Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_56.223996.15ON27427412900.0
KLTH0C11352g6.15ON2682418921e-121
SAKL0E01056g6.15ON2691837921e-106
KAFR0A050606.15ON2691957601e-101
KLLA0D01023g6.15ON2682247591e-101
ZYRO0C07920g6.15ON2931827601e-100
ACR011C6.15ON2531917282e-96
CAGL0E02673g6.15ON2631797092e-93
NCAS0D026606.15ON2611797084e-93
NDAI0I022506.15ON2711796963e-91
Kpol_1045.746.15ON2571806911e-90
TDEL0G045406.15ON2452686873e-90
Ecym_30196.15ON2661946806e-89
Suva_15.1796.15ON2591746675e-87
KNAG0F028806.15ON2691836678e-87
YOR004W (UTP23)6.15ON2541796502e-84
Skud_15.1656.15ON2571746484e-84
Smik_15.1736.15ON2511746457e-84
TPHA0J002806.15ON2711936373e-82
TBLA0A072906.15ON2591775832e-74
Kwal_55.200895.392ON1891431733e-14
KLTH0E02860g5.392ON1891431724e-14
ZYRO0A06754g5.392ON1891461691e-13
TPHA0D023105.392ON1891431672e-13
KNAG0C052705.392ON1891431653e-13
CAGL0M01056g5.392ON1891431644e-13
AEL102W5.392ON1891431636e-13
SAKL0G07766g5.392ON1891431611e-12
KAFR0D042805.392ON1891431611e-12
NDAI0C045505.392ON1891431611e-12
Kpol_1055.185.392ON1891431592e-12
Ecym_74695.392ON1891431592e-12
TDEL0E023305.392ON1891461583e-12
NCAS0F030905.392ON1891431584e-12
Suva_2.5095.392ON1891431574e-12
YDR339C (FCF1)5.392ON1891431575e-12
Skud_4.6065.392ON1891431575e-12
TBLA0H017505.392ON1891431575e-12
Smik_4.5995.392ON1891431565e-12
KLLA0A07018g5.392ON1891431471e-10
Kwal_26.83612.600ON24463657.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_56.22399
         (274 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_56.22399 s56 (111021..111845) [825 bp, 274 aa] {ON} YOR004W...   501   0.0  
KLTH0C11352g Chr3 complement(934886..935692) [807 bp, 268 aa] {O...   348   e-121
SAKL0E01056g Chr5 (79518..80327) [810 bp, 269 aa] {ON} similar t...   309   e-106
KAFR0A05060 Chr1 complement(1006556..1007365) [810 bp, 269 aa] {...   297   e-101
KLLA0D01023g Chr4 (89887..90693) [807 bp, 268 aa] {ON} similar t...   296   e-101
ZYRO0C07920g Chr3 complement(603790..604671) [882 bp, 293 aa] {O...   297   e-100
ACR011C Chr3 complement(377334..378095) [762 bp, 253 aa] {ON} Sy...   285   2e-96
CAGL0E02673g Chr5 (253705..254496) [792 bp, 263 aa] {ON} similar...   277   2e-93
NCAS0D02660 Chr4 complement(511544..512329) [786 bp, 261 aa] {ON...   277   4e-93
NDAI0I02250 Chr9 (513792..514607) [816 bp, 271 aa] {ON} Anc_6.15...   272   3e-91
Kpol_1045.74 s1045 complement(173724..174497) [774 bp, 257 aa] {...   270   1e-90
TDEL0G04540 Chr7 complement(828055..828792) [738 bp, 245 aa] {ON...   269   3e-90
Ecym_3019 Chr3 (36286..37086) [801 bp, 266 aa] {ON} similar to A...   266   6e-89
Suva_15.179 Chr15 (308047..308826) [780 bp, 259 aa] {ON} YOR004W...   261   5e-87
KNAG0F02880 Chr6 complement(546147..546956) [810 bp, 269 aa] {ON...   261   8e-87
YOR004W Chr15 (333592..334356) [765 bp, 254 aa] {ON}  UTP23Compo...   254   2e-84
Skud_15.165 Chr15 (293629..294402) [774 bp, 257 aa] {ON} YOR004W...   254   4e-84
Smik_15.173 Chr15 (300941..301696) [756 bp, 251 aa] {ON} YOR004W...   253   7e-84
TPHA0J00280 Chr10 (63865..64680) [816 bp, 271 aa] {ON} Anc_6.15 ...   249   3e-82
TBLA0A07290 Chr1 (1814724..1815503) [780 bp, 259 aa] {ON} Anc_6....   229   2e-74
Kwal_55.20089 s55 (245372..245941) [570 bp, 189 aa] {ON} YDR339C...    71   3e-14
KLTH0E02860g Chr5 (258370..258939) [570 bp, 189 aa] {ON} highly ...    71   4e-14
ZYRO0A06754g Chr1 (550964..551533) [570 bp, 189 aa] {ON} highly ...    70   1e-13
TPHA0D02310 Chr4 complement(478545..479114) [570 bp, 189 aa] {ON...    69   2e-13
KNAG0C05270 Chr3 (1028377..1028946) [570 bp, 189 aa] {ON} Anc_5....    68   3e-13
CAGL0M01056g Chr13 (117010..117579) [570 bp, 189 aa] {ON} highly...    68   4e-13
AEL102W Chr5 (436582..437151) [570 bp, 189 aa] {ON} Syntenic hom...    67   6e-13
SAKL0G07766g Chr7 (652944..653513) [570 bp, 189 aa] {ON} highly ...    67   1e-12
KAFR0D04280 Chr4 (842029..842598) [570 bp, 189 aa] {ON} Anc_5.39...    67   1e-12
NDAI0C04550 Chr3 complement(1031852..1032421) [570 bp, 189 aa] {...    67   1e-12
Kpol_1055.18 s1055 complement(40805..41374) [570 bp, 189 aa] {ON...    66   2e-12
Ecym_7469 Chr7 complement(956526..957095) [570 bp, 189 aa] {ON} ...    66   2e-12
TDEL0E02330 Chr5 (455296..455865) [570 bp, 189 aa] {ON} Anc_5.39...    65   3e-12
NCAS0F03090 Chr6 complement(616705..617274) [570 bp, 189 aa] {ON...    65   4e-12
Suva_2.509 Chr2 complement(907366..907935) [570 bp, 189 aa] {ON}...    65   4e-12
YDR339C Chr4 complement(1149951..1150520) [570 bp, 189 aa] {ON} ...    65   5e-12
Skud_4.606 Chr4 complement(1085976..1086545) [570 bp, 189 aa] {O...    65   5e-12
TBLA0H01750 Chr8 (408338..408907) [570 bp, 189 aa] {ON} Anc_5.39...    65   5e-12
Smik_4.599 Chr4 complement(1076379..1076948) [570 bp, 189 aa] {O...    65   5e-12
KLLA0A07018g Chr1 complement(632523..633092) [570 bp, 189 aa] {O...    61   1e-10
Kwal_26.8361 s26 complement(754178..754912) [735 bp, 244 aa] {ON...    30   7.8  

>Kwal_56.22399 s56 (111021..111845) [825 bp, 274 aa] {ON} YOR004W -
           Protein required for cell viability [contig 185] FULL
          Length = 274

 Score =  501 bits (1290), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 247/274 (90%), Positives = 247/274 (90%)

Query: 1   MRQKRAKSYRKQMLVYNHNFKFREPYQVLVDDQIVCDTHKAAFDLVKGLKRTLQAEVKPM 60
           MRQKRAKSYRKQMLVYNHNFKFREPYQVLVDDQIVCDTHKAAFDLVKGLKRTLQAEVKPM
Sbjct: 1   MRQKRAKSYRKQMLVYNHNFKFREPYQVLVDDQIVCDTHKAAFDLVKGLKRTLQAEVKPM 60

Query: 61  ITQCCIQAIYETNDQEAIELAKSFERRRCNHPPKEAKPPLECLQSVVNVNGVNKHRYVVA 120
           ITQCCIQAIYETNDQEAIELAKSFERRRCNHPPKEAKPPLECLQSVVNVNGVNKHRYVVA
Sbjct: 61  ITQCCIQAIYETNDQEAIELAKSFERRRCNHPPKEAKPPLECLQSVVNVNGVNKHRYVVA 120

Query: 121 TQNQEIRGCLRKVPGVPLVFMNRSVMVMEPLSKASQNVSRVQEREKLFKGLNDPKFAGLP 180
           TQNQEIRGCLRKVPGVPLVFMNRSVMVMEPLSKASQNVSRVQEREKLFKGLNDPKFAGLP
Sbjct: 121 TQNQEIRGCLRKVPGVPLVFMNRSVMVMEPLSKASQNVSRVQEREKLFKGLNDPKFAGLP 180

Query: 181 LTEQPATATAATVDKEXXXXXXXXXXXXXXXXXLSIKKKKTSESRKEPVNPAENTSATLT 240
           LTEQPATATAATVDKE                 LSIKKKKTSESRKEPVNPAENTSATLT
Sbjct: 181 LTEQPATATAATVDKEGAGAPAKKRKGPKGPNPLSIKKKKTSESRKEPVNPAENTSATLT 240

Query: 241 ENDNKEQPXXXXXXXXXXTTPQTAEETTSEQQDT 274
           ENDNKEQP          TTPQTAEETTSEQQDT
Sbjct: 241 ENDNKEQPSRRRKRSHKKTTPQTAEETTSEQQDT 274

>KLTH0C11352g Chr3 complement(934886..935692) [807 bp, 268 aa] {ON}
           similar to uniprot|Q12339 Saccharomyces cerevisiae
           YOR004W Protein required for cell viability
          Length = 268

 Score =  348 bits (892), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 171/241 (70%), Positives = 190/241 (78%), Gaps = 6/241 (2%)

Query: 1   MRQKRAKSYRKQMLVYNHNFKFREPYQVLVDDQIVCDTHKAAFDLVKGLKRTLQAEVKPM 60
           MRQKRAKSYRKQMLVYNHNFKFREPYQVLVDDQIVCDTH+A+FDLVKGL+RTLQAEVKPM
Sbjct: 1   MRQKRAKSYRKQMLVYNHNFKFREPYQVLVDDQIVCDTHRASFDLVKGLQRTLQAEVKPM 60

Query: 61  ITQCCIQAIYETNDQEAIELAKSFERRRCNHPPKEAKPPLECLQSVVNVNGVNKHRYVVA 120
           ITQCCIQAIYET +Q+AIELAKSFERRRCNHPPKEAKPP+ECLQSVV+VNG NKHRYVVA
Sbjct: 61  ITQCCIQAIYETKNQDAIELAKSFERRRCNHPPKEAKPPIECLQSVVSVNGNNKHRYVVA 120

Query: 121 TQNQEIRGCLRKVPGVPLVFMNRSVMVMEPLSKASQNVSRVQEREKLFKGLNDPKFAGLP 180
           +Q+  IR  LR+VPGVPL++MNRSVMVMEPLSKAS + SR QE+EKLFKGLNDPK+AGLP
Sbjct: 121 SQDPSIRKKLRQVPGVPLIYMNRSVMVMEPLSKASGDFSRAQEKEKLFKGLNDPKYAGLP 180

Query: 181 LTEQPATATAATVDKEXXXXXXXXXXXXXXXXXLSIKKKKTSESRKEPVNPAENTSATLT 240
             E+       T                     LSIKKKKT    K+   P++  S T  
Sbjct: 181 AEEEGGKTDNGT------EVSKNKRKGPKGPNPLSIKKKKTVPDSKDESPPSDKISVTDA 234

Query: 241 E 241
           E
Sbjct: 235 E 235

>SAKL0E01056g Chr5 (79518..80327) [810 bp, 269 aa] {ON} similar to
           uniprot|Q12339 Saccharomyces cerevisiae YOR004W Protein
           required for cell viability
          Length = 269

 Score =  309 bits (792), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 142/183 (77%), Positives = 163/183 (89%)

Query: 1   MRQKRAKSYRKQMLVYNHNFKFREPYQVLVDDQIVCDTHKAAFDLVKGLKRTLQAEVKPM 60
           MRQKRAKSYRKQMLVYNH FKFREPYQVLVDDQIV  T+K++FDL KGLKRTLQAEVKPM
Sbjct: 1   MRQKRAKSYRKQMLVYNHTFKFREPYQVLVDDQIVMGTYKSSFDLAKGLKRTLQAEVKPM 60

Query: 61  ITQCCIQAIYETNDQEAIELAKSFERRRCNHPPKEAKPPLECLQSVVNVNGVNKHRYVVA 120
           ITQCC+QA+Y T DQ AIE+AK++ERRRCNHPPKE+K  LEC++SVVN NG NKHRYVVA
Sbjct: 61  ITQCCMQALYATKDQGAIEMAKTYERRRCNHPPKESKTSLECIESVVNFNGKNKHRYVVA 120

Query: 121 TQNQEIRGCLRKVPGVPLVFMNRSVMVMEPLSKASQNVSRVQEREKLFKGLNDPKFAGLP 180
           TQ+ +IR  LR+VPGVPL++MNRSVMVMEPLS+AS+ +S+V+E EKLFKGLNDPK AGL 
Sbjct: 121 TQDIDIRRKLRRVPGVPLIYMNRSVMVMEPLSEASERLSKVREEEKLFKGLNDPKHAGLA 180

Query: 181 LTE 183
             E
Sbjct: 181 HDE 183

>KAFR0A05060 Chr1 complement(1006556..1007365) [810 bp, 269 aa] {ON}
           Anc_6.15 YOR004W
          Length = 269

 Score =  297 bits (760), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 138/195 (70%), Positives = 164/195 (84%)

Query: 1   MRQKRAKSYRKQMLVYNHNFKFREPYQVLVDDQIVCDTHKAAFDLVKGLKRTLQAEVKPM 60
           MRQKRAKSYRKQ+LVY+H FKFREPYQVLVD++IV  +  + FDLVKGLKRTLQAEVKPM
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNEIVTVSSNSNFDLVKGLKRTLQAEVKPM 60

Query: 61  ITQCCIQAIYETNDQEAIELAKSFERRRCNHPPKEAKPPLECLQSVVNVNGVNKHRYVVA 120
           ITQCC+QA+YET DQ AI++AK FERRRCNHPPKE K P+EC+ SVVNVNG NKHRYVVA
Sbjct: 61  ITQCCMQALYETRDQNAIDMAKGFERRRCNHPPKEPKTPIECVLSVVNVNGKNKHRYVVA 120

Query: 121 TQNQEIRGCLRKVPGVPLVFMNRSVMVMEPLSKASQNVSRVQEREKLFKGLNDPKFAGLP 180
           +Q+ +IR  LR+VPGVPLV ++RSVM+MEPLS  S  +S   E+EKL+KGLNDPK+AGL 
Sbjct: 121 SQDIDIRRQLRRVPGVPLVHISRSVMIMEPLSDTSAKISSRMEQEKLYKGLNDPKYAGLK 180

Query: 181 LTEQPATATAATVDK 195
           L E+ AT T  + +K
Sbjct: 181 LDEEEATETQGSGEK 195

>KLLA0D01023g Chr4 (89887..90693) [807 bp, 268 aa] {ON} similar to
           uniprot|Q12339 Saccharomyces cerevisiae YOR004W Protein
           required for cell viability
          Length = 268

 Score =  296 bits (759), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 147/224 (65%), Positives = 169/224 (75%), Gaps = 6/224 (2%)

Query: 1   MRQKRAKSYRKQMLVYNHNFKFREPYQVLVDDQIVCDTHKAAFDLVKGLKRTLQAEVKPM 60
           MRQKRAKSYRKQMLVYNH FKFR+PYQVLVDDQ+V +T  ++FD VKGL+RTLQAEVKPM
Sbjct: 1   MRQKRAKSYRKQMLVYNHTFKFRQPYQVLVDDQLVLETFNSSFDFVKGLQRTLQAEVKPM 60

Query: 61  ITQCCIQAIYETNDQEAIELAKSFERRRCNHPPKEAKPPLECLQSVVNVNGVNKHRYVVA 120
           ITQCC+Q++Y+TN+Q AI+  K FERRRCNH PKE K  LECL SVV+VNG NKHRYVVA
Sbjct: 61  ITQCCMQSLYQTNNQGAIDAGKQFERRRCNHDPKEPKSVLECLTSVVDVNGKNKHRYVVA 120

Query: 121 TQNQEIRGCLRKVPGVPLVFMNRSVMVMEPLSKASQNVSRVQEREKLFKGLNDPKFAGLP 180
           TQ+ EIR  LRK+PGVPLV+MNRSVMVMEPLS AS+ VSR  E +KL+KGLNDPKFAG+ 
Sbjct: 121 TQDVEIRRRLRKIPGVPLVYMNRSVMVMEPLSNASEKVSREVEEQKLYKGLNDPKFAGIA 180

Query: 181 LTEQPATATAATVDKEXXXXXXXXXXXXXXXXXLSIKKKKTSES 224
             E            E                 LS+KKKKT+ES
Sbjct: 181 RDENDEAGA------ENQENKPKKRKGPKEPNPLSMKKKKTTES 218

>ZYRO0C07920g Chr3 complement(603790..604671) [882 bp, 293 aa] {ON}
           similar to uniprot|Q12339 Saccharomyces cerevisiae
           YOR004W Protein required for cell viability
          Length = 293

 Score =  297 bits (760), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 138/182 (75%), Positives = 158/182 (86%)

Query: 1   MRQKRAKSYRKQMLVYNHNFKFREPYQVLVDDQIVCDTHKAAFDLVKGLKRTLQAEVKPM 60
           MRQKRAKSY+KQMLVYN+ F+FREPYQVL+DDQ+V D  K+ +DLV GLKRTLQAEVKPM
Sbjct: 1   MRQKRAKSYKKQMLVYNYAFRFREPYQVLIDDQLVSDCQKSHYDLVGGLKRTLQAEVKPM 60

Query: 61  ITQCCIQAIYETNDQEAIELAKSFERRRCNHPPKEAKPPLECLQSVVNVNGVNKHRYVVA 120
           ITQCC+QA+Y T +Q+AIEL KSFERRRCNHPPKEAKPP EC+QSVVNVNG NKHRYVVA
Sbjct: 61  ITQCCMQALYFTKNQDAIELGKSFERRRCNHPPKEAKPPHECIQSVVNVNGSNKHRYVVA 120

Query: 121 TQNQEIRGCLRKVPGVPLVFMNRSVMVMEPLSKASQNVSRVQEREKLFKGLNDPKFAGLP 180
           +Q+  +R  LRKVPGVPL+ M+RSVMVMEPLS+AS  V+ + EREKL KGLNDPK AGL 
Sbjct: 121 SQDVTLRRKLRKVPGVPLIHMSRSVMVMEPLSEASSRVNEMSEREKLLKGLNDPKLAGLK 180

Query: 181 LT 182
            T
Sbjct: 181 TT 182

>ACR011C Chr3 complement(377334..378095) [762 bp, 253 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR004W
          Length = 253

 Score =  285 bits (728), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 133/191 (69%), Positives = 159/191 (83%), Gaps = 1/191 (0%)

Query: 1   MRQKRAKSYRKQMLVYNHNFKFREPYQVLVDDQIVCDTHKAAFDLVKGLKRTLQAEVKPM 60
           MRQKRAK+Y+KQMLVYNH FKFREPYQVLVDDQIV +T+K++FDL+KGLKRTLQAEVKPM
Sbjct: 1   MRQKRAKAYKKQMLVYNHTFKFREPYQVLVDDQIVLETNKSSFDLLKGLKRTLQAEVKPM 60

Query: 61  ITQCCIQAIYETNDQEAIELAKSFERRRCNHPPKEAKPPLECLQSVVNVNGVNKHRYVVA 120
           ITQCC+Q +Y+T +Q+AI   K +ERRRCNH  KE K P+ECLQSVV VNG N+HRY+VA
Sbjct: 61  ITQCCMQKLYDTKNQDAIAQGKLYERRRCNH-VKEPKEPIECLQSVVAVNGQNRHRYIVA 119

Query: 121 TQNQEIRGCLRKVPGVPLVFMNRSVMVMEPLSKASQNVSRVQEREKLFKGLNDPKFAGLP 180
           +Q+  IR  LRKVPGVPLV++NR+VMVMEPLS  S+ VSR  E++KLFKGLNDPK+ G+ 
Sbjct: 120 SQDIAIRRALRKVPGVPLVYINRAVMVMEPLSSTSEQVSREAEKQKLFKGLNDPKYTGIA 179

Query: 181 LTEQPATATAA 191
               PA A  A
Sbjct: 180 ENSAPAGAQPA 190

>CAGL0E02673g Chr5 (253705..254496) [792 bp, 263 aa] {ON} similar to
           uniprot|Q12339 Saccharomyces cerevisiae YOR004w
          Length = 263

 Score =  277 bits (709), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 128/179 (71%), Positives = 150/179 (83%)

Query: 1   MRQKRAKSYRKQMLVYNHNFKFREPYQVLVDDQIVCDTHKAAFDLVKGLKRTLQAEVKPM 60
           MRQKRAKSYRKQ+LVYNH FKFREPYQVL+DDQIV D+  + +DLVK LKRTLQAEVKPM
Sbjct: 1   MRQKRAKSYRKQLLVYNHTFKFREPYQVLLDDQIVMDSTTSKYDLVKALKRTLQAEVKPM 60

Query: 61  ITQCCIQAIYETNDQEAIELAKSFERRRCNHPPKEAKPPLECLQSVVNVNGVNKHRYVVA 120
           ITQCC+QA+YET ++ AI+L K FERRRC H P EA  P EC+ +VV+V G NKHRYVVA
Sbjct: 61  ITQCCMQALYETKNEHAIDLGKEFERRRCGHMPGEAVSPKECILNVVDVKGKNKHRYVVA 120

Query: 121 TQNQEIRGCLRKVPGVPLVFMNRSVMVMEPLSKASQNVSRVQEREKLFKGLNDPKFAGL 179
            Q+ EIR  LRKVPGVPL+ ++RSVM+MEPLS AS  VSR++E  KLF+GLNDPK+AGL
Sbjct: 121 CQDVEIRRLLRKVPGVPLLHISRSVMIMEPLSDASAKVSRMEEESKLFRGLNDPKYAGL 179

>NCAS0D02660 Chr4 complement(511544..512329) [786 bp, 261 aa] {ON}
           Anc_6.15
          Length = 261

 Score =  277 bits (708), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 126/179 (70%), Positives = 151/179 (84%)

Query: 1   MRQKRAKSYRKQMLVYNHNFKFREPYQVLVDDQIVCDTHKAAFDLVKGLKRTLQAEVKPM 60
           MRQKRAKSYRKQ+LVYNH F+FREPYQ+LVD+QIV D   + +DL KGL RTLQAEVK M
Sbjct: 1   MRQKRAKSYRKQLLVYNHTFRFREPYQILVDNQIVTDCSTSNYDLEKGLHRTLQAEVKVM 60

Query: 61  ITQCCIQAIYETNDQEAIELAKSFERRRCNHPPKEAKPPLECLQSVVNVNGVNKHRYVVA 120
           ITQCC+QA+YE NDQ AIELA+ FERRRCNH PK+ K P+EC++SVVN+NG NKHRYVVA
Sbjct: 61  ITQCCMQALYEANDQNAIELARRFERRRCNHNPKDPKTPIECIESVVNINGQNKHRYVVA 120

Query: 121 TQNQEIRGCLRKVPGVPLVFMNRSVMVMEPLSKASQNVSRVQEREKLFKGLNDPKFAGL 179
            Q+  IR  LR+VPGVPLV ++R+VM+MEPLS AS  VS+ +E EKL+KGLNDPK+ G+
Sbjct: 121 AQDVAIRRKLRQVPGVPLVHISRAVMIMEPLSDASAKVSKRKENEKLYKGLNDPKYTGV 179

>NDAI0I02250 Chr9 (513792..514607) [816 bp, 271 aa] {ON} Anc_6.15
           YOR004W
          Length = 271

 Score =  272 bits (696), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 124/179 (69%), Positives = 149/179 (83%)

Query: 1   MRQKRAKSYRKQMLVYNHNFKFREPYQVLVDDQIVCDTHKAAFDLVKGLKRTLQAEVKPM 60
           MRQKRAKSYRKQ+LVYNH FKFR PYQVLVD+QIV D   + +DL KGLK TLQ+EVK M
Sbjct: 1   MRQKRAKSYRKQLLVYNHTFKFRAPYQVLVDNQIVLDCSNSNYDLAKGLKNTLQSEVKVM 60

Query: 61  ITQCCIQAIYETNDQEAIELAKSFERRRCNHPPKEAKPPLECLQSVVNVNGVNKHRYVVA 120
           ITQCC+QA+YE N+Q+AIELA+ FERRRCNH PKE K  +EC++SVVN+NG NKHRYVVA
Sbjct: 61  ITQCCMQALYEENNQDAIELARRFERRRCNHNPKEPKTAIECIESVVNINGQNKHRYVVA 120

Query: 121 TQNQEIRGCLRKVPGVPLVFMNRSVMVMEPLSKASQNVSRVQEREKLFKGLNDPKFAGL 179
           +Q+   R  LR+VPGVPL+ ++R+VM+MEPLS  S  VSR +E EKL+KGLNDPKF G+
Sbjct: 121 SQDLATRRKLRQVPGVPLIHISRAVMIMEPLSDVSAQVSRRKENEKLYKGLNDPKFTGV 179

>Kpol_1045.74 s1045 complement(173724..174497) [774 bp, 257 aa] {ON}
           complement(173726..174499) [774 nt, 258 aa]
          Length = 257

 Score =  270 bits (691), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 121/180 (67%), Positives = 154/180 (85%), Gaps = 1/180 (0%)

Query: 1   MRQKRAKSYRKQMLVYNHNFKFREPYQVLVDDQIVCDTHKAAFDLVKGLKRTLQAEVKPM 60
           MRQ+RAKSYRKQMLVYNH FKFREPYQ +VDDQ+V D  ++ FD++KGLKRTLQAEVK M
Sbjct: 1   MRQRRAKSYRKQMLVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAEVKVM 60

Query: 61  ITQCCIQAIYETNDQEAIELAKSFERRRCNHPPKEAKPPLECLQSVVNVNGVNKHRYVVA 120
           ITQCC+QA+Y+T++QEAI +AK FERRRCNHPPK+ K PLEC++S+V++ G NKHRYVVA
Sbjct: 61  ITQCCMQALYKTDNQEAISIAKEFERRRCNHPPKDPKSPLECIESIVDIKGSNKHRYVVA 120

Query: 121 TQNQEIRGCLRKVPGVPLVFMNRSVMVMEPLSKASQNVSRVQEREKLFKGLNDPKF-AGL 179
           +Q+ +IR  LRK+PGVP+V ++R+VM++EPLS AS  +S   E++KL+KGLND K  AGL
Sbjct: 121 SQDMDIRRKLRKIPGVPIVHVSRAVMILEPLSDASLKISERLEKDKLYKGLNDSKHTAGL 180

>TDEL0G04540 Chr7 complement(828055..828792) [738 bp, 245 aa] {ON}
           Anc_6.15 YOR004W
          Length = 245

 Score =  269 bits (687), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 157/268 (58%), Positives = 183/268 (68%), Gaps = 23/268 (8%)

Query: 1   MRQKRAKSYRKQMLVYNHNFKFREPYQVLVDDQIVCDTHKAAFDLVKGLKRTLQAEVKPM 60
           MRQKRAK+YRKQMLVYNH FKFREPYQVLVD+QIV D H + FDLVKGL+RTLQAEVK M
Sbjct: 1   MRQKRAKAYRKQMLVYNHTFKFREPYQVLVDNQIVLDCHGSNFDLVKGLQRTLQAEVKVM 60

Query: 61  ITQCCIQAIYETNDQEAIELAKSFERRRCNHPPKEAKPPLECLQSVVNVNGVNKHRYVVA 120
           ITQCC+QA+YETN Q AIELAK+FERRRCNHPPKE KPP+ECL+S+V VNG NKHRYVVA
Sbjct: 61  ITQCCMQALYETNKQGAIELAKTFERRRCNHPPKEPKPPIECLESIVCVNGHNKHRYVVA 120

Query: 121 TQNQEIRGCLRKVPGVPLVFMNRSVMVMEPLSKASQNVSRVQEREKLFKGLNDPKFAGLP 180
           +Q+ + R  LR+ PGVPLV   RSVMVMEPLS AS  VS   E EKL KGLNDP+ AG+ 
Sbjct: 121 SQDIDTRRILRRTPGVPLVHTVRSVMVMEPLSDASAKVSSAAEAEKLHKGLNDPRNAGIK 180

Query: 181 LTEQPATATAATVDKEXXXXXXXXXXXXXXXXXLSIKKKKTSESRKEPVNPAENTSATLT 240
            TE P T+                         LS+KK+KT ES+ EP   A++T    +
Sbjct: 181 -TENPQTSI---------------KKRTKQPNPLSVKKRKT-ESKGEP-KAAQDTEPVAS 222

Query: 241 ENDNKEQPXXXXXXXXXXTTPQTAEETT 268
               + +           T PQ  EE+T
Sbjct: 223 NTKKRRR-----KHKSSTTEPQGQEEST 245

>Ecym_3019 Chr3 (36286..37086) [801 bp, 266 aa] {ON} similar to
           Ashbya gossypii ACR011C
          Length = 266

 Score =  266 bits (680), Expect = 6e-89,   Method: Compositional matrix adjust.
 Identities = 132/194 (68%), Positives = 159/194 (81%), Gaps = 1/194 (0%)

Query: 1   MRQKRAKSYRKQMLVYNHNFKFREPYQVLVDDQIVCDTHKAAFDLVKGLKRTLQAEVKPM 60
           MRQKRAK+Y+KQMLVYNH FKFR+PYQVLVDDQ+V +T+K++FDL+KGLKRTLQAEVKPM
Sbjct: 1   MRQKRAKAYKKQMLVYNHTFKFRQPYQVLVDDQLVLETNKSSFDLLKGLKRTLQAEVKPM 60

Query: 61  ITQCCIQAIYETNDQEAIELAKSFERRRCNHPPKEAKPPLECLQSVVNVNGVNKHRYVVA 120
           ITQCC+Q +YE+ +Q AI  AK +ERRRCNH  KE K P EC++SVV++NG N HRYVVA
Sbjct: 61  ITQCCVQKLYESKNQGAIAQAKMYERRRCNH-YKEPKEPSECIRSVVDINGRNLHRYVVA 119

Query: 121 TQNQEIRGCLRKVPGVPLVFMNRSVMVMEPLSKASQNVSRVQEREKLFKGLNDPKFAGLP 180
           TQ+ EIR  LR+VPGVPL++MNRSVMVMEPLS  SQ VS+  E EKL KGLNDPK+AG P
Sbjct: 120 TQDIEIRRILRRVPGVPLIYMNRSVMVMEPLSSNSQQVSQQVENEKLVKGLNDPKYAGTP 179

Query: 181 LTEQPATATAATVD 194
              + A+    + D
Sbjct: 180 NNTEDASVDPKSPD 193

>Suva_15.179 Chr15 (308047..308826) [780 bp, 259 aa] {ON} YOR004W
           (REAL)
          Length = 259

 Score =  261 bits (667), Expect = 5e-87,   Method: Compositional matrix adjust.
 Identities = 120/174 (68%), Positives = 144/174 (82%)

Query: 1   MRQKRAKSYRKQMLVYNHNFKFREPYQVLVDDQIVCDTHKAAFDLVKGLKRTLQAEVKPM 60
           MRQKRAKSYRKQ+LVY+H FKFREPYQVLVD+Q+V +   + FDL  GLKRTLQA+VK M
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVM 60

Query: 61  ITQCCIQAIYETNDQEAIELAKSFERRRCNHPPKEAKPPLECLQSVVNVNGVNKHRYVVA 120
           ITQCCIQA+YET ++ AI+LAK FERRRCNH  K+ K P EC++SVVNVNG NKHRYVVA
Sbjct: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVNVNGANKHRYVVA 120

Query: 121 TQNQEIRGCLRKVPGVPLVFMNRSVMVMEPLSKASQNVSRVQEREKLFKGLNDP 174
           +Q+ ++R  LR VPGVPL+ + RSVM+MEPLS AS   SR+ E +KL+KGLNDP
Sbjct: 121 SQDIDLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKASRMTEEQKLYKGLNDP 174

>KNAG0F02880 Chr6 complement(546147..546956) [810 bp, 269 aa] {ON}
           Anc_6.15 YOR004W
          Length = 269

 Score =  261 bits (667), Expect = 8e-87,   Method: Compositional matrix adjust.
 Identities = 115/183 (62%), Positives = 151/183 (82%)

Query: 1   MRQKRAKSYRKQMLVYNHNFKFREPYQVLVDDQIVCDTHKAAFDLVKGLKRTLQAEVKPM 60
           MRQKRAKSYRKQ+LVYNH F+FREPYQV++DD+IV    ++ FDL K L+RT+QAEVK M
Sbjct: 1   MRQKRAKSYRKQLLVYNHTFRFREPYQVILDDEIVLQATESKFDLYKALQRTVQAEVKLM 60

Query: 61  ITQCCIQAIYETNDQEAIELAKSFERRRCNHPPKEAKPPLECLQSVVNVNGVNKHRYVVA 120
           ITQCC+QA+Y TN+++AI++AK +ERRRCNHPPK+ K P EC++SVV++ G NKHRY+VA
Sbjct: 61  ITQCCMQALYATNNRQAIDMAKRYERRRCNHPPKDPKSPFECIESVVDIKGENKHRYIVA 120

Query: 121 TQNQEIRGCLRKVPGVPLVFMNRSVMVMEPLSKASQNVSRVQEREKLFKGLNDPKFAGLP 180
            QN ++R  LR+VPGVPL+ ++R+VM+MEPLS AS  +S+  E++KLF GLND K AG+ 
Sbjct: 121 CQNIDLRRKLRRVPGVPLIHVSRAVMIMEPLSDASARISKRMEQQKLFSGLNDAKAAGIK 180

Query: 181 LTE 183
             E
Sbjct: 181 AAE 183

>YOR004W Chr15 (333592..334356) [765 bp, 254 aa] {ON}
           UTP23Component of the small subunit processome, involved
           in 40S ribosomal subunit biogenesis; interacts with
           snR30 and is required for dissociation of snR30 from
           large pre-ribosomal particles; has homology to PINc
           domain protein Fcf1p, although the PINc domain of Utp23p
           is not required for function; essential protein
          Length = 254

 Score =  254 bits (650), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 118/179 (65%), Positives = 144/179 (80%)

Query: 1   MRQKRAKSYRKQMLVYNHNFKFREPYQVLVDDQIVCDTHKAAFDLVKGLKRTLQAEVKPM 60
           MRQKRAKSYRKQ+LVY+H FKFREPYQVLVD+Q+V + + + F+L  GLKRTLQA+VK M
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNNSNFNLPSGLKRTLQADVKVM 60

Query: 61  ITQCCIQAIYETNDQEAIELAKSFERRRCNHPPKEAKPPLECLQSVVNVNGVNKHRYVVA 120
           ITQCCIQA+YET +  AI LAK FERRRCNH  K+ K P EC++SVVN++G NKHRYVVA
Sbjct: 61  ITQCCIQALYETRNDGAINLAKQFERRRCNHSFKDPKSPAECIESVVNISGANKHRYVVA 120

Query: 121 TQNQEIRGCLRKVPGVPLVFMNRSVMVMEPLSKASQNVSRVQEREKLFKGLNDPKFAGL 179
           +Q+ ++R  LR VPGVPL+ + RSVMVMEPLS AS   S++ E +KL+KGLNDP    L
Sbjct: 121 SQDIDLRRKLRTVPGVPLIHLTRSVMVMEPLSTASAKASKITEEQKLYKGLNDPNIEKL 179

>Skud_15.165 Chr15 (293629..294402) [774 bp, 257 aa] {ON} YOR004W
           (REAL)
          Length = 257

 Score =  254 bits (648), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 118/174 (67%), Positives = 142/174 (81%)

Query: 1   MRQKRAKSYRKQMLVYNHNFKFREPYQVLVDDQIVCDTHKAAFDLVKGLKRTLQAEVKPM 60
           MRQKRAKSYRKQ+LVY+H FKFREPYQVLVD+Q+V +   + F+L  GLKRTLQA+VK M
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVM 60

Query: 61  ITQCCIQAIYETNDQEAIELAKSFERRRCNHPPKEAKPPLECLQSVVNVNGVNKHRYVVA 120
           ITQCCIQA+YET ++ AI+LAK FERRRCNH  K+ K P EC++SVV+VNG NKHRYVVA
Sbjct: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVDVNGANKHRYVVA 120

Query: 121 TQNQEIRGCLRKVPGVPLVFMNRSVMVMEPLSKASQNVSRVQEREKLFKGLNDP 174
           +Q+  +R  LR VPGVPL+ + RSVM+MEPLS AS   S+  E +KLFKGLNDP
Sbjct: 121 SQDIHLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKESKKTEEQKLFKGLNDP 174

>Smik_15.173 Chr15 (300941..301696) [756 bp, 251 aa] {ON} YOR004W
           (REAL)
          Length = 251

 Score =  253 bits (645), Expect = 7e-84,   Method: Compositional matrix adjust.
 Identities = 116/174 (66%), Positives = 143/174 (82%)

Query: 1   MRQKRAKSYRKQMLVYNHNFKFREPYQVLVDDQIVCDTHKAAFDLVKGLKRTLQAEVKPM 60
           MRQKRAKSYRKQ+LVY+H FKFREPYQVLVD+Q+V + + + F+L  GLKRTLQA+VK M
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNGSNFNLPSGLKRTLQADVKVM 60

Query: 61  ITQCCIQAIYETNDQEAIELAKSFERRRCNHPPKEAKPPLECLQSVVNVNGVNKHRYVVA 120
           ITQCCIQA+YET ++ AI+LAK FERRRCNH  K+ K P +C++SVV++NG NKHRYVVA
Sbjct: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPADCIESVVDINGANKHRYVVA 120

Query: 121 TQNQEIRGCLRKVPGVPLVFMNRSVMVMEPLSKASQNVSRVQEREKLFKGLNDP 174
           +Q+  +R  LR VPGVPL+ + RSVMVMEPLS AS   S++ E  KL+KGLNDP
Sbjct: 121 SQDIGLRRKLRNVPGVPLIHLTRSVMVMEPLSTASAKASKMTEERKLYKGLNDP 174

>TPHA0J00280 Chr10 (63865..64680) [816 bp, 271 aa] {ON} Anc_6.15
           YOR004W
          Length = 271

 Score =  249 bits (637), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 114/193 (59%), Positives = 155/193 (80%), Gaps = 1/193 (0%)

Query: 1   MRQKRAKSYRKQMLVYNHNFKFREPYQVLVDDQIVCDTHKAAFDLVKGLKRTLQAE-VKP 59
           MRQKRAKSY+KQM+VYNH FKFREPYQ+LVD+QIV D+ ++ ++L + L++TLQAE +K 
Sbjct: 1   MRQKRAKSYKKQMVVYNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKV 60

Query: 60  MITQCCIQAIYETNDQEAIELAKSFERRRCNHPPKEAKPPLECLQSVVNVNGVNKHRYVV 119
           MITQCC+Q +Y T++QE I+ AK FERRRCNH  K+ K PLEC++S+VN++G NKHRYVV
Sbjct: 61  MITQCCMQKLYTTSNQELIDEAKRFERRRCNHSIKDPKEPLECIESIVNIDGQNKHRYVV 120

Query: 120 ATQNQEIRGCLRKVPGVPLVFMNRSVMVMEPLSKASQNVSRVQEREKLFKGLNDPKFAGL 179
           ATQN E+R  LR+VPGVP++ ++RSVM+MEP+S +S  ++R  E+ KL+KGLNDPK++  
Sbjct: 121 ATQNMELRRKLRRVPGVPILHLSRSVMIMEPISDSSVRLNRKFEQSKLYKGLNDPKYSMA 180

Query: 180 PLTEQPATATAAT 192
           P  ++    T  T
Sbjct: 181 PTPKEGTPDTEGT 193

>TBLA0A07290 Chr1 (1814724..1815503) [780 bp, 259 aa] {ON} Anc_6.15
           YOR004W
          Length = 259

 Score =  229 bits (583), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 106/177 (59%), Positives = 135/177 (76%), Gaps = 2/177 (1%)

Query: 1   MRQKRAKSYRKQMLVYNHNFKFREPYQVLVDDQIVCDTHKAAFDLVKGLKRTLQAE--VK 58
           MRQKRAKSY+KQ++VYNH FKFREPYQV++DD +V +T +A ++L+KGL   L +   +K
Sbjct: 1   MRQKRAKSYKKQLIVYNHTFKFREPYQVIIDDALVQETLRAKYNLIKGLNNVLSSSNAIK 60

Query: 59  PMITQCCIQAIYETNDQEAIELAKSFERRRCNHPPKEAKPPLECLQSVVNVNGVNKHRYV 118
           PMITQCCI A+Y++ DQE+I + K+FERRRCNH  KE   P EC+ S+V+VNG NKHRY+
Sbjct: 61  PMITQCCISALYKSEDQESISIGKTFERRRCNHSVKEPLSPSECMLSIVDVNGKNKHRYI 120

Query: 119 VATQNQEIRGCLRKVPGVPLVFMNRSVMVMEPLSKASQNVSRVQEREKLFKGLNDPK 175
           VATQ+ E+R  LRK+PGVPL+   RSVMVMEPLS AS   +   E +KL  GLN  K
Sbjct: 121 VATQDLELRRKLRKIPGVPLIHFKRSVMVMEPLSDASCEYNEEVESKKLTSGLNSTK 177

>Kwal_55.20089 s55 (245372..245941) [570 bp, 189 aa] {ON} YDR339C -
           Protein required for cell viability [contig 154] FULL
          Length = 189

 Score = 71.2 bits (173), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 78/143 (54%), Gaps = 13/143 (9%)

Query: 14  LVYNHNFKFREPYQVLVDDQIVCDTHKAAFDLVKGLKRTLQAEVKPMITQCCIQAIYETN 73
           L + +N   + PYQVL+D   +  + +   DLV+G+  TL A+  P+IT C +  + +  
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKIDLVRGMMDTLLAKCIPLITDCVMAELEKLG 110

Query: 74  DQE--AIELAKS--FERRRCNHPPKEAKPPLECLQSVVNVNGVNKHR-YVVATQNQEIRG 128
            +   A++LA+    +R  C+H    A    +CL     VN V +H+ Y+VAT +  ++ 
Sbjct: 111 PKYRIALKLARDPRIQRLSCSHKGTYAD---DCL-----VNRVLQHKCYIVATNDAALKQ 162

Query: 129 CLRKVPGVPLVFMNRSVMVMEPL 151
            +RKVPG+PL+ +     V+E L
Sbjct: 163 RIRKVPGIPLMSVGGHAYVIEKL 185

>KLTH0E02860g Chr5 (258370..258939) [570 bp, 189 aa] {ON} highly
           similar to uniprot|Q05498 Saccharomyces cerevisiae
           YDR339C Protein required for cell viability
          Length = 189

 Score = 70.9 bits (172), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 78/143 (54%), Gaps = 13/143 (9%)

Query: 14  LVYNHNFKFREPYQVLVDDQIVCDTHKAAFDLVKGLKRTLQAEVKPMITQCCIQAIYETN 73
           L + +N   + PYQVL+D   +  + +   D+V+G+  TL A+  PMIT C +  + +  
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDTLLAKCIPMITDCVMAELEKLG 110

Query: 74  DQE--AIELAKS--FERRRCNHPPKEAKPPLECLQSVVNVNGVNKHR-YVVATQNQEIRG 128
            +   A++LA+    +R  C+H    A    +CL     VN V +H+ Y+VAT +  ++ 
Sbjct: 111 PKYRIALKLARDPRIQRLTCSHKGTYAD---DCL-----VNRVLQHKCYIVATNDAGLKQ 162

Query: 129 CLRKVPGVPLVFMNRSVMVMEPL 151
            +RKVPG+PL+ +     V+E L
Sbjct: 163 RIRKVPGIPLMSVGGHAYVIEKL 185

>ZYRO0A06754g Chr1 (550964..551533) [570 bp, 189 aa] {ON} highly
           similar to uniprot|Q05498 Saccharomyces cerevisiae
           YDR339C Protein required for cell viability
          Length = 189

 Score = 69.7 bits (169), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 46/146 (31%), Positives = 77/146 (52%), Gaps = 13/146 (8%)

Query: 14  LVYNHNFKFREPYQVLVDDQIVCDTHKAAFDLVKGLKRTLQAEVKPMITQCCIQAIYETN 73
           L + +N   R PYQVL+D   +  + +   D+VKG+   L A+  P+IT C +  + +  
Sbjct: 51  LFFQYNQAIRPPYQVLIDTNFINFSIQKKIDIVKGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 74  DQE--AIELAKS--FERRRCNHPPKEAKPPLECLQSVVNVNGVNKHR-YVVATQNQEIRG 128
            +   A++LA+    +R  C H    A    +CL     VN V +H+ Y+VAT +  ++ 
Sbjct: 111 PKYRIALKLARDPRIKRLSCTHKGTYAD---DCL-----VNRVMQHKCYIVATNDAPLKQ 162

Query: 129 CLRKVPGVPLVFMNRSVMVMEPLSKA 154
            +RK+PG+PL+ +     V+E L  A
Sbjct: 163 RVRKIPGIPLMSVGGHSYVIEKLPDA 188

>TPHA0D02310 Chr4 complement(478545..479114) [570 bp, 189 aa] {ON}
           Anc_5.392 YDR339C
          Length = 189

 Score = 68.9 bits (167), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 44/143 (30%), Positives = 76/143 (53%), Gaps = 13/143 (9%)

Query: 14  LVYNHNFKFREPYQVLVDDQIVCDTHKAAFDLVKGLKRTLQAEVKPMITQCCIQAIYETN 73
           L +  N   R PYQVL+D   +  + +   D++KG+   L A+  P+IT C +  + +  
Sbjct: 51  LFFQFNEAIRPPYQVLIDTNFINFSIQKKIDIIKGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 74  DQE--AIELAKS--FERRRCNHPPKEAKPPLECLQSVVNVNGVNKHR-YVVATQNQEIRG 128
            +   A+ LA+    +R  C+H    A    +C+     VN V +H+ Y+VAT +Q ++ 
Sbjct: 111 PKYRIALRLARDPRIKRLSCSHKGTYAD---DCI-----VNRVLQHKCYIVATNDQGLKQ 162

Query: 129 CLRKVPGVPLVFMNRSVMVMEPL 151
            +RK+PG+PL+ +     V+E L
Sbjct: 163 RVRKIPGIPLMSVGGHAYVIEKL 185

>KNAG0C05270 Chr3 (1028377..1028946) [570 bp, 189 aa] {ON} Anc_5.392
           YDR339C
          Length = 189

 Score = 68.2 bits (165), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 44/143 (30%), Positives = 77/143 (53%), Gaps = 13/143 (9%)

Query: 14  LVYNHNFKFREPYQVLVDDQIVCDTHKAAFDLVKGLKRTLQAEVKPMITQCCIQAIYETN 73
           L + +N   + PYQVL+D   +  + +   D+V+G+   L A+  P+IT C I  + +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCNPLITDCVIAELEKLG 110

Query: 74  DQE--AIELAKS--FERRRCNHPPKEAKPPLECLQSVVNVNGVNKHR-YVVATQNQEIRG 128
            +   A++LA+    +R  C+H    A    +CL     VN V +H+ Y+VAT +  ++ 
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD---DCL-----VNRVLQHKCYIVATNDAGLKQ 162

Query: 129 CLRKVPGVPLVFMNRSVMVMEPL 151
            +RK+PG+PL+ +     V+E L
Sbjct: 163 RVRKIPGIPLMSVGGHAYVIEKL 185

>CAGL0M01056g Chr13 (117010..117579) [570 bp, 189 aa] {ON} highly
           similar to uniprot|Q05498 Saccharomyces cerevisiae
           YDR339c
          Length = 189

 Score = 67.8 bits (164), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 44/143 (30%), Positives = 76/143 (53%), Gaps = 13/143 (9%)

Query: 14  LVYNHNFKFREPYQVLVDDQIVCDTHKAAFDLVKGLKRTLQAEVKPMITQCCIQAIYETN 73
           L + +N   + PYQVL+D   +  + +   D+VKG+   L A+  P+IT C I  + +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVKGMMDCLLAKCNPLITDCVIAELEKLG 110

Query: 74  DQE--AIELAKS--FERRRCNHPPKEAKPPLECLQSVVNVNGVNKHR-YVVATQNQEIRG 128
            +   A++LA+    +R  C H    A    +C+     VN V +H+ Y+VAT +  ++ 
Sbjct: 111 PKYRIALKLARDPRIKRLTCTHKGTYAD---DCI-----VNRVLQHKCYIVATNDAGLKQ 162

Query: 129 CLRKVPGVPLVFMNRSVMVMEPL 151
            +RK+PG+PL+ +     V+E L
Sbjct: 163 RVRKIPGIPLMSVGGHAYVIEKL 185

>AEL102W Chr5 (436582..437151) [570 bp, 189 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR339C
          Length = 189

 Score = 67.4 bits (163), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 77/143 (53%), Gaps = 13/143 (9%)

Query: 14  LVYNHNFKFREPYQVLVDDQIVCDTHKAAFDLVKGLKRTLQAEVKPMITQCCIQAIYETN 73
           L + +N   + PYQVL+D   +  + +   DLV+G+   L A+  P+IT C +  + +  
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKIDLVRGMMDCLLAKCVPLITDCVMAELEKLG 110

Query: 74  DQE--AIELAKS--FERRRCNHPPKEAKPPLECLQSVVNVNGVNKHR-YVVATQNQEIRG 128
            +   A++LA+    +R  C+H    A    +CL     VN V +H+ Y+VAT +  ++ 
Sbjct: 111 PKYRIALKLARDPRIKRLNCSHKGTYAD---DCL-----VNRVLQHKCYIVATNDAGLKQ 162

Query: 129 CLRKVPGVPLVFMNRSVMVMEPL 151
            +RKVPG+PL+ +     V+E L
Sbjct: 163 RIRKVPGIPLMSVGGHSYVIEKL 185

>SAKL0G07766g Chr7 (652944..653513) [570 bp, 189 aa] {ON} highly
           similar to uniprot|Q05498 Saccharomyces cerevisiae
           YDR339C Protein required for cell viability
          Length = 189

 Score = 66.6 bits (161), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 44/143 (30%), Positives = 76/143 (53%), Gaps = 13/143 (9%)

Query: 14  LVYNHNFKFREPYQVLVDDQIVCDTHKAAFDLVKGLKRTLQAEVKPMITQCCIQAIYETN 73
           L + +N   + PYQVL+D   +  + +   D+V+G+   L A+  P+IT C +  + +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCVPLITDCVMAELEKLG 110

Query: 74  DQE--AIELAKS--FERRRCNHPPKEAKPPLECLQSVVNVNGVNKHR-YVVATQNQEIRG 128
            +   A+ LA+    +R  C+H    A    +CL     VN V +H+ Y+VAT +  ++ 
Sbjct: 111 PKYRIALRLARDPRIKRLNCSHKGTYAD---DCL-----VNRVLQHKCYIVATNDAALKQ 162

Query: 129 CLRKVPGVPLVFMNRSVMVMEPL 151
            +RKVPG+PL+ +     V+E L
Sbjct: 163 RIRKVPGIPLMSVGGHSYVIEKL 185

>KAFR0D04280 Chr4 (842029..842598) [570 bp, 189 aa] {ON} Anc_5.392
           YDR339C
          Length = 189

 Score = 66.6 bits (161), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 43/143 (30%), Positives = 77/143 (53%), Gaps = 13/143 (9%)

Query: 14  LVYNHNFKFREPYQVLVDDQIVCDTHKAAFDLVKGLKRTLQAEVKPMITQCCIQAIYETN 73
           L + +N   + PYQVL+D   +  + +   D+V+G+   L A+  P+IT C I  + +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCNPLITDCVIAELEKLG 110

Query: 74  DQE--AIELAKS--FERRRCNHPPKEAKPPLECLQSVVNVNGVNKHR-YVVATQNQEIRG 128
            +   A++LA+    +R  C+H    A    +C+     VN V +H+ Y+VAT +  ++ 
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD---DCI-----VNRVLQHKCYIVATNDAGLKQ 162

Query: 129 CLRKVPGVPLVFMNRSVMVMEPL 151
            +RK+PG+PL+ +     V+E L
Sbjct: 163 RVRKIPGIPLMSVGGHSYVIEKL 185

>NDAI0C04550 Chr3 complement(1031852..1032421) [570 bp, 189 aa] {ON}
           Anc_5.392
          Length = 189

 Score = 66.6 bits (161), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 43/143 (30%), Positives = 77/143 (53%), Gaps = 13/143 (9%)

Query: 14  LVYNHNFKFREPYQVLVDDQIVCDTHKAAFDLVKGLKRTLQAEVKPMITQCCIQAIYETN 73
           L + +N   + PYQVL+D   +  + +   DLV+G+   L A+  P+IT C +  + +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDLVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 74  DQE--AIELAKS--FERRRCNHPPKEAKPPLECLQSVVNVNGVNKHR-YVVATQNQEIRG 128
            +   A++LA+    +R  C+H    A    +C+     VN V +H+ Y+VAT +  ++ 
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD---DCI-----VNRVLQHKCYIVATNDAGLKQ 162

Query: 129 CLRKVPGVPLVFMNRSVMVMEPL 151
            +RK+PG+PL+ +     V+E L
Sbjct: 163 RVRKIPGIPLMSVGGHSYVIEKL 185

>Kpol_1055.18 s1055 complement(40805..41374) [570 bp, 189 aa] {ON}
           complement(40805..41374) [570 nt, 190 aa]
          Length = 189

 Score = 65.9 bits (159), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 43/143 (30%), Positives = 76/143 (53%), Gaps = 13/143 (9%)

Query: 14  LVYNHNFKFREPYQVLVDDQIVCDTHKAAFDLVKGLKRTLQAEVKPMITQCCIQAIYETN 73
           L + +N   + PYQVL+D   +  + +   D++KG+   L A+  P+IT C +  + +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIIKGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 74  DQE--AIELAKS--FERRRCNHPPKEAKPPLECLQSVVNVNGVNKHR-YVVATQNQEIRG 128
            +   A+ LA+    +R  C+H    A    +C+     VN V +H+ Y+VAT +  ++ 
Sbjct: 111 PKYRIALRLARDPRIKRLSCSHKGTYAD---DCI-----VNRVLQHKCYIVATNDVGLKQ 162

Query: 129 CLRKVPGVPLVFMNRSVMVMEPL 151
            +RKVPG+PL+ +     V+E L
Sbjct: 163 RIRKVPGIPLMSVGGHSYVIEKL 185

>Ecym_7469 Chr7 complement(956526..957095) [570 bp, 189 aa] {ON}
           similar to Ashbya gossypii AEL102W
          Length = 189

 Score = 65.9 bits (159), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 44/143 (30%), Positives = 77/143 (53%), Gaps = 13/143 (9%)

Query: 14  LVYNHNFKFREPYQVLVDDQIVCDTHKAAFDLVKGLKRTLQAEVKPMITQCCIQAIYETN 73
           L + +N   + PYQVL+D   +  + +   D+V+G+   L A+  P+IT C +  + +  
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCVPLITDCVMAELEKLG 110

Query: 74  DQE--AIELAKS--FERRRCNHPPKEAKPPLECLQSVVNVNGVNKHR-YVVATQNQEIRG 128
            +   A++LA+    +R  C+H    A    +CL     VN V +H+ Y+VAT +  ++ 
Sbjct: 111 PKYRIALKLARDPRIKRLTCSHRGTYAD---DCL-----VNRVLQHKCYIVATNDAGLKQ 162

Query: 129 CLRKVPGVPLVFMNRSVMVMEPL 151
            +RKVPG+PL+ +     V+E L
Sbjct: 163 RIRKVPGIPLLSVGGHSYVIEKL 185

>TDEL0E02330 Chr5 (455296..455865) [570 bp, 189 aa] {ON} Anc_5.392
           YDR339C
          Length = 189

 Score = 65.5 bits (158), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 43/146 (29%), Positives = 76/146 (52%), Gaps = 13/146 (8%)

Query: 14  LVYNHNFKFREPYQVLVDDQIVCDTHKAAFDLVKGLKRTLQAEVKPMITQCCIQAIYETN 73
           L + +N   + PYQVL+D   +  + +   DLV+G+   L A+  P+IT C +  + +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDLVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 74  DQE--AIELAKS--FERRRCNHPPKEAKPPLECLQSVVNVNGVNKHR-YVVATQNQEIRG 128
            +   A++LA+    +R  C H    A    +C+     VN V +H+ Y+VAT +  ++ 
Sbjct: 111 PKFRIALKLARDPRIKRLSCTHKGTYAD---DCI-----VNRVLQHKCYIVATNDAGLKQ 162

Query: 129 CLRKVPGVPLVFMNRSVMVMEPLSKA 154
            +RK+PG+PL+ +      +E L  A
Sbjct: 163 RVRKIPGIPLMSVGGHAYAIEKLPDA 188

>NCAS0F03090 Chr6 complement(616705..617274) [570 bp, 189 aa] {ON}
           Anc_5.392 YDR339C
          Length = 189

 Score = 65.5 bits (158), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 43/143 (30%), Positives = 76/143 (53%), Gaps = 13/143 (9%)

Query: 14  LVYNHNFKFREPYQVLVDDQIVCDTHKAAFDLVKGLKRTLQAEVKPMITQCCIQAIYETN 73
           L + +N   + PYQVL+D   +  + +   DLVKG+   L A+  P+IT C +  + +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDLVKGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 74  DQE--AIELAKS--FERRRCNHPPKEAKPPLECLQSVVNVNGVNKHR-YVVATQNQEIRG 128
            +   A+ LA+    +R  C+H    A    +C+     VN V +H+ ++VAT +  ++ 
Sbjct: 111 PKYRIALRLARDPRIKRLSCSHKGTYAD---DCI-----VNRVLQHKCFIVATNDAGLKQ 162

Query: 129 CLRKVPGVPLVFMNRSVMVMEPL 151
            +RK+PG+PL+ +     V+E L
Sbjct: 163 RVRKIPGIPLMSVGGHSYVIEKL 185

>Suva_2.509 Chr2 complement(907366..907935) [570 bp, 189 aa] {ON}
           YDR339C (REAL)
          Length = 189

 Score = 65.1 bits (157), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 42/143 (29%), Positives = 77/143 (53%), Gaps = 13/143 (9%)

Query: 14  LVYNHNFKFREPYQVLVDDQIVCDTHKAAFDLVKGLKRTLQAEVKPMITQCCIQAIYETN 73
           L + +N   + PYQVL+D   +  + +   D+V+G+   L A+  P+IT C +  + +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKVDIVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 74  DQE--AIELAKS--FERRRCNHPPKEAKPPLECLQSVVNVNGVNKHR-YVVATQNQEIRG 128
            +   A++LA+    +R  C+H    A    +CL     V+ V +H+ Y+VAT +  ++ 
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD---DCL-----VHRVLQHKCYIVATNDAGLKQ 162

Query: 129 CLRKVPGVPLVFMNRSVMVMEPL 151
            +RK+PG+PL+ +     V+E L
Sbjct: 163 RIRKIPGIPLMSVGGHAYVIEKL 185

>YDR339C Chr4 complement(1149951..1150520) [570 bp, 189 aa] {ON}
           FCF1Putative PINc domain nuclease required for early
           cleavages of 35S pre-rRNA and maturation of 18S rRNA;
           component of the SSU (small subunit) processome involved
           in 40S ribosomal subunit biogenesis; copurifies with
           Faf1p
          Length = 189

 Score = 65.1 bits (157), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 42/143 (29%), Positives = 77/143 (53%), Gaps = 13/143 (9%)

Query: 14  LVYNHNFKFREPYQVLVDDQIVCDTHKAAFDLVKGLKRTLQAEVKPMITQCCIQAIYETN 73
           L + +N   + PYQVL+D   +  + +   D+V+G+   L A+  P+IT C +  + +  
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKVDIVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 74  DQE--AIELAKS--FERRRCNHPPKEAKPPLECLQSVVNVNGVNKHR-YVVATQNQEIRG 128
            +   A++LA+    +R  C+H    A    +CL     V+ V +H+ Y+VAT +  ++ 
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD---DCL-----VHRVLQHKCYIVATNDAGLKQ 162

Query: 129 CLRKVPGVPLVFMNRSVMVMEPL 151
            +RK+PG+PL+ +     V+E L
Sbjct: 163 RIRKIPGIPLMSVGGHAYVIEKL 185

>Skud_4.606 Chr4 complement(1085976..1086545) [570 bp, 189 aa] {ON}
           YDR339C (REAL)
          Length = 189

 Score = 65.1 bits (157), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 42/143 (29%), Positives = 77/143 (53%), Gaps = 13/143 (9%)

Query: 14  LVYNHNFKFREPYQVLVDDQIVCDTHKAAFDLVKGLKRTLQAEVKPMITQCCIQAIYETN 73
           L + +N   + PYQVL+D   +  + +   D+V+G+   L A+  P+IT C +  + +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKVDIVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 74  DQE--AIELAKS--FERRRCNHPPKEAKPPLECLQSVVNVNGVNKHR-YVVATQNQEIRG 128
            +   A++LA+    +R  C+H    A    +CL     V+ V +H+ Y+VAT +  ++ 
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD---DCL-----VHRVLQHKCYIVATNDAGLKQ 162

Query: 129 CLRKVPGVPLVFMNRSVMVMEPL 151
            +RK+PG+PL+ +     V+E L
Sbjct: 163 RIRKIPGIPLMSVGGHAYVIEKL 185

>TBLA0H01750 Chr8 (408338..408907) [570 bp, 189 aa] {ON} Anc_5.392
           YDR339C
          Length = 189

 Score = 65.1 bits (157), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 42/143 (29%), Positives = 77/143 (53%), Gaps = 13/143 (9%)

Query: 14  LVYNHNFKFREPYQVLVDDQIVCDTHKAAFDLVKGLKRTLQAEVKPMITQCCIQAIYETN 73
           L + +N   + PYQVL+D   +  + +   D+V+G+   L A+  P+IT C +  + +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCNPLITDCVVAELEKLG 110

Query: 74  DQE--AIELAKS--FERRRCNHPPKEAKPPLECLQSVVNVNGVNKHR-YVVATQNQEIRG 128
            +   A++LA+    +R  C+H    A    +C+     VN V +H+ Y+VAT +  ++ 
Sbjct: 111 PKFRIALKLARDPRIKRLSCSHRGTYAD---DCI-----VNRVLQHKCYIVATNDAGLKQ 162

Query: 129 CLRKVPGVPLVFMNRSVMVMEPL 151
            +RK+PG+PL+ +     V+E L
Sbjct: 163 RVRKIPGIPLMSVGGHSYVVEKL 185

>Smik_4.599 Chr4 complement(1076379..1076948) [570 bp, 189 aa] {ON}
           YDR339C (REAL)
          Length = 189

 Score = 64.7 bits (156), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 42/143 (29%), Positives = 77/143 (53%), Gaps = 13/143 (9%)

Query: 14  LVYNHNFKFREPYQVLVDDQIVCDTHKAAFDLVKGLKRTLQAEVKPMITQCCIQAIYETN 73
           L + +N   + PYQVL+D   +  + +   D+V+G+   L A+  P+IT C +  + +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKVDIVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 74  DQE--AIELAKS--FERRRCNHPPKEAKPPLECLQSVVNVNGVNKHR-YVVATQNQEIRG 128
            +   A++LA+    +R  C+H    A    +CL     V+ V +H+ Y+VAT +  ++ 
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD---DCL-----VHRVLQHKCYIVATNDAGLKQ 162

Query: 129 CLRKVPGVPLVFMNRSVMVMEPL 151
            +RK+PG+PL+ +     V+E L
Sbjct: 163 RIRKIPGIPLMSVGGHAYVIEKL 185

>KLLA0A07018g Chr1 complement(632523..633092) [570 bp, 189 aa] {ON}
           highly similar to uniprot|Q05498 Saccharomyces
           cerevisiae YDR339C Protein required for cell viability
          Length = 189

 Score = 61.2 bits (147), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 42/143 (29%), Positives = 76/143 (53%), Gaps = 13/143 (9%)

Query: 14  LVYNHNFKFREPYQVLVDDQIVCDTHKAAFDLVKGLKRTLQAEVKPMITQCCIQAIYETN 73
           L + +N   + PYQVL+D   +  + +   D+VKG+   L A+   +IT C +  + +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVKGMMDCLLAKCNILITDCVMAELEKLG 110

Query: 74  DQE--AIELAKS--FERRRCNHPPKEAKPPLECLQSVVNVNGVNKHR-YVVATQNQEIRG 128
            +   A++LA+    +R  C+H    A    +C+     V+ V +H+ Y+VAT +  ++ 
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD---DCI-----VHRVLQHKCYIVATNDAGLKQ 162

Query: 129 CLRKVPGVPLVFMNRSVMVMEPL 151
            +RKVPG+PL+ +     V+E L
Sbjct: 163 RVRKVPGIPLMSVGGHSYVIEKL 185

>Kwal_26.8361 s26 complement(754178..754912) [735 bp, 244 aa] {ON}
           YMR038C (LYS7) - copper chaperone for superoxide
           dismutase Sod1p [contig 59] FULL
          Length = 244

 Score = 29.6 bits (65), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 16/63 (25%), Positives = 34/63 (53%), Gaps = 3/63 (4%)

Query: 124 QEIRGCLRKVPGVPLVF-MNRSVMVMEPLSKASQNVSRVQE--REKLFKGLNDPKFAGLP 180
           Q+I+ CL  +PG+ L F +   ++ ++  +  S  +S +Q+  R+ + +G   P  A + 
Sbjct: 25  QDIKSCLASIPGISLDFHVPEKLLAVKGTAAPSVIISTLQKCGRDAIIRGTGKPNSAAVS 84

Query: 181 LTE 183
           + E
Sbjct: 85  ILE 87

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.127    0.356 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 25,220,678
Number of extensions: 914041
Number of successful extensions: 2272
Number of sequences better than 10.0: 44
Number of HSP's gapped: 2280
Number of HSP's successfully gapped: 44
Length of query: 274
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 166
Effective length of database: 41,097,471
Effective search space: 6822180186
Effective search space used: 6822180186
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 65 (29.6 bits)