLK YLNE+ F+NN ++ ++ H++ T   L  SA+ +F   ++M+N+ L++N+  M+ S
Sbjct: 766  NNLKQYLNENLFQNNHEDLINAHINSTSQTLTNSADVLFNTFKDMMNKHLESNRNLMLNS 825

Query: 717  LRHAASEVVAKEMCLLDPVKQAWENSLENINECDKLNNVFENKI----GVTVNEIFKTID 772
             + A  EV+ KEM L  P K+ WE S++ IN+CD LNN F+ ++      T ++I  +I+
Sbjct: 826  FKAATDEVINKEMELFIPRKKKWEESIDLINQCDSLNNGFQKEVTDGLSYTRSKITASIN 885

Query: 773  QGQKTSQVTTEDAKSELTRVRAAFSSL------QNNGIILQNVDSIKKKHNLLKSQVQDS 826
            Q    S       K+E++     ++S+      ++N II    + + +K+++ +  V++S
Sbjct: 886  QMYDNST----RLKTEMSADNGGYNSINTKNVVEDNQIIRTQFNELARKNSIFQDNVENS 941

Query: 827  ANYMQAATQKFGEIDNSIQDLLNAQTIPQPQSENPIDGLLEQLNDK------SLKPLGPS 880
                 A+      +++SI+  +    I    +E  +    ++ N K       L+PL P+
Sbjct: 942  LKCAVASVNNLNHLEDSIKMAVRDTRIKGGPTEGEVGVPFKKENGKEGPTKPGLQPLQPT 1001

Query: 881  GKTPMRTVQ 889
             +  + + Q
Sbjct: 1002 NEIFLNSQQ 1010

 Score =  287 bits (735), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 134/179 (74%), Positives = 152/179 (84%), Gaps = 5/179 (2%)

Query: 7   LNITVAVRCRGRNEKEVKARSSVVVAVPDVTGTNEVSINTTGDTGITAQINSKTYTVDKV 66
           LNITVAVRCRGRNE+E+K +SSV+V VPD+ G+NEVSINTT D GITAQ+NSKTYTVDKV
Sbjct: 52  LNITVAVRCRGRNEREIKLKSSVIVTVPDINGSNEVSINTTDDVGITAQMNSKTYTVDKV 111

Query: 67  FGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSEGAG 126
           FGPSA+Q LIF  +AEPLF DFIKGYNCTVLVYGMTSTGKTYTMTGDE+LY+GELSE AG
Sbjct: 112 FGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSESAG 171

Query: 127 IIPRVLFKLFDALSAQGDDYMIKCSFIELYNEELKDLLDE-----TPDSSMPKKLRIFD 180
           IIPR+LFKLFD L    +DY++KCSFIELYNE+LKDLL++         S   KLRIFD
Sbjct: 172 IIPRILFKLFDTLEMNQEDYVVKCSFIELYNEDLKDLLNDNNNSINNSKSNINKLRIFD 230

>Suva_5.6 Chr5 complement(12298..15297) [3000 bp, 999 aa] {ON}
           YEL061C (REAL)
          Length = 999

 Score =  530 bits (1365), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 307/670 (45%), Positives = 429/670 (64%), Gaps = 8/670 (1%)

Query: 237 AIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYKKCNGESF 296
            I+IQNLQEFHI +A EG+ LLQRGL+HRQVASTKMND SSRSHTIFTI LYKK   E F
Sbjct: 314 GIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELF 373

Query: 297 RVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSLHIPFRESKL 356
           R+SKMNLVDLAGSENI+RSGA NQRAKEAGSINQSLLTLGRVIN+LADKS HIPFRESKL
Sbjct: 374 RISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSGHIPFRESKL 433

Query: 357 TRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGSFIMKDVLLK 416
           TRLLQDSLGGNTKTALIATISPAK+ SEET STLEYA+KAKNIKNKPQ+G+FIMKD+L+K
Sbjct: 434 TRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMKDILVK 493

Query: 417 SVTAELVKIKSDLLSTKSKDGIYMSQENYKELTNELENYKTEVEECKRAMEKVSAQNSLL 476
           ++T EL KIKSDLLSTKSK+GIYMSQ++YK L ++LE+YK EV+ECKR +E +S++NSLL
Sbjct: 494 NITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKRDIESLSSKNSLL 553

Query: 477 IKEKRVSNEVNESQKVKLRKLGNNIEFLYDKIDRQHKNEQELSNVVQELMRALHTMQQSL 536
           +K+K  S +  +SQ  ++  L   I  L  ++D+QHK E E+S    +L +    MQ +L
Sbjct: 554 LKDKLKSKDTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEIMQLAL 613

Query: 537 RIYEDQGQRFHTEMERVLYDNIGSFKKSLMDEIEKLKIXXXXXXXXXXXXXXAVTTELTR 596
           + Y+ +    + + E  +   I S K +L  ++  ++                +  E+  
Sbjct: 614 QDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIKNEVLT 673

Query: 597 IFDFMNSSNIEVFRNYIKKVNDQTPAYFKDIYSQXXXXXXXXXXXXXNLMIHLSSISEEY 656
           + + M      ++++ +KK+ +++P +F  I  +             N+  +LS ISEE 
Sbjct: 674 LMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDISEEN 733

Query: 657 NNLKDYLNEHFFKNNFQEALDVHVDRTYHQLKVSANSIFLKLREMLNEELDTNKEFMMQS 716
           NNLK YL  HFFKNN QE L+ H+D TY  ++   +      +  LN+ L+ NK+ +MQ+
Sbjct: 734 NNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKKLIMQN 793

Query: 717 LRHAASEVVAKEMCLLDPVKQAWENSLENINECDKLNNVFENKIGVTVNEIFKTIDQGQK 776
           L +A S V+ +EM L +P +  WENS + IN+CD +NN F N +  T+++I  T+D    
Sbjct: 794 LTNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMATTLSQIKNTVDTSSN 853

Query: 777 TSQVTTEDAKSELTRVRAAFSSLQNNGIILQNVDSIKKKHNLLKSQVQDSANYMQAATQK 836
           +   +    K ++     A S L+NN         +  KH +LK  +++S     +    
Sbjct: 854 SMNKSISVMKGQVEESENAVSLLKNNKKFNDQFKQLVNKHTILKDNIENSITSTHSHITN 913

Query: 837 FGEIDNSIQDLLNAQTIPQPQSENP-IDGLLEQLNDKSLKPLGPSGKTPMRTVQRSVTNT 895
             +I ++I++++      +   +N  ID +L+++   SL     S + P+R    +  + 
Sbjct: 914 IDDIYDTIENIMKNYGNKENAVKNEMIDNILKEI--PSL-----SKRVPLRLSNTNGNSA 966

Query: 896 DQLLPPQKSS 905
             +L P+K +
Sbjct: 967 QNILSPKKHA 976

 Score =  292 bits (748), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 137/185 (74%), Positives = 153/185 (82%), Gaps = 8/185 (4%)

Query: 4   DEELNITVAVRCRGRNEKEVKARSSVVVAVPDVTGTNEVSINTTGDTGITAQINSKTYTV 63
           +EELNITVAVRCRGRNE+E+  +SSVVV VPD+TG+ EVSINTTGDTGITAQ+N+K YTV
Sbjct: 32  NEELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKRYTV 91

Query: 64  DKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSE 123
           DKVFGP A Q LIF  +A PLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDE+LY+GELS+
Sbjct: 92  DKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSD 151

Query: 124 GAGIIPRVLFKLFDALSAQGDDYMIKCSFIELYNEELKDLLDETP--------DSSMPKK 175
            AGIIPRVL KLFD L  Q +DY++KCSFIELYNEELKDLLD           +    KK
Sbjct: 152 AAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDNNSNNSSNNGFEGPFMKK 211

Query: 176 LRIFD 180
           LRIFD
Sbjct: 212 LRIFD 216

>Kpol_1032.6 s1032 (9109..12123) [3015 bp, 1004 aa] {ON}
           (9109..12123) [3015 nt, 1005 aa]
          Length = 1004

 Score =  525 bits (1351), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 271/548 (49%), Positives = 383/548 (69%), Gaps = 8/548 (1%)

Query: 237 AIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYKKCNGESF 296
            I+IQNL+EFHI  AKEGI LLQRGL++RQVASTKMND SSRSHTIFTI LYK+ +G+ F
Sbjct: 302 GIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKEHDGKIF 361

Query: 297 RVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSLHIPFRESKL 356
           R+SKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADK++HIPFRESKL
Sbjct: 362 RISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNIHIPFRESKL 421

Query: 357 TRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGSFIMKDVLLK 416
           TRLLQDSLGGNTKTALIATISPAK+NSEET STLEYA KAK+IKNKPQ+GS I KD+L+K
Sbjct: 422 TRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIKNKPQLGSIITKDILVK 481

Query: 417 SVTAELVKIKSDLLSTKSKDGIYMSQENYKELTNELENYKTEVEECKRAMEKVSAQNSLL 476
           ++ +EL K+K+DLLSTKS+DG+YMSQ +YKELTN+LE+YKTEV+ECKR ++ ++ QN LL
Sbjct: 482 NIASELAKVKADLLSTKSRDGVYMSQIHYKELTNDLESYKTEVQECKRVIDGLTTQNGLL 541

Query: 477 IKEKRVSNEVNESQKVKLRKLGNNIEFLYDKIDRQHKNEQELSNVVQELMRALHTMQQSL 536
           +K+K+ SNEV+  QK+KL+ + ++I  L+D I++QH+ EQ L +++ +L      MQ ++
Sbjct: 542 LKDKKASNEVHNLQKIKLQSMKDSISHLHDSIEKQHRKEQTLVDLILKLKSKSIEMQATI 601

Query: 537 RIYEDQGQRFHTEMERVLYDNIGSFKKSLMDEIEKLKIXXXXXXXXXXXXXXAVTTELTR 596
           + + ++ Q    +M+++  + +   K  L++ +E++                 +  E+  
Sbjct: 602 KYHSEREQVTQAKMKQIFNEELLRLKSLLIENLERINKKIVINNTDLGMNIEKIKDEVKS 661

Query: 597 IFDFMNSSNIEVFRNYIKKVNDQTPAYFKDIYSQXXXXXXXXXXXXXNLMIHLSSISEEY 656
           I D   +    V+++ ++++  ++P     +                 L I +S ++ E+
Sbjct: 662 IIDTTQAEANHVYKDCMEQLMKESPILLGSLNDDIIKMQKISDLYNEQLSISISELNIEH 721

Query: 657 NNLKDYLNEHFFKNNFQEALDVHVDRTYHQLKVSANSIFLKLREMLNEELDTNKEFMMQS 716
           N+LK YLN  FFK++ +E L+ H+++TY  ++ ++  I  +L+  L   L+ ++  ++ S
Sbjct: 722 NDLKQYLNGSFFKSDHEEILNEHIEKTYDNIRRASTGIVEQLKTGLELYLEESRNIIIDS 781

Query: 717 LRHAASEVVAKEMCLLDPVKQAWENSLENINECDKLNNVFENKIGVTVNEIFKTIDQGQK 776
           L++  S++V  EM L  P K+ WE+S E IN+CD LNN +   I   ++ +        K
Sbjct: 782 LKNTTSDIVKSEMELFAPKKKKWEDSFEMINKCDSLNNKYFGDISALLSNM--------K 833

Query: 777 TSQVTTED 784
           TS  +T D
Sbjct: 834 TSVTSTSD 841

 Score =  291 bits (744), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 139/177 (78%), Positives = 158/177 (89%), Gaps = 1/177 (0%)

Query: 5   EELNITVAVRCRGRNEKEVKARSSVVVAVPDVTGTNEVSINTTGDTGITAQINSKTYTVD 64
           +ELNI VAVRCRGRNE+E+KA+SSVVV+VPDV G++E++INTT D GI  Q+NSKTYTVD
Sbjct: 11  DELNIIVAVRCRGRNEREIKAKSSVVVSVPDVAGSSEIAINTTEDVGIAGQMNSKTYTVD 70

Query: 65  KVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSEG 124
           KVFGPSA+Q LIF+ +AEPLF DFI+GYNCTVLVYGMTSTGKTYTMTGDERLY+GELS+ 
Sbjct: 71  KVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNGELSDS 130

Query: 125 AGIIPRVLFKLFDALSAQGDDYMIKCSFIELYNEELKDLLDETPD-SSMPKKLRIFD 180
           AGIIPRVLFKLFDA+  Q DDY+IKCSFIELYNEELKDLLDE    +S  KKLRIFD
Sbjct: 131 AGIIPRVLFKLFDAMEFQNDDYIIKCSFIELYNEELKDLLDECQAINSTAKKLRIFD 187

>NCAS0H00880 Chr8 complement(160883..163897) [3015 bp, 1004 aa] {ON}
           Anc_6.16
          Length = 1004

 Score =  521 bits (1343), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 288/621 (46%), Positives = 408/621 (65%), Gaps = 13/621 (2%)

Query: 237 AIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYKKCNGESF 296
            I+IQNLQEFHI +AKEG+ LLQ+GL+HRQVASTKMND SSRSHTIFTI LYK+     F
Sbjct: 300 GIYIQNLQEFHITNAKEGLSLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKEHKDNLF 359

Query: 297 RVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSLHIPFRESKL 356
           R+SKMNLVDLAGSENI+RSGA NQRAKE GSINQSLLTLGRVINSLADKS H+PFRESKL
Sbjct: 360 RLSKMNLVDLAGSENINRSGAMNQRAKETGSINQSLLTLGRVINSLADKSPHVPFRESKL 419

Query: 357 TRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGSFIMKDVLLK 416
           TRLLQDSLGGNTKTALIATISPAK+ SEET STLEYA+KAKNIKNKPQ+GS I+KD+LLK
Sbjct: 420 TRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSVILKDILLK 479

Query: 417 SVTAELVKIKSDLLSTKSKDGIYMSQENYKELTNELENYKTEVEECKRAMEKVSAQNSLL 476
           ++T+EL K+KSDL+STKSKDGIYMS E+Y+EL  ELE+ KTEV+E KR +EK+S+QNS+L
Sbjct: 480 NITSELAKVKSDLMSTKSKDGIYMSHEHYQELIMELESSKTEVQESKRMIEKLSSQNSML 539

Query: 477 IKEKRVSNEVNESQKVKLRKLGNNIEFLYDKIDRQHKNEQELSNVVQELMRALHTMQQSL 536
           +K+KR +NEVNE Q++KL  L +++  L +K++ Q+  E +L   + +L ++   +   +
Sbjct: 540 LKDKRSANEVNELQRIKLNNLKDSMSNLNEKLEIQNGKETKLMEQIGQLEKSREKLNSLV 599

Query: 537 RIYEDQGQRFHTEMERVLYDNIGSFKKSLMDEIEKLKIXXXXXXXXXXXXXXAVTTELTR 596
           + Y+ +  +  T++  +L +N+   KK L     K  I               +  E+T 
Sbjct: 600 KNYQTKQSQLKTQISNILNENLFELKKILNS--HKDAIRQSEGNFDVEMNLKVIKDEITS 657

Query: 597 IFDFMNSSNIEVFRNYIKKVNDQTPAYFKDIYSQXXXXXXXXXXXXXNLMIHLSSISEEY 656
           + +        +++ +I++  +QTP   + I+                +  +LS ISEEY
Sbjct: 658 MLEKTQHKTEMMYKEFIEEFLEQTPINLQKIFEHVTQVEFMVTGYYNEITENLSDISEEY 717

Query: 657 NNLKDYLNEHFFKNNFQEALDVHVDRTYHQLKVSANSIFLKLREMLNEELDTNKEFMMQS 716
           NNLK YL+  FF+NN ++ L++H++ T   L  S+  +F K + M++  L  NK+ M+ +
Sbjct: 718 NNLKQYLDNDFFQNNHEDLLNIHINATSDILAQSSAELFNKFKIMMDAHLMENKKLMIDN 777

Query: 717 LRHAASEVVAKEMCLLDPVKQAWENSLENINECDKLNNVFENKIGVTVNEIFKTIDQGQK 776
            R A ++V+ KEM L  P +  WE S+E IN CD +NN F + +   V++I   +     
Sbjct: 778 FRTATNDVITKEMELFKPKRNKWEESIELINRCDSINNGFHHNMTGQVSKIKTNLASSSS 837

Query: 777 TSQVTTEDAKSEL--------TRVRAAFSSLQNNGIILQNVDSIKKKHNLLKSQVQDSAN 828
           +        KS++        + V+ A   L+N+ +  ++ + I +K+ +L+   +++ N
Sbjct: 838 SIHNAIASIKSQVLEQLSNDDSDVKTA---LENDPMFNKHFNEIIEKNMILQKNRKNAIN 894

Query: 829 YMQAATQKFGEIDNSIQDLLN 849
           Y   +     E+  +++  LN
Sbjct: 895 YTDKSLLNIDELSETVKIALN 915

 Score =  273 bits (697), Expect = 7e-77,   Method: Compositional matrix adjust.
 Identities = 128/195 (65%), Positives = 154/195 (78%), Gaps = 17/195 (8%)

Query: 3   DDEELNITVAVRCRGRNEKEVKARSSVVVAVPDVTGTNEVSINTTGDTGITAQINSKTYT 62
           +D ELNITVAVRCRGRNE+E+ ++S VVV VPD+TG  E+SINTTG+TGITAQ+NSKTYT
Sbjct: 25  EDTELNITVAVRCRGRNEREINSKSPVVVTVPDITGAQEISINTTGETGITAQMNSKTYT 84

Query: 63  VDKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE-- 120
           VDKVFGP+ADQ LIF+ +AEPLF+DF+KGYNCTVLVYGMTSTGKTYTMTGDE+LY     
Sbjct: 85  VDKVFGPAADQDLIFQEVAEPLFRDFVKGYNCTVLVYGMTSTGKTYTMTGDEKLYQNGTM 144

Query: 121 LSEGAGIIPRVLFKLFDAL--------SAQGDDYMIKCSFIELYNEELKDLLDETPDSSM 172
           LS+ AGIIPR+LFKLFD L        +    D+++KCSF+ELYNE+LKDLL+   +   
Sbjct: 145 LSDAAGIIPRILFKLFDTLDNHRHSDVTGSTTDFVVKCSFVELYNEDLKDLLNYDSNDEQ 204

Query: 173 -------PKKLRIFD 180
                   +KLRIFD
Sbjct: 205 QQQQQLGSRKLRIFD 219

>KAFR0L00370 Chr12 (66535..69426) [2892 bp, 963 aa] {ON} Anc_6.16
           YEL061C
          Length = 963

 Score =  509 bits (1312), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 285/625 (45%), Positives = 401/625 (64%), Gaps = 20/625 (3%)

Query: 237 AIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYKKCNGESF 296
            I+IQNLQEFHI  AKEGI+LLQ+GL++RQVASTKMND SSRSHTIFTI L+K+  GE F
Sbjct: 289 GIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLFKEVKGEIF 348

Query: 297 RVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSLHIPFRESKL 356
           R+SKMNLVDLAGSENI+RSGA NQRAKEAGSINQSLLTLGRVINSLADK++H+PFRESKL
Sbjct: 349 RLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKNVHVPFRESKL 408

Query: 357 TRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGSFIMKDVLLK 416
           TRLLQDSLGGNTKTALIATISPAK+  EET STLEYA+KAKNIKNKPQ+GSFIMKD+LLK
Sbjct: 409 TRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNIKNKPQLGSFIMKDILLK 468

Query: 417 SVTAELVKIKSDLLSTKSKDGIYMSQENYKELTNELENYKTEVEECKRAMEKVSAQNSLL 476
           ++T EL KIKSDLLSTKSKDGIYM Q++YKELT +L+NYKTE++ECKR +E +++QN+LL
Sbjct: 469 NITTELTKIKSDLLSTKSKDGIYMDQQHYKELTTDLQNYKTEIQECKRTIESLTSQNALL 528

Query: 477 IKEKRVSNEVNESQKVKLRKLGNNIEFLYDKIDRQHKNEQELSNVVQELMRALHTMQQSL 536
           +K+KR  NE NE Q++K++ +  +++ LY KI+RQ   E EL   +Q   +    + + +
Sbjct: 529 LKDKRTINENNELQRIKIQTMNESMKKLYAKIERQQSIENELDGKIQIFTKTNSKLTKII 588

Query: 537 RIYEDQGQRFHTEMERVLYDNIGSFKKSLMDEIEKLKIXXXXXXXXXXXXXXAVTTELTR 596
              +++    +++ + +L  ++    K L  +IE  K                + +E+T 
Sbjct: 589 DEMKNREALVNSKFKTLLDHSLSYVSKKLNYQIENFKDQGINQNFTVDENLQLIKSEMTN 648

Query: 597 IFDFMNSSNIEVFRNYIKKVNDQTPAYFKDIYSQXXXXXXXXXXXXXNLMIHLSSISEEY 656
           +      +  + ++  I K    TP  F +I                 +  +LS +SEEY
Sbjct: 649 LLSTARDNFEKFYQECITKFLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDLSEEY 708

Query: 657 NNLKDYLNEHFF---KNNFQEALDVHVDRTYHQLKVSANSIFLKLREMLNEELDTNKEFM 713
           NN K ++ + F+   K +  E L+ +++ T   ++ S+N +   ++ +LNE L  NKE +
Sbjct: 709 NNFKQFITDEFYNQEKGHQHELLNKYINNTQTVIESSSNDVMSTIQNLLNEHLRANKELI 768

Query: 714 MQSLRHAASEVVAKEMCLLDPVKQAWENSLENINECDKLNNVFENKIGVTVNEIFKTIDQ 773
           + SL +  +E+++ E+  L P    WE S E IN  D LNN F + +  ++  +   I Q
Sbjct: 769 INSLSNVTTELMSNELDRLKPKLSKWEESAELINRSDALNNEFNDNVESSMTTMTDKIKQ 828

Query: 774 GQKTSQVTTEDAKSELTRVRAAFSS----------LQNNGIILQNVDSIKKKHNLLKSQV 823
                  T +   + + ++   F +          + +N II  N  SI++K++ L   V
Sbjct: 829 -------TNDSINNNIKKINEHFKTNDIAHSNNLMIDDNNIIKNNFKSIEEKNSRLHEFV 881

Query: 824 QDSANYMQAATQKFGEIDNSIQDLL 848
           ++       + +K  E+D SI+ +L
Sbjct: 882 KEGYLVTNESMKKLNELDTSIRTVL 906

 Score =  281 bits (720), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 130/179 (72%), Positives = 152/179 (84%), Gaps = 2/179 (1%)

Query: 4   DEELNITVAVRCRGRNEKEVKARSSVVVAVPDVTGTNEVSINTTGDTGITAQINSKTYTV 63
           +EELNITVAVRCRGRN++E+ A+SSVVV VPD+ G+ EV+INT+ D G TAQ+NSKTYTV
Sbjct: 14  EEELNITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDIGFTAQMNSKTYTV 73

Query: 64  DKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSE 123
           DKVFGPSA Q LIF  IAEPLF DFIKGYNCT+LVYGMTSTGKTYTMTGDE+LY+ ELS+
Sbjct: 74  DKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEELSD 133

Query: 124 GAGIIPRVLFKLFDALSAQGDDYMIKCSFIELYNEELKDLL--DETPDSSMPKKLRIFD 180
            AGIIPR+LFKLF+ L    +D+++KCSF+ELYNEELKDLL  D   D+   KKLRIFD
Sbjct: 134 SAGIIPRILFKLFETLEKLNEDHIVKCSFVELYNEELKDLLHGDCNNDNGNFKKLRIFD 192

>CAGL0B03641g Chr2 (363897..366863) [2967 bp, 988 aa] {ON} similar
           to uniprot|P27895 Saccharomyces cerevisiae YEL061c CIN8
           Kinesin-like protein
          Length = 988

 Score =  498 bits (1281), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 287/653 (43%), Positives = 404/653 (61%), Gaps = 14/653 (2%)

Query: 237 AIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYKKCNGESF 296
           +I+IQNL+EFHI  A EG++LLQ+GL+ RQVASTKMND SSRSH+IFTI LYK+ NGE F
Sbjct: 308 SIYIQNLEEFHITSAMEGLQLLQKGLKQRQVASTKMNDFSSRSHSIFTITLYKEQNGELF 367

Query: 297 RVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSLHIPFRESKL 356
           RVSKMNLVDLAGSENISRSGA NQRAKEAGSINQSLLTLGRVINSLADKS HIPFRESKL
Sbjct: 368 RVSKMNLVDLAGSENISRSGAMNQRAKEAGSINQSLLTLGRVINSLADKSEHIPFRESKL 427

Query: 357 TRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGSFIMKDVLLK 416
           TRLLQDSLGGNTKTALIATISPAK+ SEET STLEYA+KAKNIKNKPQ+G+FIMKD+L++
Sbjct: 428 TRLLQDSLGGNTKTALIATISPAKMTSEETCSTLEYASKAKNIKNKPQLGAFIMKDILVR 487

Query: 417 SVTAELVKIKSDLLSTKSKDGIYMSQENYKELTNELENYKTEVEECKRAMEKVSAQNSLL 476
           S+T+EL KIKSDLLSTKSK+G+YMS E+YK+L  ++E YKTE+EE KRA+E ++AQN++L
Sbjct: 488 SITSELAKIKSDLLSTKSKEGVYMSHEHYKDLHYDIECYKTELEESKRAIESLTAQNAML 547

Query: 477 IKEKRVSNEVNESQKVKLRKLGNNIEFLYDKIDRQHKNEQELSNVVQELMRALHTMQQSL 536
            +E+    + N   K  +  L +N+  L   +  Q   E  + ++++++  A   M++++
Sbjct: 548 QQERLSLKDDNACYKANIASLKDNVVTLQSSLKEQITKETNIRSLLKDVQGANEEMKKTI 607

Query: 537 RIYEDQGQRFHTEMERVLYDNIGSFKKSLMDEIEKLKIXXXXXXXXXXXXXXAVTTELTR 596
            ++E + Q     +   + D I + + +L   IE L+                +  E+ +
Sbjct: 608 HLFEFKQQELQQSISTFISDEISNIRDTLKKHIEYLQNNGDLKDTEISGNLMRLEKEVVK 667

Query: 597 IFDFMNSSNIEVFRNYIKKVNDQTPAYFKDIYSQXXXXXXXXXXXXXNLMIHLSSISEEY 656
           +         + +   +K +  +TP  F+ +  +              +   LS +SEEY
Sbjct: 668 VIKAAEEEASKSYGECVKMMLKETPRLFESVSGRLDNISKLAEENHSKIAETLSDVSEEY 727

Query: 657 NNLKDYLNEHFFKNNFQEALDVHVDRTYHQLKVSANSIFLKLREMLNEELDTNKEFMMQS 716
           NNLK YL  +FFKNN +E L  HV  TY QL+ ++  +      ML++ +  NK  M+++
Sbjct: 728 NNLKQYLTNNFFKNNHEELLSHHVQNTYAQLEENSAQLMQNFTMMLDKHIQENKRHMLEN 787

Query: 717 LRHAASEVVAKEMCLLDPVKQAWENSLENINECDKLNNVFENKIGVTVNEIFKTIDQGQK 776
           +     EV+  E+ +    +  WE S   IN+CD +N+ F   +G  + EI   +   + 
Sbjct: 788 ILGVTDEVINNELQMFGEQRAKWEKSSALINQCDSVNHSFHQALGSNLVEIRDVVSSSRD 847

Query: 777 TSQVTTEDAKSELTRVRAAFSSL-QNNGIILQNVDSIKKKH---NLLKSQVQDSANYMQA 832
               T    +S  TR R +   + Q N +I Q +  IK+K+   +L K    ++A     
Sbjct: 848 NIGATISSIQSR-TRNRQSIEEMIQGNDVIRQQITRIKQKNKSLSLFKEHSTETATTSIG 906

Query: 833 ATQKF-GEIDNSIQDLLNAQTIPQPQSENPIDGL--LEQLNDKSLKPLGPSGK 882
           +  K  G +   +  +LN   + + ++E P + L  LE++      PLG + K
Sbjct: 907 SVNKVEGNLKVIMDKVLNDPQLSRGKAEVPDEELHRLEKI------PLGITNK 953

 Score =  293 bits (749), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 136/178 (76%), Positives = 154/178 (86%), Gaps = 2/178 (1%)

Query: 5   EELNITVAVRCRGRNEKEVKARSSVVVAVPDVTGTNEVSINTTGDTGITAQINSKTYTVD 64
           EELNI VAVRCRGRNE+E+KA+SSVVV VPD   TNEVSINTT D GI A++NSKTYTVD
Sbjct: 30  EELNILVAVRCRGRNEREIKAKSSVVVDVPDNGVTNEVSINTTDDVGIAAKMNSKTYTVD 89

Query: 65  KVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSEG 124
           KVFGPSA Q L+++ IAEPLFQDFIKGYNCT+LVYGMTSTGKTYTMTGDE+L++GEL + 
Sbjct: 90  KVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGELGDA 149

Query: 125 AGIIPRVLFKLFDALSAQGDDYMIKCSFIELYNEELKDLLDE--TPDSSMPKKLRIFD 180
           AGIIPRVLF+LFD L A  DDY++KCSF+ELYNEELKDLLD   T  +S  KKLRIFD
Sbjct: 150 AGIIPRVLFELFDTLEANKDDYLVKCSFVELYNEELKDLLDSTNTATNSDNKKLRIFD 207

>Kpol_1045.73 s1045 complement(169347..172235) [2889 bp, 962 aa]
           {ON} complement(169349..172237) [2889 nt, 963 aa]
          Length = 962

 Score =  489 bits (1258), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 309/914 (33%), Positives = 500/914 (54%), Gaps = 42/914 (4%)

Query: 1   MSDDEELNITVAVRCRGR--NEKEVKARSSVVVAVPDVTGTNEVSINTTG-DTGITAQIN 57
           + D  E NI V  R +G+  NEK    R  +++  P +       I   G D  +     
Sbjct: 7   VKDKVECNIKVVARFKGQIDNEKGDDVRDQIIIEEPGL-------IKFKGKDDAV----- 54

Query: 58  SKTYTVDKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDE-RL 116
            + + +D +F     Q  ++    +P+FQDFI GYNC+ LVYG T +GKTYT++G+E  L
Sbjct: 55  KREFGMDHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSL 114

Query: 117 YDGELSE-GAGIIPRVLFKLFDALSAQGDDYMIKCSFIELYNEELKDLLDETPDSSMP-- 173
              E S    G+IPRVL +LFD LS    D+++KCS++E+YNEELKDLL +  +S +   
Sbjct: 115 LHSEASRLSVGVIPRVLEELFDHLSCNNIDHVVKCSYVEIYNEELKDLLVDQHNSLLSAS 174

Query: 174 -KKLRIFDX---XXXXXXXXXXXXXXXXPKPNEGS-------------SFGTRRKTRAPS 216
            KKLRI D                    P  +  S             S    ++    S
Sbjct: 175 IKKLRIVDSGSPNVKNGANSNCNTRDNSPLTSSKSIPTAIIRKKMGRQSLTALKQANTLS 234

Query: 217 IHRXXXXXXXX-XXXXXXXXXAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDV 275
           I R                  A +IQNL+EFHI +AKEGI+LL RGL++RQ+AS+K    
Sbjct: 235 ISRSNSFNEYSPQRHIQEKTGAPYIQNLEEFHITNAKEGIQLLHRGLKNRQIASSKNQKY 294

Query: 276 SSRSHTIFTIMLYKKCNGESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTL 335
           SSR+ TIFTI+LYK+  GE FRVSK N VDLAG+E+  +    NQR K+   INQ +  L
Sbjct: 295 SSRASTIFTIVLYKEEEGEIFRVSKWNFVDLAGAEHSHKIEGTNQRFKDINIINQGIQNL 354

Query: 336 GRVINSLADKSLHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATK 395
            +++NSL +K   IPF++SKLT L++D+L GN+K+  I T+   K + +E   TLE+  K
Sbjct: 355 NKIVNSLHEKESVIPFKDSKLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNK 414

Query: 396 AKNIKNKPQVGSFIMKDVLLKSVTAELVKIKSDLLSTKSKDGIYMSQENYKELTNELENY 455
            +++K  P +G  I K+ L+KS++ EL K+KSDLLSTKSK+G+YMS E+Y  LT +L+ +
Sbjct: 415 VRSLKCYPLLGPSINKETLIKSISNELAKVKSDLLSTKSKEGVYMSHEHYDVLTKDLDKH 474

Query: 456 KTEVEECKRAMEKVSAQNSLLIKEKRVSNEVNESQKVKLRKLGNNIEFLYDKIDRQHKNE 515
           K E+ + K+ +++++ Q++ L K+KR   EVNE Q++KL+ + +++  +Y  I++Q + E
Sbjct: 475 KVEIMDLKKVIDELNEQSTTLRKDKRAFEEVNEVQRIKLQSMRDSVSMMYTNIEKQQRRE 534

Query: 516 QELSNVVQELMRALHTMQQSLRIYEDQGQRFHTEMERVLYDNIGSFKKSLMDEIEKLKIX 575
            +L N   +L   ++ M  ++  Y D+     T+M+ +  + +   K  L+  + + +  
Sbjct: 535 HDLINSTDKLKETVNNMNVTIARYTDRESSVQTQMKTLFNEELSKLKSMLLKNLRQFEKN 594

Query: 576 XXXXXXXXXXXXXAVTTELTRIFDFMNSSNIEVFRNYIKKVNDQTPAYFKDIYSQXXXXX 635
                            E+ +I     +    +F + IKK+++++P  F           
Sbjct: 595 ELIDNLEIENNLNKAHEEIKQILQISENEIDSLFLDCIKKMSEESPKLFSSFIQDVSRLE 654

Query: 636 XXXXXXXXNLMIHLSSISEEYNNLKDYLNEHFFKNNFQEALDVHVDRTYHQLKVSANSIF 695
                   NL   LS +SEE+NNLK Y+NE FFKNN +E L  +V++TYHQ++ S++   
Sbjct: 655 NSTSENYNNLAELLSDVSEEFNNLKQYINEKFFKNNHEELLKTYVNKTYHQVQKSSDDFL 714

Query: 696 LKLREMLNEELDTNKEFMMQSLRHAASEVVAKEMCLLDPVKQAWENSLENINECDKLNNV 755
           LK  ++L   L+ NK  ++Q+++ A SEV+  EM    P K+ WE S+E I +    +N 
Sbjct: 715 LKFNDLLESYLEGNKSVLLQNIKSATSEVIENEMNHFIPQKEKWEKSIELIEKSKHSSNE 774

Query: 756 FENKIGVTVNEIFKTIDQGQKTSQVTTEDAKSELTRVRAAFSSLQNNGIILQNVDSIKKK 815
           F+ K  V V ++  T+    ++   T  + KS++  ++ A + ++NN ++ +   SI KK
Sbjct: 775 FKTKNRVIVGKLQDTLKGTSESLFDTLSEMKSKINELQKAANIIENNEVVTEEFISIMKK 834

Query: 816 HNLLKSQVQDSANYMQAATQKFGEIDNSIQDLLNAQ---TIPQPQSENPIDGLLEQLNDK 872
           + +LK  +  +    + +   F ++D+SI+++   +    I   QS   +  + +QL+ +
Sbjct: 835 NGILKDTLNINMTSTEESIVAFDKLDDSIRNVFKNEIDTNITGYQS--ILKEIFDQLDQQ 892

Query: 873 SLKPLGPSGKTPMR 886
            L P   + K+P+R
Sbjct: 893 RLTPNMRNRKSPVR 906

>TBLA0A07230 Chr1 (1803117..1806410) [3294 bp, 1097 aa] {ON}
           Anc_6.16 YEL061C
          Length = 1097

 Score =  479 bits (1234), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 282/626 (45%), Positives = 389/626 (62%), Gaps = 32/626 (5%)

Query: 238 IHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYKKCNGESFR 297
           I+IQNLQEF+I +A +GI+LLQ+GLRHR+VASTKMNDVSSRSHTIFTI LYK+ NG  +R
Sbjct: 334 IYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITLYKEHNGGLYR 393

Query: 298 VSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSLHIPFRESKLT 357
           VSKMNLVDLAGSENI++SGAQ+QRAKEAGSINQSLLTLGRVINSLADKS+HIPFRESKLT
Sbjct: 394 VSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLADKSIHIPFRESKLT 453

Query: 358 RLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGSFIMKDVLLKS 417
           RLLQDSLGGNTKT LI+TISPAKIN +ETSSTLEYA+KAKNIKNKP +GSFIMKDVLLK+
Sbjct: 454 RLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNIKNKPHLGSFIMKDVLLKN 513

Query: 418 VTAELVKIKSDLLSTKSKDGIYMSQENYKELTNELENYKTEVEECKRAMEKVSAQNSLLI 477
           +T EL KIKSDL+ST+ KDG+YMSQ++YKEL N+LE+YKTEV+E KRA E++ +QN  L+
Sbjct: 514 ITTELNKIKSDLMSTRLKDGVYMSQQHYKELNNDLESYKTEVQESKRANERLISQNGSLL 573

Query: 478 KEKRVSNEVNESQKVKLRKLGNNIEFLYDKIDRQHKNEQELSNVVQELMRALHTMQQSLR 537
           K+K+ SNE+NE Q++++ K    I+ LY+ +D  +K E  L  ++++L     +MQ ++ 
Sbjct: 574 KDKKASNELNELQRIQIEKKNEKIKELYEILDEHYKREDILVELIRQLKNVGTSMQSTIE 633

Query: 538 IYEDQGQRFHTEMERVLYDNIGSFKKSLMDEIEKLKIXXXXXXXXXXXXXXAVTTELTRI 597
            Y ++        +++L +      K L +E+ ++                         
Sbjct: 634 NYRERDLEIEESTKKILENEF----KFLKNELSQILSNINGNIIDNLKSSIISNNSSIEA 689

Query: 598 FDFMN-SSNIEVFRNYIKKVNDQTPAYFKDIYSQXXXXXXXXXXXXXN------------ 644
            D  N   NI++  N   K+  Q     + IYS              N            
Sbjct: 690 IDSSNFQKNIDIIENTTLKILKQVQEKSQHIYSSCIERILSDIPNILNKFKIEINSIDFQ 749

Query: 645 -------LMIHLSSISEEYNNLKDYLNEHFFKNNFQEALDVHVDRTYHQLKVSANSIFLK 697
                  +  +LS +SEEYNN K+YLN  F +NN++  L  H++    Q++  +N++ L 
Sbjct: 750 YNDQFNKITENLSDLSEEYNNFKEYLNNSFLQNNYELILKNHLESGQSQIESFSNNLLLN 809

Query: 698 LREMLNEELDTNKEFMMQSLRHAASEVVAKEMCLLDPVKQAWENSLENINECDKLNNVFE 757
           + + +NE    N +   + L +  +++V KE   + P K+ W  S+E IN  DK+NN F 
Sbjct: 810 INKQINEFKLHNSKLYEEKLNNIKNDIVKKETESIKPYKEKWVKSIEIINSTDKINNTFH 869

Query: 758 NKIGVTVNEIFKTIDQGQKTSQVTTEDAK-SELTRVRAAFSSLQNNGIILQNVDSIKKKH 816
           N +   + +I   I Q       +  D K +E+    A    L +N   + N++ +K K+
Sbjct: 870 NDMNNRILQINNLILQSHNDINNSINDIKVNEIRENEAVNEILSSNTEYVNNINELKIKN 929

Query: 817 -------NLLKSQVQDSANYMQAATQ 835
                    +    ++S NY+ +  Q
Sbjct: 930 MDYQEKLKCIGKSSENSINYLDSTKQ 955

 Score =  299 bits (766), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 136/176 (77%), Positives = 159/176 (90%), Gaps = 1/176 (0%)

Query: 5   EELNITVAVRCRGRNEKEVKARSSVVVAVPDVTGTNEVSINTTGDTGITAQINSKTYTVD 64
           EELNITVAVRCRGRNE+EV+A+SSVVV+VPD+ G+NEVSINT+ + GI A +NSKTYTVD
Sbjct: 9   EELNITVAVRCRGRNEREVQAKSSVVVSVPDIMGSNEVSINTSDEVGIAAHMNSKTYTVD 68

Query: 65  KVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSEG 124
           KVFGPSA Q L+FK IAEPLF+DFIKGYNCT+LVYGMTSTGKTYTMTGDE+LYDGELS+ 
Sbjct: 69  KVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKLYDGELSDS 128

Query: 125 AGIIPRVLFKLFDALSAQGDDYMIKCSFIELYNEELKDLLDETPDSSMPKKLRIFD 180
           AGIIPRVLFKLF++     DDY+IKCSF+ELYNE+LKDLLD++ D++  KKLRIFD
Sbjct: 129 AGIIPRVLFKLFESPEILNDDYIIKCSFVELYNEDLKDLLDDSVDNTY-KKLRIFD 183

>SAKL0F12298g Chr6 complement(958588..961926) [3339 bp, 1112 aa]
           {ON} similar to uniprot|P28742 Saccharomyces cerevisiae
           YBL063W KIP1 Kinesin-related motor protein required for
           mitotic spindle assembly and chromosome segregation
           functionally redundant with Cin8p
          Length = 1112

 Score =  374 bits (959), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 209/460 (45%), Positives = 280/460 (60%), Gaps = 61/460 (13%)

Query: 3   DDEELNITVAVRCRGRNEKEVKARSSVVVAVPDVTGTNEVSINTTGDTGITAQINSKTYT 62
           D    NI V VRCR RN++E+  +SSVV++     G + +  N +  +  +     KTYT
Sbjct: 49  DSPGYNIKVYVRCRSRNKREIGEKSSVVISTMGAQGRDVILSNPSSSSSGSLTNVKKTYT 108

Query: 63  VDKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE-- 120
            D+VFG  +DQ ++F  +A+    + ++GYNCTV  YG T TGKTYTM+GD  +      
Sbjct: 109 FDRVFGAESDQEVVFNSVAKNYISEMLQGYNCTVFAYGQTGTGKTYTMSGDINILGSTTH 168

Query: 121 --------LSEGAGIIPRVLFKLFDALSAQGDDYMIKCSFIELYNEELKDLLDET--PDS 170
                   LSE AGIIPRVL  LF  L  +  DY +K SF+ELYNE LKDLL ++   D 
Sbjct: 169 NHDQSSILLSEHAGIIPRVLVDLFKDLKNESTDYSVKVSFLELYNERLKDLLADSNKEDD 228

Query: 171 SMPKKLRIFDXXXXXXXXXXXXXXXXXPKPNEGSSFGTRRKTRAPSIHRXXXXXXXXXXX 230
           +  + +RIFD                 P+ N   S                         
Sbjct: 229 NNAESIRIFDNIK--------------PEKNTQGSH------------------------ 250

Query: 231 XXXXXXAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIML--- 287
                 +I ++ ++E +I  A+EG++LL  G   RQVASTK ND+SSRSHT+FTI     
Sbjct: 251 ------SIMVKGMEEIYIKSAQEGLKLLTEGSIKRQVASTKCNDLSSRSHTVFTITTNVT 304

Query: 288 -YKKCNGESF-RVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADK 345
                +GE + +  K+NLVDLAGSENI+RSGA+N+RA+EAG IN+SLLTLGRVIN+L D 
Sbjct: 305 KVDPLSGEEYVKNGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDH 364

Query: 346 SLHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQV 405
           S HIP+RESKLTRLLQDSLGG TKT +IAT+SPAKI+ EET STLEYAT+AK+IKN PQ+
Sbjct: 365 SQHIPYRESKLTRLLQDSLGGKTKTCIIATVSPAKISMEETVSTLEYATRAKSIKNTPQI 424

Query: 406 GSFIMKDVLLKSVTAELVKIKSDLLSTKSKDGIYMSQENY 445
              + KD  +     E+ +++ +L +T++KDGIY++QE Y
Sbjct: 425 NQSMTKDSCITEYIHEIDRLRKELRATRTKDGIYITQEKY 464

>ACR228C Chr3 complement(758111..761500) [3390 bp, 1129 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBL063W
           (KIP1)
          Length = 1129

 Score =  373 bits (958), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 226/505 (44%), Positives = 306/505 (60%), Gaps = 82/505 (16%)

Query: 6   ELNITVAVRCRGRNEKEVKARSSVVVAVPDVTGTNEVSINTTGDTGITAQINSKTYTVDK 65
           E NI V VRCR RNE+E++ +SSVV++     G  EV +   G TG     ++KTYT D+
Sbjct: 52  EYNIKVYVRCRSRNEREIREKSSVVISTLGNNG-REVILTNPG-TG-----SNKTYTFDR 104

Query: 66  VFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE----- 120
           VFG  +DQ  +F  +A     + I+GYNCTV  YG T TGKTYTM+GD  +         
Sbjct: 105 VFGVESDQESMFNQVARAYINEMIEGYNCTVFAYGQTGTGKTYTMSGDITMMGSSEDDPN 164

Query: 121 ---LSEGAGIIPRVLFKLFDALSAQGDDYMIKCSFIELYNEELKDLLDETPDSSM----- 172
              LSE AGIIPRVL +LF  L    +DY +K SF+ELYNE+L+DLL +  D S+     
Sbjct: 165 FVLLSEHAGIIPRVLVELFRELREVSEDYSVKVSFLELYNEKLRDLLVDDKDVSLEDHNF 224

Query: 173 -----PKKLRIFDXXXXXXXXXXXXXXXXXPKPNEGSSFGTRRKTRAPSIHRXXXXXXXX 227
                P+ +RI+D                        S  T R   +P+ +         
Sbjct: 225 NGMAPPESIRIYD------------------------SLKTDRT--SPNGY--------- 249

Query: 228 XXXXXXXXXAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIML 287
                    +I ++ ++E +I  A+EG++LL  G   R+VA+TK ND+SSRSHTIFTI  
Sbjct: 250 ---------SIFVKGMEEMYIRSAQEGLKLLMDGSLKRKVAATKCNDLSSRSHTIFTITT 300

Query: 288 ----YKKCNGESF-RVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSL 342
                   +GE + +V K+NLVDLAGSENI+RSGA+N+RA+EAG IN+SLLTLGRVIN+L
Sbjct: 301 NVTKIHPISGEQYVKVGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINAL 360

Query: 343 ADKSLHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNK 402
            D S HIP+RESKLTRLLQDSLGG TKT +IATISPAKI+ EET STLEYAT+AK+IKN 
Sbjct: 361 VDHSQHIPYRESKLTRLLQDSLGGKTKTCIIATISPAKISMEETVSTLEYATRAKSIKNT 420

Query: 403 PQVGSFIMKDVLLKSVTAELVKIKSDLLSTKSKDGIYMSQENYKELTNE---LENYKTEV 459
           PQV   + K+  +     E+ +++ +L ++ SK+GIY++QE ++   +    +E  + ++
Sbjct: 421 PQVNQLMAKESCIIEYIQEIERLRKELRASHSKEGIYITQEKFETYESNSILVEEQQAKI 480

Query: 460 ----EECKRAMEKVSAQNSLLIKEK 480
               E+ +R  EK   Q   LIKEK
Sbjct: 481 DNLQEQLRRLKEKFLEQTK-LIKEK 504

>ZYRO0B03234g Chr2 complement(263393..266809) [3417 bp, 1138 aa]
           {ON} similar to uniprot|P28742 Saccharomyces cerevisiae
           YBL063W KIP1 Kinesin-related motor protein required for
           mitotic spindle assembly and chromosome segregation
           functionally redundant with Cin8p
          Length = 1138

 Score =  366 bits (939), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 228/578 (39%), Positives = 328/578 (56%), Gaps = 80/578 (13%)

Query: 8   NITVAVRCRGRNEKEVKARSSVVVAVPDVTGTNEVSINTTGDTGITAQINSKTYTVDKVF 67
           NI V VRCR RN++E+  +SSVVV+     G + +  N +           KTY  D+VF
Sbjct: 44  NIKVYVRCRSRNQREIDEKSSVVVSTMGRKGKSVILSNPSSPLSHPK----KTYMFDEVF 99

Query: 68  GPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLY---DGE---- 120
           G  +DQ  IF  +A+   Q+ ++GYNCTV  YG T TGKTYTM+GD  ++   D +    
Sbjct: 100 GADSDQESIFTEVAKNYIQEMLEGYNCTVFAYGQTGTGKTYTMSGDMSIWGDLDSQDKIL 159

Query: 121 LSEGAGIIPRVLFKLFDALSAQGDDYMIKCSFIELYNEELKDLLDETPDSSMPKKLRIFD 180
           L E AGIIPRVL  LF  LS +  ++ +K SF+ELYNE LKDLL +  + S    +RIFD
Sbjct: 160 LGEHAGIIPRVLVNLFKQLSKETTEHSVKISFLELYNERLKDLLAD--NDSDEDNIRIFD 217

Query: 181 XXXXXXXXXXXXXXXXXPKPNEGSSFG------TRRKTRAPSIHRXX--XXXXXXXXXXX 232
                                 G+S G       + K RAP++                 
Sbjct: 218 NNNSNA---------------HGASNGMSQVKMNKSKVRAPTLSGATVSSSASNSSTSSS 262

Query: 233 XXXXAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLY---- 288
               +I ++ ++E +I  A EG++LL +G   R+VA+TK ND+SSRSHTIFTI+ +    
Sbjct: 263 SSSSSITVKGMEERYIKSAYEGLQLLTKGSLKRKVAATKCNDLSSRSHTIFTIVTHVART 322

Query: 289 KKCNGESF-RVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSL 347
              +GE + ++ K+NLVDLAGSENI+RSGA+N RA+EAG IN+SLLTLGRVIN+L + S 
Sbjct: 323 DPVSGEQYVKIGKLNLVDLAGSENINRSGAENMRAQEAGLINKSLLTLGRVINALVEHSS 382

Query: 348 HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGS 407
           HIP+R SKLTRLLQDSLGG TKT +IATISPA+I+ +ET STLEYAT+AK+IKN PQV  
Sbjct: 383 HIPYRGSKLTRLLQDSLGGKTKTCIIATISPARISMDETVSTLEYATRAKSIKNTPQVNQ 442

Query: 408 FIMKDVLLKSVTAELVKIKSDLLSTKSKDGIYMSQENYKELTNELENYKTEVEECKRAME 467
            + KD  +     E+ +++ +L +++ ++G+Y++QE Y                      
Sbjct: 443 SLSKDSCIMEYIYEIERLRQELKASRQREGMYITQEQY---------------------- 480

Query: 468 KVSAQNSLLIKEKRVSNEVNESQKVKLRKLGNNIEFLYDKIDRQHKNEQELSNVVQELMR 527
            +   NSLL++E          QKV ++ +G  I+   +K   Q K  +E     QE  +
Sbjct: 481 DLYESNSLLVEE----------QKVVIQNMGEQIKRFKEKYVEQTKLSKEAHRQFQESQK 530

Query: 528 ALHTMQQSLRIYEDQGQRFHT-------EMERVLYDNI 558
              T++   +   +  +++HT       +++++  DNI
Sbjct: 531 VCDTLRIQKKFMLETFEKYHTTCKEHAAQIDQIHSDNI 568

>TPHA0J00300 Chr10 (65794..68742) [2949 bp, 982 aa] {ON} Anc_6.16
           YEL061C
          Length = 982

 Score =  362 bits (930), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 301/988 (30%), Positives = 489/988 (49%), Gaps = 98/988 (9%)

Query: 8   NITVAVRCRGRNEKEVKARSSVVVAVPD-VTGTNEVSINTTGDTGITAQINSKTYTVDKV 66
           NITVAVRCR   ++E  + S  ++++ D   GT+   I     TG       K YT+D V
Sbjct: 9   NITVAVRCREPIDEEKHSGSPTIISIGDNEDGTSNEVIVLDESTG-----RKKIYTLDAV 63

Query: 67  FGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGD----ERLYDGELS 122
           +G   DQ  +F     P ++ F  GYN +++ YG   +GK YT+ G+    +   + E S
Sbjct: 64  YGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNANNAE-S 122

Query: 123 EGAGIIPRVLFKLFDALSAQGDDYMIKCSFIELYNEELKDLLDETPD-----------SS 171
           E  G++PRVL +LF  L + G+D++IKCSF+E+YN+EL+DLL +T +            S
Sbjct: 123 ENLGVVPRVLSRLFKDLESNGNDHIIKCSFVEIYNDELRDLLIDTGNNANGNNSNGATGS 182

Query: 172 MPKKLRIFDXXXXXXXXXXXXXXXXXPK------------------------PNEGSSFG 207
             KKLRI D                                           PN   S  
Sbjct: 183 TGKKLRIVDSASNGLRSAGSSNSSTRDNSPLTNSKKIPTAMMRKRMGKRSLPPNNSISNN 242

Query: 208 TRRKTRAPSIHRXXXXXXXXXXXXXXXXXAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQV 267
           T    R  S+ R                 +I+IQNLQE  I + +EG+ ++++GL++R++
Sbjct: 243 TANNNRL-SLSRTNSFSDYSLQSSHERLNSIYIQNLQEITITEIEEGMAIIKKGLKNRRI 301

Query: 268 AST----KMNDVSSRSHTIFTIMLYKKCN-GESFRVSKMNLVDLAGSENISRSGAQNQRA 322
           AST      N+ S RSH+IF I LYK+    E FR+SK++ V+ AGSE    + ++N   
Sbjct: 302 ASTGSASDKNEFSKRSHSIFNITLYKEEEVNEVFRMSKLSFVNFAGSEYGDNNTSKN--- 358

Query: 323 KEAGSINQSLLTLGRVINSLADKSLHIPFRESKLTRLLQDSLGGNTKTALIATISPAKIN 382
              G+ N +L +  ++IN + + S +  F +SKLT+LLQ++  G T+T  IA I+P K  
Sbjct: 359 ---GAFNSNLQSFNKMINGMVNNSTYASFLDSKLTQLLQNNFDGITRTLFIANIAPLKKQ 415

Query: 383 SEETSSTLEYATKAKNIKNKPQVGSFIMKDVLLKSVTAELVKIKSDLLSTKSKD-GIYMS 441
            + T S L  ATK K IKN+P+ GS I K+ L+K ++ ELVK KSDLLS KS D GIYM 
Sbjct: 416 LDATCSVLTMATKIKEIKNEPKKGSVITKESLIKILSNELVKTKSDLLSYKSNDNGIYMD 475

Query: 442 QENYKELTNELENYKTEVEECKRAMEKVSAQNSLLIKEKRVSNEVNESQKVKLRKLGNNI 501
           +++Y ELT  LE+YK +++  K ++ +++ + + +  EKR   E+NE Q++KL+ L   I
Sbjct: 476 EKHYSELTKTLESYKEKIQNSKNSINELTKKGNEIRIEKRTFEEINERQRIKLQNLRETI 535

Query: 502 EFLYDKIDRQHKNEQELSNVVQELMRALHTMQQSLRIYEDQGQRFHTEMERVLYDN-IGS 560
             L   +++Q K E EL N+  +L   L  MQ+S+  Y D+      ++ ++LYD  +  
Sbjct: 536 SNLNCALEKQSKRESELENIKIKLHSILGNMQKSVEKYSDKEIHLQNKL-KLLYDKELVK 594

Query: 561 FKKSLMDEIEKLKIXXXXXXXXXXXXXXAVTTELTRIFDFMNSSNIEVFRNYIKKVNDQT 620
            K SL      +K                +  E+ +I +   S   E+  N   +V D +
Sbjct: 595 LKNSLESNFADIKNRMPDDNDNMNTNIDNIKAEILKIANQSQSKVKELLTNSANQVLDTS 654

Query: 621 PAYFKDIYSQXXXXXXXXXXXXXNLMIHLSSISEEYNNLKDYLNEHFFKNNFQEALDVHV 680
           P YF+ + +                   LS ISEE+NNL +Y+N++F K++ +E +D ++
Sbjct: 655 PKYFEQLDTNLKNLEESVEINHNKYSELLSDISEEFNNLNNYINDNFLKSSHEELIDTYI 714

Query: 681 DRTYHQLKVSANSIFLKLREMLNEELDTNKEFMMQSLRHAASEVVAKEMCLLDPVKQAWE 740
           +RTYH+++  +       +++L+  ++ N + + +S+    SE+V  E+   +P K+ WE
Sbjct: 715 NRTYHEVQGISVEFTENFKKLLDIYVEKNTKSLSKSITSLTSEIVENELTQFNPEKKKWE 774

Query: 741 NS----LENINECDKLNNVFENKIGVTVNEIFKTIDQGQKTSQVTTEDAKSELTRVRAA- 795
            +    +EN NE    N    ++I      + K + +   TS++   +  S    V    
Sbjct: 775 LASNEIIENFNESITKNKNKNSEI------LAKLLSESTSTSELFINNMSSIKKNVEIVE 828

Query: 796 -FSSLQN-NGIILQNVDSIKKKHNLLKSQVQDSANYMQAATQKFGEIDNSIQDLLNAQTI 853
            FS + N N +I      I  K+  LK  + D+ N  + +   F  +  ++Q++   + +
Sbjct: 829 EFSEIFNSNDLIKSEFLEIINKNKKLKDLITDNFNSSENSIDSFDNLKEAMQNVFKNE-M 887

Query: 854 PQPQSENPID--GLLEQLNDKSLKPLGPSGKTPMRTVQRSVTNTDQLLPPQKSSYTISPI 911
            +  S + ++   + EQ+  + L     S K   +          Q L P K    ISPI
Sbjct: 888 KESYSNDTLNLKEIFEQMEQQKLGVNSSSKKKAYK----------QNLSPSK----ISPI 933

Query: 912 KEIDGNRRLTSPHKRGVVS----DHERP 935
           K    + +L SP K  + S    D +RP
Sbjct: 934 K---SSTKLNSPLKVEIQSLSEIDMKRP 958

>Ecym_4688 Chr4 (1342239..1345643) [3405 bp, 1134 aa] {ON} similar
           to Ashbya gossypii ACR228C
          Length = 1134

 Score =  365 bits (938), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 218/511 (42%), Positives = 305/511 (59%), Gaps = 84/511 (16%)

Query: 2   SDDEELNITVAVRCRGRNEKEVKARSSVVVAVPDVTGTNEVSINTTGDTGITAQINSKTY 61
           S+++  NI V VRCR RN +E+K +SSVVV+     G   +  N +  TG     N+KTY
Sbjct: 50  SEEQGYNIKVYVRCRSRNVREIKEKSSVVVSTLGSQGREIILSNQS--TG-----NNKTY 102

Query: 62  TVDKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGEL 121
           T D+VFG  +DQ  +F  +A     + ++GYNCTV  YG T TGKTYTM+GD  +    L
Sbjct: 103 TFDQVFGVESDQESLFDKVARAYITEMLEGYNCTVFAYGQTGTGKTYTMSGDISVVGASL 162

Query: 122 --------SEGAGIIPRVLFKLFDALSAQGDDYMIKCSFIELYNEELKDLLDETPD---- 169
                   SE AGIIPRVL +LF  L  + +DY +K SF+ELYNE+L+DLL E  +    
Sbjct: 163 EDPNYVLLSEHAGIIPRVLVELFQQLQRESEDYSVKVSFLELYNEKLRDLLVEDKEPLID 222

Query: 170 --------SSMPKKLRIFDXXXXXXXXXXXXXXXXXPKPNEGSSFGTRRKTRAPSIHRXX 221
                   ++ P+ +RI+D                  K +  +S G              
Sbjct: 223 EGGIGGGVANSPETIRIYDNL----------------KLDRSNSSG-------------- 252

Query: 222 XXXXXXXXXXXXXXXAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHT 281
                          +I ++ ++E +I  A+EG++LL  G   R+VA+T+ ND+SSRSHT
Sbjct: 253 --------------HSIMVKGMEEMYIRSAQEGLKLLMEGSLKRKVAATRCNDLSSRSHT 298

Query: 282 IFTIML----YKKCNGESF-RVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLG 336
           IFTI          +GE + ++ K+NLVDLAGSENI+RSGA+N+RA+EAG IN+SLLTLG
Sbjct: 299 IFTITTNVTKIHPISGEQYVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLG 358

Query: 337 RVINSLADKSLHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKA 396
           RVIN+L D S HIP+RESKLTRLLQDSLGG TKT +IAT+SPAK + EET+STLEYAT+A
Sbjct: 359 RVINALVDHSQHIPYRESKLTRLLQDSLGGKTKTCIIATVSPAKTSMEETASTLEYATRA 418

Query: 397 KNIKNKPQVGSFIMKDVLLKSVTAELVKIKSDLLSTKSKDGIYMSQENYKELTNE---LE 453
           K+IKN PQ+   + K+  +     E+ K++ +L +  +K+GIY+++E Y+   +    +E
Sbjct: 419 KSIKNTPQINQLMAKESCILGYIKEIEKLRKNLKANHAKEGIYITEEKYETYESNCILVE 478

Query: 454 NYKTEV----EECKRAMEKVSAQNSLLIKEK 480
             + ++    E+ KR  EK   Q   L+KEK
Sbjct: 479 EQQAKIDNLQEQIKRFKEKYLEQTK-LVKEK 508

>Suva_2.54 Chr2 (99000..102332) [3333 bp, 1110 aa] {ON} YBL063W
           (REAL)
          Length = 1110

 Score =  362 bits (928), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 209/459 (45%), Positives = 281/459 (61%), Gaps = 75/459 (16%)

Query: 6   ELNITVAVRCRGRNEKEVKARSSVVVAVPDVTGTNEVSINTTGDTGITAQINSKTYTVDK 65
           E NI V VRCR RN +E+  +SSVV++     G   +  N +  +  +++   KTY  D+
Sbjct: 50  ESNIHVYVRCRSRNRREIDEKSSVVISTLGPQGKEIILSNGSHQSYSSSK---KTYQFDQ 106

Query: 66  VFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE----- 120
           VFG  +DQ ++F   A+   ++ + GYNCT+  YG T TGKTYTM+GD  +  G+     
Sbjct: 107 VFGAESDQEMVFHATAKNYIREMLHGYNCTIFAYGQTGTGKTYTMSGDINIL-GDVQSTD 165

Query: 121 ---LSEGAGIIPRVLFKLFDALSAQGDDYMIKCSFIELYNEELKDLL----DETPDSSMP 173
              L E AGIIPRVL  LF  LS+   +Y +K SF+ELYNE LKDLL    D+ P ++  
Sbjct: 166 NLLLGEHAGIIPRVLVDLFKELSSLNKEYSVKVSFLELYNENLKDLLSDNEDDDPTANDS 225

Query: 174 KK-LRIFDXXXXXXXXXXXXXXXXXPKPNEGSSFGTRRKTRAPSIHRXXXXXXXXXXXXX 232
           KK +RIFD                    N  SS                           
Sbjct: 226 KKQIRIFDNN------------------NNNSS--------------------------- 240

Query: 233 XXXXAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLY---- 288
                I ++ +QE  I  A EG+ LL +G   R+VA+TK ND+SSRSHT+FTI       
Sbjct: 241 -----IMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIIEQ 295

Query: 289 -KKCNGES---FRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLAD 344
             K +G++    ++ K+NLVDLAGSENI+RSGA+N+RA+EAG IN+SLLTLGRVIN+L D
Sbjct: 296 DSKEHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVD 355

Query: 345 KSLHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQ 404
            S HIP+RESKLTRLLQDSLGG TKT +IAT+SPAKI+ EET+STLEYAT+AK+IKN PQ
Sbjct: 356 HSNHIPYRESKLTRLLQDSLGGMTKTCIIATVSPAKISMEETASTLEYATRAKSIKNSPQ 415

Query: 405 VGSFIMKDVLLKSVTAELVKIKSDLLSTKSKDGIYMSQE 443
           V   + KD  LK    E+ K+++DL ++++K GI+++Q+
Sbjct: 416 VNQSLSKDTCLKDYIQEIEKLRNDLKNSRNKQGIFITQD 454

>KAFR0L01710 Chr12 complement(308820..312275) [3456 bp, 1151 aa]
           {ON} Anc_7.387 YBL063W
          Length = 1151

 Score =  361 bits (927), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 227/563 (40%), Positives = 318/563 (56%), Gaps = 79/563 (14%)

Query: 8   NITVAVRCRGRNEKEVKARSSVVVAVPDVTGTNEVSINTTGDTGITAQINSKTYTVDKVF 67
           NI V VRCR RN++E++ +SSVV++     G   V      D         KTY  D+VF
Sbjct: 59  NIQVYVRCRSRNQREIEEKSSVVISTMGAQGKEVV----LSDPSSVLSHTKKTYIFDQVF 114

Query: 68  GPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGD-ERLYDGE------ 120
           G  +DQ ++F   A+    + ++GYNCT+  YG T TGKTYTM+GD   L D E      
Sbjct: 115 GVESDQEVVFNATAQNYIHEMLQGYNCTIFAYGQTGTGKTYTMSGDINILGDLESQDKIL 174

Query: 121 LSEGAGIIPRVLFKLFDALSAQGDDYMIKCSFIELYNEELKDLLDETPDSSMPKKLRIFD 180
           L E AGIIPRVL  LF  L+ +  +Y +K SF+ELYNE LKDLL ++ ++   + +RIFD
Sbjct: 175 LGEHAGIIPRVLVNLFQYLTRESTEYSVKISFLELYNERLKDLLSQSKETE--ESIRIFD 232

Query: 181 XXXXXXXXXXXXXXXXXPKPNEGSSFGTRRKTRAPSIHRXXXXXXXXXXXXXXXXXAIHI 240
                            P  N      +R  T +                      +I +
Sbjct: 233 NHI--------------PSGNSKIQKSSRNNTYS----------------------SIMV 256

Query: 241 QNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYKK----CNGESF 296
           + ++E +I  A EG++LL  G   R+VASTK ND+SSRSHTIFTI          +GE +
Sbjct: 257 KGMEEIYIKSAHEGLQLLTEGSLKRKVASTKCNDLSSRSHTIFTITTNITKIDPVSGEQY 316

Query: 297 -RVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSLHIPFRESK 355
            ++ K+NLVDLAGSENISRSGA+N RA+EAG IN+SLLTLGRVIN+L D S HIP+RESK
Sbjct: 317 VKIGKLNLVDLAGSENISRSGAENMRAQEAGLINKSLLTLGRVINALVDHSQHIPYRESK 376

Query: 356 LTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGSFIMKDVLL 415
           LTRLLQDSLGG TKT +IAT+SPAKI+ EET STLEYAT+AK+IKN PQ+   + KDV +
Sbjct: 377 LTRLLQDSLGGKTKTCIIATVSPAKISMEETISTLEYATRAKSIKNTPQINQSMSKDVCI 436

Query: 416 KSVTAELVKIKSDLLSTKSKDGIYMSQENYKELTNELENYKTEVEECKRAMEKVSAQNSL 475
                E+ +++ +L +++ KDG+Y++QE +                       +   N +
Sbjct: 437 NEYVQEIERLRQELKASRQKDGVYITQEQF----------------------DLYESNGI 474

Query: 476 LIKEKRVSNEVNESQKVKLRKLGNNIEFLYDKIDRQHKNEQELSNVVQELMRALHTMQQS 535
           L+ E++      E Q  K ++   N   +  +++   KN QELSN   +L+    ++   
Sbjct: 475 LVDEQKAKIVNMEEQIKKFKEKYVNQTAINKELETSLKNSQELSN---DLLDKQASLISI 531

Query: 536 LRIYEDQGQRFHTEMERVLYDNI 558
              Y+   + F TE+  +  +N+
Sbjct: 532 FGEYQSNFKLFETEINTIHENNL 554

>TDEL0C01600 Chr3 (276912..280229) [3318 bp, 1105 aa] {ON} Anc_7.387
           YBL063W
          Length = 1105

 Score =  357 bits (917), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 199/451 (44%), Positives = 278/451 (61%), Gaps = 42/451 (9%)

Query: 8   NITVAVRCRGRNEKEVKARSSVVVAVPDVTGTNEVSINTTGDTGITAQINSKTYTVDKVF 67
           N+ V VRCR RNE+E++ +SSVV++     G   +  N  G    +   + +TYT D+VF
Sbjct: 41  NMRVYVRCRSRNEQEIEEKSSVVISTLGAKGREVILSNGAG----SLSHSKRTYTFDQVF 96

Query: 68  GPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLY---DGE---- 120
           G  +DQ  +F  +A+    + ++GYNCTV  YG T TGKTYTM+GD  +    D +    
Sbjct: 97  GAESDQETVFDEVAKDYISEMLEGYNCTVFTYGQTGTGKTYTMSGDISILGDLDSQDKIL 156

Query: 121 LSEGAGIIPRVLFKLFDALSAQGDDYMIKCSFIELYNEELKDLLDETPDSSMPKKLRIFD 180
           L E +GIIPRVL  LF  LS + ++Y +K SF+ELYNE+LKDLL E+      + +RIFD
Sbjct: 157 LGEHSGIIPRVLVDLFKQLSQETNEYTVKVSFLELYNEKLKDLLAESEQEE--ENIRIFD 214

Query: 181 XXXXXXXXXXXXXXXXXPKPNEGSSFGTRRKTRAPSIHRXXXXXXXXXXXXXXXXXAIHI 240
                                  S F   +  +                       +I +
Sbjct: 215 N---------------------NSGFNCNKNVKQLV---KLDGSSHRTSSASSSSSSIMV 250

Query: 241 QNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYKK-----CNGES 295
           + ++EF+I  A EG+ LL  G   R+VA+TK ND+SSRSHT+FTI           N + 
Sbjct: 251 KGMEEFYIKSAHEGLELLMTGSLKRKVAATKCNDLSSRSHTVFTITTNVARTDPVSNEQY 310

Query: 296 FRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSLHIPFRESK 355
            ++ K+NLVDLAGSENI+RSGA+N+RA+EAG IN+SLLTLGRVIN+L D S HIP+RESK
Sbjct: 311 IKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDNSQHIPYRESK 370

Query: 356 LTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGSFIMKDVLL 415
           LTRLLQDSLGG TKT +IATISPAKI+ +ET STLEYAT+AK+IKN PQV   + K+  L
Sbjct: 371 LTRLLQDSLGGKTKTCIIATISPAKISMDETVSTLEYATRAKSIKNTPQVNQSMSKNSCL 430

Query: 416 KSVTAELVKIKSDLLSTKSKDGIYMSQENYK 446
                E+ +++ +L +++ K+G+Y++++ ++
Sbjct: 431 GEYIHEIERLRQELKASRQKEGMYITEDQFQ 461

>Skud_2.41 Chr2 (85542..88874) [3333 bp, 1110 aa] {ON} YBL063W
           (REAL)
          Length = 1110

 Score =  356 bits (913), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 205/457 (44%), Positives = 278/457 (60%), Gaps = 75/457 (16%)

Query: 8   NITVAVRCRGRNEKEVKARSSVVVAVPDVTGTNEVSINTTGDTGITAQINSKTYTVDKVF 67
           NI V VRCR RN++E+  +SSVV++     G   +  N +  +  +++   KTY  D+VF
Sbjct: 51  NIHVYVRCRSRNKREIDEKSSVVISTLGPQGKEIILSNGSHQSYSSSK---KTYQFDQVF 107

Query: 68  GPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE------- 120
           G  +DQ  +F   A+   ++ + GYNCT+  YG T TGKTYTM+GD  +  G+       
Sbjct: 108 GAESDQETVFNATAKNYIREMLHGYNCTIFAYGQTGTGKTYTMSGDINIL-GDVQSTDNL 166

Query: 121 -LSEGAGIIPRVLFKLFDALSAQGDDYMIKCSFIELYNEELKDLLDETPD-----SSMPK 174
            L E AGIIPRVL  LF  LS+   +Y +K +F+ELYNE LKDLL +  D     +   +
Sbjct: 167 LLGEHAGIIPRVLVDLFKELSSLNKEYSVKVTFLELYNENLKDLLSDNEDDDPAVNDSKR 226

Query: 175 KLRIFDXXXXXXXXXXXXXXXXXPKPNEGSSFGTRRKTRAPSIHRXXXXXXXXXXXXXXX 234
           ++RIFD                    N  SS                             
Sbjct: 227 QIRIFDNN------------------NNNSS----------------------------- 239

Query: 235 XXAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLY-----K 289
              I ++ +QE  I  A EG+ LL +G   R+VA+TK ND+SSRSHT+FTI         
Sbjct: 240 ---IMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIVEQDS 296

Query: 290 KCNGES---FRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKS 346
           K +G++    ++ K+NLVDLAGSENI+RSGA+N+RA+EAG IN+SLLTLGRVIN+L D S
Sbjct: 297 KDHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHS 356

Query: 347 LHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVG 406
            HIP+RESKLTRLLQDSLGG TKT +IATISPAKI+ EET+STLEYAT+AK+IKN PQV 
Sbjct: 357 NHIPYRESKLTRLLQDSLGGMTKTCIIATISPAKISMEETASTLEYATRAKSIKNTPQVN 416

Query: 407 SFIMKDVLLKSVTAELVKIKSDLLSTKSKDGIYMSQE 443
             + KD  LK    E+ K+++DL ++++K GI+++Q+
Sbjct: 417 QSLSKDTCLKDYIQEIEKLRNDLKNSRNKQGIFITQD 453

>YBL063W Chr2 (101886..105221) [3336 bp, 1111 aa] {ON}
           KIP1Kinesin-related motor protein required for mitotic
           spindle assembly, chromosome segregation, and 2 micron
           plasmid partitioning; functionally redundant with Cin8p
           for chromosomal but not plasmid functions
          Length = 1111

 Score =  352 bits (902), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 231/583 (39%), Positives = 332/583 (56%), Gaps = 119/583 (20%)

Query: 8   NITVAVRCRGRNEKEVKARSSVVVAVPDVTGTNEVSINTTGDTGITAQINSKTYTVDKVF 67
           NI V VRCR RN++E++ +SSVV++     G   +  N +  +  +++   KTY  D+VF
Sbjct: 52  NIHVYVRCRSRNKREIEEKSSVVISTLGPQGKEIILSNGSHQSYSSSK---KTYQFDQVF 108

Query: 68  GPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE------- 120
           G  +DQ  +F   A+   ++ + GYNCT+  YG T TGKTYTM+GD  +  G+       
Sbjct: 109 GAESDQETVFNATAKNYIKEMLHGYNCTIFAYGQTGTGKTYTMSGDINIL-GDVQSTDNL 167

Query: 121 -LSEGAGIIPRVLFKLFDALSAQGDDYMIKCSFIELYNEELKDLLDET----PDSSMPKK 175
            L E AGIIPRVL  LF  LS+   +Y +K SF+ELYNE LKDLL ++    P  + PK+
Sbjct: 168 LLGEHAGIIPRVLVDLFKELSSLNKEYSVKISFLELYNENLKDLLSDSEDDDPAVNDPKR 227

Query: 176 -LRIFDXXXXXXXXXXXXXXXXXPKPNEGSSFGTRRKTRAPSIHRXXXXXXXXXXXXXXX 234
            +RIFD                    N  SS                             
Sbjct: 228 QIRIFDNN------------------NNNSS----------------------------- 240

Query: 235 XXAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLY-----K 289
              I ++ +QE  I  A EG+ LL +G   R+VA+TK ND+SSRSHT+FTI         
Sbjct: 241 ---IMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIVEQDS 297

Query: 290 KCNGES---FRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKS 346
           K +G++    ++ K+NLVDLAGSENI+RSGA+N+RA+EAG IN+SLLTLGRVIN+L D S
Sbjct: 298 KDHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHS 357

Query: 347 LHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVG 406
            HIP+RESKLTRLLQDSLGG TKT +IATISPAKI+ EET+STLEYAT+AK+IKN PQV 
Sbjct: 358 NHIPYRESKLTRLLQDSLGGMTKTCIIATISPAKISMEETASTLEYATRAKSIKNTPQVN 417

Query: 407 SFIMKDVLLKSVTAELVKIKSDLLSTKSKDGIYMSQENYKELTNELENYKTEVEECKRAM 466
             + KD  LK    E+ K+++DL ++++K GI+++Q+       +L+ Y++         
Sbjct: 418 QSLSKDTCLKDYIQEIEKLRNDLKNSRNKQGIFITQD-------QLDLYES--------- 461

Query: 467 EKVSAQNSLLIKEKRVSNEVNESQKVKLRKLGNNIEFLYDKIDRQHKNEQELSNVVQELM 526
                 NS+LI E          Q +K+  L   I+    K    + N+ +++N++Q   
Sbjct: 462 ------NSILIDE----------QNLKIHNLREQIK----KFKENYLNQLDINNLLQSEK 501

Query: 527 RALHTMQQSLRIYEDQGQRFHTEMERVLYDNIGSFKKSLMDEI 569
             L  + Q+  +       F++E++++ + N+      LM+E+
Sbjct: 502 EKLIAIIQNFNV---DFSNFYSEIQKIHHTNL-----ELMNEV 536

>Smik_2.53 Chr2 (95765..99106) [3342 bp, 1113 aa] {ON} YBL063W
           (REAL)
          Length = 1113

 Score =  348 bits (894), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 246/630 (39%), Positives = 340/630 (53%), Gaps = 127/630 (20%)

Query: 8   NITVAVRCRGRNEKEVKARSSVVVAVPDVTGTNEVSINTTGDTGITAQINSKTYTVDKVF 67
           NI V VRCR RN++E+  +SSVV++     G   +  N +  +  +++   KTY  D+VF
Sbjct: 52  NIHVYVRCRSRNKREIDEKSSVVISTLGPQGKEIILSNGSHQSYSSSK---KTYQFDQVF 108

Query: 68  GPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE------- 120
           G  +DQ  +F   A+   ++ + GYNCT+  YG T TGKTYTM+GD  +  G+       
Sbjct: 109 GAESDQETVFNATAKNYIREMLHGYNCTIFAYGQTGTGKTYTMSGDINIL-GDVQSTDKL 167

Query: 121 -LSEGAGIIPRVLFKLFDALSAQGDDYMIKCSFIELYNEELKDLLDETPD-----SSMPK 174
            L E AGIIPRVL  LF  LS    +Y +K SF+ELYNE LKDLL ++ D     +   +
Sbjct: 168 LLGEHAGIIPRVLVDLFKELSTLNREYSVKISFLELYNENLKDLLSDSDDDDPVVNDTKR 227

Query: 175 KLRIFDXXXXXXXXXXXXXXXXXPKPNEGSSFGTRRKTRAPSIHRXXXXXXXXXXXXXXX 234
           ++RIFD                    N  SS                             
Sbjct: 228 QIRIFDNN------------------NNNSS----------------------------- 240

Query: 235 XXAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLY-----K 289
              I ++ +QE  I  A EG+ LL +G   R+VA+TK ND+SSRSHT+FTI         
Sbjct: 241 ---IMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIVEQDS 297

Query: 290 KCNGES---FRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKS 346
           K +G++    ++ K+NLVDLAGSENI+RSGA+N+RA+EAG IN+SLLTLGRVIN+L D S
Sbjct: 298 KDHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHS 357

Query: 347 LHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVG 406
            HIP+RESKLTRLLQDSLGG TKT +IAT+SPAKI+ EET+STLEYAT+AK+IKN PQV 
Sbjct: 358 NHIPYRESKLTRLLQDSLGGMTKTCIIATVSPAKISMEETASTLEYATRAKSIKNTPQVN 417

Query: 407 SFIMKDVLLKSVTAELVKIKSDLLSTKSKDGIYMSQ------ENYKELTNELENYKTE-- 458
             + KD  LK    E+ K+K+DL ++++K GI+++Q      E+   L +E +N K    
Sbjct: 418 QSLSKDTCLKDYIQEIEKLKNDLKNSRNKQGIFITQDQLDLYESNSILIDE-QNLKIHNL 476

Query: 459 VEECKRAMEKVSAQ---NSLLIKEKRVSNEVNESQKVKLRKLGNNIEFLYDKIDRQHKNE 515
            E+ K+  EK   Q   N+LL  EK       E     +R    +    Y KI + H   
Sbjct: 477 REQIKKFKEKYLTQLDINNLLQSEK-------EKLVTVIRDFDIDYSHFYSKIQQIHYTN 529

Query: 516 QELSNVV--------------------------QELMRALHTMQQSLRIYEDQGQRFHTE 549
            EL N V                          Q++++ L+++Q SLR Y  +  +    
Sbjct: 530 LELINQVTQQRDSSHENCQKQYTANQNMQLKISQQVLQTLNSLQNSLRNYNSKFSQVING 589

Query: 550 MERVLYDNIGSFK-------KSLMDEIEKL 572
           +   L +++ S K       KSLM+    L
Sbjct: 590 VTEELTNSVNSHKVNHDSTFKSLMNTTANL 619

>NDAI0E04300 Chr5 complement(965403..968963) [3561 bp, 1186 aa] {ON}
           Anc_7.387
          Length = 1186

 Score =  350 bits (897), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 200/448 (44%), Positives = 268/448 (59%), Gaps = 68/448 (15%)

Query: 8   NITVAVRCRGRNEKEVKARSSVVVAVPDVTGTNEVSINTTGDTGITAQINSKTYTVDKVF 67
           NI V VRCR R+E+E+K +SSVV++     G   +  N +           K+Y+ D+VF
Sbjct: 108 NIKVYVRCRSRSEREIKEKSSVVISTLGPQGNQVILSNPSSPLSYPK----KSYSFDRVF 163

Query: 68  GPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE------- 120
           G  +DQ  +F   A+    + + GYNCTV  YG T TGKTYTM+GD  +           
Sbjct: 164 GAESDQETVFNDAAKNYISEMLSGYNCTVFAYGQTGTGKTYTMSGDLNILGNLESKDMIL 223

Query: 121 LSEGAGIIPRVLFKLFDALSAQGDDYMIKCSFIELYNEELKDLLDETPDSSMPKKLRIFD 180
           L E AGIIPRVL  LF  L+ + +DY +K SF+ELYNE LKDL  +  + S  + +RIFD
Sbjct: 224 LGEHAGIIPRVLVNLFKMLALE-NDYSVKISFLELYNERLKDLFAQ--NESEEETIRIFD 280

Query: 181 XXXXXXXXXXXXXXXXXPKPNEGSSFGTRRKTRAPSIHRXXXXXXXXXXXXXXXXXAIHI 240
                               N  SS                               +I +
Sbjct: 281 NN------------------NNASS-------------------------------SIMV 291

Query: 241 QNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIML----YKKCNGESF 296
           + ++E +I  A EG++LL  G   R+VASTK ND+SSRSHT+FTI          +GE +
Sbjct: 292 KGMEEIYIKSAHEGLQLLMDGSLKRKVASTKCNDLSSRSHTVFTIATNITKIDPISGEQY 351

Query: 297 -RVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSLHIPFRESK 355
            +  K+NLVDLAGSENI+RSGA+N+RA+EAG IN+SLLTLGRVIN+L D S HIP+RESK
Sbjct: 352 IKTGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHSQHIPYRESK 411

Query: 356 LTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGSFIMKDVLL 415
           LTRLLQDSLGG TKT +IATISPAKI+ EET STLEYA +AK+IKN PQ+   + KD  +
Sbjct: 412 LTRLLQDSLGGKTKTCIIATISPAKISMEETVSTLEYAIRAKSIKNTPQINQSMSKDTCI 471

Query: 416 KSVTAELVKIKSDLLSTKSKDGIYMSQE 443
               +E+ +++ +L +++ KDGI ++Q+
Sbjct: 472 NEYVSEIERLRLELKTSRQKDGICITQD 499

>NCAS0E02640 Chr5 (527838..531146) [3309 bp, 1102 aa] {ON} Anc_7.387
          Length = 1102

 Score =  346 bits (888), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 197/450 (43%), Positives = 272/450 (60%), Gaps = 69/450 (15%)

Query: 9   ITVAVRCRGRNEKEVKARSSVVVAVPDVTGTNEVSINTTGDTGITAQINSKTYTVDKVFG 68
           I V VRCR RNE+E++ +SSVV++      + ++ ++        A+   +TYT D+VFG
Sbjct: 61  IKVYVRCRSRNEREIQEKSSVVISTLGAPQSTQLLLSNPLLPLAYAK---RTYTFDRVFG 117

Query: 69  PSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGEL------- 121
             +DQ  +F   A+    + ++GYNCTV  YG T TGKTYTM+GD  +  G+L       
Sbjct: 118 AESDQESVFNDAAKNYIHEMLEGYNCTVFAYGQTGTGKTYTMSGDLNILGGDLDSNTMVL 177

Query: 122 -SEGAGIIPRVLFKLFDALSAQGDDYMIKCSFIELYNEELKDLLDETPDSSMPKKLRIFD 180
             E AGIIPRVL +LF  L    + Y +K SF+ELYNE LKDLL    + S  + +RIFD
Sbjct: 178 LGEHAGIIPRVLVELFRWLDG-NEGYSVKVSFLELYNERLKDLL--ASEQSEEENIRIFD 234

Query: 181 XXXXXXXXXXXXXXXXXPKPNEGSSFGTRRKTRAPSIHRXXXXXXXXXXXXXXXXXAIHI 240
                               N  +S                               +I +
Sbjct: 235 --------------------NVSAS------------------------------SSIMV 244

Query: 241 QNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIML----YKKCNGESF 296
           + ++E +I  A +G++LL  G   R+VA+TK ND+SSRSHT+FTI          +GE +
Sbjct: 245 KGMEEIYINSAHQGLQLLMDGSIKRKVAATKCNDLSSRSHTVFTITTNITKLDPVSGEQY 304

Query: 297 -RVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSLHIPFRESK 355
            +  K+NLVDLAGSENI+RSGA+N+RA+EAG IN+SLLTLGRVIN+L D + HIP+RESK
Sbjct: 305 VKTGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHTQHIPYRESK 364

Query: 356 LTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGSFIMKDVLL 415
           LTRLLQDSLGG TKT +IATISPAKI+ +ET STLEYAT+AK+IKN PQV   + KD  +
Sbjct: 365 LTRLLQDSLGGKTKTCIIATISPAKISMDETISTLEYATRAKSIKNTPQVNQSMSKDSCI 424

Query: 416 KSVTAELVKIKSDLLSTKSKDGIYMSQENY 445
                E+ +++ +L +++ KDGI ++Q+ +
Sbjct: 425 NEYVHEIERLRQELKTSRQKDGISITQDQF 454

>TPHA0E00890 Chr5 (181328..185026) [3699 bp, 1232 aa] {ON} Anc_7.387
           YBL063W
          Length = 1232

 Score =  337 bits (864), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 224/642 (34%), Positives = 333/642 (51%), Gaps = 109/642 (16%)

Query: 1   MSDDEELNITVAVRCRGRNEKEVKARSSVVVAVPDVTGTNEV----------SINTTGDT 50
           +S  ++ NI V VRCR R ++E+  +SSVV++     G   +          + N  G T
Sbjct: 44  LSHTKDDNIKVYVRCRSRTQREIDEKSSVVISTLGANGNKVILSPNQSRKLYNTNANGST 103

Query: 51  -----------------GITAQINSKTYTVDKVFGPSADQLLIFKVIAEPLFQDFIKGYN 93
                                  N +TYT DKVFG  +DQ  +F+ +A+    + ++GYN
Sbjct: 104 RTKNNTNLNNNIKNATTNSNTGTNGRTYTFDKVFGVESDQETLFESVAKNYIYEMLQGYN 163

Query: 94  CTVLVYGMTSTGKTYTMTGDERLY---DGE----LSEGAGIIPRVLFKLFDALSA----- 141
           CTV  YG T TGKTYTM+GD  +    D +    L E AGIIPRVL  LF  LS      
Sbjct: 164 CTVFAYGQTGTGKTYTMSGDLNILGNLDSKDKILLGEHAGIIPRVLVYLFKELSKNDTIT 223

Query: 142 ------------------------QGDDYMIKCSFIELYNEELKDLLDETPDSSMPKKLR 177
                                   +  +Y +K SF+ELYNE+L DLL      ++    +
Sbjct: 224 NTKVNNNKNNNNNSNNKNEEQINLKNTEYSVKVSFLELYNEKLTDLLSNYKTDALNSNDK 283

Query: 178 IFDXXXXXXXXXXXXXXXXXPKPNEGSSFGTRRKTRAPSIH-----RXXXXXXXXXXXXX 232
           + +                      G +   + K +  ++H                   
Sbjct: 284 LINQTSGNSTPYSIT---------NGLNVNDKFKIKNNNLHDFDGKNVRIMSNQNKSASN 334

Query: 233 XXXXAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIML----Y 288
               +I ++ ++E +I  A EG++LL  G   R+VASTK+ND+SSRSHTIFTI+      
Sbjct: 335 CNGSSITVKGMEEIYIKSAHEGLQLLTEGSLKRKVASTKLNDLSSRSHTIFTIITNVTKV 394

Query: 289 KKCNGESF-RVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSL 347
               G+ F +  K+NLVDLAGSENI+RSGA+N+RA+EAG IN+SLLTLGRVIN+L D+S 
Sbjct: 395 DPVTGKHFVKTGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDRSH 454

Query: 348 HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGS 407
           HIP+RESKLTRLLQDSLGG TKT +IAT+SPAKI+ EET STLEYAT+AK+IKN PQ+  
Sbjct: 455 HIPYRESKLTRLLQDSLGGKTKTCIIATVSPAKISLEETVSTLEYATRAKSIKNTPQINQ 514

Query: 408 FIMKDVLLKSVTAELVKIKSDLLSTKSKDGIYMSQENYKELTNELENYKTEVEECKRAME 467
            + KD  +     E+ +++++L   ++K+GIY++Q+       +L+ Y++          
Sbjct: 515 SLSKDTFIHEYINEIDRLRNELKLARTKEGIYITQD-------QLDLYES---------- 557

Query: 468 KVSAQNSLLIKEKRVSNEVNESQ----KVKLRKLGNNIEFLYDKIDRQHKNEQELSNVVQ 523
                NS+LI E++   +  E Q    K K  +   +   L +K+++     Q+LS   +
Sbjct: 558 -----NSILITEQKAKIDNMEDQIKRFKAKYVEETESNRILLNKLEQSEDANQKLSEKTK 612

Query: 524 ELMRALHTMQQSLRIYEDQGQRFHTEMERVLYDNIGSFKKSL 565
            ++      Q++ +I+     + H+    V +D++ + K  L
Sbjct: 613 VIISLFKRYQENFKIFNSNINQIHSSNLEV-FDSLQNHKDKL 653

>TBLA0D00640 Chr4 (168893..172321) [3429 bp, 1142 aa] {ON} Anc_7.387
           YBL063W
          Length = 1142

 Score =  294 bits (752), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 193/444 (43%), Positives = 247/444 (55%), Gaps = 94/444 (21%)

Query: 8   NITVAVRCRGRNEKEVKARSSVVVAVPDVTGTNEVSINTTGDTGITAQINSKTYTVDKVF 67
           NI V VRCR RN+KE+  +SSVVV+     G   +  N+T         N   Y  D VF
Sbjct: 9   NIKVYVRCRSRNQKEIDEKSSVVVSTLGQNGNQIIISNST---------NKNKYIFDNVF 59

Query: 68  GPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELS----- 122
           G  +DQ  IF  +A    Q+ I GYNCT+  YG T TGKTYTM+GD  +  G+L+     
Sbjct: 60  GVESDQESIFNSVAYNYIQEMIDGYNCTLFAYGQTGTGKTYTMSGDLNII-GDLNSTKNI 118

Query: 123 ---EGAGIIPRVLFKLF----DALSAQGD----DYMIKCSFIELYNEELKDLLDETPDSS 171
              E AGIIPRVL +LF    D++S Q +     Y +K SF+ELYNE LKDLL  + D+ 
Sbjct: 119 LLGEHAGIIPRVLVQLFTSLEDSISNQKNTSVKGYTVKISFLELYNERLKDLL--SADAD 176

Query: 172 MPKKLRIFDXXXXXXXXXXXXXXXXXPKPNEGSSFGTRRKTRAPSIHRXXXXXXXXXXXX 231
           +P                          PN GSS         PS+              
Sbjct: 177 LP--------------------------PNSGSS-----SANDPSV----SSNIKIFDNK 201

Query: 232 XXXXXAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIM----- 286
                +I ++ +QE  I +A EG+ LL +G   R+V STK+ND+SSRSHTIFTI      
Sbjct: 202 DSSDSSIIVKGMQEIFIKNAMEGLNLLMKGSLQRKVKSTKLNDLSSRSHTIFTITTNIIK 261

Query: 287 LYKKCNGESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKS 346
           L  + N E  ++ K+NLVDLAGSENI++SG +  R++E G IN+SLLTLGRVIN+L+DK+
Sbjct: 262 LDNQTNKEYIKIGKLNLVDLAGSENITKSGLK--RSQETGLINKSLLTLGRVINALSDKT 319

Query: 347 ------------------------LHIPFRESKLTRLLQDSLGGNTKTALIATISPAKIN 382
                                    HIP+RESKLTRLLQDSLGG TKT +IATISPAK  
Sbjct: 320 NNTHGSNNDNNNSSSSSSISNSHHSHIPYRESKLTRLLQDSLGGMTKTCIIATISPAKTC 379

Query: 383 SEETSSTLEYATKAKNIKNKPQVG 406
            +ET STLEYAT+A +IKN P++ 
Sbjct: 380 LDETISTLEYATRAMSIKNNPKIN 403

>Ecym_3415 Chr3 (782976..784964) [1989 bp, 662 aa] {ON} similar to
           Ashbya gossypii ADR145C
          Length = 662

 Score =  189 bits (481), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 140/412 (33%), Positives = 209/412 (50%), Gaps = 72/412 (17%)

Query: 8   NITVAVRCRGRNEKEVKARSSVVVAVPDVT---GTNEVSINTTGDTGITAQINSKTYTVD 64
           N+ V VR +  +  E K  +  VVA+ + T     N+ S  +T   G+  +  S+++  D
Sbjct: 34  NVKVMVRLKPIDAPE-KQYNVAVVALDESTVEFPNNDTSPGST--NGVQGESPSRSFHFD 90

Query: 65  KVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTG--DERLYDGELS 122
            VFG ++ Q  ++  +AE +   F  GYN T+L YG T +GK+YTM G  D R       
Sbjct: 91  YVFGTNSTQDDVYDFVAEEMLDQFFTGYNSTILAYGQTGSGKSYTMFGPIDNR------- 143

Query: 123 EGAGIIPRVLFKLFDAL----SAQGDDYMIKCSFIELYNEELKDLLDETPD-SSMPKKLR 177
              G+IPR+  ++F+ +    S+   +Y++  SF+E+Y E++ DLL E+ + S+ PKK  
Sbjct: 144 ---GLIPRICHEIFERIGLLKSSADIEYVVSVSFLEIYLEKVYDLLGESINKSASPKK-- 198

Query: 178 IFDXXXXXXXXXXXXXXXXXPKPNEGSSFGTRRKTRAPSIHRXXXXXXXXXXXXXXXXXA 237
                                         T  K  + +IH                   
Sbjct: 199 ------------------------------TSEKRTSLTIHESSTF-------------G 215

Query: 238 IHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYKKCNGE-SF 296
           +++Q+     + D  E +  +  G   R  +ST MN  SSRSH I  I L K+ N E S 
Sbjct: 216 VYVQSATVISVSDGDELLHCIHLGESQRCKSSTDMNFESSRSHAIVKINLLKRDNLEGSI 275

Query: 297 RVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKS---LHIPFRE 353
           + S + LVDLAGSE +S++ A     +EA  IN SL +LG VIN+L  K     HIP+R+
Sbjct: 276 QKSDLFLVDLAGSEKVSKTNAVGATLEEAKKINLSLSSLGNVINALTQKDKKRTHIPYRD 335

Query: 354 SKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQV 405
           S+LTRLL+DSLGGN+KT LI   +  K N  ET +TL + ++AK I+NK  V
Sbjct: 336 SQLTRLLRDSLGGNSKTTLILNCACDKSNEAETLTTLRFGSRAKQIENKAIV 387

>SAKL0G18920g Chr7 complement(1634668..1636617) [1950 bp, 649 aa]
           {ON} weakly similar to uniprot|P32364 Saccharomyces
           cerevisiae YKL079W SMY1 not believed to act as a
           kinesin, colocalizes with Myo2p; kinesin heavy chain
           homolog
          Length = 649

 Score =  177 bits (450), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 117/360 (32%), Positives = 182/360 (50%), Gaps = 69/360 (19%)

Query: 53  TAQINSKTYTVDKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTG 112
           + Q N + +T D+VF   + Q  +++ +A  + + F +GYN T+L YG T +GK++TM G
Sbjct: 67  STQNNDRLFTFDRVFDTGSTQESVYEFVAGDMLKSFFQGYNGTILAYGQTGSGKSHTMFG 126

Query: 113 DERLYDGELSEGAGIIPRV---LFKLFDALSAQGDDYMIKCSFIELYNEELKDLLDETPD 169
            +        E  G+IPR+   +FK  +    +   + +  SF+E+Y E++ DLL ++ +
Sbjct: 127 PK--------ENRGVIPRICHDIFKQIETPDYEDCIFTVSVSFMEVYLEKIYDLLAQSLE 178

Query: 170 SSMPKKLRIFDXXXXXXXXXXXXXXXXXPKPNEGSSFGTRRKTRAPSIHRXXXXXXXXXX 229
               K++ +                                     S+H           
Sbjct: 179 KPADKRISL-------------------------------------SLH----------- 190

Query: 230 XXXXXXXAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYK 289
                   I+++ L   ++   +E +  +++G   R V+ST MN  SSRSH+I  I L K
Sbjct: 191 --DTKDSGIYVKGLNTNYVTSEQELLDYIKQGESQRNVSSTSMNLESSRSHSIVRINLEK 248

Query: 290 K-CNGESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLAD---- 344
           +    E+ + S + LVDLAGSE + ++ A     +EA  IN SL  LG VIN+L      
Sbjct: 249 RNALEENIQHSFLYLVDLAGSEKVGKTNAAGVTLEEAKKINSSLSALGNVINALTQVESK 308

Query: 345 ---KSLHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKN 401
               S HIP+R+SKLTRLLQDSLGGN+KT LI   S ++ N +ET STL + ++AK IKN
Sbjct: 309 SKRTSAHIPYRDSKLTRLLQDSLGGNSKTTLILNCSTSRFNEQETLSTLRFGSRAKKIKN 368

>ADR145C Chr4 complement(959805..961712) [1908 bp, 635 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YKL079W
           (SMY1)
          Length = 635

 Score =  177 bits (448), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 121/356 (33%), Positives = 179/356 (50%), Gaps = 61/356 (17%)

Query: 58  SKTYTVDKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLY 117
           ++ +  D VFG  A Q  +F  +AE +   F  GYN T+L YG T +GK+YTM G     
Sbjct: 57  ARAFRFDYVFGTDARQEEVFDYVAEEMLDQFFTGYNSTILAYGQTGSGKSYTMFGP---- 112

Query: 118 DGELSEGAGIIPRVLFKLFDALSAQGD----DYMIKCSFIELYNEELKDLLDETPD-SSM 172
                   G+IPR+  ++F+ +    +    +Y++  SF+E+Y E++ DLL E+ + +S 
Sbjct: 113 ----PGHRGLIPRICQQIFERIGLLKNCADIEYVVSVSFLEIYLEKVYDLLGESINKASS 168

Query: 173 PKKLRIFDXXXXXXXXXXXXXXXXXPKPNEGSSFGTRRKTRAPSIHRXXXXXXXXXXXXX 232
           PKK                         +E ++FG                         
Sbjct: 169 PKK---------------NSDKRASLTVHESNTFG------------------------- 188

Query: 233 XXXXAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYKKCN 292
                ++++      + D  E +  +  G   R   ST MN  SSRSH I  I L K+ N
Sbjct: 189 -----VYVEGATIVSVSDGDELLNCIHLGEAQRYKGSTDMNLESSRSHAIVKINLLKRDN 243

Query: 293 GES-FRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA--DKSLHI 349
            E   + S + LVDLAGSE ++++ A     +EA  IN SL +LG VIN+L   +K  HI
Sbjct: 244 LEGNIQKSDLFLVDLAGSEKVAKTNAVGATLEEAKKINLSLSSLGNVINALTQKEKRTHI 303

Query: 350 PFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQV 405
           P+R+S+LTRLL+DSLGGN+KT LI   +  K N  ET +TL + ++AK+IKNK  V
Sbjct: 304 PYRDSQLTRLLRDSLGGNSKTTLILNCACDKSNESETLTTLRFGSRAKHIKNKAIV 359

>Ecym_4066 Chr4 (146761..148197) [1437 bp, 478 aa] {ON} similar to
           Ashbya gossypii ACR228C - AER441C - ADR145C
          Length = 478

 Score =  165 bits (418), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 128/415 (30%), Positives = 204/415 (49%), Gaps = 89/415 (21%)

Query: 8   NITVAVRCRGRNEKEVKARSSVVVAVPDVTGTNEVSINTTGDTGITAQINSKTYTVDKVF 67
           NI VA+R R +  +E  +R SV+        +NE+++       +   +   T+  D+VF
Sbjct: 4   NIKVAIRIRDKISRET-SRPSVI----KRKTSNEITLQKDNTANVITTVE-HTFYFDQVF 57

Query: 68  GPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSEGAGI 127
             S++Q  I+  +A       ++GY+  V+ YG T  GKTYTM G E        +  GI
Sbjct: 58  DESSNQKQIYHELAREYILKALEGYHTCVIAYGQTGAGKTYTMMGTE--------QEPGI 109

Query: 128 IPRV---LFKLFDALSAQGDD------YMIKCSFIELYNEELKDLLDETPDSSMPKKLRI 178
           IP V   LFK+ D    +G D      + +  S+ ++YNE++ D+L     S     LR+
Sbjct: 110 IPLVSHELFKIIDMCQDEGPDEDALVHFKVTVSYFQIYNEQIYDML-----SGGCNVLRV 164

Query: 179 FDXXXXXXXXXXXXXXXXXPKPNEGSSFGTRRKTRAPSIHRXXXXXXXXXXXXXXXXXAI 238
            D                          G R+ T                          
Sbjct: 165 RD--------------------------GPRKVT-------------------------- 172

Query: 239 HIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYKKCNGESF-- 296
           +I+ L +  +   +E ++ ++ G   R VA T +N+ SSRSH I TI + ++   +SF  
Sbjct: 173 YIEGLSDRIVNSCEELLKCIEEGSARRSVAGTAVNENSSRSHAICTINI-QQTEIDSFGD 231

Query: 297 ---RVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA-DKSLHIPFR 352
              RVS + LVDLAGSE    S  +++R KE  +IN+SL+TL RV+  L+ +K   +P+R
Sbjct: 232 TVERVSSIKLVDLAGSERTKVSKTKDERFKEGTNINKSLMTLRRVVTMLSNNKVTGVPYR 291

Query: 353 ESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGS 407
           ES LTR+L+D+L GN+ T ++A ISP   + EE+ STL YA+ AK+++ +  + +
Sbjct: 292 ESLLTRVLRDNLDGNSITCILACISPC--DYEESISTLRYASTAKHVRTEAHLNT 344

>KLTH0G01606g Chr7 (116364..118823) [2460 bp, 819 aa] {ON} similar
           to uniprot|P53086 Saccharomyces cerevisiae YGL216W KIP3
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 819

 Score =  164 bits (414), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 151/549 (27%), Positives = 257/549 (46%), Gaps = 118/549 (21%)

Query: 61  YTVDKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 120
           +  D+VF   A Q  +++    PL    + G+N TV  YG T  GKTYT++G        
Sbjct: 125 FVFDRVFDMHASQEEVYEATTRPLLDSVLDGFNSTVFAYGATGCGKTYTVSGT------- 177

Query: 121 LSEGAGIIPRVLFKLFDALSAQGD--DYMIKCSFIELYNEELKDLLD-ETPDSSMPKKLR 177
            +E  GII   + +LF  +    D   + +  S++E+YNE ++DLL+ ETP     KKL 
Sbjct: 178 -AENPGIIFLTMQELFAKMEQLKDTKKFELTASYLEIYNESIRDLLEPETPS----KKLV 232

Query: 178 IFDXXXXXXXXXXXXXXXXXPKPNEGSSFGTRRKTRAPSIHRXXXXXXXXXXXXXXXXXA 237
           + +                                    +HR                  
Sbjct: 233 LRE-----------------------------------DVHRH----------------- 240

Query: 238 IHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYKKCNG---- 293
           I + NL    +   ++ + L+ +G  +R  ++T  N+ SSRSH +  + + +K       
Sbjct: 241 ITVANLSHHPLFTVEDVMDLVVKGNINRTTSATDANETSSRSHAVLQVHITQKNRTAELT 300

Query: 294 ESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA-----DKSLH 348
           E  + + ++L+DLAGSE  S +  + +R  E  +IN+SLL LG  IN+L          H
Sbjct: 301 EDHKFATLSLIDLAGSERASATKNRGERLHEGANINRSLLALGNCINALCAGGKRGGGFH 360

Query: 349 IPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNK------ 402
           +P+R+SKLTRLL+ SLGGN KT +I  ISP   + +ET +TL+YAT+AK IK K      
Sbjct: 361 VPYRDSKLTRLLKFSLGGNCKTVMIVCISPTSNHYDETLNTLKYATRAKEIKTKIIRNQH 420

Query: 403 ---PQVGSFI------------MKDVLLKSVTAEL--VKIKSDLLSTKSKDGIYMSQENY 445
                VGS++            ++    K +  EL   KI  + +     D +   ++NY
Sbjct: 421 SLDRHVGSYLKMITEQRQEIEELRSRERKMIDLELSRYKISRERVHMSVWDSVQSLRQNY 480

Query: 446 K--ELTNELENYKTEVEECKRAMEKVSAQNSLLIKEKRVSNEVNESQKVKLRKLGNNIEF 503
           K  E  + L+  K+ +   +R ++ V  + ++L+K    +++++            N   
Sbjct: 481 KTSEKFHHLKVIKSLMLCKRRFLQMVGVELAVLLKFTSPNSDIHV-----------NCMA 529

Query: 504 LYDKIDRQHKNEQELSNVVQELMRAL-HTMQQSL-RIYEDQGQRFHTEMERVLYDNIGSF 561
           L++++ ++ KN ++  +   EL  AL HT Q  L ++ E +G     E + V Y+++ S+
Sbjct: 530 LHEQLVQKVKNLEQSFDSPDELESALEHTRQVDLVKLQEMEGW---AESDLVWYESLLSW 586

Query: 562 -KKSLMDEI 569
             +S+ +EI
Sbjct: 587 VSESVRNEI 595

>Kpol_1004.25 s1004 (54983..56503) [1521 bp, 506 aa] {ON}
           (54983..56503) [1521 nt, 507 aa]
          Length = 506

 Score =  158 bits (399), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 117/375 (31%), Positives = 171/375 (45%), Gaps = 91/375 (24%)

Query: 64  DKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSE 123
           D+ FG    Q   +K       +D + GYNC +L YG T +GKTYTM G+ +      ++
Sbjct: 64  DEGFGKINSQSEFYKGSINHFVKDALNGYNCCILAYGQTGSGKTYTMMGESK------ND 117

Query: 124 GAGIIPRVLFKLFDALS----------AQGDDYMIKCSFIELYNEELKDLLDETPDSSMP 173
             G+IPR    LF  +           +Q  +Y + CS  E+YNE++ DLL E  +    
Sbjct: 118 TRGVIPRFCEDLFHEIESIKIKDSSDLSQRSEYKVVCSIFEIYNEQIIDLL-EMNEVQSC 176

Query: 174 KKLRIFDXXXXXXXXXXXXXXXXXPKPNEGSSFGTRRKTRAPSIHRXXXXXXXXXXXXXX 233
            K R+                               R+ R  S++               
Sbjct: 177 SKYRV-------------------------------RENRDRSMY--------------- 190

Query: 234 XXXAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYK---- 289
                 I+N+ E  + +  + I+ ++ G R+R   ST MN  SSRSH I +I + +    
Sbjct: 191 ------IENITEIEVSNIDQMIKCVKMGFRNRTTRSTNMNVNSSRSHAIVSITIKRTDID 244

Query: 290 -KCNGESFRVSKMNLVDLAGSE-NISRSGAQNQRAKEAGSINQSLLTLGRVINSLADK-- 345
              N      S    VDLAGSE + +     N R KE  SIN+SL TL RV+ SL  +  
Sbjct: 245 LNTNSSIISDSICRFVDLAGSERSTATQNCHNDRLKEGNSINKSLSTLRRVLTSLKKREE 304

Query: 346 ------------SLHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYA 393
                       ++ +PFRES LT +L+D+LGGN+KT +IA ISP   N EE++STL YA
Sbjct: 305 LKYNSNSNSSAHNIVVPFRESLLTWILKDNLGGNSKTCIIACISPT--NFEESASTLRYA 362

Query: 394 TKAKNIKNKPQVGSF 408
             A+ IK    + ++
Sbjct: 363 DIAQTIKTNSIINTY 377

>Kpol_1013.7 s1013 (11880..13742) [1863 bp, 620 aa] {ON}
           (11880..13742) [1863 nt, 621 aa]
          Length = 620

 Score =  159 bits (401), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 115/354 (32%), Positives = 167/354 (47%), Gaps = 73/354 (20%)

Query: 61  YTVDKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 120
           YT D VF P A    ++    +PL      G+N TV  YGMT +GKTYTM+G     DG 
Sbjct: 104 YTYDNVFHPDASNFDVYAATCKPLIDKLFDGFNSTVFAYGMTGSGKTYTMSG----VDG- 158

Query: 121 LSEGAGIIP----RVLFKLFDALSAQGDDYMIKCSFIELYNEELKDLLDETPDSSMPKKL 176
               AG+IP     +  K+FD+   +   Y    S++E+YNE++ DLL+   D   PK L
Sbjct: 159 ---NAGLIPLSVAYMYSKIFDSTIHENKKYDTLVSYLEIYNEKIYDLLETDFD---PKPL 212

Query: 177 RIFDXXXXXXXXXXXXXXXXXPKPNEGSSFGTRRKTRAPSIHRXXXXXXXXXXXXXXXXX 236
           R                      PN G                                 
Sbjct: 213 R---------SSIAVPELKIRDDPNYG--------------------------------- 230

Query: 237 AIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYKK--CNGE 294
            + +  L E      +E +  ++ G +HR+ +ST  N  SSRSH I  I L      +GE
Sbjct: 231 -VRVIGLTEKRCQSHEELLNWIKLGDKHRKTSSTDFNTRSSRSHAIILIRLISSDLSSGE 289

Query: 295 SFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADK--------- 345
               S ++L DLAGSE ++   AQ++R +E   IN+SLL LG VI+ L+ +         
Sbjct: 290 VV-TSTLSLCDLAGSERVT---AQHERRQEGSFINKSLLALGTVISKLSAEVNNSTESVN 345

Query: 346 SLHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNI 399
           + HIP+R+SKLTR+LQ +L GN+    I TI  +   + E+ +TL +A++AKN+
Sbjct: 346 NSHIPYRDSKLTRILQPALSGNSIVTTICTIDTSVDATNESVNTLRFASRAKNV 399

>SAKL0F01760g Chr6 (146659..149088) [2430 bp, 809 aa] {ON} similar
           to uniprot|P53086 Saccharomyces cerevisiae YGL216W KIP3
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 809

 Score =  156 bits (394), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 110/352 (31%), Positives = 168/352 (47%), Gaps = 73/352 (20%)

Query: 61  YTVDKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 120
           +  DK+F   A Q  +++    PL    + G+N TV  YG T  GKT+T++G        
Sbjct: 136 FVFDKLFDEDATQTEVYESTTRPLLDSVLDGFNGTVFAYGATGCGKTFTISG-------- 187

Query: 121 LSEGAGIIPRVLFKLFDALSAQGDD--YMIKCSFIELYNEELKDLLDETPDSSMPKKLRI 178
             E  G+I   + +LF  +    D   + +  S++E+YNE ++DLL  +PD S  KKL I
Sbjct: 188 TPEQPGVIFLTMQELFQRIEDLKDSKHFDLTLSYLEIYNESIRDLL--SPDIS-SKKLVI 244

Query: 179 FDXXXXXXXXXXXXXXXXXPKPNEGSSFGTRRKTRAPSIHRXXXXXXXXXXXXXXXXXAI 238
                                             R  SI                    I
Sbjct: 245 ----------------------------------REDSI------------------KGI 252

Query: 239 HIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYKKCN----GE 294
            + NL        ++ + L+ RG  +R  + T  N+ SSRSH +  I + +K       E
Sbjct: 253 SVANLSHHTPQTVQDVMDLVVRGNMNRTTSPTDANETSSRSHAVLQINVVQKNRTAELSE 312

Query: 295 SFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA----DKSLHIP 350
           +   + ++++DLAGSE  S +  + +R  E  +IN+SLL LG  IN+L       + H+P
Sbjct: 313 AHTFATLSIIDLAGSERASATKNRGERLHEGANINRSLLALGNCINALCVSGRRSTCHVP 372

Query: 351 FRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNK 402
           +R+SKLTRLL+ SLGGN KT +I  I+P+  + +ET +TL+YA +AK IK K
Sbjct: 373 YRDSKLTRLLKFSLGGNCKTVMIVCIAPSSAHYDETLNTLKYANRAKEIKTK 424

>TBLA0C05310 Chr3 (1286959..1288989) [2031 bp, 676 aa] {ON}
           Anc_3.479 YPR141C
          Length = 676

 Score =  152 bits (385), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 114/347 (32%), Positives = 163/347 (46%), Gaps = 66/347 (19%)

Query: 61  YTVDKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 120
           Y+ DKVF  +     IFK ++E L Q  + G+N  +  YG T +GKT+TM          
Sbjct: 383 YSFDKVFSQTDTNQEIFKEVSE-LIQSSLDGFNVCIFAYGQTGSGKTFTM---------- 431

Query: 121 LSEGAGIIPRVLFKLFDAL---SAQGDDYMIKCSFIELYNEELKDLLDETPDSSMPKKLR 177
           L+   GIIP     +FD +   +  G  Y + C F+E+YN+E+ DLL    + S      
Sbjct: 432 LNPKDGIIPSTAKHIFDWIDNSAKNGWKYNVTCEFLEIYNDEIYDLLRSDDNKS------ 485

Query: 178 IFDXXXXXXXXXXXXXXXXXPKPNEGSSFGTRRKTRAPSIHRXXXXXXXXXXXXXXXXXA 237
                                     SS G R K     IH                   
Sbjct: 486 -------------------------NSSNGPRHK-----IHHDDASKTTV---------- 505

Query: 238 IHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYKKCNG-ESF 296
             ++NL+   +   +    +L+  ++ R  AST  N+ SSRSH+IF I ++    G    
Sbjct: 506 --VENLETITLTSKESVDAVLKNAMKLRATASTSSNERSSRSHSIFIIKIHGINEGLGEE 563

Query: 297 RVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLAD---KSLHIPFRE 353
           R   +NL+DLAGSE +S S  Q++R KE   IN+SL  LG V+NSL      + HI FR+
Sbjct: 564 RNGLLNLIDLAGSERLSVSKVQSERIKETQHINKSLSFLGNVMNSLGSPDATTRHISFRD 623

Query: 354 SKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIK 400
           SKLT LLQ SL GN+KT ++  IS +  +  ET  +L +A K  + K
Sbjct: 624 SKLTYLLQYSLTGNSKTLMVVNISSSSDHINETIKSLNFAKKVNSTK 670

>KLLA0D05951g Chr4 (509713..511719) [2007 bp, 668 aa] {ON} similar
           to uniprot|P28743 Saccharomyces cerevisiae YPL155C KIP2
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 668

 Score =  149 bits (375), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 104/350 (29%), Positives = 164/350 (46%), Gaps = 64/350 (18%)

Query: 61  YTVDKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 120
           +  D VF P  +   +++ +A P+     +G+NCT+  YGMT +GKTYTM+G +      
Sbjct: 106 FNFDHVFSPEMNNDRVYETMALPMIDKLFEGFNCTIFAYGMTGSGKTYTMSGSK------ 159

Query: 121 LSEGAGIIPRVLFKLFDALSA--QGDDYMIKCSFIELYNEELKDLLDETPDSSMPKKLRI 178
              G GIIP  +  +FD ++       + ++ S++E+YNE                  RI
Sbjct: 160 --SGPGIIPMCVDTIFDRINVGLPRKKFTVRVSYLEIYNE------------------RI 199

Query: 179 FDXXXXXXXXXXXXXXXXXPKPNEGSSFGTRRKTRAPSIHRXXXXXXXXXXXXXXXXXAI 238
           FD                            + KT   +I                    +
Sbjct: 200 FDLLNL-----------------------PQGKTLNSNIMVPSSTLTNDLKLRDDLKYGV 236

Query: 239 HIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLY--KKCNGESF 296
            +  L E ++   KE ++ +  G  +R+   T  N  SSRSH +  I ++   +  GE  
Sbjct: 237 KVVGLVERNVSSNKELMKCISIGDHNRKTGETDFNTRSSRSHAVVLIRVFCTDEITGEQV 296

Query: 297 RVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSL-------HI 349
            +S ++L DLAGSE   R+  Q +R KE   IN+SLL LG VI+ L+ +S        HI
Sbjct: 297 -MSTLSLCDLAGSE---RATGQQERRKEGAYINKSLLALGTVISKLSMESSGLSTNVGHI 352

Query: 350 PFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNI 399
           P+R+SKLTR+LQ +L G++  A I T+      S E+ +T+ +A++AKNI
Sbjct: 353 PYRDSKLTRILQPALSGDSLVATICTVDTRPETSTESINTIRFASRAKNI 402

>TPHA0D01270 Chr4 (264339..266429) [2091 bp, 696 aa] {ON} Anc_8.678
           YPL155C
          Length = 696

 Score =  148 bits (374), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 109/396 (27%), Positives = 176/396 (44%), Gaps = 69/396 (17%)

Query: 29  VVVAV-PDVTGTNEVSINTTGDTGITAQINSKTYTVDKVFGPSADQLLIFKVIAEPLFQD 87
           ++VA+ P     NE  +    D    A  +   + +D++F      L I+  + +PL   
Sbjct: 76  IIVAIRPKPISNNEKKVWNIVDNKRIAHDDVGEFRLDRIFDCDVSNLEIYSELCKPLIDK 135

Query: 88  FIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSEGAGIIPRVLFKLFDALSAQG---- 143
              GYN T+  YGMT +GKT+TM+G +        E  G+IP  +  LF+ ++ +     
Sbjct: 136 LAMGYNATLFAYGMTGSGKTFTMSGTQ--------EDTGLIPLSISHLFNTINEENLLGK 187

Query: 144 DDYMIKCSFIELYNEELKDLLDETPDSSMPKKLRIFDXXXXXXXXXXXXXXXXXPKPNEG 203
             Y +  S++E+YNE+L DLLD                                    EG
Sbjct: 188 KKYEMLVSYMEIYNEKLYDLLDTNV---------------------------------EG 214

Query: 204 SSFGTRRKTRAPSIHRXXXXXXXXXXXXXXXXXAIHIQNLQEFHIMDAKEGIRLLQRGLR 263
            +FG     + P                      I +  L E       + ++ ++ G +
Sbjct: 215 VNFGYSSNLQTPPRFGNSFNSAQDLRIRDDAQYGIKVVGLSEHRCSSKDDLMKWVRIGDK 274

Query: 264 HRQVASTKMNDVSSRSHTIFTI-MLYKKCNGESFRVSKMNLVDLAGSENISRSGAQNQRA 322
           +++++ T+ N  SSRSH+I  + ++           S ++L DLAGSE   ++ +Q +R 
Sbjct: 275 NKKISETEYNSRSSRSHSILLVRLIATDLETGIVTTSTLSLCDLAGSE---KATSQQERR 331

Query: 323 KEAGSINQSLLTLGRVINSLADKS-------------------LHIPFRESKLTRLLQDS 363
           KE   IN+SLL LG VI  L+ +S                    HIP+R+SKLTR+LQ +
Sbjct: 332 KEGAFINKSLLALGTVIAKLSSESNQHRNADNVNHQETSNPNNSHIPYRDSKLTRILQPA 391

Query: 364 LGGNTKTALIATISPAKINSEETSSTLEYATKAKNI 399
           L GN+    I T+      S ET +TL +A++AKN+
Sbjct: 392 LSGNSIITTICTVDIRSDASSETLNTLRFASRAKNV 427

>SAKL0G05016g Chr7 (415990..417504) [1515 bp, 504 aa] {ON} weakly
           similar to uniprot|P53086 Saccharomyces cerevisiae
           YGL216W KIP3 Kinesin-related motor protein involved in
           mitotic spindle positioning
          Length = 504

 Score =  144 bits (363), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 111/322 (34%), Positives = 172/322 (53%), Gaps = 57/322 (17%)

Query: 240 IQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYKK----CNGES 295
           ++ L EF +   +E +  +++G R R V  T MN+ SSRSH IFTI + +         +
Sbjct: 199 VEGLNEFKVCKVEEILEYMKQGDRLRTVGVTNMNNSSSRSHAIFTISIKQSETTLAGDLT 258

Query: 296 FRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSLH--IPFRE 353
            R S + LVDLAGSE +S +GA+  R KE  +IN+SL TLGRV++ LA K+    IP+R+
Sbjct: 259 ERRSSIKLVDLAGSERVSTTGARGDRLKEGSNINKSLTTLGRVVSVLAKKNRPKLIPYRD 318

Query: 354 SKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGSFIMKDV 413
           S LT +L+++LGGN+KT +IA +SP   + EET STL YAT AK +KN  +V S      
Sbjct: 319 SALTWVLKENLGGNSKTVMIACVSPC--DYEETISTLRYATTAKEVKNTARVNS------ 370

Query: 414 LLKSVTAELVKIKSDLLSTKSKDGIYMSQENYKELTNELENYKTEVEECKR-AMEKVSAQ 472
                 +E +K K  L++ +++      +E  KEL+  L++ K + +E  R  + K+   
Sbjct: 371 ------SESLKNKEQLVTMRNQ-----LEELQKELS--LQSVKLQNQELLREQINKIKCT 417

Query: 473 NSLLIKEKRVSNEVNESQKVKLRKLGNNIEFLYDKIDRQHK------------------N 514
           N+ L  EKR+  E   + K   R         +DKI R+                    N
Sbjct: 418 NAYL--EKRIEQEAAFATKYHER---------WDKITREKAQLESTLLSVIGAMYSESLN 466

Query: 515 EQELSNVVQELMRALHTMQQSL 536
           +Q+  N +  L++  H ++ +L
Sbjct: 467 KQDWRNTINSLLKESHELKSAL 488

 Score = 74.7 bits (182), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 57/187 (30%), Positives = 83/187 (44%), Gaps = 26/187 (13%)

Query: 1   MSDDEELNITVAVRCRGRNEKEVKARSSVVVAVPDVTGTNEVSINTTGDTGITAQINSKT 60
           MSD    NI VAVR R    +E   +  +       +   +  I+T+           K 
Sbjct: 1   MSD----NIKVAVRLRSPLPRE-HGQPIITQVTSPTSFVIQQHISTSSLLATEEFTQGKI 55

Query: 61  YTVDKVF----GPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDE-- 114
           +T D  F      S DQ +I+  I        + GYN  +L YG T +GK++TM G E  
Sbjct: 56  FTFDHCFKYSENASHDQEVIYDTIGREYLLHTLDGYNTCILAYGQTGSGKSFTMMGPEVS 115

Query: 115 -------RLYDGELSEGA-GIIPRVLFKLFDALSAQGDD-------YMIKCSFIELYNEE 159
                     D  + + A GIIPRV   LFD  +    +       + I CS++E+YNE+
Sbjct: 116 KHFHNNQTALDRAIEDSAIGIIPRVCCDLFDICNMCNSEEDGIKTQFEIYCSYLEIYNEQ 175

Query: 160 LKDLLDE 166
           ++DLL E
Sbjct: 176 VRDLLSE 182

>TDEL0A06240 Chr1 (1092814..1094727) [1914 bp, 637 aa] {ON}
           Anc_8.678 YPL155C
          Length = 637

 Score =  145 bits (366), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 126/417 (30%), Positives = 198/417 (47%), Gaps = 82/417 (19%)

Query: 61  YTVDKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 120
           +T D+VF  +   L I++  + P+    ++G+N TV  YGMT +GKT+TMTG E      
Sbjct: 112 FTFDRVFPANCTNLDIYEASSRPMIDKLLQGFNATVFAYGMTGSGKTFTMTGTE------ 165

Query: 121 LSEGAGIIPRVLFKLFDAL---SAQG-DDYMIKCSFIELYNEELKDLLD---ETPDSSMP 173
             + AG+IP  +  LF  +   S +G   Y +  S++E+YNE++ DLLD   E   +S P
Sbjct: 166 --DEAGLIPLSVTYLFSKILEHSMRGTSKYEVVVSYLEIYNEKIYDLLDCESENKFNSTP 223

Query: 174 KKLRIFDXXXXXXXXXXXXXXXXXPKPNEGSSFGTRRKTRAPSIHRXXXXXXXXXXXXXX 233
            ++ +                            GT R +  P   R              
Sbjct: 224 SRMFLS---------------------------GTPRSSGGPVELRIRDDLKY------- 249

Query: 234 XXXAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYKK--C 291
               + I  L E     ++E  R +Q G ++R+ + T  N  SSRSH I  + L      
Sbjct: 250 ---GVRITGLTEKRCESSEELSRWIQIGDKNRKTSETIYNTRSSRSHAIVLVRLNNTDLR 306

Query: 292 NGESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSL--------- 342
           +GE+   S ++L DLAGSE   ++ +Q +R KE   IN+SLL LG VI+ L         
Sbjct: 307 SGETVS-STLSLCDLAGSE---KAVSQYERRKEGAFINKSLLALGTVISKLSSESLSKNG 362

Query: 343 ---------ADKSLHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYA 393
                     + + HIP+R+SKLTR+LQ +L GN+    I TI      + ET +T+ +A
Sbjct: 363 PPTFTSTNPTEPNTHIPYRDSKLTRILQPALSGNSIITTICTIDTRNEAASETVNTIRFA 422

Query: 394 TKAKN----IKNKPQV--GSFIMKDVLLKSVTAELVKIKSDLLSTKSKDGIYMSQEN 444
           ++AKN    +  +P V  GS+  KD  ++++T +L K    ++  K +  +  S  N
Sbjct: 423 SRAKNVTLQVAKRPAVGTGSYNEKDQTIENLTQQLEKQHQLVMRLKQRTSMTSSSHN 479

>KLLA0A01606g Chr1 (139355..141664) [2310 bp, 769 aa] {ON} similar
           to uniprot|P53086 Saccharomyces cerevisiae YGL216W KIP3
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 769

 Score =  146 bits (369), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 107/354 (30%), Positives = 169/354 (47%), Gaps = 75/354 (21%)

Query: 61  YTVDKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 120
           +  D++F     Q  +++    PL    + G+N TV  YG T  GKT+T++G        
Sbjct: 124 FIFDRIFDMDVTQQEVYENTTRPLLDSVLDGFNGTVFAYGATGCGKTFTISGT------- 176

Query: 121 LSEGAGIIPRVLFKLFDALSAQGD--DYMIKCSFIELYNEELKDLLDETPDSSMPKKLRI 178
            SE  GII   + +LF  +    D   + ++ SF+E+YNE++ DLLD    S   KKL I
Sbjct: 177 -SEQPGIIFLTMQELFIRMEQLKDTKKFQLQLSFLEIYNEQIHDLLDPNISS---KKLVI 232

Query: 179 FDXXXXXXXXXXXXXXXXXPKPNEGSSFGTRRKTRAPSIHRXXXXXXXXXXXXXXXXXAI 238
            +                        +F +     +P                       
Sbjct: 233 REDSY-------------------NRTFVSNLSKHSP----------------------- 250

Query: 239 HIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYKKCNGESFR- 297
             +N++E  +MD      L+ +G  +R  + T  N+ SSRSH +  I + +       + 
Sbjct: 251 --ENVEE--VMD------LVIKGNMNRTTSPTDANETSSRSHAVLQIHVAQMNRTADIKQ 300

Query: 298 ---VSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADK------SLH 348
               + ++++DLAGSE  + +  + +R  E  +IN+SLL LG  IN+L         S H
Sbjct: 301 DQTFATLSIIDLAGSERAAVTKNRGERLLEGANINRSLLALGNCINALCVSSTRTGFSCH 360

Query: 349 IPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNK 402
           +P+R+SKLTRLL+ SLGGN KT +I  +SP+  + +ET +TL+YA +AK IK K
Sbjct: 361 VPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSGHYDETLNTLKYANRAKEIKTK 414

>KLTH0D11286g Chr4 (922942..924978) [2037 bp, 678 aa] {ON} similar
           to uniprot|P28743 Saccharomyces cerevisiae YPL155C KIP2
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 678

 Score =  143 bits (360), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 104/363 (28%), Positives = 168/363 (46%), Gaps = 76/363 (20%)

Query: 61  YTVDKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTG--DERLYD 118
           +  DKVF P  +   +++ I +P+     +GYN T+  YGMT +GKT+TM+G  DE    
Sbjct: 140 FWFDKVFSPQTNNYGVYEEIGKPMIDKLFQGYNATIFAYGMTGSGKTFTMSGTRDE---- 195

Query: 119 GELSEGAGIIPRVLFKLFDAL---SAQGDDYMIKCSFIELYNEELKDLLDETPDSSMPKK 175
                 AG+I   + ++F  +   S     Y ++ S++E+YNE++ DLL+  P +  P  
Sbjct: 196 ------AGLILLSVEQIFSQIMKESVNNKSYEVRVSYLEIYNEKIYDLLN-YPSAKSP-- 246

Query: 176 LRIFDXXXXXXXXXXXXXXXXXPKPNEGSSFGTRRKTRAPSIHRXXXXXXXXXXXXXXXX 235
                                      G ++G+ +    P                    
Sbjct: 247 ---------------------------GGTYGSFQSKNVPG-------AGAELPVRDDAR 272

Query: 236 XAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYKKCN--- 292
             + +  L E  +  +++ +R ++ G  +R+   T  N  SSRSH I TI +   C    
Sbjct: 273 HGVRVVGLTEQQVHSSEDVLRKIELGNSNRRTGETDYNTRSSRSHAIVTIKV--TCTELL 330

Query: 293 GESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKS------ 346
             +   S ++L DLAGSE   R+  Q++R KE   IN+SLL LG VI+ L+  S      
Sbjct: 331 SGTDTTSTLSLCDLAGSE---RAAGQHERRKEGAFINKSLLALGTVISKLSAVSGASGGG 387

Query: 347 ----------LHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKA 396
                      H+P+R+SKLTR+LQ +L G++    I TI        ET +T+ +A++A
Sbjct: 388 AATPPPTFGNSHVPYRDSKLTRILQPALSGDSIVTTICTIDTKPDAMSETVNTIRFASRA 447

Query: 397 KNI 399
           KN+
Sbjct: 448 KNV 450

>CAGL0M02189g Chr13 complement(261290..263308) [2019 bp, 672 aa]
           {ON} similar to uniprot|P28743 Saccharomyces cerevisiae
           YPL155c KIP2 kinesin-related protein
          Length = 672

 Score =  142 bits (358), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 113/371 (30%), Positives = 170/371 (45%), Gaps = 82/371 (22%)

Query: 61  YTVDKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 120
           +T D VF        I+    +PL    I+GYN T+  YGMT +GKT+TM+G E      
Sbjct: 133 FTFDHVFSTGCSNFDIYGKTTQPLIDRLIEGYNATIFAYGMTGSGKTFTMSGTE------ 186

Query: 121 LSEGAGIIPRVLFKLFDAL----SAQGDDYMIKCSFIELYNEELKDLLDETPDSSMPK-K 175
             E  G+IP  +  LF +L    + + +   +  S++E+YNE++ DLLD    S++    
Sbjct: 187 --EEKGLIPLSVSYLFSSLLEKTNTENEKSEVWVSYLEIYNEKINDLLDVASGSNVQNTP 244

Query: 176 LRIFDXXXXXXXXXXXXXXXXXPKPNEGSSFGTRRKTRAPSIHRXXXXXXXXXXXXXXXX 235
            R+F                   K  + S  G R                          
Sbjct: 245 SRLFTSTHTSSSGDL--------KIRDDSECGVR-------------------------- 270

Query: 236 XAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYKK--CNG 293
               +  L +     ++E +  + +G ++R+ + T+ N  SSRSH I  I L  K    G
Sbjct: 271 ----VVGLTQKRCDTSEEVLDWINKGNKNRKTSETEFNTRSSRSHAIVMIRLISKDIRTG 326

Query: 294 ESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA---------- 343
           E   +  ++L DLAGSE   R   QN+R KE   IN+SLL LG VI+ L+          
Sbjct: 327 EQ-NIRTLSLCDLAGSE---RGVGQNERRKEGAFINRSLLALGTVISRLSAENNGSHHTG 382

Query: 344 -----DKSL----------HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSS 388
                 +SL          HIP+R+SKLTRLLQ +L G++    + TI  A  +S ET +
Sbjct: 383 RAANSQQSLASPNGSSSGNHIPYRDSKLTRLLQPALSGDSVVVALCTIDLAHESSSETLN 442

Query: 389 TLEYATKAKNI 399
           TL +A+++KN+
Sbjct: 443 TLRFASRSKNV 453

>Kpol_1050.103 s1050 complement(235625..237718) [2094 bp, 697 aa]
           {ON} complement(235625..237718) [2094 nt, 698 aa]
          Length = 697

 Score =  141 bits (355), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 114/369 (30%), Positives = 166/369 (44%), Gaps = 81/369 (21%)

Query: 47  TGDTGITAQI------NSKTYTVDKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYG 100
           TG   +T  I       S  +  DK+F        +F  + E L Q  + G+N  +  YG
Sbjct: 388 TGTQSLTLDIKRPMTNGSVNFQFDKIFNYDESNRQVFGEVKE-LVQSALDGHNVCIFTYG 446

Query: 101 MTSTGKTYTMTGDERLYDGELSEGAGIIPRVLFKLFDALSAQ---GDDYMIKCSFIELYN 157
            T +GKTYTM          L+E  GIIP  L  + D  S+    G  Y +K  F+E+YN
Sbjct: 447 QTGSGKTYTM----------LNEEDGIIPSTLDHIIDWTSSMKKLGWQYGLKIKFVEIYN 496

Query: 158 EELKDLLDETPDSSMPKKLRIFDXXXXXXXXXXXXXXXXXPKPNEGSSFGTRRKTRAPSI 217
           +                  RIFD                    N+G       + R   I
Sbjct: 497 D------------------RIFDLL------------------NDGKGKHKECEVRHDDI 520

Query: 218 HRXXXXXXXXXXXXXXXXXAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSS 277
            R                  I           + +E   L+QR  + R+ A T MN+ SS
Sbjct: 521 GRRTELTNVITREFQLEEDLIE---------SNRRELQELVQRLNKVRRTAKTAMNNRSS 571

Query: 278 RSHTIFTIMLY-------KKCNGESFRVSKMNLVDLAGSENISRSG-AQNQRAKEAGSIN 329
           RSH++F + +        ++C G       +NLVDLAGSE ++RSG    +R +E   IN
Sbjct: 572 RSHSVFIVEVEGFNKDSEERCKG------VLNLVDLAGSERMNRSGLVDKERIEETKQIN 625

Query: 330 QSLLTLGRVINSL--ADKSLHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETS 387
           +SL ++G VI++L     SLHIPFR +KLT LL+ SL G++KT ++ T+SP+  +  ET 
Sbjct: 626 KSLSSVGDVIHALRQGSGSLHIPFRNTKLTYLLKHSLQGSSKTLMLVTVSPSNSSRNETM 685

Query: 388 STLEYATKA 396
           ++L +ATK 
Sbjct: 686 NSLRFATKV 694

>Kwal_26.8806 s26 (950736..952883) [2148 bp, 715 aa] {ON} YPL155C
           (KIP2) - kinesin-related protein [contig 68] FULL
          Length = 715

 Score =  140 bits (354), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 103/354 (29%), Positives = 164/354 (46%), Gaps = 61/354 (17%)

Query: 61  YTVDKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 120
           +  D VF P ++   +++ I +P+     +GYN  +  YGMT +GKT+TM+G        
Sbjct: 139 FKFDNVFRPQSNNYEVYQQIGKPMIDRLFQGYNAIIFAYGMTGSGKTFTMSGT------- 191

Query: 121 LSEGAGIIPRVLFKLFDAL---SAQGDDYMIKCSFIELYNEELKDLLDETPDSSMPKKLR 177
             E AG+I   +  +F  +   S     + +  S++E+YNE++ DLL+++   S      
Sbjct: 192 -PEEAGLISLSVEHIFAQIMSESLANKSFQVTVSYLEIYNEKIYDLLNQSSLKSP----- 245

Query: 178 IFDXXXXXXXXXXXXXXXXXPKPNEGSSFGTRRKTRAPSIHRXXXXXXXXXXXXXXXXXA 237
                                KP   +  GT    R  S H                   
Sbjct: 246 --------GGGSGGGYGSFSSKPTHAA--GTELPVRDDSKH------------------G 277

Query: 238 IHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYKKCN---GE 294
           + +  L E  +  +++ ++ +  G  +R+   T  N  SSRSH I T+ L   C      
Sbjct: 278 VRVMGLTEQRVYSSEDVLKWISLGDTNRRTGETDYNTRSSRSHAIVTLNL--ACTDLVSG 335

Query: 295 SFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSLH------ 348
           +   S ++L DLAGSE   R+  Q++R KE   IN+SLL LG VI+ L+  S+H      
Sbjct: 336 AETTSTLSLCDLAGSE---RAAGQHERRKEGAFINKSLLALGTVISKLSASSMHTTPSFG 392

Query: 349 ---IPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNI 399
              IP+R+SKLTR+LQ +L G +    I TI        ET +T+ +A++AKN+
Sbjct: 393 NSHIPYRDSKLTRILQPALSGESIVTTICTIDTRLDAMSETVNTIRFASRAKNV 446

>ZYRO0F07414g Chr6 (600148..602112) [1965 bp, 654 aa] {ON} similar
           to uniprot|P28743 Saccharomyces cerevisiae YPL155C KIP2
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 654

 Score =  139 bits (350), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 112/361 (31%), Positives = 167/361 (46%), Gaps = 70/361 (19%)

Query: 61  YTVDKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 120
           +  D VF  + + + ++   ++P+     +G N TV  YGMT +GKT+TM G E      
Sbjct: 122 FKYDHVFKTACNNVEVYAQTSKPMIDRVFEGLNATVFAYGMTGSGKTFTMAGTE------ 175

Query: 121 LSEGAGIIPRVLFKLFDAL---SAQGDD-YMIKCSFIELYNEELKDLL----DETPDSSM 172
             E  G+IP  +  L+  +   S QGD  + I  S++E+YNE++ DLL    +  P ++ 
Sbjct: 176 --ETLGLIPLSVAYLYSRVMEESLQGDSRFEIAVSYLEIYNEKIYDLLDCENELKPTAAT 233

Query: 173 PKKLRIFDXXXXXXXXXXXXXXXXXPKPNEGSSFGTRRKTRAPSIHRXXXXXXXXXXXXX 232
               R+F                        +  GTR  ++ P                 
Sbjct: 234 SS--RMF------------------------AHMGTR-SSKTP----------VELKLRE 256

Query: 233 XXXXAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYKKCN 292
                + I  L E     + E ++ ++ G + R+   T  N  SSRSH I  I L K   
Sbjct: 257 DSKYGVKIVGLTERRCESSDELLKWIRIGDKSRKTGETTYNTRSSRSHAIVMIRLTKTDL 316

Query: 293 GESFRVSK-MNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSL---- 347
            E   VS  ++L DLAGSE   ++   N+R KE   IN+SLL LG VI+ L+ +S     
Sbjct: 317 KEGTSVSSTLSLCDLAGSE---KAVTHNERRKEGAFINKSLLALGTVISKLSAESTSHRN 373

Query: 348 ---------HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKN 398
                    HIP+R+SKLTR+LQ +L GN     I TI      S ET +TL +A++AKN
Sbjct: 374 GGSSSPVTGHIPYRDSKLTRILQPALSGNGVVTTICTIDTRPDASSETLNTLRFASRAKN 433

Query: 399 I 399
           +
Sbjct: 434 V 434

>YPL155C Chr16 complement(257216..259336) [2121 bp, 706 aa] {ON}
           KIP2Kinesin-related motor protein involved in mitotic
           spindle positioning, stabilizes microtubules by
           targeting Bik1p to the plus end; Kip2p levels are
           controlled during the cell cycle
          Length = 706

 Score =  139 bits (350), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 117/379 (30%), Positives = 174/379 (45%), Gaps = 88/379 (23%)

Query: 61  YTVDKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 120
           +  D VF      L +++  ++P+    + G+N T+  YGMT +GKT+TM+G+E+    E
Sbjct: 163 FKFDHVFASHCTNLEVYERTSKPMIDKLLMGFNATIFAYGMTGSGKTFTMSGNEQ----E 218

Query: 121 LSEGAGIIPRVLFKLFDAL---SAQGD-DYMIKCSFIELYNEELKDLLD---ETPDSSMP 173
           L    G+IP  +  LF  +   S  GD  + +  S++E+YNE + DLL+   E   S + 
Sbjct: 219 L----GLIPLSVSYLFTNIMEQSMNGDKKFDVIISYLEIYNERIYDLLESGLEESGSRIS 274

Query: 174 KKLRIFDXXXXXXXXXXXXXXXXXPKPNEGSSFGTRRKTRAPSIHRXXXXXXXXXXXXXX 233
              R++                   K N  +  G   K R  S +               
Sbjct: 275 TPSRLY-----------------MSKSNS-NGLGVELKIRDDSQY--------------- 301

Query: 234 XXXAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYKKC-- 291
               + +  L E     ++E +R +  G + R++  T  N  SSRSH I  I L      
Sbjct: 302 ---GVKVIGLTERRCESSEELLRWIAVGDKSRKIGETDYNARSSRSHAIVLIRLTSTNVK 358

Query: 292 NGESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSL-ADK----- 345
           NG S R S ++L DLAGSE   R+  Q +R KE   IN+SLL LG VI+ L ADK     
Sbjct: 359 NGTS-RSSTLSLCDLAGSE---RATGQQERRKEGSFINKSLLALGTVISKLSADKMNSVG 414

Query: 346 -------------------------SLHIPFRESKLTRLLQDSLGGNTKTALIATISPAK 380
                                    S HIP+R+SKLTRLLQ +L G++    I T+    
Sbjct: 415 SNIPSPSASGSSSSSGNATNNGTSPSNHIPYRDSKLTRLLQPALSGDSIVTTICTVDTRN 474

Query: 381 INSEETSSTLEYATKAKNI 399
             + ET +TL +A++AKN+
Sbjct: 475 DAAAETMNTLRFASRAKNV 493

>SAKL0H06490g Chr8 complement(571300..573273) [1974 bp, 657 aa] {ON}
           similar to uniprot|P28743 Saccharomyces cerevisiae
           YPL155C KIP2 Kinesin-related motor protein involved in
           mitotic spindle positioning
          Length = 657

 Score =  138 bits (348), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 119/435 (27%), Positives = 199/435 (45%), Gaps = 86/435 (19%)

Query: 61  YTVDKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 120
           ++ D VF P+ D   +++  A P+ +   +G+N T+  YGMT +GKT+TM+G        
Sbjct: 147 FSFDHVFHPTNDNFAVYEETARPMIEKLFQGFNSTIFAYGMTGSGKTFTMSGT------- 199

Query: 121 LSEGAGIIPRVLFKLFDAL---SAQGDDYMIKCSFIELYNEELKDLLDETPDSSMPKKLR 177
            S   G+IP  +  +F  +   S     + +K S++E+YNE                  +
Sbjct: 200 -SNEPGLIPLSVNDIFSNIMSKSLNNQRFDVKVSYLEIYNE------------------K 240

Query: 178 IFDXXXXXXXXXXXXXXXXXPKPNEGSSFGTRRKTRAPSIHRXXXXXXXXXXXXXXXXXA 237
           I+D                        SFGT+       I                    
Sbjct: 241 IYDLLNYQVSK---------------GSFGTKTTGIELKIR-------------DDSKYG 272

Query: 238 IHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYK---KCNGE 294
           + +  L E  +  +++ ++ +  G  +R+   T  N  SSRSH I  I L     K   E
Sbjct: 273 VKVIGLTEQEVDTSEDVMKWIALGNSNRKTGETDFNSRSSRSHAIVLIRLTCTDLKSGLE 332

Query: 295 SFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSL------- 347
           +   S ++L DLAGSE   R+ AQ +R KE   IN+SLL LG VI+ L+ +S        
Sbjct: 333 T--TSTLSLCDLAGSE---RATAQRERRKEGAFINKSLLALGTVISKLSAESTQNMGVGG 387

Query: 348 --HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNI-----K 400
             HIP+R+SKLTR+LQ +L G+     I T+     +S ET +T+ +A++AKNI     +
Sbjct: 388 GHHIPYRDSKLTRILQPALSGDGIVTTICTVDAHAESSAETINTIRFASRAKNISLVVKR 447

Query: 401 NKPQVGSFIMKDVLLKSVTAELVKIKSDLLSTKSKDGIYM-----SQENYKELTNELENY 455
           N+  + +   KD +++++  +L +    +   KS +G        + E+   L +E +  
Sbjct: 448 NEMDISN--EKDHIIENLRRQLEQQNETIAVLKSNNGTCRTTDAGASEDALSLQSENKVL 505

Query: 456 KTEVEECKRAMEKVS 470
           K  +E C++ ++K S
Sbjct: 506 KLRLEHCEKLLDKDS 520

>NDAI0E02090 Chr5 complement(423630..425687) [2058 bp, 685 aa] {ON} 
          Length = 685

 Score =  137 bits (346), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 120/409 (29%), Positives = 181/409 (44%), Gaps = 78/409 (19%)

Query: 28  SVVVAVPDVTGTNEVSINTTG----DTGITAQINSKTYTVDKVFGPSADQLLIFKVIAEP 83
           ++ VA+     +N   ++T+     D    A  +   +  D VF      L I++VI  P
Sbjct: 100 TITVAIRPKPTSNPSDVSTSSWLVTDEKTIAHDDVGEFKFDHVFNSFVSNLEIYQVINRP 159

Query: 84  LFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSEGAGIIPRVLFKLFDAL---S 140
           +     +G+N T+  YGMT +GKTYTM G       E  +  G+IP  +  LF  +   +
Sbjct: 160 MIDKLFQGFNSTIFAYGMTGSGKTYTMMGCP-----EREQKDGLIPLSVSYLFTKIMEET 214

Query: 141 AQGD-DYMIKCSFIELYNEELKDLL-DETPDSSMPKKLRIFDXXXXXXXXXXXXXXXXXP 198
             GD  + I  S++E+YNE++ DLL DE  +++       F                   
Sbjct: 215 LDGDKKFEIVLSYLEIYNEKIYDLLGDENNNNNNNNGTLAFGTPT--------------- 259

Query: 199 KPNEGSSFGTRRKTRAPSIHRXXXXXXXXXXXXXXXXXAIHIQNLQEFHIMDAKEGIRLL 258
           + N    F    K R  S +                   + +  L E     ++E +  +
Sbjct: 260 RNNNNICFQNELKIRDDSKY------------------GVRVIGLTEKRCESSEELMNWI 301

Query: 259 QRGLRHRQVASTKMNDVSSRSHTIFTIMLYKKCNGESFRVSK-MNLVDLAGSENISRSGA 317
            +G + R+ A T  N  SSRSH I  I L      +   +S  ++L DLAGSE   R+  
Sbjct: 302 IKGDKIRKTAETDFNARSSRSHAIVLIRLTTSDMKDGTSISSTLSLCDLAGSE---RATG 358

Query: 318 QNQRAKEAGSINQSLLTLGRVINSLADKS---------------------------LHIP 350
           Q +R KE   IN+SLL LG VI+ L+ +S                            HIP
Sbjct: 359 QQERRKEGAFINKSLLALGTVISKLSTESNKNRSPTLPSPPLSSSSSSTSINSSVPGHIP 418

Query: 351 FRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNI 399
           +R+SKLTRLLQ +L G++    I TI     +S ET +TL +A++AKNI
Sbjct: 419 YRDSKLTRLLQPALSGDSIVTTICTIDTKNESSAETLNTLRFASRAKNI 467

>Skud_16.127 Chr16 complement(228817..230937) [2121 bp, 706 aa] {ON}
           YPL155C (REAL)
          Length = 706

 Score =  137 bits (346), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 111/375 (29%), Positives = 168/375 (44%), Gaps = 80/375 (21%)

Query: 61  YTVDKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 120
           +  D VF      L +++   +P+    + G+N T+  YGMT +GKT+TM+G+E+    E
Sbjct: 163 FKFDHVFASHCTNLEVYERTGKPMIDKLLMGFNATIFAYGMTGSGKTFTMSGNEQ----E 218

Query: 121 LSEGAGIIPRVLFKLFDALSAQGDD----YMIKCSFIELYNEELKDLLDETPDSSMPKKL 176
           L    G+IP  +  LF  +  Q  D    + +  S++E+YNE + DLL+   + S  +  
Sbjct: 219 L----GLIPLSVSYLFSNIMEQSMDGDKKFDVIISYLEIYNERIYDLLESGLEESGSRP- 273

Query: 177 RIFDXXXXXXXXXXXXXXXXXPKPNEGSSFGTRRKTRAPSIHRXXXXXXXXXXXXXXXXX 236
                                 K N  ++ G   K R  S +                  
Sbjct: 274 -------------GTPSRSYMGKSNS-NAMGVELKIRDDSKY------------------ 301

Query: 237 AIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYKK-CNGES 295
            + +  L E      +E +R +  G + R++  T  N  SSRSH I  I L     N  +
Sbjct: 302 GVKVIGLTERRCESTEELLRWIGIGDKSRKIGETDYNTRSSRSHAIVLIRLTSTDVNNGT 361

Query: 296 FRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSL-ADKSL------- 347
            R S ++L DLAGSE   R+  Q +R KE   IN+SLL LG VI+ L ADK+        
Sbjct: 362 SRSSTLSLCDLAGSE---RATGQQERRKEGSFINKSLLALGTVISKLSADKTTSVDSNIS 418

Query: 348 -----------------------HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSE 384
                                  HIP+R+SKLTRLLQ +L G++    I T+      + 
Sbjct: 419 TTPTGSSGSSSGSITGNSGIPSNHIPYRDSKLTRLLQPALSGDSIVTTICTVDTRNDAAA 478

Query: 385 ETSSTLEYATKAKNI 399
           ET +TL +A++AKN+
Sbjct: 479 ETMNTLRFASRAKNV 493

>KLTH0G03850g Chr7 (308053..309474) [1422 bp, 473 aa] {ON} some
           similarities with uniprot|P28742 Saccharomyces
           cerevisiae YBL063W
          Length = 473

 Score =  134 bits (336), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 80/172 (46%), Positives = 111/172 (64%), Gaps = 8/172 (4%)

Query: 240 IQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYKKCN---GESF 296
           ++ LQEF +    E +  L++G   + V +T +N+ SSRSHTIFTI + +K N   G   
Sbjct: 170 VEGLQEFEVNSVDEILDYLRQGSERKTVGATLVNEQSSRSHTIFTINVEQKENSPLGHVL 229

Query: 297 -RVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSLH--IPFRE 353
            R S + L+DLAGSE  + SGA  +R KE  +IN+SL TLGRVI  LA K     IP+R+
Sbjct: 230 ERRSSIRLIDLAGSERANASGATGERLKEGSNINKSLSTLGRVIAMLAKKKQPRLIPYRD 289

Query: 354 SKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQV 405
           + LT +L++SLGGN+KT +IA +SP     EET STL YAT A+++K   Q+
Sbjct: 290 AALTWVLKESLGGNSKTCMIACVSPCDF--EETMSTLRYATLARSVKTFAQL 339

 Score = 67.8 bits (164), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 55/100 (55%), Gaps = 15/100 (15%)

Query: 72  DQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSEGAGIIPRV 131
           DQ  +++ +A       + GYN  +  YG T +GK++TMTG   L         GI+PR+
Sbjct: 62  DQAQLYEQLARDYLLHALDGYNTCIFAYGQTGSGKSHTMTGSAEL--------PGIVPRM 113

Query: 132 LFKLFDA--LSAQGDD-----YMIKCSFIELYNEELKDLL 164
             +LF+   +    DD     + I+CS++E+YNE ++DLL
Sbjct: 114 CQELFEVREMYESSDDQASTQFKIRCSYLEIYNETVRDLL 153

>Smik_6.352 Chr6 (564913..567060) [2148 bp, 715 aa] {ON} YPL155C
           (REAL)
          Length = 715

 Score =  134 bits (336), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 112/384 (29%), Positives = 171/384 (44%), Gaps = 92/384 (23%)

Query: 61  YTVDKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 120
           +  D VF      L +++  ++P+    + G+N T+  YGMT +GKT+TM+G+E+    E
Sbjct: 163 FKFDHVFASHCTNLEVYEKTSKPMIDKLLMGFNATIFAYGMTGSGKTFTMSGNEQ----E 218

Query: 121 LSEGAGIIPRVLFKLFDAL---SAQGD-DYMIKCSFIELYNEELKDLLD---ETPDSSMP 173
           L    G+IP  +  LF  +   S  GD  + +  S++E+YNE + DLL+   E   S + 
Sbjct: 219 L----GLIPLSVSYLFTNIMEQSMNGDKKFDVVISYLEIYNERIYDLLESGLEESGSRLG 274

Query: 174 KKLRIFDXXXXXXXXXXXXXXXXXPKPNEGSSFGTRRKTRAPSIHRXXXXXXXXXXXXXX 233
              R +                     N  ++ G   K R  S +               
Sbjct: 275 TPSRSYMSK------------------NNSNALGVELKIRDDSQY--------------- 301

Query: 234 XXXAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYKK-CN 292
               + +  L E     +++ +R +  G + R++  T  N  SSRSH I  I L      
Sbjct: 302 ---GVKVIGLTERRCESSEDLLRWIAVGDKSRKIGETDYNARSSRSHAIVLIRLTSTDVR 358

Query: 293 GESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSL-ADK------ 345
             + R S ++L DLAGSE   R+  Q +R KE   IN+SLL LG VI+ L ADK      
Sbjct: 359 DGTSRSSTLSLCDLAGSE---RATGQQERRKEGSFINKSLLALGTVISKLSADKTNSVGS 415

Query: 346 ------------------------------SLHIPFRESKLTRLLQDSLGGNTKTALIAT 375
                                         S HIP+R+SKLTRLLQ +L G++    I T
Sbjct: 416 IIPTTPTSSGNSSSSSSSSSGSIVSNSNTSSNHIPYRDSKLTRLLQPALSGDSIVTTICT 475

Query: 376 ISPAKINSEETSSTLEYATKAKNI 399
           +      + ET +TL +A++AKN+
Sbjct: 476 VDTRNDAAAETMNTLRFASRAKNV 499

>KLLA0B00759g Chr2 (59965..61335) [1371 bp, 456 aa] {ON} some
           similarities with uniprot|P28742 Saccharomyces
           cerevisiae YBL063W KIP1 Kinesin-related motor protein
           required for mitotic spindle assembly and chromosome
           segregation; functionally redundant with Cin8p
          Length = 456

 Score =  129 bits (325), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 99/265 (37%), Positives = 150/265 (56%), Gaps = 28/265 (10%)

Query: 240 IQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYKKCNGESFRVS 299
           +Q++  F +   +E +  L  G   R VAST+MN  SSRSH IFT+ + ++    S R S
Sbjct: 150 VQDITTFKVNRVEEVLEYLSIGDSKRSVASTRMNMESSRSHAIFTLSIKQQEPDGSIRES 209

Query: 300 KMNLVDLAGSE--NISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSLH-IPFRESKL 356
            + LVDLAGSE  N +      +R KE  +IN+SL TLGR I+ LA  S H IP+R+S L
Sbjct: 210 DLKLVDLAGSERANATMGIDNGKRMKEGANINKSLSTLGRCISQLAKNSKHLIPYRDSLL 269

Query: 357 TRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGSFI------M 410
           T +L+++LGGN+KT +IA ISP  I+ EE+ STL YAT AK IK +  +   +      M
Sbjct: 270 TWVLKENLGGNSKTCMIACISP--IDLEESLSTLRYATTAKEIKLRATMNEIVPNINEDM 327

Query: 411 KDVLLKSVTA--ELVKIKSDLLSTKSKDGIYMSQENYKELTNELENYKTEVEECKRAMEK 468
           K  +  + ++  EL  +KS++ S +S+  I            + E +KT  E+       
Sbjct: 328 KAAVEAAASSRKELEMLKSEMSSLQSEYNI------------KSEQWKTH-EKLLVRFNH 374

Query: 469 VSAQNSLLIKEKRVSNEVNESQKVK 493
           ++  N  L  E +++NE+ +SQ ++
Sbjct: 375 ITKLNDYL--ENQLTNEITKSQSLQ 397

 Score = 63.2 bits (152), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 36/110 (32%), Positives = 54/110 (49%), Gaps = 9/110 (8%)

Query: 59  KTYTVDKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYD 118
           +++  D +F  S+ Q  I   +        ++GYN  +  YG T +GKTYTM G      
Sbjct: 35  RSFNFDHIFDTSSSQTDIPGELCSKYVLHALEGYNACIFAYGQTGSGKTYTMRGT----- 89

Query: 119 GELSEGAGIIPRVLFKLFDALSAQGDDY-MIKCSFIELYNEELKDLLDET 167
              +   GIIP +   LFDAL         +  ++ E+YNE+L DLL +T
Sbjct: 90  ---NSNPGIIPLLCRDLFDALELDKTTVSSVSITYFEIYNEKLIDLLGDT 136

>TPHA0D04190 Chr4 complement(899419..901437) [2019 bp, 672 aa] {ON} 
          Length = 672

 Score =  127 bits (320), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 108/347 (31%), Positives = 158/347 (45%), Gaps = 72/347 (20%)

Query: 61  YTVDKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 120
           +T DK+FG   D   +F  I + L Q  + GYN  +  YG T +GKTYTM          
Sbjct: 384 FTFDKIFGMQDDNYEVFDDI-KNLVQSSLDGYNVCIFTYGQTGSGKTYTM---------- 432

Query: 121 LSEGAGIIPRVL---FKLFDALSAQGDDYMIKCSFIELYNEELKDLLDETPDSSMPKKLR 177
           L+E  GII + +         L   G +Y ++  FIE+YNE ++DLL+  P++     +R
Sbjct: 433 LNEKDGIIMQTIEYIVHFAGNLHKLGWEYELEVEFIEIYNETIRDLLN--PEAKHQHVIR 490

Query: 178 IFDXXXXXXXXXXXXXXXXXPKPNEGSSFGTRRKTRAPSIHRXXXXXXXXXXXXXXXXXA 237
             D                          GT   T    I                    
Sbjct: 491 HDDKK------------------------GTTEVTNTHKI-------------------T 507

Query: 238 IHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYKKCNG---- 293
           I + + ++  I  + +  +L++ G   R   ST MN+ SSRSH++F +    K  G    
Sbjct: 508 IKLTHNEDDEIAKSAQIRQLIRNGNNTRNTKSTHMNNASSRSHSVFMM----KITGHNRI 563

Query: 294 -ESFRVSKMNLVDLAGSENISRSG--AQNQRAKEAGSINQSLLTLGRVINSLADKSLHIP 350
            +     ++NLVDLAGSE + +       +  KE  SIN+SL  L  VI+S+  +  +IP
Sbjct: 564 TQEHSTGRLNLVDLAGSERLQQQEQITSQETLKETTSINKSLTCLADVIHSMKHRQPYIP 623

Query: 351 FRESKLTRLLQDSLGGNTKTALIATISPAKINS-EETSSTLEYATKA 396
           FR SKLT LL++SL   +KT +   ISP  INS  ET ++L  A K 
Sbjct: 624 FRNSKLTYLLKNSLINKSKTLMYVNISP-NINSIRETINSLRLARKV 669

>Kwal_47.18608 s47 complement(896394..897833) [1440 bp, 479 aa] {ON}
           YGL216W (KIP3) - kinesin-related protein involved in
           mitosis [contig 192] FULL
          Length = 479

 Score =  125 bits (313), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 74/174 (42%), Positives = 110/174 (63%), Gaps = 8/174 (4%)

Query: 240 IQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYKK---CNGESF 296
           ++ L+EF +   ++ +  +++G   R + ST +N+ SSRSHTIFTI + +K     G   
Sbjct: 170 VEGLREFDVSSVEDILNYVKQGNEKRMMGSTLVNEYSSRSHTIFTISIKQKEKSALGHVI 229

Query: 297 -RVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSLH--IPFRE 353
            R S + L+DLAGSE    +     R KE  +IN+SL TLGRVI+ LA +     IP+R+
Sbjct: 230 ERHSSIKLIDLAGSERAKAAKTSGDRLKEGSNINKSLSTLGRVISMLAKRKQPKLIPYRD 289

Query: 354 SKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGS 407
           + LT +L++SLGGN+KT +IA +SP   + EET STL YAT A+N+K   Q+ +
Sbjct: 290 AALTWVLKESLGGNSKTCMIACVSPC--DYEETLSTLRYATLARNVKTCAQLNA 341

 Score = 73.9 bits (180), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 55/175 (31%), Positives = 85/175 (48%), Gaps = 33/175 (18%)

Query: 1   MSDDEELNITVAVRCRGRNEKEVKARSSVVVAVPDVTGTNEVSINTTGDTGITAQINSKT 60
           MSD    NI VAVR R   E+EV    S++  V D         N   +T        ++
Sbjct: 1   MSD----NIKVAVRLRRPLEREVD--ESIIARVEDGNVIQVKDRNQKNET--------RS 46

Query: 61  YTVDKVFGPS----ADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERL 116
           +  D+ F  S    ADQL +++ ++       + GY+  V  YG T +GK++TMTG    
Sbjct: 47  FHFDQCFAYSENIEADQLELYEQLSREYLLHALDGYHTCVFAYGQTGSGKSHTMTGS--- 103

Query: 117 YDGELSEGAGIIPRVLFKLFDA--LSAQGDD-----YMIKCSFIELYNEELKDLL 164
                 E  GI+ R+  +LF+   +    DD     + I+CS++E+YNE ++DLL
Sbjct: 104 -----PESPGIVSRMCQELFEVREIYESSDDQVNTQFKIRCSYLEIYNETVRDLL 153

>Suva_16.155 Chr16 complement(266334..268448) [2115 bp, 704 aa] {ON}
           YPL155C (REAL)
          Length = 704

 Score =  124 bits (312), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 108/380 (28%), Positives = 171/380 (45%), Gaps = 90/380 (23%)

Query: 61  YTVDKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 120
           +  D VF      L +++  ++P+    + G+N T+  YGMT +GKT+TM+G+E+    E
Sbjct: 163 FEFDHVFASHCTNLEVYERTSKPMIDKLLVGFNATIFAYGMTGSGKTFTMSGNEQ----E 218

Query: 121 LSEGAGIIPRVLFKLFD---ALSAQGD-DYMIKCSFIELYNEELKDLLDETPDSSM---- 172
           L    G+IP  +  LF     LS  GD  + +  S++E+YNE + DLL+   + S+    
Sbjct: 219 L----GLIPLSVSYLFSNVMELSMNGDKKFDVIISYLEIYNERIYDLLESGLEESLSRPS 274

Query: 173 -PKKLRIFDXXXXXXXXXXXXXXXXXPKPNEGSSFGTRRKTRAPSIHRXXXXXXXXXXXX 231
            P +L +                       +G+S G   + +                  
Sbjct: 275 TPSRLYM----------------------GKGNSNGLSAELKI----------------R 296

Query: 232 XXXXXAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYKK- 290
                 + +  L E     ++E ++ +  G + R++  T  N  SSRSH I  I L    
Sbjct: 297 DDTQYGVKVIGLTERRCESSEELLKWIAIGDKSRKIGETDYNARSSRSHAIVLIRLTSTD 356

Query: 291 CNGESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSL-ADK---- 345
               + R S ++L DLAGSE   R+  Q +R KE   IN+SLL LG VI+ L ADK    
Sbjct: 357 LESGTSRSSTLSLCDLAGSE---RATGQQERRKEGSFINKSLLALGTVISKLSADKINPT 413

Query: 346 --SLHIP------------------------FRESKLTRLLQDSLGGNTKTALIATISPA 379
             ++H                          +R+SKLTRLLQ +L G++    I T+   
Sbjct: 414 GSNIHTTPTNTGSSSSGTVTSNNNIPNNHIPYRDSKLTRLLQPALSGDSIVTTICTVDTR 473

Query: 380 KINSEETSSTLEYATKAKNI 399
              + ET +TL +A++AKN+
Sbjct: 474 NDAAAETINTLRFASRAKNV 493

>Kwal_47.19093 s47 complement(1092732..1095191) [2460 bp, 819 aa]
           {ON} YGL216W (KIP3) - 1:1 [contig 188] FULL
          Length = 819

 Score =  121 bits (304), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 102/360 (28%), Positives = 185/360 (51%), Gaps = 49/360 (13%)

Query: 238 IHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYKKCNG---- 293
           I + NL    +   ++ + L+ +G  +R  ++T  N+ SSRSH +  + + ++       
Sbjct: 241 ITVANLSHHPLSTVEDVMDLVIKGNTNRTTSATDANETSSRSHAVLQVHITQRNRTAELT 300

Query: 294 ESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA-----DKSLH 348
           E  + + ++L+DLAGSE  S +  + +R  E  +IN+SLL LG  IN+L          H
Sbjct: 301 EDHKFATLSLIDLAGSERASATKNRGERLHEGANINRSLLALGNCINALCVSGRKRGGYH 360

Query: 349 IPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNK------ 402
           +P+R+SKLTRLL+ SLGGN KT +I  ISP+  + +ET +TL+YAT+AK IK K      
Sbjct: 361 VPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSNHYDETLNTLKYATRAKEIKTKIIRNQH 420

Query: 403 ---PQVGSFI------------MKDVLLKSVTAEL--VKIKSDLLSTKSKDGIYMSQENY 445
                VGS++            +++   K +  E+   KI  + +     D ++  + NY
Sbjct: 421 SLDRHVGSYLKMITEQRQEIEELRERERKMIDLEISRYKISRERIHMAVWDSVHSLRHNY 480

Query: 446 K--ELTNELENYKTEVEECKRAMEKVSAQNSLLIKEKRVSNEVNESQKVKLRKLGNNIEF 503
           K  E    L+  K+ +   +R ++ V  + ++L+K      +++            N   
Sbjct: 481 KNSEKFQHLKVIKSLMLCKRRFLQMVGVELAVLLKHITPDTDMHA-----------NCST 529

Query: 504 LYDKIDRQHKNEQELSNVVQELMRAL-HTMQQSL-RIYEDQGQRFHTEMERVLYDNIGSF 561
           L+++++++ KN ++  +   EL  AL HT +  + ++ E +G R  T++    YD++ S+
Sbjct: 530 LHEQLNQKVKNLEQSFDSPDELESALEHTREVDMVKLQEMEGWRDDTDLP--WYDSLLSW 587

 Score = 70.9 bits (172), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 59/111 (53%), Gaps = 11/111 (9%)

Query: 61  YTVDKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 120
           +  D+VF   + Q+ +++    PL    + G+N TV  YG T  GKTYT++G        
Sbjct: 125 FVFDRVFDMDSSQIEVYEATTRPLLDSVLDGFNGTVFAYGATGCGKTYTVSG-------- 176

Query: 121 LSEGAGIIPRVLFKLFDALSAQGDD--YMIKCSFIELYNEELKDLLD-ETP 168
             E  GII   + +LF  +    D   + +  S++E+YNE ++DLL+ ETP
Sbjct: 177 TPENPGIIFLTMQELFAKMEELQDTKRFELSASYLEIYNETIRDLLEPETP 227

>KAFR0F04210 Chr6 complement(826173..828191) [2019 bp, 672 aa] {ON}
           Anc_3.528 YGL216W
          Length = 672

 Score =  120 bits (301), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 71/173 (41%), Positives = 108/173 (62%), Gaps = 8/173 (4%)

Query: 238 IHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYKKCN----- 292
           I + NL      + ++ I L+ RG  +R  + T+ N+VSSRSH++  I + +        
Sbjct: 211 ISVTNLSYHRPENVQDVIDLVIRGNLNRSSSPTEANEVSSRSHSVLQIHVKQVLKNFDDI 270

Query: 293 GESFRV-SKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA--DKSLHI 349
           G + ++ S ++++DLAGSE    +  +  R  E  +IN+SLL LG  IN+L    KS HI
Sbjct: 271 GSTNQIDSTLSIIDLAGSERAITTKNRGIRLYEGANINKSLLALGNCINALCINKKSCHI 330

Query: 350 PFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNK 402
           P+R+SKLTRLL+ SLGGN KT +I  +SP+ ++ +ET +TL+YA +AK IK K
Sbjct: 331 PYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSLHYDETLNTLKYANRAKEIKTK 383

 Score = 68.9 bits (167), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 42/114 (36%), Positives = 57/114 (50%), Gaps = 14/114 (12%)

Query: 61  YTVDKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 120
           +  DK+F   + Q  IF+    PL    + G+N TV  YG T  GKTYT+ G        
Sbjct: 92  FIFDKLFDDDSTQEQIFEDTTRPLLDSVLDGFNGTVFAYGATGCGKTYTING-------- 143

Query: 121 LSEGAGIIPRVLFKLFDALSAQGDD-----YMIKCSFIELYNEELKDLLD-ETP 168
            SE  GII R + +LF  +     D       I  S++E+YNE ++DLL  ETP
Sbjct: 144 TSEDPGIIFRTMNELFGKIEILLQDSNRSKIEISLSYLEIYNETIRDLLKPETP 197

>NCAS0E00550 Chr5 complement(93778..96132) [2355 bp, 784 aa] {ON}
           Anc_3.528
          Length = 784

 Score =  120 bits (301), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 69/175 (39%), Positives = 105/175 (60%), Gaps = 10/175 (5%)

Query: 238 IHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYKKCNGESFR 297
           I + NL   +    +E I L+ +G  +R  + T+ N+VSSRSH +  I + +        
Sbjct: 267 ISVSNLSYHNPQTVQEVIDLVIKGNINRTTSPTEANEVSSRSHAVLQIHIMQTNRTADLT 326

Query: 298 ----VSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA------DKSL 347
                + ++++DLAGSE  + +  + +R  E  +IN+SLL LG  IN+L       ++S 
Sbjct: 327 SEHTFATLSIIDLAGSERAAATKNRGERLYEGANINRSLLALGNCINALCLTDGGTNRSC 386

Query: 348 HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNK 402
           HIP+R+SKLTRLL+ SLGGN KT +I  ISP+  + +ET +TL+YA +AK IK K
Sbjct: 387 HIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 441

 Score = 69.7 bits (169), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 65/120 (54%), Gaps = 13/120 (10%)

Query: 61  YTVDKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 120
           +  DK+F   A Q  +++     L    + G+N TV  YG T  GKTYT++G        
Sbjct: 151 FVFDKLFDQDASQETVYQSTTSGLLDSVLDGFNGTVFAYGATGCGKTYTVSG-------- 202

Query: 121 LSEGAGIIPRVLFKLFDALSAQGDD--YMIKCSFIELYNEELKDLLDETPDSSMPKKLRI 178
             E  GII RV+ +LF+ +    D   + +  S++E+YNE ++DLL   P+ ++PK+L I
Sbjct: 203 TPEQPGIIFRVMQELFERMEDLKDTKRFELSLSYLEIYNETIRDLLK--PE-TVPKRLII 259

>ZYRO0E08668g Chr5 complement(694586..696922) [2337 bp, 778 aa] {ON}
           similar to uniprot|P53086 Saccharomyces cerevisiae
           YGL216W KIP3 Kinesin-related motor protein involved in
           mitotic spindle positioning
          Length = 778

 Score =  120 bits (300), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 65/175 (37%), Positives = 105/175 (60%), Gaps = 9/175 (5%)

Query: 237 AIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYKKCNGESF 296
           +I + NL  ++    ++ + L+ +G  +R  ++T  N+ SSRSH +  I + +       
Sbjct: 243 SIRVSNLSHYNPQKVEDVMDLVIKGNMNRTTSATDANEASSRSHAVLQIHIMQHNRTADL 302

Query: 297 R----VSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA-----DKSL 347
           +     + ++++DLAGSE  + +  +  R  E  +IN+SLL LG  IN+L       +S 
Sbjct: 303 KSDHTFATLSIIDLAGSERAATTKNRGNRLYEGANINRSLLALGNCINALCLNDGTRRSC 362

Query: 348 HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNK 402
           H+P+R+SKLTRLL+ SLGGN KT +I  ISP+  + +ET +TL+YA +AK IK K
Sbjct: 363 HVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSTHYDETLNTLKYANRAKEIKTK 417

 Score = 66.2 bits (160), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 40/122 (32%), Positives = 65/122 (53%), Gaps = 13/122 (10%)

Query: 61  YTVDKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 120
           +  D++F   + Q  +++    PL    + G+N TV  YG T  GKTYT++G        
Sbjct: 128 FVFDRLFDVDSTQKDVYESTMIPLLDSVLDGFNGTVFAYGATGCGKTYTISGS------- 180

Query: 121 LSEGAGIIPRVLFKLFDALSAQGD--DYMIKCSFIELYNEELKDLLDETPDSSMPKKLRI 178
             E  GII + + +LF+ +    D   + +  SF+E+YNE ++DLL   P++S  KKL I
Sbjct: 181 -PENPGIIFQAMQELFNRIENLKDTKHFELSLSFLEIYNESIRDLL--CPETS-SKKLVI 236

Query: 179 FD 180
            +
Sbjct: 237 LE 238

>CAGL0I07029g Chr9 (675486..677603) [2118 bp, 705 aa] {ON} similar
           to uniprot|P53086 Saccharomyces cerevisiae YGL216w KIP3
           kinesin-related protein required for nuclear migration
          Length = 705

 Score =  118 bits (296), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 69/175 (39%), Positives = 102/175 (58%), Gaps = 10/175 (5%)

Query: 238 IHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYKKCNG---- 293
           I + NL +      +E + L+ RG  +R  + T+ N+VSSRSH +  I + +K       
Sbjct: 272 ITVANLSQHFPTTVQEVMDLVIRGNFNRTTSPTEANEVSSRSHAVLQIHIVQKNRTPDIK 331

Query: 294 ESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA------DKSL 347
           E      ++++DLAGSE  + +  +  R  E  +IN+SLL LG  IN+L           
Sbjct: 332 EEHTFGTLSIIDLAGSERAAATKNRGARLHEGANINRSLLALGNCINALCINGNDERPRC 391

Query: 348 HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNK 402
           H+P+R+SKLTRLL+ SLGGN KT +I  ISP+  + +ET +TL+YA +AK IK K
Sbjct: 392 HVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 446

 Score = 68.2 bits (165), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 38/111 (34%), Positives = 57/111 (51%), Gaps = 11/111 (9%)

Query: 61  YTVDKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 120
           +  DK+F   A Q  +++     L    + G+N TV  YG T  GKTYT++G        
Sbjct: 156 FVFDKLFDTDATQREVYQSTTSSLLDSVLDGFNGTVFAYGATGCGKTYTVSG-------- 207

Query: 121 LSEGAGIIPRVLFKLFDALSAQGD--DYMIKCSFIELYNEELKDLLD-ETP 168
             E  GI+ + + +LF  +    D   + I  SF+E+YNE ++DLL  ETP
Sbjct: 208 TPENPGIVFQAMEELFQKMEDLKDTKSFQISLSFLEIYNERIRDLLKPETP 258

>Smik_7.48 Chr7 (79575..81992) [2418 bp, 805 aa] {ON} YGL216W (REAL)
          Length = 805

 Score =  118 bits (296), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 69/175 (39%), Positives = 106/175 (60%), Gaps = 12/175 (6%)

Query: 238 IHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYKK------C 291
           I + NL   H    ++ + L+ +G  +R  + T+ N+VSSRSH +  I + +        
Sbjct: 269 IKVANLSYHHPTTVEDVMDLVVQGNINRTTSPTEANEVSSRSHAVLQIHIMQTNKLVDLT 328

Query: 292 NGESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA----DKSL 347
           +  +F  + ++++DLAGSE  + +  +  R  E  +IN+SLL LG  IN+L      +S 
Sbjct: 329 SQHTF--ATLSIIDLAGSERAAATRNRGIRLHEGANINRSLLALGNCINALCLNDGSRSC 386

Query: 348 HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNK 402
           HIP+R+SKLTRLL+ SLGGN KT +I  ISP+  + +ET +TL+YA +AK IK K
Sbjct: 387 HIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 441

 Score = 70.1 bits (170), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 38/111 (34%), Positives = 60/111 (54%), Gaps = 11/111 (9%)

Query: 61  YTVDKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 120
           +  DK+F  ++ Q  ++K    PL    + G+N TV  YG T  GKTYT++G        
Sbjct: 153 FVFDKLFDENSSQSRVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSGT------- 205

Query: 121 LSEGAGIIPRVLFKLFDALSAQGDD--YMIKCSFIELYNEELKDLL-DETP 168
                GII   + +LF+ ++   D+  + I  S++E+YNE ++DLL  ETP
Sbjct: 206 -PSQPGIIFLAMEELFNKIADLRDEKNFEISLSYLEIYNERIRDLLKPETP 255

>Skud_7.53 Chr7 (90098..92515) [2418 bp, 805 aa] {ON} YGL216W (REAL)
          Length = 805

 Score =  118 bits (296), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 69/175 (39%), Positives = 107/175 (61%), Gaps = 12/175 (6%)

Query: 238 IHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYKK------C 291
           I + NL   H    ++ + L+ +G  +R  + T+ N+VSSRSH++  I + +        
Sbjct: 269 IKVANLSYHHPTTVEDVMDLVVQGNINRTTSPTEANEVSSRSHSVLQIHIMQTNKLVDLT 328

Query: 292 NGESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA----DKSL 347
           +  +F  + ++++DLAGSE  S +  +  R  E  +IN+SLL LG  IN+L      ++ 
Sbjct: 329 SQHTF--ATLSIIDLAGSERASATRNRGIRLHEGANINRSLLALGNCINALCLNDGSRTC 386

Query: 348 HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNK 402
           HIP+R+SKLTRLL+ SLGGN KT +I  ISP+  + +ET +TL+YA +AK IK K
Sbjct: 387 HIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 441

 Score = 71.2 bits (173), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 60/111 (54%), Gaps = 11/111 (9%)

Query: 61  YTVDKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 120
           +  DK+F  ++ Q+ ++K    PL    + G+N TV  YG T  GKTYT++G        
Sbjct: 153 FVFDKLFDENSSQVRVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSGT------- 205

Query: 121 LSEGAGIIPRVLFKLFDALSAQGDD--YMIKCSFIELYNEELKDLL-DETP 168
                GII   + +LF+ +S   D+  + I  S++E+YNE + DLL  ETP
Sbjct: 206 -PSQPGIIFLAMEELFNKISDLKDEKNFEISLSYLEIYNERISDLLRPETP 255

>KNAG0B00520 Chr2 (85045..87216) [2172 bp, 723 aa] {ON} Anc_3.528
           YGL216W
          Length = 723

 Score =  117 bits (294), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 94/328 (28%), Positives = 165/328 (50%), Gaps = 31/328 (9%)

Query: 238 IHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYKKCN----G 293
           I + NL        ++ + L+ RG  +R  + T+ N VSSRSH +  I + ++       
Sbjct: 259 ISVSNLSYHSPRSVQDVLDLVIRGNDNRTTSPTEANSVSSRSHAVLQIHIMQRNKLVDLK 318

Query: 294 ESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLAD-----KSLH 348
           E      ++++DLAGSE  + +  + +R  E  +IN+SLL LG  IN+L       ++ H
Sbjct: 319 EHQTFGTLSIIDLAGSERAAATKNRGRRLHEGANINRSLLALGNCINALCSNDGSHRNQH 378

Query: 349 IPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGSF 408
           +P+R+SKLTRLL+ SLGGN KT +I  ISP+  + +ET +TL+YA +AK IK K      
Sbjct: 379 VPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSAHYDETLNTLKYANRAKEIKTK-----V 433

Query: 409 IMKDVLLKSVTAELVKIKSDLLSTKSKDGIYMSQENYKELTNELENYKTEVEECKRAMEK 468
           I     L    A  +K+ ++    ++ D +   Q    ++   + NYK  +E+ +R++E+
Sbjct: 434 IRNHQTLNRHVASYLKMITE--QKRTIDELEARQAQMVQVG--ITNYKLAIEKIERSIEE 489

Query: 469 VSAQNSLLIKEKRVSN-----EVNESQKVKLRKLGNNIEFLYDKIDRQHKNEQELSNVVQ 523
           V       +  K   N      +  +++  L+ +   +E +   +     +E     +++
Sbjct: 490 VVGNVCKQLSSKSFQNIKLLKALTLTKRTLLQLIVIEVENVLAIV-----SEWTDQRIIE 544

Query: 524 ELMRALHTMQQSLRIYEDQGQRFHTEME 551
              R +  MQ+ +++ ED   RF T  E
Sbjct: 545 TCERVIRQMQEQVKLLED---RFDTATE 569

 Score = 72.4 bits (176), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 46/129 (35%), Positives = 66/129 (51%), Gaps = 15/129 (11%)

Query: 53  TAQINSKTYTVDKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTG 112
           T   +   +  DK+F     Q  +++     L    + G+N TV  YG T  GKTYT++G
Sbjct: 135 TGSADETKFVFDKLFDTDVSQEDVYRGTTSTLLDSVLDGFNGTVFAYGATGCGKTYTVSG 194

Query: 113 DERLYDGELSEGAGIIPRVLFKLF---DALSAQGDDYMIKCSFIELYNEELKDLLDETPD 169
                     E  GII R + +LF   DAL A   D+ +  SF+E+YNE + DLL  +PD
Sbjct: 195 TR--------ENPGIIFRTMEELFVKMDAL-AGTKDFELTVSFLEIYNETIHDLL--SPD 243

Query: 170 SSMPKKLRI 178
           +  P+KL I
Sbjct: 244 TP-PQKLVI 251

>Suva_7.44 Chr7 (79883..82300) [2418 bp, 805 aa] {ON} YGL216W (REAL)
          Length = 805

 Score =  118 bits (295), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 68/175 (38%), Positives = 106/175 (60%), Gaps = 12/175 (6%)

Query: 238 IHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYKK------C 291
           I + NL   H    ++ + L+ +G  +R  + T+ N+VSSRSH +  I + +        
Sbjct: 269 IKVANLSYHHPTTVEDVMNLVVQGNINRTTSPTEANEVSSRSHAVLQIHIMQTNKLVDLT 328

Query: 292 NGESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA----DKSL 347
           +  +F  + ++++DLAGSE  + +  +  R  E  +IN+SLL LG  IN+L      ++ 
Sbjct: 329 SQHTF--ATLSVIDLAGSERAAATRNRGLRLHEGANINRSLLALGNCINALCLNDGSRTC 386

Query: 348 HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNK 402
           HIP+R+SKLTRLL+ SLGGN KT +I  ISP+  + +ET +TL+YA +AK IK K
Sbjct: 387 HIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 441

 Score = 70.9 bits (172), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 67/137 (48%), Gaps = 15/137 (10%)

Query: 39  TNEVSINTTGDTGITAQINSK----TYTVDKVFGPSADQLLIFKVIAEPLFQDFIKGYNC 94
           T   SIN+ G     +Q         +  DK+F  ++ Q  ++K    PL    + GYN 
Sbjct: 127 TASSSINSNGTNKFASQRRRHGGEIKFVFDKLFDENSSQTQVYKETTSPLLDSVLDGYNS 186

Query: 95  TVLVYGMTSTGKTYTMTGDERLYDGELSEGAGIIPRVLFKLFDALSAQGDD--YMIKCSF 152
           TV  YG T  GKTYT++G             G+I   + +LF+ +    D+  + I  S+
Sbjct: 187 TVFAYGATGCGKTYTVSGT--------PSQPGVIFLAMEELFNKIDDLKDEKNFEISLSY 238

Query: 153 IELYNEELKDLL-DETP 168
           +E+YNE ++DLL  ETP
Sbjct: 239 LEIYNERIRDLLKPETP 255

>YGL216W Chr7 (84885..87302) [2418 bp, 805 aa] {ON}
           KIP3Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 805

 Score =  117 bits (294), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 69/175 (39%), Positives = 106/175 (60%), Gaps = 12/175 (6%)

Query: 238 IHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYKK------C 291
           I + NL   H    ++ + L+ +G  +R  + T+ N+VSSRSH +  I + +        
Sbjct: 269 IKVANLSYHHPNTVEDVMDLVVQGNINRTTSPTEANEVSSRSHAVLQIHIMQTNKLVDLT 328

Query: 292 NGESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA----DKSL 347
           +  +F  + ++++DLAGSE  + +  +  R  E  +IN+SLL LG  IN+L      +S 
Sbjct: 329 SQHTF--ATLSIIDLAGSERAAATRNRGIRLHEGANINRSLLALGNCINALCLNDGSRSC 386

Query: 348 HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNK 402
           HIP+R+SKLTRLL+ SLGGN KT +I  ISP+  + +ET +TL+YA +AK IK K
Sbjct: 387 HIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 441

 Score = 73.6 bits (179), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 60/111 (54%), Gaps = 11/111 (9%)

Query: 61  YTVDKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 120
           +  DK+F  ++ Q  ++K    PL    + G+N TV  YG T  GKTYT++G        
Sbjct: 153 FVFDKLFDETSSQARVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSGT------- 205

Query: 121 LSEGAGIIPRVLFKLFDALSAQGD--DYMIKCSFIELYNEELKDLL-DETP 168
                GII   + +LF+ ++   D  D+ I  S++E+YNE ++DLL  ETP
Sbjct: 206 -PSQPGIIFLAMEELFNKITDLKDEKDFEISLSYLEIYNERIRDLLKPETP 255

>Kpol_423.8 s423 (11134..13554) [2421 bp, 806 aa] {ON}
           (11134..13554) [2421 nt, 807 aa]
          Length = 806

 Score =  117 bits (294), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 83/255 (32%), Positives = 136/255 (53%), Gaps = 29/255 (11%)

Query: 238 IHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYKKCNG---- 293
           I + NL        ++ + L+ +G  +R  ++T  N+ SSRSH +  I + +        
Sbjct: 262 ISVANLSHHRPKTVQDVMDLIIKGNINRTTSATDANETSSRSHAVLQIHISQTNRTVDLT 321

Query: 294 ESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA-----DKSLH 348
            S   + ++++DLAGSE  + +  + +R  E  +IN+SLL LG  IN+L       +S H
Sbjct: 322 SSHVFATLSIIDLAGSERAASTKNRGERLYEGANINKSLLALGNCINALCLNDGTRRSCH 381

Query: 349 IPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKP----- 403
           +P+R+SKLTRLL+ SLGGN KT +I  +SP+  + +ET +TL+YA +AK IK K      
Sbjct: 382 VPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSTHYDETLNTLKYANRAKEIKTKVIRNQQ 441

Query: 404 ----QVGSFIMKDVLLKSVTAELVKIKSDLLSTKSKDGIYMSQENYKELTNELENYKTEV 459
                VGS+      LK +T +  +I  D L  + ++ I +  + YK      E  +  +
Sbjct: 442 SLNRHVGSY------LKMITEQKKEI--DELRQREQNMIEIQLKKYKL---GREKIQLSM 490

Query: 460 EECKRAMEKVSAQNS 474
           ++C R ++   AQ S
Sbjct: 491 DDCLRNIQNTYAQTS 505

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 63/120 (52%), Gaps = 13/120 (10%)

Query: 61  YTVDKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 120
           +  DK+F   + QL +++     L    + G+N TV  YG T  GKTYT++G        
Sbjct: 146 FIFDKLFNEGSSQLAVYRSTTSLLLDSVLDGFNGTVFAYGATGCGKTYTISGT------- 198

Query: 121 LSEGAGIIPRVLFKLFDALSAQGD--DYMIKCSFIELYNEELKDLLDETPDSSMPKKLRI 178
             E  GII   + +LF  +    D  ++ +  S++E+YNE ++DLL+  PD+   KKL I
Sbjct: 199 -PEQPGIIFLAMEELFQKIENIKDTKNFELTLSYLEIYNESIRDLLN--PDTP-SKKLVI 254

>ZYRO0D12650g Chr4 (1071620..1073056) [1437 bp, 478 aa] {ON} some
           similarities with uniprot|P28742 Saccharomyces
           cerevisiae YBL063W KIP1
          Length = 478

 Score =  114 bits (286), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 78/200 (39%), Positives = 114/200 (57%), Gaps = 13/200 (6%)

Query: 240 IQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIML-----YKKCNGE 294
           ++ L+E  + + +E I  + +G  +R V ST MN  SSRSH IF I +     +KK    
Sbjct: 180 VEGLEEIAVHNVEELISCIHKGNENRTVRSTNMNQESSRSHAIFHISVNQKETHKKTGTV 239

Query: 295 SFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLAD----KSLHIP 350
               S   LVDLAGSE +  + A  +  +E  SIN+SL  LGRVI+ LA+    +S  IP
Sbjct: 240 VECHSTCKLVDLAGSERLGSAAADGKIRQEGTSINKSLSILGRVISLLAEGDRQRSQMIP 299

Query: 351 FRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGSFIM 410
           +RES LT +L+++LGGN+ T L+A +SP   N  E+ STL YA+  K +K    + S   
Sbjct: 300 YRESALTWILKENLGGNSNTCLVACVSPE--NYYESLSTLRYASLTKKVKTNATINSMSH 357

Query: 411 KDVL--LKSVTAELVKIKSD 428
            + +  LK+   EL K+ +D
Sbjct: 358 IEQMEELKAKLRELQKMIND 377

 Score = 74.3 bits (181), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 63/120 (52%), Gaps = 21/120 (17%)

Query: 58  SKTYTVDKVFGPS----ADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGD 113
           +K +  D  FG +     DQ +I++ +        ++GYN  +L YG T +GKT+TM G+
Sbjct: 49  AKEFRYDHCFGSTDSVDRDQSIIYESLVRGYVLHTLEGYNSCILAYGQTGSGKTFTMMGE 108

Query: 114 ERLYDGELSEGAGIIPRVLFKLFDA--LSAQGD-------DYMIKCSFIELYNEELKDLL 164
           +           GI+PR   +LF+   +  Q D       D+ +KCSF E+YNE++ DLL
Sbjct: 109 K--------GNEGIVPRFCRELFEVFHMCHQDDQESDIITDFQVKCSFFEIYNEQVIDLL 160

>NDAI0I02960 Chr9 complement(699469..702075) [2607 bp, 868 aa] {ON}
           Anc_3.528
          Length = 868

 Score =  117 bits (292), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 69/178 (38%), Positives = 104/178 (58%), Gaps = 13/178 (7%)

Query: 238 IHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYKKCN----G 293
           I + NL   +    ++ I L+ RG  +R  +ST+ N+VSSRSH +  I + +        
Sbjct: 307 ISVSNLSYHYPKSVQDVIDLVIRGNINRSTSSTEANEVSSRSHAVLQIHIMQTNTKIDLT 366

Query: 294 ESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA---------D 344
                + ++++DLAGSE  + +  + +R  E  +IN+SLL LG  IN+L          +
Sbjct: 367 SEHTFATLSIIDLAGSERAAATKNRGERLYEGANINKSLLALGNCINALCIPTNNTRRRN 426

Query: 345 KSLHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNK 402
              HIP+R+SKLTRLL+ SLGGN KT +I  ISP+  + +ET +TL+YA +AK IK K
Sbjct: 427 IRYHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 484

 Score = 68.6 bits (166), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 43/127 (33%), Positives = 67/127 (52%), Gaps = 13/127 (10%)

Query: 54  AQINSKTYTVDKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGD 113
           A+ N   +  DK+F  ++ Q  ++      L    + G+N TV  YG T  GKTYT++G 
Sbjct: 184 AKKNEMKFVFDKIFDENSSQDEVYLGTTSSLLDSVLDGFNGTVFAYGATGCGKTYTVSGT 243

Query: 114 ERLYDGELSEGAGIIPRVLFKLFDALSAQGDD--YMIKCSFIELYNEELKDLLDETPDSS 171
           +        E  GII RV+ +LF+ +    D+  + +  S++E+YNE + DLL   PD+ 
Sbjct: 244 Q--------ENPGIIFRVMQELFERMEDLKDEKTFQLSISYLEIYNEMIYDLL--KPDTP 293

Query: 172 MPKKLRI 178
             KKL I
Sbjct: 294 -SKKLII 299

>TDEL0D05960 Chr4 complement(1079683..1081884) [2202 bp, 733 aa]
           {ON} Anc_3.528 YGL216W
          Length = 733

 Score =  116 bits (291), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 64/174 (36%), Positives = 103/174 (59%), Gaps = 9/174 (5%)

Query: 238 IHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYKKCNGESFR 297
           I + NL        ++ + L+  G  +R  ++T  N+ SSRSH +  I + +        
Sbjct: 245 ISVANLSHHRPKTVEDVMDLVVLGNTNRTTSATDANETSSRSHAVLQINIVQSSRTAEIT 304

Query: 298 ----VSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA-----DKSLH 348
                +K++++DLAGSE  + +  + +R +E  +IN+SLL LG  IN+L       ++ H
Sbjct: 305 SDHTFAKLSIIDLAGSERAASTKNRGERLQEGANINRSLLALGNCINALCISDGTRRTCH 364

Query: 349 IPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNK 402
           +P+R+SKLTRLL+ SLGGN KT +I  +SP+  + +ET +TL+YA +AK IK K
Sbjct: 365 VPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSTHYDETLNTLKYANRAKEIKTK 418

 Score = 64.7 bits (156), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 62/120 (51%), Gaps = 13/120 (10%)

Query: 61  YTVDKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 120
           +  DK+F  +A Q  ++      L    + G+N TV  YG T  GKTYT++G        
Sbjct: 129 FVFDKLFDENATQEEVYSGTTSELLDAVLDGFNGTVFAYGATGCGKTYTVSG-------- 180

Query: 121 LSEGAGIIPRVLFKLFDALSAQGD--DYMIKCSFIELYNEELKDLLDETPDSSMPKKLRI 178
             E  G+I   + +LF  +    D   + I  S++E+YNE ++DLL  +P+ S PKKL I
Sbjct: 181 TPERPGVIFLAMQELFARMEELEDTRKFEISVSYLEIYNETIRDLL--SPEMS-PKKLVI 237

>TBLA0C04960 Chr3 complement(1210067..1212472) [2406 bp, 801 aa]
           {ON} Anc_3.528 YGL216W
          Length = 801

 Score =  116 bits (290), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 68/178 (38%), Positives = 105/178 (58%), Gaps = 13/178 (7%)

Query: 238 IHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYKK------C 291
           I + NL  +     +E + L+ +G  +R  +ST  N+ SSRSH +  I L ++       
Sbjct: 226 ISVSNLSTYSPATIEEVMDLIIQGNLNRTTSSTHANETSSRSHAVLQIHLTQQNKLNNDI 285

Query: 292 NGESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSL-------AD 344
           N      S ++++DLAGSE  + +  + +   E  +IN+SLL LG  IN+L       + 
Sbjct: 286 NSTEQLFSTLSIIDLAGSERAASTKNRGETLLEGANINKSLLALGNCINALCINTSSHSQ 345

Query: 345 KSLHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNK 402
           + +HIP+R+SKLTRLL+ SLGGN KT +I  +SP+  + +ET +TL+YA +AK IK K
Sbjct: 346 QQIHIPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSKHYDETLNTLKYANRAKEIKTK 403

 Score = 75.5 bits (184), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 62/120 (51%), Gaps = 13/120 (10%)

Query: 61  YTVDKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 120
           +  DK+   ++ Q  +F+   EPL    + GYN TV  YG T  GKTYT++G        
Sbjct: 110 FIFDKLLDQNSTQQHVFQSTTEPLLDSILDGYNGTVFAYGATGCGKTYTISGT------- 162

Query: 121 LSEGAGIIPRVLFKLFDALSAQGD--DYMIKCSFIELYNEELKDLLDETPDSSMPKKLRI 178
             E  GII   L  LF+ +    D  +  I  S++E+YNE +KDLLD T  S   KKL I
Sbjct: 163 -PENPGIIFLTLQSLFNKIENLKDTKEISISLSYLEIYNESIKDLLDPTISS---KKLVI 218

>TBLA0C01880 Chr3 (441985..443391) [1407 bp, 468 aa] {ON} Anc_8.678
           YPL155C
          Length = 468

 Score =  113 bits (283), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 103/338 (30%), Positives = 157/338 (46%), Gaps = 90/338 (26%)

Query: 76  IFKVIAEPLFQ----DFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSEGAGIIPRV 131
           IF    +PL      D I G   T++ YG T +GKTYTM G +       +EG GI+   
Sbjct: 122 IFVRDCKPLVHRVATDCISG---TIIAYGATGSGKTYTMHGTK-------AEG-GIVQ-- 168

Query: 132 LFKLFDALSAQGDDYMIKCSFIELYNEELKDLLDETPDSSMPKKLRIFDXXXXXXXXXXX 191
              + D L+    +  I  S++E+YNE L DLL +       K+LRI D           
Sbjct: 169 -LSIRDLLTQLSKNCQITISYLEIYNERLHDLLCDG-----TKELRILDDS--------- 213

Query: 192 XXXXXXPKPNEGSSFGTRRKTRAPSIHRXXXXXXXXXXXXXXXXXAIHIQNLQEFHIM-- 249
                                 AP                     A  +  L+E  I   
Sbjct: 214 ----------------------AP--------------------IACRLHGLKETTITLD 231

Query: 250 DAKEGI-RLLQ---RGLRHRQVASTKMNDVSSRSHTIFTIMLYKKCNGESFRVSKMNLVD 305
           D+++ + R+L+   +G R+R+V ST+ N  SSRSH +  + +     G   RV  + L D
Sbjct: 232 DSEQSVSRVLELVAQGNRNRRVRSTQHNTGSSRSHAVLRLRITDSM-GSKARV--LTLCD 288

Query: 306 LAGSENISRSGAQNQRAK-EAGSINQSLLTLG---RVINSLADKSLHIPFRESKLTRLLQ 361
           LAGSE   R+   ++  + E G+IN+SL+ LG   R++N     S H+P+R+SKLTRLL+
Sbjct: 289 LAGSE---RASVHDRGLRAEGGAINKSLMALGTVVRLLNETGPSSTHVPYRDSKLTRLLK 345

Query: 362 DSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNI 399
            SL GN    ++ T+S +  + E++  TL +A +A  +
Sbjct: 346 PSLSGNGLVTMVCTVSLSGTDYEQSLGTLRFARRASGV 383

>TPHA0D03480 Chr4 complement(731687..734230) [2544 bp, 847 aa] {ON}
           Anc_3.528 YGL216W
          Length = 847

 Score =  115 bits (288), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 66/176 (37%), Positives = 103/176 (58%), Gaps = 13/176 (7%)

Query: 238 IHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYKK------C 291
           I + NL        +E +  + RG  +R  + T  N+ SSRSH +  I + +        
Sbjct: 244 ITVSNLSHHKPQTVQEVMDFVIRGNMNRTTSPTDANETSSRSHAVLQIHIAQTDRTPDLI 303

Query: 292 NGESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA-----DKS 346
           +  +F  + ++++DLAGSE  + +  + +R  E  +IN+SLL LG  IN+L       ++
Sbjct: 304 SNSTF--ATLSIIDLAGSERAASTKNRGERLIEGANINKSLLALGNCINALCISDGTRRT 361

Query: 347 LHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNK 402
            H+P+R+SKLTRLL+ SLGGN KT +I  ISP+  + +ET +TL YA +AK+IK K
Sbjct: 362 CHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSTHYDETLNTLTYANRAKDIKTK 417

 Score = 62.4 bits (150), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 34/107 (31%), Positives = 56/107 (52%), Gaps = 10/107 (9%)

Query: 61  YTVDKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 120
           +  DK+F  +A+Q  ++      L    + G+N TV  YG T  GKT+T++G        
Sbjct: 128 FVFDKLFDETANQTNVYNSTTSSLLDSVLDGFNGTVFAYGATGCGKTFTISG-------- 179

Query: 121 LSEGAGIIPRVLFKLFDALSAQGDDYMIK--CSFIELYNEELKDLLD 165
             E  GII   + +LF  + +  D   I+   S++E+YNE ++DLL+
Sbjct: 180 TPEQPGIIFLTMDELFKRIESLKDTKNIELTLSYLEIYNETIRDLLN 226

>AER441C Chr5 complement(1480055..1482511) [2457 bp, 818 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL216W
           (KIP3)
          Length = 818

 Score =  115 bits (288), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 72/194 (37%), Positives = 109/194 (56%), Gaps = 24/194 (12%)

Query: 246 FHIMDAKEGIR-LLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYKKCNGESFRVSKM--- 301
           +H  +  E +  L+ RG  +R  + T  N+ SSRSH +  + + +       +  KM   
Sbjct: 251 YHTPETVEDVMDLVIRGNVNRTTSPTDANETSSRSHAVLQVHVVQSSRTVDLKEDKMYAT 310

Query: 302 -NLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKS----LHIPFRESKL 356
            +++DLAGSE  S +  + +R  E  +IN+SLL LG  IN+L         H+P+R+SKL
Sbjct: 311 LSIIDLAGSERASATKNRGERLHEGSNINKSLLALGNCINALCMTGRRAVCHVPYRDSKL 370

Query: 357 TRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKP---------QVGS 407
           TRLL+ SLGGN KT +I  +SP+  + +ET +TL+YA +AK+IK K           VGS
Sbjct: 371 TRLLKFSLGGNCKTVMIVCVSPSSAHYDETLNTLKYANRAKDIKTKVIRNQHSLDRHVGS 430

Query: 408 FIMKDVLLKSVTAE 421
           +      LK +TA+
Sbjct: 431 Y------LKMITAQ 438

 Score = 65.9 bits (159), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 59/112 (52%), Gaps = 12/112 (10%)

Query: 61  YTVDKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 120
           +  DK+F   A Q  +F+    PL    + G+N TV  YG T  GKT+T++G        
Sbjct: 128 FMFDKLFDVDASQQDVFQCTTMPLLDSILDGFNGTVFAYGATGCGKTFTISG-------- 179

Query: 121 LSEGAGIIPRVLFKLFDALSAQGD--DYMIKCSFIELYNEELKDLLDETPDS 170
             +  GII   + +LF  ++   D   + +  S++E+YNE ++DLL+  PD+
Sbjct: 180 TPDSPGIIFLTMQELFQRINNLKDTKTFELTVSYLEIYNETIRDLLE--PDT 229

>Kpol_1019.11 s1019 complement(20458..22401) [1944 bp, 647 aa] {ON}
           complement(20458..22401) [1944 nt, 648 aa]
          Length = 647

 Score =  114 bits (284), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 135/516 (26%), Positives = 229/516 (44%), Gaps = 122/516 (23%)

Query: 43  SINTTGDTGITA----QINSKTYTVDKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLV 98
           SIN T DT +T     Q+ +  Y  DKVF  S D  +  +   E   +  ++GYN +++ 
Sbjct: 52  SINFT-DTQLTGFSKDQVVNTQYKFDKVFA-SNDTGVEHQEFIESNLESLLQGYNTSIVT 109

Query: 99  YGMTSTGKTYTMTGDERLYDGELSEGAGIIPRVLFKLFDALSAQ-GDD-----YMIKCSF 152
           YG + TGK++ + G+++          G+I ++L KLF+ +  + G++     Y +K SF
Sbjct: 110 YGQSGTGKSFELYGEQQ---------DGLIFQLLTKLFNRIDEEMGNNNKNIHYTVKFSF 160

Query: 153 IELYNEELKDLLDETPDSSMPKKLRIFDXXXXXXXXXXXXXXXXXPKPNEGSSFGTRRKT 212
           +E+Y E++ DL+D +P  S+ K L+I D                       S++      
Sbjct: 161 LEVYQEKMFDLMD-SP--SVKKHLKIND-----------------------STYAMN--- 191

Query: 213 RAPSIHRXXXXXXXXXXXXXXXXXAIHIQNLQEFHIMDAKE-----GIRLLQRGLRHRQV 267
                                      ++NL+   ++  +E      I LL +  RH   
Sbjct: 192 ------------------------GFQVENLRTTQVLTLEELKILINICLLNQKERH--- 224

Query: 268 ASTKMNDVSSRSHTIFTIMLYKKCN-GESFRVSKMNLVDLAGSENISRSGAQNQRAKEAG 326
                N++  RSHTI  + + K+    ES  +S + +VDLAGS+ I ++ +     ++A 
Sbjct: 225 -----NNLIQRSHTIMEVSIEKRNKLDESITMSSLYIVDLAGSDPIGKNSSSGITTEDAK 279

Query: 327 SINQSLLTLGRVINSLA----------DKS--LH-IPFRESKLTRLLQDSLGGNTKTALI 373
            IN  + ++  VIN L           D S  +H +P++ S LTRLL D LGGN KT  +
Sbjct: 280 KINHQIKSVNDVINGLVVMNREGGIMTDISTLMHKVPYKSSILTRLLLDPLGGNCKTTFL 339

Query: 374 ATISPAKINSEETSSTLEYATKAKNIKNKPQVGSFIMKDVLLKSVTAELVKIKSDLLSTK 433
            T S  K +  ET STL++    K+    P++  F +       +    +K+K D     
Sbjct: 340 LTSSLKKNDWNETLSTLKFGYNCKSANTNPRINRFGLNSKATMDIFLTDMKLKED----- 394

Query: 434 SKDGIYMSQENYKELTNELENYKTEV----EECKRAMEKVSAQNSLLIKEK-----RVSN 484
                ++S  N   LTN++ N  T+     +E K    K + + + ++K +      + N
Sbjct: 395 ----NFISITN--NLTNQVNNLMTQANSLEDELKNNETKYNKKETNILKSQVETLTELLN 448

Query: 485 EVNESQKVKLRKLGNNIEFLYDKIDR-QHKNEQELS 519
             N   +V LR    N E L   +++ +H    ELS
Sbjct: 449 NPNNRSQVDLRNQNENTEILTKLLEKCEHNASLELS 484

>KNAG0A07880 Chr1 complement(1254698..1256992) [2295 bp, 764 aa]
           {ON} Anc_3.479 YPR141C
          Length = 764

 Score =  114 bits (284), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 71/155 (45%), Positives = 99/155 (63%), Gaps = 8/155 (5%)

Query: 248 IMDAKEGI-RLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLY---KKCNGESFRVSKMNL 303
           ++++KE + ++L+R  + R  AST  N+ SSRSH+IF I L+    K   ES  V  +NL
Sbjct: 602 VLESKESVDKVLKRATKLRSTASTLSNEHSSRSHSIFIIELHGVNHKTKEESCGV--LNL 659

Query: 304 VDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSL--HIPFRESKLTRLLQ 361
           VDLAGSE +  S    +R +E  +IN+SL  LG VI +L DK+   HIPFR SKLT LLQ
Sbjct: 660 VDLAGSERVHSSQVTGERLRETQNINRSLSCLGDVIYALNDKNTKRHIPFRNSKLTYLLQ 719

Query: 362 DSLGGNTKTALIATISPAKINSEETSSTLEYATKA 396
            SL GN+KT +   ISP+  +  ET ++L +A+K 
Sbjct: 720 YSLVGNSKTLMFVNISPSSSHINETINSLRFASKV 754

 Score = 75.1 bits (183), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 59/110 (53%), Gaps = 18/110 (16%)

Query: 60  TYTVDKVF--GPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLY 117
           ++  DK+F  G S D+  +FK + + L Q  + GYN  +  YG T +GKTYTM       
Sbjct: 471 SFKFDKIFDTGESNDE--VFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM------- 520

Query: 118 DGELSEGAGIIPRVLFKLFDA---LSAQGDDYMIKCSFIELYNEELKDLL 164
              L    G+IP  +  +FD    L  +G +Y I C F+E+YNE + DLL
Sbjct: 521 ---LHPNDGVIPATISHIFDWVENLKERGWEYKISCQFVEIYNENIVDLL 567

>CAGL0D04994g Chr4 complement(482176..484254) [2079 bp, 692 aa] {ON}
           similar to uniprot|P17119 Saccharomyces cerevisiae
           YPR141c KAR3 kinesin-related protein
          Length = 692

 Score =  113 bits (282), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 99/158 (62%), Gaps = 5/158 (3%)

Query: 248 IMDAKEGI-RLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYKKCNGESFRVSK-MNLVD 305
           ++D+++ + ++L+R  + R  AST  N+ SSRSH+IF I L  K  G   +    +NLVD
Sbjct: 530 VLDSRDTVDKVLKRANKLRSTASTAANEHSSRSHSIFIIHLEGKNEGTGEKSQGILNLVD 589

Query: 306 LAGSENISRSGAQNQRAKEAGSINQSLLTLGRVI---NSLADKSLHIPFRESKLTRLLQD 362
           LAGSE ++ S    +R +E  SIN+SL  LG VI   NS   +  HIPFR SKLT LLQ 
Sbjct: 590 LAGSERLNSSMVVGERLRETQSINKSLSCLGDVIHALNSPDGQKRHIPFRNSKLTYLLQY 649

Query: 363 SLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIK 400
           SL G++KT +   ISPA ++  ET ++L +A+K  N K
Sbjct: 650 SLIGSSKTLMFVNISPAALHLNETINSLRFASKVNNTK 687

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 65/123 (52%), Gaps = 17/123 (13%)

Query: 48  GDTGITA-QINSKT--YTVDKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTST 104
           GD G+T  + NS+   +  DK+F        IFK + + L Q  + GYN  +  YG T +
Sbjct: 381 GDQGMTINRGNSQVIPFKFDKIFDQQETNDEIFKEVGQ-LIQSSLDGYNVCIFAYGQTGS 439

Query: 105 GKTYTMTGDERLYDGELSEGAGIIPRVL---FKLFDALSAQGDDYMIKCSFIELYNEELK 161
           GKTYTM          L+ G GI+P  +   F   D L+A+G  Y + C FIE+YNE + 
Sbjct: 440 GKTYTM----------LNPGDGIVPATINHIFSWIDKLAARGWSYKVSCEFIEIYNENIV 489

Query: 162 DLL 164
           DLL
Sbjct: 490 DLL 492

>Ecym_1200 Chr1 (402658..405159) [2502 bp, 833 aa] {ON} similar to
           Ashbya gossypii AER441C
          Length = 833

 Score =  113 bits (283), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 76/214 (35%), Positives = 118/214 (55%), Gaps = 25/214 (11%)

Query: 257 LLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYKKCNGESFRVSK----MNLVDLAGSENI 312
           L+ +G  +R  + T  N+ SSRSH +  I + +       +  K    ++++DLAGSE  
Sbjct: 265 LVIKGNINRTTSPTDANETSSRSHAVLQIHVVQSSRSVDLKEDKTYATLSIIDLAGSERA 324

Query: 313 SRSGAQNQRAKEAGSINQSLLTLGRVINSLADKS----LHIPFRESKLTRLLQDSLGGNT 368
           S +  + +R  E  +IN+SLL LG  IN+L         H+P+R+SKLTRLL+ SLGGN 
Sbjct: 325 SATKNRGERLHEGSNINKSLLALGNCINALCMTGRRTYCHVPYRDSKLTRLLKFSLGGNC 384

Query: 369 KTALIATISPAKINSEETSSTLEYATKAKNIKNKP---------QVGSFIMKDVLLKSVT 419
           KT +I  +SP+  + +ET +TL+YA +AK+IK K           VGS+      LK +T
Sbjct: 385 KTVMIVCVSPSSAHYDETLNTLKYANRAKDIKTKVIRNQHSLDRHVGSY------LKMIT 438

Query: 420 AELVKIKSDLLSTKSKDGIYMSQENYKELTNELE 453
           ++  +I  D L  +    I +  + YK   N+L+
Sbjct: 439 SQKQEI--DELRNREAKMIDLRLQQYKLSRNKLQ 470

 Score = 65.5 bits (158), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 38/112 (33%), Positives = 57/112 (50%), Gaps = 12/112 (10%)

Query: 61  YTVDKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 120
           +  DK+F   A Q  +F     PL    I G+N TV  YG T  GKT+T++G        
Sbjct: 130 FMFDKLFDVEATQQDVFLGTTRPLLDSIIDGFNGTVFAYGATGCGKTFTISG-------- 181

Query: 121 LSEGAGIIPRVLFKLFDALSAQGD--DYMIKCSFIELYNEELKDLLDETPDS 170
             E  GII   + +LF  +    D   + +  S++E+YNE ++DLL+  PD+
Sbjct: 182 TPENPGIIFLTMQELFQRIENLKDTKTFQLTVSYLEIYNEMIRDLLE--PDT 231

>KAFR0B06590 Chr2 complement(1368106..1370226) [2121 bp, 706 aa]
           {ON} Anc_3.479 YPR141C
          Length = 706

 Score =  112 bits (281), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 71/159 (44%), Positives = 98/159 (61%), Gaps = 9/159 (5%)

Query: 249 MDAKEGI-RLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLY---KKCNGESFRVSKMNLV 304
           +D +E + ++L R  + R  ASTK N+ SSRSH+IF I L+    K N +S+ +  +NLV
Sbjct: 546 LDREETVEKVLHRATKLRSTASTKSNEHSSRSHSIFIIHLHGKNSKTNEDSYGI--LNLV 603

Query: 305 DLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVI---NSLADKSLHIPFRESKLTRLLQ 361
           DLAGSE I+ S    +R +E   IN+SL  LG VI   NS   K  HIPFR SKLT LL+
Sbjct: 604 DLAGSERINSSQVSGERLRETQHINKSLSCLGDVIHALNSSEHKERHIPFRNSKLTHLLK 663

Query: 362 DSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIK 400
            SL GN+KT +   IS +  +  ET ++L +A+K  + K
Sbjct: 664 YSLSGNSKTLMFVNISASLNHVNETINSLRFASKVNSTK 702

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 46/122 (37%), Positives = 61/122 (50%), Gaps = 14/122 (11%)

Query: 52  ITAQINSKTYTVDKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMT 111
           IT   N+  Y  DK+F        IFK + + L Q  + GYN  +  YG T +GKT+TM 
Sbjct: 412 ITKNNNTNKYKFDKIFDQFESNSEIFKEVGQ-LVQSALDGYNVCIFAYGQTGSGKTFTM- 469

Query: 112 GDERLYDGELSEGAGIIP---RVLFKLFDALSAQGDDYMIKCSFIELYNEELKDLLDETP 168
                    L+   GIIP   R +F   D L  +G +Y I C F+E+YNE + DLL E  
Sbjct: 470 ---------LNPSDGIIPSTVRHIFTWIDNLKERGWEYQINCQFVEIYNENIIDLLREKQ 520

Query: 169 DS 170
            S
Sbjct: 521 TS 522

>TBLA0C03940 Chr3 complement(946819..949038) [2220 bp, 739 aa] {ON}
           Anc_3.479 YPR141C
          Length = 739

 Score =  111 bits (278), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 73/176 (41%), Positives = 100/176 (56%), Gaps = 15/176 (8%)

Query: 239 HIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIML--YKKCNGESF 296
           ++ N++ F I +  + I L+ +    R  +ST +N  SSRSH IF I L  Y     E  
Sbjct: 563 YVTNIKRFKIENISDTIGLINKSKIKRMTSSTGLNSHSSRSHGIFIIYLEGYNHKTNEKC 622

Query: 297 RVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSL------------AD 344
            +SK+NLVDLAGSE I+ S  Q  R KE  SIN+SL  LG VI++L              
Sbjct: 623 -ISKLNLVDLAGSERINFSKVQGDRLKETQSINKSLSCLGDVIHALNRGNKNHLNSNDLQ 681

Query: 345 KSLHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIK 400
           K+ HIPFR SKLT LL+ SL G++KT +   +S  + +  ET ++L +ATK  N K
Sbjct: 682 KTRHIPFRNSKLTYLLKYSLIGDSKTLMFVNVSSNEAHLNETINSLRFATKVNNTK 737

 Score = 73.9 bits (180), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 58/118 (49%), Gaps = 17/118 (14%)

Query: 57  NSKTYTV--DKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDE 114
           N+ TY+   D VF        +F  I E L Q  + GYN  +  YG T +GKTYTM    
Sbjct: 438 NNATYSFEFDHVFKQDEGNSEVFNEI-EQLIQSALDGYNVCIFAYGQTGSGKTYTM---- 492

Query: 115 RLYDGELSEGAGIIP---RVLFKLFDALSAQGDDYMIKCSFIELYNEELKDLL-DETP 168
                 L+   G+IP   + +F   D+L   G +Y + C FIELYNE + DL  D  P
Sbjct: 493 ------LNPNDGVIPMTIKYIFNSMDSLKKNGWEYNVSCEFIELYNENIIDLFRDNGP 544

>KLTH0F14498g Chr6 complement(1188459..1190567) [2109 bp, 702 aa]
           {ON} similar to uniprot|P17119 Saccharomyces cerevisiae
           YPR141C KAR3 Minus-end-directed microtubule motor that
           functions in mitosis and meiosis localizes to the
           spindle pole body and localization is dependent on
           functional Cik1p required for nuclear fusion during
           mating potential Cdc28p substrate
          Length = 702

 Score =  108 bits (271), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 72/167 (43%), Positives = 98/167 (58%), Gaps = 6/167 (3%)

Query: 239 HIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIML--YKKCNGESF 296
           HI N+    +   +   R+L+R L+ R  A+T  N  SSRSH++F I L  Y   +GE  
Sbjct: 532 HITNITVCKLTSREMVNRMLRRALKMRSTAATVANSRSSRSHSVFIIKLDGYNTISGEK- 590

Query: 297 RVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSL--ADKS-LHIPFRE 353
               +NLVDLAGSE I     Q +R +E  +IN+SL  LG VI++L  AD S  HIPFR 
Sbjct: 591 STGTLNLVDLAGSERIHSLQPQAERLRETQNINKSLSCLGDVIHALGSADASKRHIPFRN 650

Query: 354 SKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIK 400
           SKLT LLQ SL G++KT +   +SP   +  ET ++L +A K  + K
Sbjct: 651 SKLTYLLQYSLMGDSKTLMFVNVSPCANSMLETLNSLRFAAKVNSTK 697

 Score = 72.0 bits (175), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 53/167 (31%), Positives = 76/167 (45%), Gaps = 23/167 (13%)

Query: 5   EELNITVAVRCRGRNEKEVKARSSVVVAVPDVTGTNEVSINTTGDTGITAQINSK--TYT 62
           +EL   + V CR R   E +  SS  + +   +       + TG   IT + +SK   +T
Sbjct: 358 QELRGNIRVFCRLRPALENENYSSSSIEIEKFS-------DETGMQSITIKRDSKQHKFT 410

Query: 63  VDKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELS 122
            D+ F        +F  I + L Q  + GYN  +  YG T +GKT+TM          L+
Sbjct: 411 FDRCFSAQETNGDVFSEIGQ-LIQSSLDGYNVCIFAYGQTGSGKTFTM----------LN 459

Query: 123 EGAGIIPRVLFKLF---DALSAQGDDYMIKCSFIELYNEELKDLLDE 166
              GIIP  L  +F   + L   G  Y I   F+E+YNE +KDL  E
Sbjct: 460 PNDGIIPSTLNHIFLWVEKLKELGWVYEITSQFVEIYNENIKDLFKE 506

>Kpol_505.39 s505 complement(87351..89429) [2079 bp, 692 aa] {ON}
           complement(87351..89429) [2079 nt, 693 aa]
          Length = 692

 Score =  108 bits (269), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 68/159 (42%), Positives = 96/159 (60%), Gaps = 7/159 (4%)

Query: 248 IMDAKEGIR-LLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYKKCN--GESFRVSKMNLV 304
           I+ +K+ +  L+++  + R  A+T  N+ SSRSH+IF I L    N  GES     +NLV
Sbjct: 529 ILKSKDSVDFLIKKATKLRATATTAANERSSRSHSIFIIHLRGSNNITGES-SYGILNLV 587

Query: 305 DLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSL---HIPFRESKLTRLLQ 361
           DLAGSE ++ S  +  R +E  +IN+SL  LG VI++L        HIPFR SKLT LLQ
Sbjct: 588 DLAGSERLNSSQVEGARLRETQNINKSLSCLGDVIHALGSSDASKRHIPFRNSKLTYLLQ 647

Query: 362 DSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIK 400
            SL GN+KT +   ISP +   +ET ++L +A+K    K
Sbjct: 648 YSLTGNSKTLMFVNISPTQQQIQETLNSLRFASKVNTTK 686

 Score = 68.9 bits (167), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 58/115 (50%), Gaps = 14/115 (12%)

Query: 61  YTVDKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 120
           +  D++F        +F  I + L Q  + GYN  +  YG T +GKT+TM          
Sbjct: 397 FQFDRIFDQHEVNKDVFDEIGQ-LVQSSLDGYNVCIFAYGQTGSGKTFTM---------- 445

Query: 121 LSEGAGIIPRVLFKLFD---ALSAQGDDYMIKCSFIELYNEELKDLLDETPDSSM 172
           L+   G+IP  +  +FD   +L  +G +Y + C F+E+YNE + DLL E   + +
Sbjct: 446 LNPNDGMIPATIDHIFDWTDSLKERGWEYEVSCQFVEIYNENIIDLLREETSAEL 500

>SAKL0F03168g Chr6 (261405..263525) [2121 bp, 706 aa] {ON} similar
           to uniprot|P17119 Saccharomyces cerevisiae YPR141C KAR3
           Minus-end-directed microtubule motor that functions in
           mitosis and meiosis localizes to the spindle pole body
           and localization is dependent on functional Cik1p
           required for nuclear fusion during mating potential
           Cdc28p substrate
          Length = 706

 Score =  107 bits (268), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 69/167 (41%), Positives = 97/167 (58%), Gaps = 6/167 (3%)

Query: 239 HIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIML--YKKCNGESF 296
           H+ N+    + D      LL+R  + R  A+T  N+ SSRSH++F I L  Y    GE  
Sbjct: 536 HVTNVTTCKLTDRDMVDTLLKRAAKLRSTAATGSNERSSRSHSVFIIKLRGYNSNTGEEC 595

Query: 297 RVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSL---HIPFRE 353
           + + +NLVDLAGSE I+ S     R +E  +IN+SL  LG VI++LA       HIPFR 
Sbjct: 596 QGT-LNLVDLAGSERINASQVTGDRLRETQNINKSLSCLGDVIHALASPDASKRHIPFRN 654

Query: 354 SKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIK 400
           SKLT LLQ SL G++KT +   ISP   +  ET ++L +A+K  + +
Sbjct: 655 SKLTYLLQYSLLGDSKTLMFVNISPCLDHFNETLNSLRFASKVNSTR 701

 Score = 71.2 bits (173), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 55/166 (33%), Positives = 75/166 (45%), Gaps = 25/166 (15%)

Query: 5   EELNITVAVRCRGRNEKEVKARSSVVVAVP---DVTGTNEVSINTTGDTGITAQINSKTY 61
           +EL   + V CR R   + +   S  V +    D  GT   S+N T D+          +
Sbjct: 362 QELRGNIRVFCRIRPLLQGEGSESCHVHINLFNDDEGTQ--SMNITRDS------KKHEF 413

Query: 62  TVDKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGEL 121
             DK+F P      IF+ I + L Q  + GYN  +  YG T +GKTYTM          L
Sbjct: 414 KFDKIFDPENSNDDIFEEIRQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM----------L 462

Query: 122 SEGAGIIPRVL---FKLFDALSAQGDDYMIKCSFIELYNEELKDLL 164
               G+IP  L   F+    L  +G +Y I   FIE+YNE + DLL
Sbjct: 463 HPQNGMIPSTLDHIFQWIHLLKERGWEYEISSQFIEIYNETIIDLL 508

>NCAS0C01350 Chr3 complement(246839..248806) [1968 bp, 655 aa] {ON}
           Anc_8.678
          Length = 655

 Score =  107 bits (266), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 69/179 (38%), Positives = 101/179 (56%), Gaps = 20/179 (11%)

Query: 237 AIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYKK--CNGE 294
            + +  L+E     ++E ++ ++RG  HR+ A T  N  SSRSH I  I L      +G 
Sbjct: 278 GVRVMGLREQRCESSEELMKWIRRGDSHRKTAETDYNARSSRSHAIVLIRLTNTNVIDGT 337

Query: 295 SFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSL------- 347
           S   S ++L DLAGSE   R+  Q +R KE   IN+SLL LG VI+ L+ +S        
Sbjct: 338 SIS-STLSLCDLAGSE---RATGQQERRKEGAFINKSLLALGTVISKLSAESTAASHGNS 393

Query: 348 -------HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNI 399
                  HIP+R+SKLTR+LQ +L G++    I TI   K ++ ET +TL +A++AKN+
Sbjct: 394 PNANGNGHIPYRDSKLTRILQPALSGDSIVTTICTIDTQKESAAETLNTLRFASRAKNV 452

 Score = 64.7 bits (156), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 37/109 (33%), Positives = 57/109 (52%), Gaps = 8/109 (7%)

Query: 61  YTVDKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 120
           +  D V+ P    L I++ I +P+     +G+N TV  YGMT +GKTYTM G       +
Sbjct: 135 FKFDHVYSPHVSNLEIYESINKPMIDKLFQGFNATVFAYGMTGSGKTYTMMGSGG----D 190

Query: 121 LSEGAGIIPRVLFKLFDALSAQG----DDYMIKCSFIELYNEELKDLLD 165
             +  G+IP  +  LF  +   G      + +  S++E+YNE + DLLD
Sbjct: 191 GGDDDGLIPLSVSYLFSKVIEVGLVGERKFDVLLSYLEIYNERIYDLLD 239

>NCAS0F03470 Chr6 complement(695163..697259) [2097 bp, 698 aa] {ON}
           Anc_3.479 YPR141C
          Length = 698

 Score =  105 bits (261), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 67/150 (44%), Positives = 90/150 (60%), Gaps = 8/150 (5%)

Query: 257 LLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYKK---CNGESFRVSKMNLVDLAGSENIS 313
           +L+R  + R  AST  N+ SSRSH+IF I L         ES+ +  +NLVDLAGSE I+
Sbjct: 548 ILKRANKLRSTASTGSNEHSSRSHSIFIIHLRGSNSLTGEESYGI--LNLVDLAGSERIN 605

Query: 314 RSGAQNQRAKEAGSINQSLLTLGRVINSLA---DKSLHIPFRESKLTRLLQDSLGGNTKT 370
            S     R +E  +IN+SL  LG VI++L        HIPFR SKLT LLQ SL GN+KT
Sbjct: 606 SSQVTGDRLRETQNINRSLSCLGDVIHALGGPDQGKRHIPFRNSKLTYLLQYSLTGNSKT 665

Query: 371 ALIATISPAKINSEETSSTLEYATKAKNIK 400
            +   ISP+  +  ET ++L +A+K  + K
Sbjct: 666 LMFVNISPSANHINETINSLRFASKVNSTK 695

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 58/190 (30%), Positives = 88/190 (46%), Gaps = 28/190 (14%)

Query: 5   EELNITVAVRCRGRNE-KEVKARSSVVVAVPDVTGTNEVSINTTGDTGITAQINSKT--- 60
           +EL   + V CR R     ++++ +  + V D    N +  +     GI    N+ T   
Sbjct: 343 QELRGKIRVYCRIRPPLPNIESKDTAHIKVEDFDDDNGIQ-SMEVMKGIEVNNNNATQIP 401

Query: 61  --YTVDKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYD 118
             +  DK+F  +     +FK + + L Q  + GYN  +  YG T +GKTYTM        
Sbjct: 402 QRFKFDKIFNQTDTNADVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM-------- 452

Query: 119 GELSEGAGIIPRVLFKLFDA---LSAQGDDYMIKCSFIELYNEELKDLL-----DETP-- 168
             L    GIIP  +  +F+    L  +G  Y I C F+E+YNE + DLL     D+T   
Sbjct: 453 --LRPKDGIIPSTIKHIFNWTKNLKERGWHYEIDCQFVEIYNENIIDLLRSSSNDDTRNI 510

Query: 169 DSSMPKKLRI 178
           DS++P K  I
Sbjct: 511 DSNIPTKHEI 520

>TDEL0F03640 Chr6 complement(666365..668479) [2115 bp, 704 aa] {ON}
           Anc_3.479 YPR141C
          Length = 704

 Score =  105 bits (261), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 70/152 (46%), Positives = 94/152 (61%), Gaps = 12/152 (7%)

Query: 257 LLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYKKCNGESFRVSK-----MNLVDLAGSEN 311
           LL+R  + R  AST  N+ SSRSH+IF + L    +GE+    +     +NLVDLAGSE 
Sbjct: 549 LLKRANKLRSTASTACNERSSRSHSIFIVHL----SGENVLTGERSHGILNLVDLAGSER 604

Query: 312 ISRSGAQNQRAKEAGSINQSLLTLGRVINSL--ADKS-LHIPFRESKLTRLLQDSLGGNT 368
           I+ S    +R +E  SIN+SL  LG VI++L  AD S  HIPFR SKLT LLQ SL GN+
Sbjct: 605 INTSQVIGERLRETQSINKSLSCLGDVIHALGSADASKRHIPFRNSKLTYLLQYSLTGNS 664

Query: 369 KTALIATISPAKINSEETSSTLEYATKAKNIK 400
           KT +   IS    ++ ET ++L +A+K  + K
Sbjct: 665 KTLMFVNISGNPNHTNETLNSLRFASKVNSTK 696

 Score = 71.6 bits (174), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 39/116 (33%), Positives = 58/116 (50%), Gaps = 16/116 (13%)

Query: 61  YTVDKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 120
           +  D++F        +F+ I + L Q  + GYN  +  YG T +GKTYTM          
Sbjct: 403 FKFDRIFNEKETNYDVFQEIGQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM---------- 451

Query: 121 LSEGAGIIPRVLFKLFDA---LSAQGDDYMIKCSFIELYNEELKDLL--DETPDSS 171
           L+   GIIP  +  +F+    L  +G  Y + C F+E+YNE + DLL  +E P  S
Sbjct: 452 LNPTDGIIPATITHIFNWTKNLKERGWRYDVSCQFVEIYNETIADLLRREEKPAGS 507

>Suva_16.469 Chr16 complement(811946..814141) [2196 bp, 731 aa] {ON}
           YPR141C (REAL)
          Length = 731

 Score =  105 bits (261), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 66/147 (44%), Positives = 89/147 (60%), Gaps = 8/147 (5%)

Query: 256 RLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLY---KKCNGESFRVSKMNLVDLAGSENI 312
           R+L+R  + R  AST  N+ SSRSH+IF I L     K   +S+    +NLVDLAGSE I
Sbjct: 575 RVLKRANKLRSTASTASNEHSSRSHSIFIIHLSGLNAKTGAQSY--GTLNLVDLAGSERI 632

Query: 313 SRSGAQNQRAKEAGSINQSLLTLGRVINSLA---DKSLHIPFRESKLTRLLQDSLGGNTK 369
           + S     R +E  +IN+SL  LG VI++L        HIPFR SKLT LLQ SL G++K
Sbjct: 633 NISQVVGDRLRETQNINKSLSCLGDVIHALGQPDSAKRHIPFRNSKLTYLLQYSLTGDSK 692

Query: 370 TALIATISPAKINSEETSSTLEYATKA 396
           T +   ISP+  +  ET ++L +A+K 
Sbjct: 693 TLMFVNISPSSSHINETLNSLRFASKV 719

 Score = 76.6 bits (187), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 55/107 (51%), Gaps = 14/107 (13%)

Query: 61  YTVDKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 120
           +  DK+F        +FK + + L Q  + GYN  +  YG T +GKT+TM          
Sbjct: 436 FKFDKIFDQRNTNEDVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTFTM---------- 484

Query: 121 LSEGAGIIPRVL---FKLFDALSAQGDDYMIKCSFIELYNEELKDLL 164
           L+ G GIIP  +   F   + L  +G DY + C FIE+YNE + DLL
Sbjct: 485 LNPGDGIIPSTISHIFNWINKLKTKGWDYEVNCEFIEIYNENIVDLL 531

>TPHA0D03200 Chr4 complement(659182..661356) [2175 bp, 724 aa] {ON}
           Anc_3.479 YPR141C
          Length = 724

 Score =  103 bits (258), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 65/149 (43%), Positives = 92/149 (61%), Gaps = 6/149 (4%)

Query: 257 LLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYKK--CNGESFRVSKMNLVDLAGSENISR 314
           +L++  + R  A+T  N+ SSRSH++F I L  K    G+S     +NLVDLAGSE ++ 
Sbjct: 571 VLKKATKLRATAATNSNERSSRSHSVFMIYLKGKNEITGDSSE-GILNLVDLAGSERLNS 629

Query: 315 SGAQNQRAKEAGSINQSLLTLGRVINSLA---DKSLHIPFRESKLTRLLQDSLGGNTKTA 371
           S A   R +E  +IN+SL  LG VI++L    +   HIPFR SKLT LLQ SL G++KT 
Sbjct: 630 SQAVGARLRETQNINKSLSCLGDVIHALGQNDNTKRHIPFRNSKLTYLLQYSLTGSSKTL 689

Query: 372 LIATISPAKINSEETSSTLEYATKAKNIK 400
           +   ISP K +  ET ++L +A+K  + K
Sbjct: 690 MFVNISPTKSHLNETINSLRFASKVNSTK 718

 Score = 74.7 bits (182), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 59/110 (53%), Gaps = 14/110 (12%)

Query: 58  SKTYTVDKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLY 117
           S+ Y  D++F  +     +FK I + L Q  + G+N  +  YG T +GKTYTM       
Sbjct: 427 SQIYKFDRIFDQADSNTEVFKEIGQ-LVQSSLDGHNVCIFAYGQTGSGKTYTM------- 478

Query: 118 DGELSEGAGIIPRVLFKLFD---ALSAQGDDYMIKCSFIELYNEELKDLL 164
              L++  G+IP  +  +FD   ++  +G  Y I C FIE+YNE + DLL
Sbjct: 479 ---LNDNDGMIPATISHIFDWTESMKEKGWIYDISCQFIEIYNEGIIDLL 525

>KLLA0B10956g Chr2 (958985..961057) [2073 bp, 690 aa] {ON} similar
           to uniprot|P17119 Saccharomyces cerevisiae YPR141C KAR3
           Minus-end-directed microtubule motor that functions in
           mitosis and meiosis localizes to the spindle pole body
           and localization is dependent on functional Cik1p
           required for nuclear fusion during mating potential
           Cdc28p substrate
          Length = 690

 Score =  103 bits (256), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 62/147 (42%), Positives = 92/147 (62%), Gaps = 4/147 (2%)

Query: 257 LLQRGLRHRQVASTKMNDVSSRSHTIFTIMLY--KKCNGESFRVSKMNLVDLAGSENISR 314
           +L+   + + +A+T  N+ SSRSH++FTI ++      GE+     +NLVDLAGSE I  
Sbjct: 541 VLRTANKTKSIAATNSNERSSRSHSVFTIRIHGTNSITGEA-SDGVLNLVDLAGSERIDT 599

Query: 315 SGAQNQRAKEAGSINQSLLTLGRVINSLADKSL-HIPFRESKLTRLLQDSLGGNTKTALI 373
           S     R +E  +IN+SL  LG VI +L  K + HIPFR SKLT LLQ SL G++KT + 
Sbjct: 600 SNVTGDRLRETQNINKSLSCLGDVIYALNGKDMKHIPFRNSKLTYLLQYSLIGDSKTLMF 659

Query: 374 ATISPAKINSEETSSTLEYATKAKNIK 400
             +SP+  + +ET ++L +A+K  + K
Sbjct: 660 VNVSPSSNHVKETLNSLRFASKVNSTK 686

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 56/174 (32%), Positives = 80/174 (45%), Gaps = 21/174 (12%)

Query: 8   NITVAVRCRGRNEKEVKARSSVVVAVPDVTGTNEVSINTTGDTGITAQINSKTYTVDKVF 67
           NI V  R R   E EV+  S + V+  D       + N +    I+ +  +  +  DKVF
Sbjct: 358 NIRVYCRIRPPLENEVQDISHIHVSNFD-------NRNGSQAIEISNEDRNSRFLFDKVF 410

Query: 68  GPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSEGAGI 127
             +A    +F+ + + L Q  + GYN  +  YG T +GKTYTM  D            G+
Sbjct: 411 SSNASNRDVFEEVGQ-LIQSSLDGYNVCIFAYGQTGSGKTYTMMND----------PDGV 459

Query: 128 IPRVLFKLFDA---LSAQGDDYMIKCSFIELYNEELKDLLDETPDSSMPKKLRI 178
           IP  L  +FD    L  +G DY  +  FIE+YNE++ DLL        P K  I
Sbjct: 460 IPMTLDHIFDWTHLLKERGWDYSFEAQFIEIYNEQIVDLLRSLNPEPGPTKYEI 513

>ZYRO0B04290g Chr2 (353283..355478) [2196 bp, 731 aa] {ON} similar
           to uniprot|P17119 Saccharomyces cerevisiae YPR141C KAR3
           Minus-end-directed microtubule motor that functions in
           mitosis and meiosis localizes to the spindle pole body
           and localization is dependent on functional Cik1p
           required for nuclear fusion during mating potential
           Cdc28p substrate
          Length = 731

 Score =  103 bits (256), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 66/149 (44%), Positives = 90/149 (60%), Gaps = 6/149 (4%)

Query: 257 LLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYKKCNGESFRVSK--MNLVDLAGSENISR 314
           LL++  R R  AST  N+ SSRSH++F I L K  N  +   S   +NLVDLAGSE I+ 
Sbjct: 566 LLRKANRLRSTASTSANERSSRSHSVFIIFL-KGSNHLTGEQSDGILNLVDLAGSERINS 624

Query: 315 SGAQNQRAKEAGSINQSLLTLGRVINSLADKSL---HIPFRESKLTRLLQDSLGGNTKTA 371
           S    +R +E  +IN+SL  LG V+++L        HIPFR SKLT LLQ SL GN+KT 
Sbjct: 625 SQVLGERLRETQNINKSLSCLGDVVHALGSNDAAKRHIPFRNSKLTYLLQYSLTGNSKTL 684

Query: 372 LIATISPAKINSEETSSTLEYATKAKNIK 400
           +   IS  + +  ET ++L +A+K  + K
Sbjct: 685 MFVNISACESHLNETLNSLRFASKVNSTK 713

 Score = 75.9 bits (185), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 52/171 (30%), Positives = 80/171 (46%), Gaps = 20/171 (11%)

Query: 5   EELNITVAVRCRGRNEKEVKARSSVVVAV---PDVTGTNEVSINTTGDTGITAQINSKTY 61
           +EL   + V CR R   + +  ++  + V    D  G   + I  + +TG +   N   +
Sbjct: 372 QELRGNIRVFCRIRPPLKYENPNTAHLTVNKFDDENGCQTMEIVKSNNTGNSIPQN---F 428

Query: 62  TVDKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGEL 121
             D++F  +     +F+ I + L Q  + GYN  +  YG T +GKTYTM          L
Sbjct: 429 KFDRIFDQNETNENVFEEIGQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM----------L 477

Query: 122 SEGAGIIPRVL---FKLFDALSAQGDDYMIKCSFIELYNEELKDLLDETPD 169
           +   GIIP  +   F   + L  +G +Y I C FIE+YNE + DLL    D
Sbjct: 478 NPRNGIIPATISHIFSWIENLKERGWNYEINCQFIEIYNENIADLLRSDQD 528

>KAFR0H02410 Chr8 complement(460353..462329) [1977 bp, 658 aa] {ON}
           Anc_8.678 YPL155C
          Length = 658

 Score =  102 bits (254), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 115/412 (27%), Positives = 164/412 (39%), Gaps = 89/412 (21%)

Query: 53  TAQINSKTYTVDKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTG 112
           T   N+  Y  D VF P  D   I+K  A PL            L  G  +T   Y MT 
Sbjct: 125 TINTNNDEYKFDHVFSPHVDNFEIYKTTAIPLIDK---------LFTGFNATLFCYGMT- 174

Query: 113 DERLYDGELSEGAGIIPRVLFKLFDALSAQGD----DYMIKCSFIELYNEELKDLLDETP 168
                      G+G             +  GD    D ++  S   L+N+ L    D+  
Sbjct: 175 -----------GSG----------KTYTMMGDNENPDGIVPLSVSLLFNQVLNSRNDKKY 213

Query: 169 DSSMPKKLRIFDXXXXXXXXXXXXXXXXXPKPNEGSSFGTRRKTRAPSIHRXXXXXXXXX 228
           D  +   L I++                 P           R T  PS            
Sbjct: 214 DVIL-SYLEIYNEKIYDLLDDDRTNHLLTPS----------RFTSTPS-----RLNSSEL 257

Query: 229 XXXXXXXXAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIML- 287
                    + I  L E     ++E ++ ++ G  +R+ + T+ N  SSRSH +  + L 
Sbjct: 258 RIRDDLEYGVKITGLNEERCDTSQELMKWIKYGDSNRKTSETEYNLRSSRSHAVILVRLV 317

Query: 288 -YKKCNGESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKS 346
            +   +G S   S + L DLAGSE   R+  Q +R KE   IN+SLL LG VI+ L+ +S
Sbjct: 318 THNVIDG-SKTSSTLTLCDLAGSE---RAAGQQERRKEGAFINKSLLALGTVISKLSAES 373

Query: 347 L------------------------HIPFRESKLTRLLQDSLGGNTKTALIATISPAKIN 382
           L                        HIP+R+SKLTRLLQ +L GN+    I TI P    
Sbjct: 374 LSNSKHVSNPMGPPASPSLNSNGNNHIPYRDSKLTRLLQPALSGNSAVTTICTIDPRMET 433

Query: 383 SEETSSTLEYATKAKNI-------KNKPQVG-SFIMKDVLLKSVTAELVKIK 426
             ET +TL +A++AKN+       KN   +  S + KD ++K +T  L K K
Sbjct: 434 YAETINTLRFASRAKNVSLRFNIKKNLSTISKSEVEKDKIIKELTFRLEKQK 485

>NDAI0B05770 Chr2 complement(1400232..1402523) [2292 bp, 763 aa]
           {ON} Anc_3.479
          Length = 763

 Score =  102 bits (254), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 69/155 (44%), Positives = 93/155 (60%), Gaps = 13/155 (8%)

Query: 257 LLQRGLRHRQVASTKMNDVSSRSHTIFTIML--YKKCNGE-SFRVSKMNLVDLAGSENIS 313
           +L+R  + R  AST  N+ SSRSH+IF I L    +  GE S+ +  +NLVDLAGSE I+
Sbjct: 603 ILRRANKLRSTASTLSNEHSSRSHSIFIIHLKGTNEITGEKSYGI--LNLVDLAGSERIN 660

Query: 314 RSGAQNQRAKEAGSINQSLLTLGRVINSLAD--------KSLHIPFRESKLTRLLQDSLG 365
            S    +R +E  +IN+SL  LG VI++L          K  HIPFR SKLT LLQ SL 
Sbjct: 661 SSQVTGERLRETQNINRSLSCLGDVIHALTGSEKDKENAKKRHIPFRNSKLTYLLQYSLI 720

Query: 366 GNTKTALIATISPAKINSEETSSTLEYATKAKNIK 400
           GN+KT +   ISP+     ET ++L +A+K  + K
Sbjct: 721 GNSKTLMFVNISPSINYVNETLNSLRFASKVNSAK 755

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 51/167 (30%), Positives = 77/167 (46%), Gaps = 18/167 (10%)

Query: 5   EELNITVAVRCRGRNE---KEVKARSSVVVA-VPDVTGTNEVSINTTGDTGITAQINSKT 60
           +EL   + V CR R     +E    S + V+   D  GT  + I    +   +    +  
Sbjct: 393 QELRGNIRVYCRIRPPILPQESNNTSHLKVSEFDDNNGTQTLEIQKALNNNSSNNSTTLK 452

Query: 61  YTVDKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 120
           +  DK+F  +     +FK + + L Q  + GYN  +  YG T +GKTYTM          
Sbjct: 453 FKFDKIFNQNETNDDVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM---------- 501

Query: 121 LSEGAGIIPRVLFKLFDA---LSAQGDDYMIKCSFIELYNEELKDLL 164
           L    GIIP  +  +F+    L  +G  Y I+C F+E+YNE + DLL
Sbjct: 502 LHPKDGIIPATISHIFNWTNNLKERGWKYEIECEFVEIYNENIVDLL 548

>Skud_16.435 Chr16 complement(769308..771497) [2190 bp, 729 aa] {ON}
           YPR141C (REAL)
          Length = 729

 Score =  101 bits (252), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 64/146 (43%), Positives = 88/146 (60%), Gaps = 8/146 (5%)

Query: 257 LLQRGLRHRQVASTKMNDVSSRSHTIFTIMLY---KKCNGESFRVSKMNLVDLAGSENIS 313
           +L++  + R  AST  N+ SSRSH+IF I L     K   +S+    +NLVDLAGSE I+
Sbjct: 577 ILKKANKLRSTASTASNEHSSRSHSIFMIHLSGSNAKTGAQSY--GTLNLVDLAGSERIN 634

Query: 314 RSGAQNQRAKEAGSINQSLLTLGRVINSLA---DKSLHIPFRESKLTRLLQDSLGGNTKT 370
            S     R +E  +IN+SL  LG VI++L        HIPFR SKLT LLQ SL G++KT
Sbjct: 635 ISQVVGDRLRETQNINKSLSCLGDVIHALGQPDSTKRHIPFRNSKLTYLLQYSLTGDSKT 694

Query: 371 ALIATISPAKINSEETSSTLEYATKA 396
            +   ISP+  +  ET ++L +A+K 
Sbjct: 695 LMFVNISPSSSHINETLNSLRFASKV 720

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 41/118 (34%), Positives = 58/118 (49%), Gaps = 14/118 (11%)

Query: 50  TGITAQINSKTYTVDKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYT 109
           T I +      +  DK+F        +FK + + L Q  + GYN  +  YG T +GKT+T
Sbjct: 425 TKIQSTTQVHEFKFDKIFDQQNTNEDVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTFT 483

Query: 110 MTGDERLYDGELSEGAGIIPRVL---FKLFDALSAQGDDYMIKCSFIELYNEELKDLL 164
           M          L+ G GIIP  +   F   + L  +G DY + C FIE+YNE + DLL
Sbjct: 484 M----------LNTGDGIIPSTISHIFSWINKLKTKGWDYKVNCEFIEIYNENIVDLL 531

>Smik_16.388 Chr16 complement(687227..689416) [2190 bp, 729 aa] {ON}
           YPR141C (REAL)
          Length = 729

 Score =  101 bits (251), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 64/146 (43%), Positives = 88/146 (60%), Gaps = 8/146 (5%)

Query: 257 LLQRGLRHRQVASTKMNDVSSRSHTIFTIMLY---KKCNGESFRVSKMNLVDLAGSENIS 313
           +L++  + R  AST  N+ SSRSH+IF I L     K   +S+    +NLVDLAGSE I+
Sbjct: 577 ILKKANKLRSTASTASNEHSSRSHSIFIIHLSGSNTKTGAQSY--GTLNLVDLAGSERIN 634

Query: 314 RSGAQNQRAKEAGSINQSLLTLGRVINSLA---DKSLHIPFRESKLTRLLQDSLGGNTKT 370
            S     R +E  +IN+SL  LG VI++L        HIPFR SKLT LLQ SL G++KT
Sbjct: 635 ISQVVGDRLRETQNINKSLSCLGDVIHALGQPDSTKRHIPFRNSKLTYLLQYSLTGDSKT 694

Query: 371 ALIATISPAKINSEETSSTLEYATKA 396
            +   ISP+  +  ET ++L +A+K 
Sbjct: 695 LMFVNISPSSSHINETLNSLRFASKV 720

 Score = 78.6 bits (192), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 42/115 (36%), Positives = 60/115 (52%), Gaps = 16/115 (13%)

Query: 53  TAQINSKTYTVDKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTG 112
           TAQ++   +  DK+F        +FK + + L Q  + GYN  +  YG T +GKT+TM  
Sbjct: 430 TAQVHE--FKFDKIFDQKDTNADVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTFTM-- 484

Query: 113 DERLYDGELSEGAGIIPRVL---FKLFDALSAQGDDYMIKCSFIELYNEELKDLL 164
                   L+ G GIIP  +   F   + L  +G DY + C FIE+YNE + DLL
Sbjct: 485 --------LNPGDGIIPSTISHIFNWINKLKTKGWDYEVNCEFIEIYNENIVDLL 531

>YPR141C Chr16 complement(815734..817923) [2190 bp, 729 aa] {ON}
           KAR3Minus-end-directed microtubule motor that functions
           in mitosis and meiosis, localizes to the spindle pole
           body and localization is dependent on functional Cik1p,
           required for nuclear fusion during mating; potential
           Cdc28p substrate
          Length = 729

 Score =  100 bits (250), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 64/146 (43%), Positives = 87/146 (59%), Gaps = 8/146 (5%)

Query: 257 LLQRGLRHRQVASTKMNDVSSRSHTIFTIMLY---KKCNGESFRVSKMNLVDLAGSENIS 313
           +L++  + R  AST  N+ SSRSH+IF I L     K    S+    +NLVDLAGSE I+
Sbjct: 577 ILKKANKLRSTASTASNEHSSRSHSIFIIHLSGSNAKTGAHSY--GTLNLVDLAGSERIN 634

Query: 314 RSGAQNQRAKEAGSINQSLLTLGRVINSLA---DKSLHIPFRESKLTRLLQDSLGGNTKT 370
            S     R +E  +IN+SL  LG VI++L        HIPFR SKLT LLQ SL G++KT
Sbjct: 635 VSQVVGDRLRETQNINKSLSCLGDVIHALGQPDSTKRHIPFRNSKLTYLLQYSLTGDSKT 694

Query: 371 ALIATISPAKINSEETSSTLEYATKA 396
            +   ISP+  +  ET ++L +A+K 
Sbjct: 695 LMFVNISPSSSHINETLNSLRFASKV 720

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 51/164 (31%), Positives = 79/164 (48%), Gaps = 17/164 (10%)

Query: 5   EELNITVAVRCRGRNE-KEVKARSSVVVAVPDVTGTNEVSINTTGDTGITAQINSKTYTV 63
           +EL   + V CR R   K ++   + ++ V +    + V          TAQ++   +  
Sbjct: 381 QELRGNIRVYCRIRPALKNLENSDTSLINVNEFDDNSGVQSMEVTKIQNTAQVHE--FKF 438

Query: 64  DKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSE 123
           DK+F      + +FK + + L Q  + GYN  +  YG T +GKT+TM          L+ 
Sbjct: 439 DKIFDQQDTNVDVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTFTM----------LNP 487

Query: 124 GAGIIPRVL---FKLFDALSAQGDDYMIKCSFIELYNEELKDLL 164
           G GIIP  +   F   + L  +G DY + C FIE+YNE + DLL
Sbjct: 488 GDGIIPSTISHIFNWINKLKTKGWDYKVNCEFIEIYNENIVDLL 531

>Ecym_4407 Chr4 (846516..848651) [2136 bp, 711 aa] {ON} similar to
           Ashbya gossypii AGR253W
          Length = 711

 Score =  100 bits (248), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 66/169 (39%), Positives = 98/169 (57%), Gaps = 6/169 (3%)

Query: 237 AIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYKKCNGESF 296
           A  I N+ +  +   ++   +L+R  R R  A T+ N+ SSRSH++F + +    N ++ 
Sbjct: 540 ATSITNVTKMKMTSQEQVDSMLKRASRMRSTACTRSNERSSRSHSVFMVHI-NGHNDQTG 598

Query: 297 RVS--KMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVI---NSLADKSLHIPF 351
            VS  K+NL+DLAGSE I+ S     R +E  +IN+SL  LG VI   NS      HIPF
Sbjct: 599 EVSHGKLNLIDLAGSERINSSLVTGDRLRETQNINKSLSCLGDVIYALNSPDAAKRHIPF 658

Query: 352 RESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIK 400
           R SKLT LLQ SL G++KT +   I   + ++ ET ++L +A+K  + K
Sbjct: 659 RNSKLTYLLQYSLIGDSKTLMFVNIPSDQKHTNETLNSLRFASKVNSTK 707

 Score = 73.9 bits (180), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 41/112 (36%), Positives = 57/112 (50%), Gaps = 14/112 (12%)

Query: 58  SKTYTVDKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLY 117
           S  +  DK+F P      +F+ I + L Q  + GYN  +  YG T +GKTYTM       
Sbjct: 414 SYNFHFDKIFEPHNTNADVFQEICQ-LVQCSLDGYNVCIFAYGQTGSGKTYTM------- 465

Query: 118 DGELSEGAGIIPRVL---FKLFDALSAQGDDYMIKCSFIELYNEELKDLLDE 166
              L+ G G+IP  L   F+  + L   G  Y + C +IE+YNE + DLL E
Sbjct: 466 ---LNPGDGMIPMTLSHIFQWTEDLMEHGWRYEMDCEYIEIYNETILDLLRE 514

>AGR253W Chr7 (1218744..1220873) [2130 bp, 709 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR141C (KAR3)
          Length = 709

 Score = 98.2 bits (243), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 64/173 (36%), Positives = 97/173 (56%), Gaps = 14/173 (8%)

Query: 237 AIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYKKCNGESF 296
             +I N+    +    +   +L++  + R  A+T+ N+ SSRSH++F + +    NG + 
Sbjct: 538 GTYITNVTRMKMTSTSQVDTILKKASKMRSTAATRSNERSSRSHSVFMVHI----NGRNL 593

Query: 297 RVS-----KMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSL----ADKSL 347
                   K+NLVDLAGSE I+ S    +R +E  +IN+SL  LG VI +L    A K  
Sbjct: 594 HTGETSQGKLNLVDLAGSERINSSAVTGERLRETQNINKSLSCLGDVIYALNTPDAGKR- 652

Query: 348 HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIK 400
           +IPFR SKLT LLQ SL G++KT +   I P   +  ET ++L +A+K  + K
Sbjct: 653 YIPFRNSKLTYLLQYSLVGDSKTLMFVNIPPDPNHISETLNSLRFASKVNSTK 705

 Score = 78.2 bits (191), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 54/166 (32%), Positives = 80/166 (48%), Gaps = 22/166 (13%)

Query: 5   EELNITVAVRCRGRNE--KEVKARSSVVV-AVPDVTGTNEVSINTTGDTGITAQINSKTY 61
           +EL   + V CR R     E +  S +++    +  G   ++IN         +I S  +
Sbjct: 361 QELRGNIRVYCRVRPPLLNEPQDMSHILIEKFNEAKGAQSLTINRN-----EGRILSYNF 415

Query: 62  TVDKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGEL 121
             D +F PS     IF+ I + L Q  + GYN  +  YG T +GKTYTM          L
Sbjct: 416 QFDMIFEPSHTNKEIFEEIRQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM----------L 464

Query: 122 SEGAGIIPRVL---FKLFDALSAQGDDYMIKCSFIELYNEELKDLL 164
           + G G+IP  L   FK    L  +G +Y ++C +IE+YNE + DLL
Sbjct: 465 NAGDGMIPMTLSHIFKWTANLKERGWNYEMECEYIEIYNETILDLL 510

>ACR145W Chr3 (605114..607171) [2058 bp, 685 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL155C (KIP2)
          Length = 685

 Score = 94.0 bits (232), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 83/272 (30%), Positives = 134/272 (49%), Gaps = 45/272 (16%)

Query: 237 AIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYK---KCNG 293
            + + +L E  +   ++ ++ +  G R+R+   T  N  SSRSH I  + L +   K   
Sbjct: 274 GVKVVDLTEQLVSSHEDVMKWIATGDRNRKTGETDFNTRSSRSHAIVLLRLTRYDLKTGS 333

Query: 294 ESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA---------- 343
           E+   S ++L DLAGSE   R+  Q  R KE   IN+SLL LG VI  L+          
Sbjct: 334 EA--TSTLSLCDLAGSE---RAVTQIVRRKEGAFINKSLLALGTVIAKLSMLGSQANGLQ 388

Query: 344 --DKSLHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIK- 400
               + HIP+R+SKLTR+LQ +L G++    I TI     +S ET++T+ +A++AKNI  
Sbjct: 389 PSPAAGHIPYRDSKLTRILQPALTGDSIITTICTIDSKAESSTETTNTVRFASRAKNIAL 448

Query: 401 --NKPQVGSFIMKDVLLKSVTAEL-------------VKIKSDLLSTKSKDGIYMSQENY 445
              K ++ S   KD +++++  +L                 S   ST   D   +   + 
Sbjct: 449 NVRKNEMDSHAEKDTIIQNLRKQLDEQHETIVMLRRSAAAPSGNGSTSPLDSPGVGGTSL 508

Query: 446 KELTN-------ELEN--YKTEVEECKRAMEK 468
            E T+       E+EN   KT++E C++ ++K
Sbjct: 509 SERTHNMEKGLLEVENSILKTKLEHCEKLLDK 540

 Score = 74.7 bits (182), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 62/109 (56%), Gaps = 12/109 (11%)

Query: 61  YTVDKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 120
           +  D VF        +++ +  P+     +GYN T+  YGMT +GKT+TM+G++      
Sbjct: 146 FQFDHVFTKGVCNQEVYQALGVPIIDKLFEGYNATIFAYGMTGSGKTFTMSGNK------ 199

Query: 121 LSEGAGIIPRVLFKLFDALSAQGDD----YMIKCSFIELYNEELKDLLD 165
             +  G+IP+ +  +FD +S++       Y +K S++E+YNE++ DLL+
Sbjct: 200 --QEPGLIPQCVGNIFDRISSEHHGASLAYEVKVSYLEIYNEKIYDLLN 246

>TPHA0N01650 Chr14 complement(356519..358567) [2049 bp, 682 aa] {ON}
           Anc_2.633 YKL079W
          Length = 682

 Score = 90.1 bits (222), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 92/381 (24%), Positives = 165/381 (43%), Gaps = 82/381 (21%)

Query: 66  VFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSEGA 125
           +F   ++  LI   I   +  + ++GYN  ++ YG   +GKTY++ G+    D + S G 
Sbjct: 89  IFDRDSNIDLIGNTIVTGMIDEAMEGYNTALVTYGPKYSGKTYSLYGN----DVDDSFGL 144

Query: 126 GIIPRVLFK-LFDALSAQGDD------YMIKCSFIELYNEELKDLLDETPDSSMPKKLRI 178
           G   +++FK LF  ++    D      +++K SF+E++ +++ DLL     + +P     
Sbjct: 145 G---QIIFKDLFSRINKSVTDSNAKYTFIVKISFLEVWLDKVVDLLAPQNLTKLP----- 196

Query: 179 FDXXXXXXXXXXXXXXXXXPKPNEGSSFGTRRKTRAPSIHRXXXXXXXXXXXXXXXXXAI 238
                                           K R  S H+                  +
Sbjct: 197 ------------------------------HLKIRHVSEHK-----------------GL 209

Query: 239 HIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYKKCN-GESFR 297
            + NL++ H+   KE +    + +    V ++K ++   R++TIF I + K     ES  
Sbjct: 210 PVDNLRQVHVASFKETLYYFNQAM---SVLNSKHDNSFPRTNTIFNINIEKLDKLDESTT 266

Query: 298 VSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSLH--------- 348
            S + LVDLAGS+ I R  +    +++   IN S+ ++  +I SL+  S           
Sbjct: 267 SSSIYLVDLAGSDLIDRKNSSGVNSEDVKRINSSIKSVQNIITSLSKLSYSDYKNYEFSL 326

Query: 349 ---IPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQV 405
              +P+  SKL +LL++ LGGN KT  + TIS      ++    L+  T  ++ K  PQ+
Sbjct: 327 ENSVPYDSSKLGKLLKEPLGGNCKTNFLFTISMNPEQYDDIIEALQLGTILQDSKTVPQI 386

Query: 406 GSFIMKDVLLKSVTAELVKIK 426
             F + +    S+  E  K+K
Sbjct: 387 NKFGLNENKTLSIALENFKLK 407

>Ecym_2395 Chr2 complement(766148..768211) [2064 bp, 687 aa] {ON}
           similar to Ashbya gossypii ACR145W
          Length = 687

 Score = 90.1 bits (222), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 64/181 (35%), Positives = 96/181 (53%), Gaps = 22/181 (12%)

Query: 237 AIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYKKCNGESF 296
            + + +L E  +    E I+ +  G ++R+   T  N  SSRSH I  + L  +C  ++ 
Sbjct: 275 GVKVVDLTEQQVESHGEVIKWIAAGDKNRKTGETDFNSRSSRSHAIVLLRL-TRCELKTG 333

Query: 297 R--VSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSL------- 347
               S ++L DLAGSE   R+  Q  R KE   IN+SLL LG VI  L+  S        
Sbjct: 334 TEVTSTLSLCDLAGSE---RAVTQLVRRKEGAFINKSLLALGTVIAKLSANSAGSGSGSN 390

Query: 348 ---------HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKN 398
                    HIP+R+SKLTR+LQ +L G++    I TI     ++ ET++T+ +A++AKN
Sbjct: 391 GQPPSAMGGHIPYRDSKLTRILQPALTGDSIITTICTIDSKSESNSETTNTVRFASRAKN 450

Query: 399 I 399
           I
Sbjct: 451 I 451

 Score = 71.6 bits (174), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 58/112 (51%), Gaps = 13/112 (11%)

Query: 61  YTVDKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 120
           +  D VF        ++  + +P+     +GYN T+  YGMT +GKT+TM+G +      
Sbjct: 145 FQFDHVFTKEVTNSEVYMALGQPIVDKLFQGYNATIFAYGMTGSGKTFTMSGTK------ 198

Query: 121 LSEGAGIIPRVLFKLFDALSAQGD-----DYMIKCSFIELYNEELKDLLDET 167
             +  G+IP  +  +FD +  +        Y +K S++E+YNE++ DLL  T
Sbjct: 199 --QDPGLIPLCVGNMFDRVMEETSKSTEHKYEVKVSYLEIYNEKIYDLLSIT 248

>KNAG0J01720 Chr10 (314395..316272) [1878 bp, 625 aa] {ON} Anc_8.678
           YPL155C
          Length = 625

 Score = 89.4 bits (220), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 65/180 (36%), Positives = 93/180 (51%), Gaps = 21/180 (11%)

Query: 237 AIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYKK--CNGE 294
            + +  + E     A+E ++ +  G   R+   T  N  SSRSH I  + L      NG 
Sbjct: 242 GVKVHGVLEQKCDTAEELMKWVSVGEAVRKTGKTDYNMRSSRSHAIIQVKLITTNLLNGT 301

Query: 295 SFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKS-------- 346
           +   + ++L DLAGSE  S    Q +R KE   IN+SLL LG VI+ L+ +S        
Sbjct: 302 TH-FNTLSLCDLAGSEKASE---QLERRKEGSFINKSLLALGTVISKLSAESNAHDSSRP 357

Query: 347 -------LHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNI 399
                   HIP+R+SKLTRLLQ +L  ++    I TI P K    ET +TL +A++AKN+
Sbjct: 358 SSGSLNNSHIPYRDSKLTRLLQPALCNDSVVTAICTIDPTKEAMTETVNTLRFASRAKNV 417

 Score = 62.8 bits (151), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 55/116 (47%), Gaps = 14/116 (12%)

Query: 54  AQINSKTYTVDKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGD 113
           A  +   +  D VFGP+A    +F  +   L +    G N T+L YG T +GKTYTM G 
Sbjct: 120 AHWDQGDFQFDHVFGPTATNEDLFAELGGGLVEKLFDGCNATLLAYGTTGSGKTYTMVG- 178

Query: 114 ERLYDGELSEGAGIIPRVLFKLFDALSAQGDDYMIK----CSFIELYNEELKDLLD 165
                       GI+      +F  +    D+  +K     S++E+YNE++ DLL+
Sbjct: 179 ---------HNDGIVKMCGDCVFTRMLNAADERQVKRSVTVSYLEIYNEKICDLLN 225

>TDEL0B07270 Chr2 complement(1280163..1282097) [1935 bp, 644 aa]
           {ON} Anc_2.633 YKL079W
          Length = 644

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 66/203 (32%), Positives = 100/203 (49%), Gaps = 28/203 (13%)

Query: 237 AIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYKKCN-GES 295
           +I I+NL+  ++    E +   ++G   R +AS       SRS  I  I + ++ N  E 
Sbjct: 188 SISIKNLRCVYVTSLLEALSYCEKG---RSLAS-------SRSSVIIRITVEQRDNVKEV 237

Query: 296 FRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA------------ 343
           F+     LVDL  S+ I +        +    INQS++TL  V  SLA            
Sbjct: 238 FKTGSFQLVDLGSSDKIDKQNNLGISPENTKKINQSMVTLENVARSLAGTEQSVKNGRPR 297

Query: 344 DKSLHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIK--- 400
             + +IP++ES LT+LLQ+++GGN KT L+   S AK + EET +TL +    K +K   
Sbjct: 298 SGNYYIPYKESCLTQLLQETIGGNCKTTLVLMCSTAKQDEEETLNTLNFGANMKLVKNLF 357

Query: 401 --NKPQVGSFIMKDVLLKSVTAE 421
             NK    S  M D+L+K   A+
Sbjct: 358 QQNKAGTNSKAMLDLLMKDFDAK 380

 Score = 59.7 bits (143), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 41/126 (32%), Positives = 63/126 (50%), Gaps = 14/126 (11%)

Query: 57  NSKTYTVDKVFGPSAD-QLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDER 115
           N K + VD++F P A  +     +I + + Q F  GYN  ++ YG T +GKT TM G   
Sbjct: 67  NLKLFRVDQIFNPGAQTKDTTSSIIGDSVAQLF-NGYNVAIMAYGQTDSGKTSTMFG--- 122

Query: 116 LYDGELSEGAGIIPRVLFKLFDALSAQGD---DYMIKCSFIELYNEELKDLLDETPDSSM 172
                 ++G G+I  V  ++F  +    +   DY I  S IE+  E ++DLL    +   
Sbjct: 123 -----YNKGDGVINGVCKQIFTTVETGSENNIDYSISLSIIEVNCESIRDLLAPLSEQK- 176

Query: 173 PKKLRI 178
           P KLR+
Sbjct: 177 PLKLRL 182

>Kwal_55.21164 s55 complement(713274..715037) [1764 bp, 588 aa]
           {OFF} YPR141C (KAR3) - kinesin-like nuclear fusion
           protein [contig 452] PARTIAL
          Length = 588

 Score = 75.5 bits (184), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 56/167 (33%), Positives = 73/167 (43%), Gaps = 27/167 (16%)

Query: 5   EELNITVAVRCRGR----NEKEVKARSSVVVAVPDVTGTNEVSINTTGDTGITAQINSKT 60
           +EL   + V CR R    NEKE  + S  +    D  GT  ++I          +     
Sbjct: 357 QELRGNIRVFCRLRPHLDNEKE-DSSSISIDGFSDENGTQCITIKR--------EAKYHK 407

Query: 61  YTVDKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 120
           +T D+ FG       IF  I + L Q  + GYN  +  YG T +GKTYTM   E      
Sbjct: 408 FTFDRCFGAQESNKDIFHEIGQ-LIQSSLDGYNVCIFAYGQTGSGKTYTMLNPE------ 460

Query: 121 LSEGAGIIPRVLFKLF---DALSAQGDDYMIKCSFIELYNEELKDLL 164
                GIIP  L  +F   + L   G  Y I   FIE+YNE +KDL 
Sbjct: 461 ----DGIIPSTLNHIFLWVEKLKELGWSYDISSQFIEIYNENIKDLF 503

 Score = 33.5 bits (75), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 31/58 (53%), Gaps = 2/58 (3%)

Query: 239 HIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIML--YKKCNGE 294
           HI N+    + + +    +L R ++ R  A+T  N  SSRSH++F I L  Y   +GE
Sbjct: 531 HITNITVCKLTNREMVNSILVRAMKMRSTAATSANARSSRSHSVFIIKLRGYNAISGE 588

>Kwal_YGOB_55.21164 s55 complement(713063..713220,713222..715037)
           [1974 bp, 657 aa] {ON} ANNOTATED BY YGOB -
          Length = 657

 Score = 75.5 bits (184), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 56/167 (33%), Positives = 73/167 (43%), Gaps = 27/167 (16%)

Query: 5   EELNITVAVRCRGR----NEKEVKARSSVVVAVPDVTGTNEVSINTTGDTGITAQINSKT 60
           +EL   + V CR R    NEKE  + S  +    D  GT  ++I          +     
Sbjct: 357 QELRGNIRVFCRLRPHLDNEKE-DSSSISIDGFSDENGTQCITIKR--------EAKYHK 407

Query: 61  YTVDKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 120
           +T D+ FG       IF  I + L Q  + GYN  +  YG T +GKTYTM   E      
Sbjct: 408 FTFDRCFGAQESNKDIFHEIGQ-LIQSSLDGYNVCIFAYGQTGSGKTYTMLNPE------ 460

Query: 121 LSEGAGIIPRVLFKLF---DALSAQGDDYMIKCSFIELYNEELKDLL 164
                GIIP  L  +F   + L   G  Y I   FIE+YNE +KDL 
Sbjct: 461 ----DGIIPSTLNHIFLWVEKLKELGWSYDISSQFIEIYNENIKDLF 503

 Score = 33.9 bits (76), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 31/58 (53%), Gaps = 2/58 (3%)

Query: 239 HIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIML--YKKCNGE 294
           HI N+    + + +    +L R ++ R  A+T  N  SSRSH++F I L  Y   +GE
Sbjct: 531 HITNITVCKLTNREMVNSILVRAMKMRSTAATSANARSSRSHSVFIIKLRGYNAISGE 588

>Suva_11.145 Chr11 (272862..274835) [1974 bp, 657 aa] {ON} YKL079W
           (REAL)
          Length = 657

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 41/129 (31%), Positives = 65/129 (50%), Gaps = 19/129 (14%)

Query: 45  NTTGDTGITAQINSKTYTVDKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTST 104
           NTTGDT         T+  DKVF  +A Q  +   + +P   D + GYN T+L YG + +
Sbjct: 67  NTTGDT-------HSTFQFDKVFDANATQKDVQDFLLDPTINDVLSGYNSTILTYGPSFS 119

Query: 105 GKTYTMTGDERLYDGELSEGAGIIPRVLFKLFDALS----AQGDDYMIKCSFIELYNEEL 160
           GK+Y++ G +        +G GI+P +   LF  L      +G+++ +     E+Y E+ 
Sbjct: 120 GKSYSLIGPQ--------DGGGILPNICKALFSTLEDREKNKGNNFSVSVLAFEIYMEKT 171

Query: 161 KDLLDETPD 169
            DLL   P+
Sbjct: 172 YDLLVPLPE 180

 Score = 52.8 bits (125), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 41/137 (29%), Positives = 67/137 (48%), Gaps = 13/137 (9%)

Query: 277 SRSHTIFTIMLYKKCNGES-FRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTL 335
           SRSH +F + + ++       + S + L+DL G+E   +             +NQS+  L
Sbjct: 234 SRSHVVFQLHVEQRNRRHDILKNSSLYLIDLHGAEKFDKRIENTLSQDSLKKLNQSIEAL 293

Query: 336 GRVINSLADKSL----------HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEE 385
              + SL  KS+             +RES+LT +L+DSLGGN KT +I T   + + +  
Sbjct: 294 KNTVQSLEIKSMDSVYSAKASHSSTYRESQLTEVLKDSLGGNRKTKVILTCFLSNVPT-- 351

Query: 386 TSSTLEYATKAKNIKNK 402
           T STL++    + I N+
Sbjct: 352 TLSTLKFGDSIRQINNR 368

>YKL079W Chr11 (286603..288573) [1971 bp, 656 aa] {ON}  SMY1Protein
           that interacts with Myo2p, proposed to be involved in
           exocytosis; N-terminal domain is related to the motor
           domain of kinesins
          Length = 656

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 59/114 (51%), Gaps = 12/114 (10%)

Query: 60  TYTVDKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDG 119
           T+  DKVF  +A Q  + K +  P+  D + GYN TV+ YG + +GK+Y++ G +     
Sbjct: 74  TFQFDKVFDANATQEDVQKFLVHPIINDVLNGYNGTVITYGPSFSGKSYSLIGSK----- 128

Query: 120 ELSEGAGIIPRVLFKLFDAL----SAQGDDYMIKCSFIELYNEELKDLLDETPD 169
              E  GI+P +   LFD L      +GD + +     E+Y E+  DLL   P+
Sbjct: 129 ---ESEGILPNICKTLFDTLEKNEETKGDSFSVSVLAFEIYMEKTYDLLVPLPE 179

 Score = 57.4 bits (137), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 68/137 (49%), Gaps = 13/137 (9%)

Query: 277 SRSHTIFTIMLYKKCNGES-FRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTL 335
           SRSH +F + + ++   +   + S + LVDL G+E   +             +NQS+  L
Sbjct: 233 SRSHLVFQLHVEQRNRKDDILKNSSLYLVDLHGAEKFDKRTESTLSQDALKKLNQSIEAL 292

Query: 336 GRVINSLADK----------SLHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEE 385
              + SL+ K          S    +RES+LT +L+DSLGGN KT +I T   + + +  
Sbjct: 293 KNTVRSLSMKERDSAYSAKGSHSSAYRESQLTEVLKDSLGGNRKTKVILTCFLSNVPT-- 350

Query: 386 TSSTLEYATKAKNIKNK 402
           T STLE+    + I NK
Sbjct: 351 TLSTLEFGDSIRQINNK 367

>Smik_11.160 Chr11 (272801..274771) [1971 bp, 656 aa] {ON} YKL079W
           (REAL)
          Length = 656

 Score = 69.3 bits (168), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 41/130 (31%), Positives = 66/130 (50%), Gaps = 19/130 (14%)

Query: 39  TNEVSINTTGDTGITAQINSKTYTVDKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLV 98
           T+E S  TTGDT         T+  DKVF  +A Q  +   +  P   D + GYN T++ 
Sbjct: 60  TSEPSHETTGDT-------YSTFKFDKVFDTNATQEDVQDFLVRPSIDDVLSGYNGTIIT 112

Query: 99  YGMTSTGKTYTMTGDERLYDGELSEGAGIIPRVLFKLFDAL----SAQGDDYMIKCSFIE 154
           YG + +GK+Y++ G +        EG GI+P +   LF+ L      +G+++ +     E
Sbjct: 113 YGPSFSGKSYSLLGSQ--------EGEGILPNICKVLFETLEKNKETKGNNFSVSVLAFE 164

Query: 155 LYNEELKDLL 164
           ++ E+  DLL
Sbjct: 165 IFMEKTYDLL 174

 Score = 56.2 bits (134), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 70/137 (51%), Gaps = 13/137 (9%)

Query: 277 SRSHTIFTIMLYKKC-NGESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTL 335
           S+SH +F + + ++  N +  R S + L+DL G+E   +             +NQS+  L
Sbjct: 233 SKSHLVFQLHVEQRNRNADILRKSSLYLIDLHGAERFDKRTEVTLSQDALKKLNQSIEAL 292

Query: 336 GRVINSLADK----------SLHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEE 385
             ++  L+ K          S    +RES+LT +L+DSLGGN KT +I T   + +++  
Sbjct: 293 KNIVRLLSVKDRDSAYSVKASHSSTYRESQLTEVLKDSLGGNRKTKVILTCFLSNVST-- 350

Query: 386 TSSTLEYATKAKNIKNK 402
           T STLE+    + I NK
Sbjct: 351 TLSTLEFGECIRQITNK 367

>Skud_11.148 Chr11 (271990..273960) [1971 bp, 656 aa] {ON} YKL079W
           (REAL)
          Length = 656

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 34/114 (29%), Positives = 59/114 (51%), Gaps = 12/114 (10%)

Query: 60  TYTVDKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDG 119
           T+  DKVF  +A Q  +   +  P  +D + GYN T+L YG + +GK+Y++ G +  Y+ 
Sbjct: 74  TFQFDKVFDANATQKDVQDFLVNPTIKDILSGYNSTILTYGPSFSGKSYSLLGSQ--YN- 130

Query: 120 ELSEGAGIIPRVLFKLFDAL----SAQGDDYMIKCSFIELYNEELKDLLDETPD 169
                 G++P +   LF+ L      +G ++ +     E+Y E+  DLL   P+
Sbjct: 131 -----EGVLPNICQVLFETLEENEETKGTNFCVSVLAFEIYMEKSYDLLVPLPE 179

 Score = 59.3 bits (142), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 66/220 (30%), Positives = 102/220 (46%), Gaps = 37/220 (16%)

Query: 277 SRSHTIFTIMLYKKCNGES-FRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTL 335
           S+SH +F + + ++   E   + S + L+DL G+E   +             +NQS+  L
Sbjct: 233 SKSHLVFQLHVEQRNRREDILKNSSLYLIDLHGAEKFEKRTENTLSQDALKKLNQSIEAL 292

Query: 336 GRVINSLADK----------SLHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEE 385
             ++  LA K          S    +RES+LT +L+DSLGGN K  +I T   + + +  
Sbjct: 293 KNIVQLLAVKNPDSAYSTKASHSSTYRESQLTEVLRDSLGGNRKMKVILTCFLSNVPT-- 350

Query: 386 TSSTLEYATKAKNIKNKPQVGSFIMKDVLLKSVTAELVKIKSDLL--STKSKDGIYMSQE 443
           T STLE+    + I NK           ++ S T   +K K DL     K KD  Y+SQ 
Sbjct: 351 TISTLEFGDNIRQIINK-----------VMSSTTGLNMKKKMDLFVQDMKIKDDNYVSQI 399

Query: 444 N--------YKELTNE---LENYKTEVEECKRAMEKVSAQ 472
           N         K+L+NE    E+ KTE+E  ++   K+  Q
Sbjct: 400 NILKSELDSLKDLSNESSSREDMKTELENYEKENVKLKLQ 439

>CAGL0L05104g Chr12 complement(577023..579050) [2028 bp, 675 aa]
           {ON} similar to uniprot|P32364 Saccharomyces cerevisiae
           YKL079w SMY1 kinesin-related protein
          Length = 675

 Score = 60.8 bits (146), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 82/393 (20%), Positives = 154/393 (39%), Gaps = 91/393 (23%)

Query: 45  NTTGDTGITAQINSKTYTVDKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTST 104
           NT     IT   +   +  +KV+      + I K ++E + +D   GY+ +++ YG   +
Sbjct: 71  NTIIHYPITNFADESIFNFEKVYDVGVPLVDIHKSLSESVLKDIYDGYDVSIISYGEAGS 130

Query: 105 GKTYTMTGDERLYDGELSEG--AGIIPRVLFKLFDALSAQGDDYMIKCSFIELYNEELKD 162
           GK++T      L+  E S+G  A     ++ K  +    Q     I+ S +E+  E++ D
Sbjct: 131 GKSFT------LFGNEDSDGIIALTFQDIIQKKRELEKDQNTIVNIQISALEISLEKVYD 184

Query: 163 LLDETPDSSMPKKLRIFDXXXXXXXXXXXXXXXXXPKPNEGSSFGTRRKTRAPSIHRXXX 222
           +L  + D   P K                         +E   FG               
Sbjct: 185 ML-HSADDRKPLK-----------------------SHHETKKFG--------------- 205

Query: 223 XXXXXXXXXXXXXXAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTI 282
                          ++ Q     +I   KE  R+++    +++ +  KM+   S SH +
Sbjct: 206 ---------------LYYQEANNEYINSIKEFDRVMKLIQDNKEASEKKMDSKRSTSHVV 250

Query: 283 F--TIMLYKKCNGESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVIN 340
              ++    + +G +   S +   DL GS    +   Q    +    +N S+  L  V+N
Sbjct: 251 IRCSVEQLDRVHG-TITSSNIMFADLCGSNRFEKDVDQKLGVENIKKLNLSISNLESVVN 309

Query: 341 SL--------------------ADKSLHIPFRESKLTRLLQDSLGGNTKTALIATISPAK 380
           S+                    +     +P+++S+LT L+Q++LGGN++T ++      K
Sbjct: 310 SVLQNQQKNHLYIENKLVPSVNSSDLQRVPYKDSQLTGLIQEALGGNSRTRVVLNCFDDK 369

Query: 381 INSEETSSTLEYATKAKNIKNKPQVGSFIMKDV 413
            + EET +TL +  + +NI N      F+  DV
Sbjct: 370 SHHEETIATLRFGVQLQNILN------FVRADV 396

>KNAG0M02540 Chr13 (471930..473498) [1569 bp, 522 aa] {ON} Anc_2.633
           YKL079W
          Length = 522

 Score = 60.5 bits (145), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 60/109 (55%), Gaps = 8/109 (7%)

Query: 59  KTYTVDKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYD 118
           +T+++DKVF PSA Q  +  V+  P+  +   G N  +   G + TGKT+TM G + +  
Sbjct: 42  RTFSLDKVFPPSASQADVTAVLLGPIVDNLAHGVNVQMASLGDSQTGKTHTMLGQQGV-- 99

Query: 119 GELSEGAGIIPRVLFKLFDALSA-QGDDYMIKCSFIELYNEELKDLLDE 166
                  G++ R+L K+F  ++  +G       S +EL N+++ DLL++
Sbjct: 100 -----SQGLLQRILTKVFQLMNENEGVTVQYSLSAVELVNDKVYDLLNK 143

>TBLA0C00800 Chr3 complement(165244..167325) [2082 bp, 693 aa] {ON}
           Anc_2.633 YKL079W
          Length = 693

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 68/244 (27%), Positives = 109/244 (44%), Gaps = 34/244 (13%)

Query: 240 IQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYKKCNGESFRV- 298
           I+N++   I+D  E   L+      R + S   N +  RS TI  I L +    E     
Sbjct: 231 IKNVKSVTILDRNELNDLIDSS--RRLLHSCHNNGI--RSSTILRIKLLQLDEDEDLETQ 286

Query: 299 SKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLAD-KSLHIP---FRES 354
           S +  VDLAGS+  S+   +    + A   N+ + +L  ++ +LA+ +S+ I    +R S
Sbjct: 287 STICFVDLAGSDRASKDIEKGITREAASKYNRVMDSLNSMVYTLANSESISINKSIYRNS 346

Query: 355 KLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGSFIMKDVL 414
            LTR+L D L GN KT LI + S  K +  ET STL +++ A ++ N+            
Sbjct: 347 HLTRILYDLLAGNHKTNLIFSCSLNKDDEYETFSTLGFSSYASSMSNQ------------ 394

Query: 415 LKSVTAELVKIKSDLLSTKSKDGIYMSQENYKELTNELENYKTEVEECKRAMEKVSAQNS 474
                   +KI    +    K  I     N  E     E Y+  +E  K  + +VS QN 
Sbjct: 395 --------IKINQTAIGGDKKRAILTDDWNLME-----EYYRNRIELLKDELHEVSMQNV 441

Query: 475 LLIK 478
           ++ +
Sbjct: 442 MMTR 445

 Score = 51.6 bits (122), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 45/171 (26%), Positives = 66/171 (38%), Gaps = 57/171 (33%)

Query: 58  SKTYTVDKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLY 117
           S  Y  DK+F P      I   ++     D  KGYN T + YG T TGKTYT      LY
Sbjct: 55  SNQYRFDKIFEPEKPDDEINSTLSFACINDLFKGYNSTYISYGQTGTGKTYT------LY 108

Query: 118 DGELSE---------------------------------------------GAGIIPRV- 131
               ++                                               G+I +V 
Sbjct: 109 GTAFNDTPTDLDSKNINTNKNVKNDSNISSNSNIQTSASSNKSANSILQKKNYGLISKVG 168

Query: 132 --LFKLFDALSA--QGDDYMIKCSFIELYNEELKDLLDETPDSSMPKKLRI 178
             LF++ D + A  +G  +++  SF+E+Y EE+ DLL +  D+   KKL +
Sbjct: 169 NDLFEMIDQIRAIRKGITFLVNISFVEVYKEEVYDLL-QHDDTLSNKKLSL 218

>NCAS0H03180 Chr8 (611693..613675) [1983 bp, 660 aa] {ON} Anc_2.633
          Length = 660

 Score = 52.8 bits (125), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 51/109 (46%), Gaps = 6/109 (5%)

Query: 56  INSKTYTVDKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDER 115
           +++  Y  D +F   + +   +  I + L  D  KGYN T++ YG TS+GK++ + GD  
Sbjct: 81  VSNNEYQFDSIFDVDSKETEFYDSITDNLIDDISKGYNTTIMTYGPTSSGKSHALFGDPD 140

Query: 116 LYDGELSEGAGIIPRVLFKLFDALSAQGDDYMIKCSFIELYNEELKDLL 164
                 S   G+I  +  +L           +   S  ELY +++ DLL
Sbjct: 141 ------STNDGLINHIADRLLFPQCEDNLKTLCSISMWELYIDKVYDLL 183

 Score = 52.8 bits (125), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 71/286 (24%), Positives = 127/286 (44%), Gaps = 41/286 (14%)

Query: 239 HIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHT---IFTIMLYKKC---N 292
           HI++L + H+    E    L+ G +          ++S   H+   IF +    +C    
Sbjct: 198 HIRDLHQIHVTSPIEIKDTLKNGYK----------NISPLHHSKSQIF-VRFEVQCIDRK 246

Query: 293 GESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADK----SLH 348
            +  R S +  +DL GS+ +++  A    + +    NQ +  L  +I +L ++    S H
Sbjct: 247 DDVTRCSSITFIDLCGSDLLTKQNASKLSSDDIKKFNQMIYLLQNLIKTLPEEQSTNSSH 306

Query: 349 IPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGSF 408
             F++S L ++L D LGG+TK  L+  I     N+      ++   KAK IKN P +   
Sbjct: 307 --FKDSSLNKILMDYLGGDTKMTLVVAIDG---NTGGYEDAVKLGAKAKLIKNYPTMNKI 361

Query: 409 IMK-----DVLLKSVTAE----LVKIKSDLLSTKSKDGIYMSQENYKELTNELENYKTEV 459
            +      D+L++ +  +    L KI  +LL T+ K     +       +N LEN   E 
Sbjct: 362 GLNAKRKMDLLVQDMNVKEQNYLAKI--NLLQTEIKTLKTENDSTTNSTSNSLENALQEN 419

Query: 460 EECK---RAMEKVSAQNSLLIKEKRVSNEVNESQKVKLRKLGNNIE 502
            + K    +++++    SL        NE+NE  ++ L+KL +  E
Sbjct: 420 SKLKLQLESLQQILGTMSLANPSSSNKNEMNEHDEL-LKKLMSTCE 464

>ZYRO0E01078g Chr5 (73042..75048) [2007 bp, 668 aa] {ON} similar to
           uniprot|Q759X8 Ashbya gossypii ADR145C ADR145Cp and
           weakly similar to YKL079W uniprot|P32364 Saccharomyces
           cerevisiae YKL079W SMY1 not believed to act as a kinesin
           colocalizes with Myo2p kinesin heavy chain homolog
          Length = 668

 Score = 52.0 bits (123), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 56/118 (47%), Gaps = 12/118 (10%)

Query: 61  YTVDKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 120
           +  +KV+     Q  + + I      + + G+N +++ +G   +GKTYTM G++      
Sbjct: 68  FRFNKVYDVGVRQQEVCEDIIGDNVMELLAGFNVSIMAFGSEGSGKTYTMFGNDH----- 122

Query: 121 LSEGAGIIPRVLFKLFDALSA----QGDDYMIKCSFIELYNEELKDLLDETPDSSMPK 174
                GI+ R+   +FD L       G++  I  +F EL+ E + DLL    +S + K
Sbjct: 123 ---EEGIVQRMCQSIFDQLDKLHEDSGNESTISINFFELFAENVYDLLSLQKNSKVLK 177

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 38/138 (27%), Positives = 67/138 (48%), Gaps = 13/138 (9%)

Query: 277 SRSHTIFTIMLYKKCNGE-SFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTL 335
           SRS     I + ++   E + + S + L+DLA S+ + ++   +    E  S N S+  L
Sbjct: 224 SRSSAFLNITVEQRNKKEETLKHSVLQLIDLASSDKLDKNLKYDISTDEMKSTNSSMQNL 283

Query: 336 GRVINSLADKSLHIP----------FRESKLTRLLQDSLGGNTKTALIATISPAKINSEE 385
            +V+  L++  L  P           R S+L + LQ ++GG++KT  +   S  K + E 
Sbjct: 284 HQVVYGLSE--LESPSSKNHSSKHTHRTSRLAKFLQQAIGGDSKTTAVMLSSTDKADREN 341

Query: 386 TSSTLEYATKAKNIKNKP 403
           T  TL   ++ ++I N P
Sbjct: 342 TVITLSLGSRLRSIHNFP 359

>NDAI0C00480 Chr3 complement(84502..86298) [1797 bp, 598 aa] {ON}
           Anc_2.633
          Length = 598

 Score = 51.2 bits (121), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 44/171 (25%), Positives = 83/171 (48%), Gaps = 9/171 (5%)

Query: 239 HIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLY-KKCNGES-- 295
           H++NL    I    +  +  + G +              RS++I    ++ ++ N +   
Sbjct: 205 HVKNLSHIQIASLDDLQKWFKIGCQRSSAIINAGTAKEKRSNSIIISKIHLEQVNPKDQL 264

Query: 296 FRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLAD-KSLHIP---F 351
           +++S ++ +DL G +  ++   Q     E   +N  + +   +I +L+D KSL      +
Sbjct: 265 YKLSTLSFIDLYGIDKFTKKDIQ-LTNDEMKKLNTLMSSFQNLITTLSDPKSLPYTSSLY 323

Query: 352 RESKLTRLLQDSLGGNTKTALIATI-SPAKINSEETSSTLEYATKAKNIKN 401
           ++S L ++LQD +GGN+KT  I    SP+ I  EE    L++A   K+IKN
Sbjct: 324 KDSALNKILQDYIGGNSKTTFIIPFPSPSIIQHEELIEMLKFAMGLKSIKN 374

 Score = 34.3 bits (77), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 34/144 (23%), Positives = 70/144 (48%), Gaps = 32/144 (22%)

Query: 53  TAQINSKTYTVDKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTG 112
           T +++S+ +  D +F  +++Q  +  V      +D   GYN + + YG +++GK+ T+  
Sbjct: 61  TLKLDSQDFKFDNIFPTNSEQNEMLTV---STIKDLFDGYNQSFITYGKSNSGKSDTL-- 115

Query: 113 DERLYDGELSEGAGIIPRVLF-KLFDALSAQGDD--------------YMIKCSFIELY- 156
                    +E  G+I R+LF +LF  + +   D              +    S +E++ 
Sbjct: 116 --------FNEKDGLI-RLLFEQLFKKVQSLTADNNNNNTREGNNILTFNFSLSMMEIFS 166

Query: 157 NEELKDLL--DETPDSSMPKKLRI 178
           +E++ DLL  + T D+ + K L++
Sbjct: 167 SEKIYDLLSNEYTKDNPILKSLKV 190

>TBLA0A00820 Chr1 (178283..180694) [2412 bp, 803 aa] {ON} Anc_2.633
           YKL079W
          Length = 803

 Score = 51.6 bits (122), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 46/166 (27%), Positives = 79/166 (47%), Gaps = 18/166 (10%)

Query: 237 AIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYKK-CNGES 295
           ++ I+NL++ ++   +E    L  G  +R      M  ++SRS+ +  I L +     + 
Sbjct: 236 SLEIENLRQVYVESFEELNSYLIEGRSNRN-----MKHLTSRSNIVIKINLEQVFLEDQL 290

Query: 296 FRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSLHIPFRE-- 353
            + S + L+D+A S+ I ++ +    AKEA  +N  + +    IN LA+     P+ +  
Sbjct: 291 MKCSSLILLDMAASDYIDKNDSLGISAKEAKKLNYPMESFTSYINLLAETGTS-PYDQQI 349

Query: 354 ---------SKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTL 390
                    S L  ++   +GGN KT  I+TISP   N  ET  TL
Sbjct: 350 NGKKSNDYNSNLVDIMSIPIGGNCKTLFISTISPLLANQNETFITL 395

 Score = 38.5 bits (88), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 37/75 (49%), Gaps = 6/75 (8%)

Query: 48  GDTGITAQINSKT-----YTVDKVFGPSADQL-LIFKVIAEPLFQDFIKGYNCTVLVYGM 101
           G TG      S+T     + VDKVF     Q  L+   I +    +   G+N +++ +G 
Sbjct: 33  GATGTRIIFTSETTGNTEFQVDKVFDRFTKQSDLLSSDIVKNKISELFDGFNSSIIAFGQ 92

Query: 102 TSTGKTYTMTGDERL 116
           + TGK++TM G+  L
Sbjct: 93  SGTGKSFTMFGNNSL 107

>KAFR0C04020 Chr3 (802379..804382) [2004 bp, 667 aa] {ON} Anc_2.633
           YKL079W
          Length = 667

 Score = 48.5 bits (114), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 52/106 (49%), Gaps = 11/106 (10%)

Query: 61  YTVDKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 120
           Y  D V   S +   ++  I   L  +  +GY+  V+ YG   TGK+    G +  Y+G 
Sbjct: 63  YQFDSVHEKSTE---LYNGIKGDLINNIFEGYHTGVITYGSAGTGKSSIFYGTDSTYEG- 118

Query: 121 LSEGAGIIPRVLFKLFDALSAQGDD--YMIKCSFIELYNEELKDLL 164
                G++   +  L+D + + G+D  + +  S IE++ E++ DLL
Sbjct: 119 -----GVVLMFVQDLYDKIDSIGNDTHFTVSLSTIEIHLEKMYDLL 159

 Score = 42.0 bits (97), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 63/130 (48%), Gaps = 7/130 (5%)

Query: 277 SRSHTIFTIMLYKK-CNGESFRVSKMNLVDLAGSENISRSG--AQNQRAKEAGSINQSLL 333
           S+SH I  I + ++  N +  +   ++  DLA  + I +    +    + E   +N    
Sbjct: 219 SKSHLITKINVEQRNLNEDVVKRGSISFFDLAAIDFIDKDSMVSLGLTSDEVKKLNLEST 278

Query: 334 TLGRVINSLADKSLH----IPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSST 389
           TL   I S+++ S +    IP++ S LT+LL     GN KT +I T S  K N  ET  T
Sbjct: 279 TLKNSIISMSELSENPNAVIPYKNSNLTKLLNQCFMGNMKTTVILTCSMLKSNEAETLET 338

Query: 390 LEYATKAKNI 399
           L+   K ++I
Sbjct: 339 LKMGLKLESI 348

>KNAG0H00360 Chr8 (51965..54010) [2046 bp, 681 aa] {ON} Anc_2.633
           YKL079W
          Length = 681

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/129 (24%), Positives = 58/129 (44%), Gaps = 6/129 (4%)

Query: 40  NEVSINTTGDTGITAQINSKTYTVDKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVY 99
           N   + T  DT +  ++  ++++  KV    A +   F  +A  +  D + G NC V  Y
Sbjct: 71  NSNHVQTVNDTVV--KLGEQSFSFSKVLNDQATKTEQFTELASKVTDDVLSGINCCVTTY 128

Query: 100 GMTSTGKTYTMTGDERLYDGE---LSEGAGIIPRVLFKLFDAL-SAQGDDYMIKCSFIEL 155
           G      +  M G +     E    S  +G++ +    +F+A+ S    +Y +  S  E+
Sbjct: 129 GSGLAADSLVMFGPQSGNSKEEQDSSRCSGLLQQTCKHIFNAIDSDSTSEYQVSLSLCEV 188

Query: 156 YNEELKDLL 164
           Y +++ DLL
Sbjct: 189 YVDKVFDLL 197

>NCAS0C05200 Chr3 (1059068..1060786) [1719 bp, 572 aa] {ON}
           Anc_2.633 YKL079W
          Length = 572

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 51/102 (50%), Gaps = 16/102 (15%)

Query: 82  EPLFQDFI----KGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSEGAGIIPRVLFKLFD 137
           EPL  D I    +G +C+++ YG ++TGKT+ +    R          GIIP  + +L+ 
Sbjct: 66  EPLVIDNINELTRGVDCSMVTYGQSATGKTHVLFDQVR----------GIIPLFIEQLYI 115

Query: 138 ALSAQGD-DYMIKCSFIELYNE-ELKDLLDETPDSSMPKKLR 177
            L AQ D  Y I  S  E  ++ +++DLL    D    K L+
Sbjct: 116 YLEAQSDLQYQIGLSVWEADSKGKIRDLLVPLNDPQQQKSLK 157

 Score = 42.7 bits (99), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 57/127 (44%), Gaps = 19/127 (14%)

Query: 276 SSRSHTIFTIML-YKKCNGESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLT 334
           +S  HT   I L    C+ +SFR   +  VDL   E++                 Q + +
Sbjct: 191 NSTFHTFVKISLQLVNCHEDSFRKCCIEFVDLCAQEDVL----------------QLVCS 234

Query: 335 LGRVINSLADKSLHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYAT 394
           L  V+++  DK   I   +S+  +LL +S+GGN KT  I   S  + N + +  TLE+  
Sbjct: 235 LVAVLSNDNDKK--IGKEKSQFCKLLSNSIGGNRKTTFILACSTLEQNEKISLETLEFGL 292

Query: 395 KAKNIKN 401
           K   + N
Sbjct: 293 KVSQVVN 299

>NCAS0C02830 Chr3 (534302..536926) [2625 bp, 874 aa] {ON} Anc_8.401
          Length = 874

 Score = 38.9 bits (89), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 37/131 (28%), Positives = 60/131 (45%), Gaps = 15/131 (11%)

Query: 249 MDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYKKCNGESFRV---------S 299
           +D  + I LL    ++  V S  +N +   S T   + L +      F           S
Sbjct: 368 IDIDDAIELLGSTFKNLSVRSYAVNRLKKASDTELELYLLQLVQAVCFENISTFSDKTNS 427

Query: 300 KMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSLHI---PFRESKL 356
           +  +VD+ G++++ +S  QN   K    +N SLLTLG+ IN+L    + I   P  E  +
Sbjct: 428 EFTIVDMNGTQHLGKS--QNVMPKTT-ELNSSLLTLGKSINNLNLDEMPIVISPLAEFLI 484

Query: 357 TRLLQDSLGGN 367
            R L++S  GN
Sbjct: 485 RRALKNSRLGN 495

>TBLA0A07470 Chr1 (1850075..1851751) [1677 bp, 558 aa] {ON} Anc_1.25
           YCL048W
          Length = 558

 Score = 33.1 bits (74), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 43/155 (27%), Positives = 69/155 (44%), Gaps = 33/155 (21%)

Query: 649 LSSISEEYNNLKDYLNEHFFKNNFQEALDVHVDRTYHQLKVSANSIFLKLREMLNEE--- 705
           LSSI E +NN+++    +   N F E LD ++ +  +QL V AN+  L+LR  L EE   
Sbjct: 284 LSSI-EGFNNIQEIEVFNINNNRFLETLDSNIKKVKNQLSVHANAKELELRMPLLEEAEN 342

Query: 706 ----------------LDTNKEF---MMQSLRHAASEVVAKEMCLLDPVKQAWENSLENI 746
                           +D++ EF   M  SL     E V   + ++D       NS  N+
Sbjct: 343 ITIRDTSFVSFPRLRKVDSSLEFIENMFTSLEIPTLETVGGTLGIID-------NS--NL 393

Query: 747 NECDKLN-NVFENKIGVTVNEIFKTIDQGQKTSQV 780
           N  D +N    +  + V+ N +  T++  Q   Q+
Sbjct: 394 NVVDFMNITSIQGGLMVSNNSLLTTLESFQSLKQI 428

>KLLA0C15851g Chr3 complement(1378324..1380579) [2256 bp, 751 aa]
           {ON} similar to uniprot|O13585 Saccharomyces cerevisiae
           YPR089W Hypothetical ORF
          Length = 751

 Score = 32.3 bits (72), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 49/92 (53%), Gaps = 2/92 (2%)

Query: 440 MSQENYKELTNELENYKTEVEECKRAMEKVSAQNSLLIKEKR-VSNEVNESQKVKLRKLG 498
           +S+ N  +L   L+ Y+ E+ E K +M+K+  Q    IK+++ V  ++  S K+ L  L 
Sbjct: 619 LSRLNVTQLYKSLDRYRYELNEGKTSMKKLLKQKVKAIKDQQPVLLDIEFSVKLTLPTL- 677

Query: 499 NNIEFLYDKIDRQHKNEQELSNVVQELMRALH 530
             + FLYD+ +  ++    L   +Q+ +  +H
Sbjct: 678 QELYFLYDECESSYRFLPILPIAIQDEIDEIH 709

>KAFR0G02060 Chr7 (433290..434786) [1497 bp, 498 aa] {ON} Anc_8.609
           YOR198C
          Length = 498

 Score = 31.6 bits (70), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 52/107 (48%), Gaps = 16/107 (14%)

Query: 650 SSISEEYNNLKDYLNEHFFKNNFQEALDVHVD-RTYHQLKVSANSIFLKLREMLNEELDT 708
           S I  + N + + L +   K+NFQ A DV V      QL  + N   ++ + M+ E    
Sbjct: 98  SQIKRKTNEINEKLGKQAKKSNFQSADDVKVKIDEIDQLIGTGNLSIVEEKLMIKE---- 153

Query: 709 NKEFMMQSLRHAASEVVAKEMCLLDPVKQAWENSLENINEC-DKLNN 754
                +QSL       + K++ L+DP+K + +N    IN+  D+LNN
Sbjct: 154 -----IQSLNK-----LIKDLKLIDPIKSSIDNDKTKINQLKDELNN 190

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.130    0.351 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 91,100,428
Number of extensions: 3872400
Number of successful extensions: 16637
Number of sequences better than 10.0: 678
Number of HSP's gapped: 17000
Number of HSP's successfully gapped: 1009
Length of query: 943
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 824
Effective length of database: 39,836,145
Effective search space: 32824983480
Effective search space used: 32824983480
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 71 (32.0 bits)