Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_56.22396na 1ON2102109711e-135
KLTH0C11374gna 1ON2052161529e-12
KLLA0B01848g6.242ON66929683.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_56.22396
         (210 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_56.22396 s56 (110070..110702) [633 bp, 210 aa] {ON} [contig...   378   e-135
KLTH0C11374g Chr3 complement(935901..936518) [618 bp, 205 aa] {O...    63   9e-12
KLLA0B01848g Chr2 (159037..161046) [2010 bp, 669 aa] {ON} simila...    31   3.0  

>Kwal_56.22396 s56 (110070..110702) [633 bp, 210 aa] {ON} [contig
           185] FULL
          Length = 210

 Score =  378 bits (971), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 189/210 (90%), Positives = 189/210 (90%)

Query: 1   MIPYPTRDSDDFSLTDFRPAENXXXXXXXXXXXXAEPARVQRTQIRKISNPYEDSVGTRR 60
           MIPYPTRDSDDFSLTDFRPAEN            AEPARVQRTQIRKISNPYEDSVGTRR
Sbjct: 1   MIPYPTRDSDDFSLTDFRPAENRRRRGRSMGDSRAEPARVQRTQIRKISNPYEDSVGTRR 60

Query: 61  HLQVSSLPLEVPSYARAKIGKKLEPVAVPREYALHSTSSREDDESTLLVDSGDKISTRQE 120
           HLQVSSLPLEVPSYARAKIGKKLEPVAVPREYALHSTSSREDDESTLLVDSGDKISTRQE
Sbjct: 61  HLQVSSLPLEVPSYARAKIGKKLEPVAVPREYALHSTSSREDDESTLLVDSGDKISTRQE 120

Query: 121 RKQMPVEAVVHQFSQPVVPLEFAPVMQPVEQIAETFFSMGADKNALSTVMFSGGGSIKII 180
           RKQMPVEAVVHQFSQPVVPLEFAPVMQPVEQIAETFFSMGADKNALSTVMFSGGGSIKII
Sbjct: 121 RKQMPVEAVVHQFSQPVVPLEFAPVMQPVEQIAETFFSMGADKNALSTVMFSGGGSIKII 180

Query: 181 WIXXXXXXXXXFDSLSSRLIESIKEKSGLN 210
           WI         FDSLSSRLIESIKEKSGLN
Sbjct: 181 WILALAVAVLLFDSLSSRLIESIKEKSGLN 210

>KLTH0C11374g Chr3 complement(935901..936518) [618 bp, 205 aa] {ON}
           conserved hypothetical protein
          Length = 205

 Score = 63.2 bits (152), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 64/216 (29%), Positives = 101/216 (46%), Gaps = 17/216 (7%)

Query: 1   MIPYPTRDSDDFSLTDFRPAENXXXXXXXXXXXXAEPARVQRTQIRKISNPY---EDSVG 57
           MIPYPTRD+DDFSLTDFR   +             E +   R +++  +  +   E S G
Sbjct: 1   MIPYPTRDTDDFSLTDFRSRGSGGGQKQAKYVAETEISAPVRRELKPKAIAHARREPSWG 60

Query: 58  TRRHLQVSSLPLEVPSYARAKIGKKLEP-VAVPREYALHSTSSREDDESTLLVDSGDKIS 116
           T   L+  + P+E   Y R+   +  EP +A  R+ +   T +  DD +  L+D+GDKI 
Sbjct: 61  T---LEGGTAPVETNIYLRSLAHESDEPNLAAERKRSKGDTFAINDDST--LLDTGDKIV 115

Query: 117 TRQERKQMPVEAVVHQFSQPVVPLE-FAPVMQPVEQIAETFFSMGADKNALSTVMFSGGG 175
            RQ +  +  E V    S  V+    F P  + ++  ++    +      L   M   G 
Sbjct: 116 ARQ-KADVRTECVQQWRSTDVIHANRFLPQKRQLQVTSKRSAPL-----TLKAPMIHQGD 169

Query: 176 SI-KIIWIXXXXXXXXXFDSLSSRLIESIKEKSGLN 210
           ++ KI+           F+S+SS+LI  IK  +GL+
Sbjct: 170 TLKKILLTFALLITVLTFESMSSKLINIIKASTGLS 205

>KLLA0B01848g Chr2 (159037..161046) [2010 bp, 669 aa] {ON} similar
           to uniprot|Q08968 Saccharomyces cerevisiae YPL222W FMP40
           The authentic non-tagged protein was localized to the
           mitochondria
          Length = 669

 Score = 30.8 bits (68), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 17/29 (58%)

Query: 76  RAKIGKKLEPVAVPREYALHSTSSREDDE 104
           R KI K+  P+ +PR Y L S ++   DE
Sbjct: 578 RVKIAKQFNPLFIPRNYILESVANHYTDE 606

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.130    0.362 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 19,043,760
Number of extensions: 691911
Number of successful extensions: 1385
Number of sequences better than 10.0: 14
Number of HSP's gapped: 1381
Number of HSP's successfully gapped: 14
Length of query: 210
Length of database: 53,481,399
Length adjustment: 105
Effective length of query: 105
Effective length of database: 41,441,469
Effective search space: 4351354245
Effective search space used: 4351354245
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 63 (28.9 bits)