Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_56.223876.14ON54354326900.0
KLTH0C11396g6.14ON55051121490.0
SAKL0E01012g6.14ON54452319810.0
KLLA0D00979g6.14ON56149518340.0
TDEL0G045506.14ON56448217030.0
Smik_5.276.14ON60848617020.0
Skud_5.296.14ON60848616920.0
YEL060C (PRB1)6.14ON63548616940.0
Suva_5.76.14ON66448616700.0
ACR012C6.14ON54148416290.0
TBLA0A073006.14ON57346516180.0
NCAS0F002206.14ON69548216020.0
NDAI0K028806.14ON70449815730.0
ZYRO0C07942g6.14ON54849715420.0
Kpol_1032.56.14ON68050415330.0
Ecym_30186.14ON57547215040.0
CAGL0B03619g6.14ON46847414770.0
KNAG0E009206.14ON53146114490.0
KAFR0L003606.14ON50243414440.0
Kpol_1045.756.14ON47742113540.0
TPHA0M002306.14ON58547313311e-178
Smik_15.1726.14ON47841912951e-175
YOR003W (YSP3)6.14ON47841712921e-174
Suva_15.1786.14ON47641912851e-173
Skud_15.1646.14ON48241812631e-170
CAGL0E02651g6.14ON48541711501e-152
KAFR0B065506.14ON45641910281e-135
NCAS0D026306.14ON4514339501e-123
NDAI0I022806.14ON4824288671e-110
KNAG0F02970singletonON4203778581e-109
CAGL0L13266gsingletonON5794377466e-91
NCAS0D043906.313ON4923644928e-55
ZYRO0D08822g6.313ON4904174848e-54
TDEL0A072806.313ON4363874819e-54
SAKL0A02002g6.313ON4793744794e-53
Kpol_1018.56.313ON4654284776e-53
KNAG0I024706.313ON4754094742e-52
Kpol_1028.616.313ON5183294753e-52
TBLA0F039706.313ON7343774829e-52
Smik_3.1496.313ON4913204664e-51
CAGL0L10802g6.313ON5173484622e-50
Suva_3.846.313ON5273244623e-50
KLTH0A06094g6.313ON4963884594e-50
Skud_3.1246.313ON5403204606e-50
YCR045C (RRT12)6.313ON4913204551e-49
Ecym_21056.313ON6103244489e-48
KAFR0J024506.313ON4783684383e-47
NDAI0I005606.313ON4833974365e-47
AAR069W6.313ON7683004432e-46
Kwal_23.61836.313ON4934394288e-46
TPHA0D037606.313ON6073184153e-43
KLLA0F06028g6.313ON5083314008e-42
TBLA0A067006.313ON4972583471e-34
Kwal_33.133721.78ON3772933367e-34
KLTH0F02288g1.78ON3803253332e-33
Kpol_2000.691.78ON3863132962e-28
ZYRO0F16764g1.78ON3863422619e-24
TDEL0C062301.78ON3643052422e-21
TPHA0B045201.78ON3882722263e-19
TBLA0A054101.78ON3822812006e-16
Skud_14.1012.6ON81969820.21
NCAS0F004905.85ON98763790.49
YNL238W (KEX2)2.6ON81466790.52
Suva_14.1062.6ON80966790.58
ZYRO0F15598g2.6ON79065780.74
SAKL0G00440g2.6ON83665780.78
Smik_14.972.6ON81466761.1
TPHA0P017902.6ON79960761.3
KAFR0A080402.6ON76665751.4
NDAI0F038902.6ON83368751.5
NDAI0D026205.85ON98747751.9
KNAG0F007702.6ON82665742.1
KNAG0K005805.85ON98956742.2
Kpol_1050.725.85ON98933732.8
TPHA0A052005.85ON99150723.5
NCAS0A008802.6ON83368723.7
ZYRO0B08140g5.85ON98447714.5
TBLA0D027108.481ON58234714.6
Ecym_64862.6ON78165714.8
KAFR0F012706.241aON99359705.9
Kpol_1015.82.6ON84365706.7
TDEL0G010905.85ON98341707.1
CAGL0J07546g2.6ON78961707.3
KLTH0H00418g2.6ON81165698.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_56.22387
         (543 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_56.22387 s56 (107327..108958) [1632 bp, 543 aa] {ON} YEL060...  1040   0.0  
KLTH0C11396g Chr3 complement(936878..938530) [1653 bp, 550 aa] {...   832   0.0  
SAKL0E01012g Chr5 (75498..77132) [1635 bp, 544 aa] {ON} similar ...   767   0.0  
KLLA0D00979g Chr4 (86703..88388) [1686 bp, 561 aa] {ON} similar ...   711   0.0  
TDEL0G04550 Chr7 complement(829468..831162) [1695 bp, 564 aa] {O...   660   0.0  
Smik_5.27 Chr5 complement(42408..44234) [1827 bp, 608 aa] {ON} Y...   660   0.0  
Skud_5.29 Chr5 complement(39160..40986) [1827 bp, 608 aa] {ON} Y...   656   0.0  
YEL060C Chr5 complement(40046..41953) [1908 bp, 635 aa] {ON}  PR...   657   0.0  
Suva_5.7 Chr5 complement(15849..17843) [1995 bp, 664 aa] {ON} YE...   647   0.0  
ACR012C Chr3 complement(378750..380375) [1626 bp, 541 aa] {ON} S...   632   0.0  
TBLA0A07300 Chr1 complement(1815683..1817404) [1722 bp, 573 aa] ...   627   0.0  
NCAS0F00220 Chr6 (32791..34878) [2088 bp, 695 aa] {ON} Anc_6.14 ...   621   0.0  
NDAI0K02880 Chr11 complement(651446..653560) [2115 bp, 704 aa] {...   610   0.0  
ZYRO0C07942g Chr3 complement(605044..606690) [1647 bp, 548 aa] {...   598   0.0  
Kpol_1032.5 s1032 (6368..8410) [2043 bp, 680 aa] {ON} (6368..841...   595   0.0  
Ecym_3018 Chr3 (33738..35465) [1728 bp, 575 aa] {ON} similar to ...   583   0.0  
CAGL0B03619g Chr2 (361572..362978) [1407 bp, 468 aa] {ON} simila...   573   0.0  
KNAG0E00920 Chr5 complement(174432..176027) [1596 bp, 531 aa] {O...   562   0.0  
KAFR0L00360 Chr12 (64781..66289) [1509 bp, 502 aa] {ON} Anc_6.14...   560   0.0  
Kpol_1045.75 s1045 complement(174970..176403) [1434 bp, 477 aa] ...   526   0.0  
TPHA0M00230 Chr13 (45121..46878) [1758 bp, 585 aa] {ON} Anc_6.14...   517   e-178
Smik_15.172 Chr15 (298772..300208) [1437 bp, 478 aa] {ON} YOR003...   503   e-175
YOR003W Chr15 (331455..332891) [1437 bp, 478 aa] {ON}  YSP3Putat...   502   e-174
Suva_15.178 Chr15 (305907..307337) [1431 bp, 476 aa] {ON} YOR003...   499   e-173
Skud_15.164 Chr15 (291471..292919) [1449 bp, 482 aa] {ON} YOR003...   491   e-170
CAGL0E02651g Chr5 (251868..253325) [1458 bp, 485 aa] {ON} simila...   447   e-152
KAFR0B06550 Chr2 (1359770..1361140) [1371 bp, 456 aa] {ON} Anc_6...   400   e-135
NCAS0D02630 Chr4 (506222..507577) [1356 bp, 451 aa] {ON} Anc_6.14     370   e-123
NDAI0I02280 Chr9 complement(519169..520617) [1449 bp, 482 aa] {O...   338   e-110
KNAG0F02970 Chr6 (563666..564928) [1263 bp, 420 aa] {ON}              335   e-109
CAGL0L13266g Chr12 (1418408..1420147) [1740 bp, 579 aa] {ON} som...   291   6e-91
NCAS0D04390 Chr4 complement(836796..838274) [1479 bp, 492 aa] {O...   194   8e-55
ZYRO0D08822g Chr4 (754340..755812) [1473 bp, 490 aa] {ON} simila...   191   8e-54
TDEL0A07280 Chr1 complement(1276408..1277718) [1311 bp, 436 aa] ...   189   9e-54
SAKL0A02002g Chr1 (176105..177544) [1440 bp, 479 aa] {ON} simila...   189   4e-53
Kpol_1018.5 s1018 (14365..15762) [1398 bp, 465 aa] {ON} (14365.....   188   6e-53
KNAG0I02470 Chr9 complement(479068..480495) [1428 bp, 475 aa] {O...   187   2e-52
Kpol_1028.61 s1028 (138312..139868) [1557 bp, 518 aa] {ON} (1383...   187   3e-52
TBLA0F03970 Chr6 complement(985334..987538) [2205 bp, 734 aa] {O...   190   9e-52
Smik_3.149 Chr3 complement(206258..207733) [1476 bp, 491 aa] {ON...   184   4e-51
CAGL0L10802g Chr12 complement(1159230..1160783) [1554 bp, 517 aa...   182   2e-50
Suva_3.84 Chr3 complement(121533..123116) [1584 bp, 527 aa] {ON}...   182   3e-50
KLTH0A06094g Chr1 complement(513667..515157) [1491 bp, 496 aa] {...   181   4e-50
Skud_3.124 Chr3 complement(192464..194086) [1623 bp, 540 aa] {ON...   181   6e-50
YCR045C Chr3 complement(208135..209610) [1476 bp, 491 aa] {ON}  ...   179   1e-49
Ecym_2105 Chr2 (185014..186846) [1833 bp, 610 aa] {ON} similar t...   177   9e-48
KAFR0J02450 Chr10 complement(469452..470888) [1437 bp, 478 aa] {...   173   3e-47
NDAI0I00560 Chr9 (114935..116386) [1452 bp, 483 aa] {ON} Anc_6.313    172   5e-47
AAR069W Chr1 (460781..463087) [2307 bp, 768 aa] {ON} Syntenic ho...   175   2e-46
Kwal_23.6183 s23 complement(1485143..1486624) [1482 bp, 493 aa] ...   169   8e-46
TPHA0D03760 Chr4 complement(792115..793938) [1824 bp, 607 aa] {O...   164   3e-43
KLLA0F06028g Chr6 (576687..578213) [1527 bp, 508 aa] {ON} some s...   158   8e-42
TBLA0A06700 Chr1 (1634983..1636476) [1494 bp, 497 aa] {ON} Anc_6...   138   1e-34
Kwal_33.13372 s33 (190864..191997) [1134 bp, 377 aa] {ON} YCR045...   134   7e-34
KLTH0F02288g Chr6 (186895..188037) [1143 bp, 380 aa] {ON} weakly...   132   2e-33
Kpol_2000.69 s2000 complement(151054..152214) [1161 bp, 386 aa] ...   118   2e-28
ZYRO0F16764g Chr6 complement(1390437..1391597) [1161 bp, 386 aa]...   105   9e-24
TDEL0C06230 Chr3 complement(1135740..1136834) [1095 bp, 364 aa] ...    98   2e-21
TPHA0B04520 Chr2 complement(1065861..1067027) [1167 bp, 388 aa] ...    92   3e-19
TBLA0A05410 Chr1 (1328472..1329620) [1149 bp, 382 aa] {ON} Anc_1...    82   6e-16
Skud_14.101 Chr14 (191111..193570) [2460 bp, 819 aa] {ON} YNL238...    36   0.21 
NCAS0F00490 Chr6 (89926..92889) [2964 bp, 987 aa] {ON} Anc_5.85 ...    35   0.49 
YNL238W Chr14 (202428..204872) [2445 bp, 814 aa] {ON}  KEX2Subti...    35   0.52 
Suva_14.106 Chr14 (196428..198857) [2430 bp, 809 aa] {ON} YNL238...    35   0.58 
ZYRO0F15598g Chr6 complement(1278928..1281300) [2373 bp, 790 aa]...    35   0.74 
SAKL0G00440g Chr7 (41016..43526) [2511 bp, 836 aa] {ON} similar ...    35   0.78 
Smik_14.97 Chr14 (181672..184116) [2445 bp, 814 aa] {ON} YNL238W...    34   1.1  
TPHA0P01790 Chr16 complement(373247..375646) [2400 bp, 799 aa] {...    34   1.3  
KAFR0A08040 Chr1 complement(1609550..1611850) [2301 bp, 766 aa] ...    33   1.4  
NDAI0F03890 Chr6 complement(921561..924062) [2502 bp, 833 aa] {O...    33   1.5  
NDAI0D02620 Chr4 complement(606774..609737) [2964 bp, 987 aa] {O...    33   1.9  
KNAG0F00770 Chr6 (137641..140121) [2481 bp, 826 aa] {ON} Anc_2.6...    33   2.1  
KNAG0K00580 Chr11 complement(101850..104819) [2970 bp, 989 aa] {...    33   2.2  
Kpol_1050.72 s1050 complement(157470..160439) [2970 bp, 989 aa] ...    33   2.8  
TPHA0A05200 Chr1 complement(1168851..1171826) [2976 bp, 991 aa] ...    32   3.5  
NCAS0A00880 Chr1 (173726..176227) [2502 bp, 833 aa] {ON} Anc_2.6...    32   3.7  
ZYRO0B08140g Chr2 (635368..638322) [2955 bp, 984 aa] {ON} highly...    32   4.5  
TBLA0D02710 Chr4 (669879..671627) [1749 bp, 582 aa] {ON} Anc_8.4...    32   4.6  
Ecym_6486 Chr6 complement(941694..944039) [2346 bp, 781 aa] {ON}...    32   4.8  
KAFR0F01270 Chr6 (243255..246236) [2982 bp, 993 aa] {ON}               32   5.9  
Kpol_1015.8 s1015 complement(19725..20576,20692..20940,20990..20...    32   6.7  
TDEL0G01090 Chr7 (223036..225987) [2952 bp, 983 aa] {ON} Anc_5.8...    32   7.1  
CAGL0J07546g Chr10 complement(733686..736055) [2370 bp, 789 aa] ...    32   7.3  
KLTH0H00418g Chr8 (46022..48457) [2436 bp, 811 aa] {ON} similar ...    31   8.9  

>Kwal_56.22387 s56 (107327..108958) [1632 bp, 543 aa] {ON} YEL060C
           (PRB1) - vacuolar protease B [contig 185] FULL
          Length = 543

 Score = 1040 bits (2690), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 510/543 (93%), Positives = 510/543 (93%)

Query: 1   MKLQTTXXXXXXXXXXXXXXXXXXXXXSKDALVAVEETAASLGESILSSFSKEVTKKAAE 60
           MKLQTT                     SKDALVAVEETAASLGESILSSFSKEVTKKAAE
Sbjct: 1   MKLQTTLPVAMVAALASALVLPEVEEASKDALVAVEETAASLGESILSSFSKEVTKKAAE 60

Query: 61  SGAGVTLSPLVTARNMYDAIPHRYIVVFKDRVLPEEVDFHMEVVSEAHAQSVGKLDANDA 120
           SGAGVTLSPLVTARNMYDAIPHRYIVVFKDRVLPEEVDFHMEVVSEAHAQSVGKLDANDA
Sbjct: 61  SGAGVTLSPLVTARNMYDAIPHRYIVVFKDRVLPEEVDFHMEVVSEAHAQSVGKLDANDA 120

Query: 121 FFEATMDEEMGIMATSREGGILDSFDVNGMLRGYIGYFTQEIVDFIRMNPLVAFVEQDSM 180
           FFEATMDEEMGIMATSREGGILDSFDVNGMLRGYIGYFTQEIVDFIRMNPLVAFVEQDSM
Sbjct: 121 FFEATMDEEMGIMATSREGGILDSFDVNGMLRGYIGYFTQEIVDFIRMNPLVAFVEQDSM 180

Query: 181 VYANEFDTQNGAPWGLSRISHREKLNLGSFNKYLYDDAAGKGVTSYVIDTGINIDHKDFE 240
           VYANEFDTQNGAPWGLSRISHREKLNLGSFNKYLYDDAAGKGVTSYVIDTGINIDHKDFE
Sbjct: 181 VYANEFDTQNGAPWGLSRISHREKLNLGSFNKYLYDDAAGKGVTSYVIDTGINIDHKDFE 240

Query: 241 GRAAWGKTVPTNDLDQDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVV 300
           GRAAWGKTVPTNDLDQDGNGHGTHCAGTIASKHYG            LRSNGSGSMSDVV
Sbjct: 241 GRAAWGKTVPTNDLDQDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGSMSDVV 300

Query: 301 KGVEFAAKSHQDAVKKNKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNEN 360
           KGVEFAAKSHQDAVKKNKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNEN
Sbjct: 301 KGVEFAAKSHQDAVKKNKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNEN 360

Query: 361 QDACNSSPAAAENAITVGASTLADDRAYFSNWGKCVDIFAPGLNVLSTYIGSETATATLS 420
           QDACNSSPAAAENAITVGASTLADDRAYFSNWGKCVDIFAPGLNVLSTYIGSETATATLS
Sbjct: 361 QDACNSSPAAAENAITVGASTLADDRAYFSNWGKCVDIFAPGLNVLSTYIGSETATATLS 420

Query: 421 GTSMASPHVAGLLTYFLSLQPDSDSEYFHAAGGITPSQLKKKLIAYSTKNALGDLPEDTV 480
           GTSMASPHVAGLLTYFLSLQPDSDSEYFHAAGGITPSQLKKKLIAYSTKNALGDLPEDTV
Sbjct: 421 GTSMASPHVAGLLTYFLSLQPDSDSEYFHAAGGITPSQLKKKLIAYSTKNALGDLPEDTV 480

Query: 481 NYLIYNGGGQDLDDFWVKDLEEKVADAKDNTASEFESIIDALEEKTDGLYEEIREIFEGL 540
           NYLIYNGGGQDLDDFWVKDLEEKVADAKDNTASEFESIIDALEEKTDGLYEEIREIFEGL
Sbjct: 481 NYLIYNGGGQDLDDFWVKDLEEKVADAKDNTASEFESIIDALEEKTDGLYEEIREIFEGL 540

Query: 541 NII 543
           NII
Sbjct: 541 NII 543

>KLTH0C11396g Chr3 complement(936878..938530) [1653 bp, 550 aa] {ON}
           similar to uniprot|P09232 Saccharomyces cerevisiae
           YEL060C PRB1 Vacuolar proteinase B (yscB) a serine
           protease of the subtilisin family involved in protein
           degradation in the vacuole and required for full protein
           degradation during sporulation
          Length = 550

 Score =  832 bits (2149), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/511 (79%), Positives = 441/511 (86%), Gaps = 12/511 (2%)

Query: 43  GESILSSFSKEVTKKAAESGAGVTLSPLVTARNMYDAIPHRYIVVFKDRVLPEEVDFHME 102
           GESI+SSFSK++TK AA  G  V LSPLV++   Y AIPHRYIVVFK  + PEEVDFH +
Sbjct: 42  GESIVSSFSKQMTKDAASKGESVELSPLVSSSGKYLAIPHRYIVVFKQNLSPEEVDFHKQ 101

Query: 103 VVSEAHAQSVGKLDANDAFFEAT----------MDEEMGIMATSREGGILDSFDVNGMLR 152
           +VSEAH QSV KL++   FF +T          +D +    A +REGGI DSFDV+G+L 
Sbjct: 102 IVSEAHLQSVAKLESTHEFFTSTENFVEDRDFELDYQRSFSAQTREGGIQDSFDVSGLLT 161

Query: 153 GYIGYFTQEIVDFIRMNPLVAFVEQDSMVYANEFDTQNGAPWGLSRISHREKLNLGSFNK 212
           GYIGYFT EIVDFIRMNPLV FVEQDS+V+A EF TQNGAPWGLSRISHREKLNLGSFNK
Sbjct: 162 GYIGYFTDEIVDFIRMNPLVDFVEQDSVVFAQEFGTQNGAPWGLSRISHREKLNLGSFNK 221

Query: 213 YLYDDAAGKGVTSYVIDTGINIDHKDFEGRAAWGKTVPTNDLDQDGNGHGTHCAGTIASK 272
           YLYDD AGKGVTSYVIDTG+N+DHKDFEGRA+WGKT+PTNDLDQDGNGHGTHCAGTIASK
Sbjct: 222 YLYDDDAGKGVTSYVIDTGVNVDHKDFEGRASWGKTIPTNDLDQDGNGHGTHCAGTIASK 281

Query: 273 HYGXXXXXXXXXXXXLRSNGSGSMSDVVKGVEFAAKSHQDAVKKNKKGFKGSTANMSLGG 332
           HYG            LRSNGSGSMSDVVKGVEFAAKSHQDAVK+NKKGFKGSTANMSLGG
Sbjct: 282 HYGVAKNANVVAVKVLRSNGSGSMSDVVKGVEFAAKSHQDAVKENKKGFKGSTANMSLGG 341

Query: 333 GKSPALDMAVNAAVKAGIHFAVAAGNENQDACNSSPAAAENAITVGASTLADDRAYFSNW 392
           GKSPALDMAVNAAVKAGIHFAVAAGNENQDACNSSPA+AENA+TVGASTLADDRAYFSNW
Sbjct: 342 GKSPALDMAVNAAVKAGIHFAVAAGNENQDACNSSPASAENAVTVGASTLADDRAYFSNW 401

Query: 393 GKCVDIFAPGLNVLSTYIGSETATATLSGTSMASPHVAGLLTYFLSLQPDSDSEYFHAAG 452
           GKCVDIFAPGLNVLSTYIGS+TATATLSGTSMASPHVAGLLTYFLSLQPDSDSEYFHAAG
Sbjct: 402 GKCVDIFAPGLNVLSTYIGSDTATATLSGTSMASPHVAGLLTYFLSLQPDSDSEYFHAAG 461

Query: 453 GITPSQLKKKLIAYSTKNALGDLPEDTVNYLIYNGGGQDLDDFWVKDLEEKVADAKDNTA 512
           GITPSQLKKKLIAYSTKN LGD+P+DTVNYLI+NGGG+ LDDFW K  E  V + +D  +
Sbjct: 462 GITPSQLKKKLIAYSTKNVLGDIPDDTVNYLIFNGGGEGLDDFWGK--ESVVDEVEDTIS 519

Query: 513 SEFESIIDALEEKTDGLYEEIREIFEGLNII 543
           SE ES IDALEEKTD LYEEIRE+F+ +NII
Sbjct: 520 SEIESFIDALEEKTDVLYEEIREVFDHMNII 550

>SAKL0E01012g Chr5 (75498..77132) [1635 bp, 544 aa] {ON} similar to
           uniprot|P09232 Saccharomyces cerevisiae YEL060C PRB1
           Vacuolar proteinase B (yscB) a serine protease of the
           subtilisin family involved in protein degradation in the
           vacuole and required for full protein degradation during
           sporulation
          Length = 544

 Score =  767 bits (1981), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/523 (72%), Positives = 433/523 (82%), Gaps = 14/523 (2%)

Query: 28  SKDALVAVEETAASLGESILSSFSKEVTKKAAESGAGVTLSPLVTARNMYDAIPHRYIVV 87
           SKD  V+V+E  +   + +L+SF+KE+T+ AAE G  V L+PLV++    + IPHRYI+V
Sbjct: 29  SKD--VSVKEINSD-SQEVLASFAKEITRAAAEKGEEVKLAPLVSSPQPANIIPHRYIIV 85

Query: 88  FKDRVLPEEVDFHMEVVSEAHAQSVGKLDANDAFFEATMD--EEMGIMATSREGGILDSF 145
           FK    PEE+ FH E++SEAHA+SV KLD+ D+FF AT    +E GI A S EGGI +SF
Sbjct: 86  FKKDATPEEISFHKEIISEAHAESVAKLDSKDSFFAATKGSADEYGIAAKSSEGGIQESF 145

Query: 146 DVNGMLRGYIGYFTQEIVDFIRMNPLVAFVEQDSMVYANEFDTQNGAPWGLSRISHREKL 205
           D+  ML GYIGYFT E+VDFIRMN  V F+E+DS+V+A+EFDTQNGAPWGLSRISHRE+L
Sbjct: 146 DIANMLNGYIGYFTDEVVDFIRMNQWVEFIEKDSLVFASEFDTQNGAPWGLSRISHRERL 205

Query: 206 NLGSFNKYLYDDAAGKGVTSYVIDTGINIDHKDFEGRAAWGKTVPTNDLDQDGNGHGTHC 265
           NLGSFNKYLYDD AGKGVTSYVIDTGIN++HKDF GRA WGKTVP ND D DGNGHGTHC
Sbjct: 206 NLGSFNKYLYDDDAGKGVTSYVIDTGINVNHKDFNGRAVWGKTVPQNDEDADGNGHGTHC 265

Query: 266 AGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVVKGVEFAAKSHQDAVKKNKKGFKGST 325
           AGTIAS+HYG            LRSNGSG+MSDVVKGVEFAA+SHQ+A KKNKKGFKGST
Sbjct: 266 AGTIASEHYGVAKNAEVVAIKVLRSNGSGTMSDVVKGVEFAAQSHQEASKKNKKGFKGST 325

Query: 326 ANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACNSSPAAAENAITVGASTLADD 385
           ANMSLGGGKSPALD+AVNAAVKAGIHFAVAAGNENQDACN+SPAAAENAITVGASTL+DD
Sbjct: 326 ANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQDACNTSPAAAENAITVGASTLSDD 385

Query: 386 RAYFSNWGKCVDIFAPGLNVLSTYIGSETATATLSGTSMASPHVAGLLTYFLSLQPDSDS 445
           RAYFSNWGKCVDIFAPGLNVLSTYIGSETATATLSGTSMASPHVAGLLTYFLSLQPDSDS
Sbjct: 386 RAYFSNWGKCVDIFAPGLNVLSTYIGSETATATLSGTSMASPHVAGLLTYFLSLQPDSDS 445

Query: 446 EYFHAAGGITPSQLKKKLIAYSTKNALGDLPEDTVNYLIYNGGGQDLDDFWVKDLEE--- 502
           E+F A+ GITP+QLKKKLIAYSTK+ L +LPEDT NYLIYNGGGQDL DFW K  E+   
Sbjct: 446 EFFQAS-GITPAQLKKKLIAYSTKDVLYELPEDTPNYLIYNGGGQDLSDFWGKSEEQVKE 504

Query: 503 --KVADAKDNTASEFESIIDALEEKTDGLYEEIREIFEGLNII 543
              + D KD   SE   +I++ + KTD L+EE+R +F+ LNII
Sbjct: 505 EGSIQDFKDFKLSE---LIESFDTKTDLLFEEVRSVFDKLNII 544

>KLLA0D00979g Chr4 (86703..88388) [1686 bp, 561 aa] {ON} similar to
           uniprot|P09232 Saccharomyces cerevisiae YEL060C PRB1
           Vacuolar proteinase B (yscB) a serine protease of the
           subtilisin family involved in protein degradation in the
           vacuole and required for full protein degradation during
           sporulation
          Length = 561

 Score =  711 bits (1834), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/495 (68%), Positives = 401/495 (81%), Gaps = 3/495 (0%)

Query: 51  SKEVTKKAAESGAGVTLSPLVTARNMYDAIPHRYIVVFKDRVLPEEVDFHMEVVSEAHAQ 110
           SK+  K      A   L+PL T  ++ + IP+RYI+VFK     +EV FH E+VS  HA+
Sbjct: 68  SKKFDKLRPVDDASAILAPLSTVNDIANKIPNRYIIVFKKDASADEVKFHQELVSVEHAK 127

Query: 111 SVGKLDANDAFFEATMDE--EMGIMATSREGGILDSFDVNGMLRGYIGYFTQEIVDFIRM 168
           ++G L  ND FF AT  E  E G+ A S EGGI DSFD+ G L GY+GYFT+E++DFIR 
Sbjct: 128 ALGSLADNDPFFTATSGEHSEFGVKAHSLEGGIQDSFDIAGSLSGYVGYFTKEVIDFIRR 187

Query: 169 NPLVAFVEQDSMVYANEFDTQNGAPWGLSRISHREKLNLGSFNKYLYDDAAGKGVTSYVI 228
           +PLV FVE+DSMV++N F+TQN APWGL+RISHREKLNLGSFNKYLYDD AGKGVT+YV+
Sbjct: 188 SPLVEFVEEDSMVFSNSFNTQNSAPWGLARISHREKLNLGSFNKYLYDDDAGKGVTAYVV 247

Query: 229 DTGINIDHKDFEGRAAWGKTVPTNDLDQDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXL 288
           DTG+N++HKDF+GRA WGKT+P +D D DGNGHGTHCAGTI S HYG            L
Sbjct: 248 DTGVNVNHKDFDGRAVWGKTIPKDDPDVDGNGHGTHCAGTIGSVHYGVAKNADIVAVKVL 307

Query: 289 RSNGSGSMSDVVKGVEFAAKSHQDAVKKNKKGFKGSTANMSLGGGKSPALDMAVNAAVKA 348
           RSNGSG+MSDVVKGVE+ A++H+ AV++ KKGFKGSTANMSLGGGKSPALD+AVNAAVKA
Sbjct: 308 RSNGSGTMSDVVKGVEYVAEAHKKAVEEQKKGFKGSTANMSLGGGKSPALDLAVNAAVKA 367

Query: 349 GIHFAVAAGNENQDACNSSPAAAENAITVGASTLADDRAYFSNWGKCVDIFAPGLNVLST 408
           G+HFAVAAGNENQDACN+SPAAAENAITVGASTL+D+RAYFSNWGKCVDIF PGLN+LST
Sbjct: 368 GVHFAVAAGNENQDACNTSPAAAENAITVGASTLSDERAYFSNWGKCVDIFGPGLNILST 427

Query: 409 YIGSETATATLSGTSMASPHVAGLLTYFLSLQPDSDSEYFHAAGGITPSQLKKKLIAYST 468
           YIGS+TATATLSGTSMA+PHV GLLTYFLSLQPD+DSEYFHAAGGITPSQLKKKLI +ST
Sbjct: 428 YIGSDTATATLSGTSMATPHVVGLLTYFLSLQPDADSEYFHAAGGITPSQLKKKLIDFST 487

Query: 469 KNALGDLPEDTVNYLIYNGGGQDLDDFWVKDLEEKVADAKDNTASEFESIIDALEEKTDG 528
           KN L DLPEDTVNYLIYNGGGQDLDD W KD      +   N     ES+I++L+ KTD 
Sbjct: 488 KNVLSDLPEDTVNYLIYNGGGQDLDDLWGKDYSIG-KEPSANPEFSLESLINSLDSKTDA 546

Query: 529 LYEEIREIFEGLNII 543
           +++++R++ +  NII
Sbjct: 547 IFDDVRQLLDQFNII 561

>TDEL0G04550 Chr7 complement(829468..831162) [1695 bp, 564 aa] {ON}
           Anc_6.14 YOR003W
          Length = 564

 Score =  660 bits (1703), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/482 (68%), Positives = 381/482 (79%), Gaps = 17/482 (3%)

Query: 64  GVTLSPLVTARNMYDAIPHRYIVVFKDRVLPEEVDFHMEVVSEAHAQSVGKLDANDAFFE 123
           G  ++PL    N   A PHRYIVV K    PEE+  HME ++++  QSVG+L  +D FF 
Sbjct: 98  GEGVAPLSIPPN---AFPHRYIVVLKHSS-PEEIALHMEAITQSQLQSVGELAQDDPFFS 153

Query: 124 ATMDEEMGIMATSREGGILDSFDVNGMLRGYIGYFTQEIVDFIRMNPLVAFVEQDSMVYA 183
           A      G+  T   GGI DSFDV G+L GY+GYFT  +V+ IR +P+V FVE DS V+A
Sbjct: 154 A-----QGVRTT---GGIQDSFDVAGLLNGYVGYFTDAVVELIRKSPMVDFVEMDSPVHA 205

Query: 184 NEFDTQNGAPWGLSRISHREKLNLGSFNKYLYDDAAGKGVTSYVIDTGINIDHKDFEGRA 243
           +EFDTQNGAPWGLSRISHRE+LNLGSFNKYL+DD AGKGVTSYVIDTGIN+ H+DFEGRA
Sbjct: 206 SEFDTQNGAPWGLSRISHRERLNLGSFNKYLFDDEAGKGVTSYVIDTGINVKHQDFEGRA 265

Query: 244 AWGKTVPTNDLDQDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVVKGV 303
            WGKT+PTND D DGNGHGTHCAGTIASKHYG            LRSNGSGSMSDV+KGV
Sbjct: 266 HWGKTIPTNDEDLDGNGHGTHCAGTIASKHYGVAKGADVVAVKVLRSNGSGSMSDVIKGV 325

Query: 304 EFAAKSHQDAVKKNKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDA 363
           EFAA+SHQ AVK  KKGFKGSTANMSLGGGKSPALD+AVNAAVKAGIHFAVAAGNENQDA
Sbjct: 326 EFAAQSHQKAVKDKKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQDA 385

Query: 364 CNSSPAAAENAITVGASTLADDRAYFSNWGKCVDIFAPGLNVLSTYIGSETATATLSGTS 423
           CN+SPAAAE A+TVGASTL+DDRAYFSN+GKCVDIFAPGLN+LSTYIGS+ ATATLSGTS
Sbjct: 386 CNTSPAAAEQAVTVGASTLSDDRAYFSNYGKCVDIFAPGLNILSTYIGSDDATATLSGTS 445

Query: 424 MASPHVAGLLTYFLSLQPDSDSEYFHAAG-GITPSQLKKKLIAYSTKNALGDLPEDTVNY 482
           MASPHVAGLLTYFLSLQPDSDS++F A   G+TP QLKKKLIAYSTK+ L DLPEDT N 
Sbjct: 446 MASPHVAGLLTYFLSLQPDSDSDFFDAGSQGVTPEQLKKKLIAYSTKDILYDLPEDTPNA 505

Query: 483 LIYNGGGQDLDDFW-VKDLEEKVADAKDNTASEFESIIDALEEKTDGLYEEIREIFEGLN 541
           LIYNGGG  L  FW   D +E     +D   ++ + + D L  KTD L++++R++ + LN
Sbjct: 506 LIYNGGGHGLKGFWDGHDKQEANTRFQD---TDLQELSDNLGAKTDALFDQVRDVLDRLN 562

Query: 542 II 543
           II
Sbjct: 563 II 564

>Smik_5.27 Chr5 complement(42408..44234) [1827 bp, 608 aa] {ON}
           YEL060C (REAL)
          Length = 608

 Score =  660 bits (1702), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/486 (68%), Positives = 384/486 (79%), Gaps = 20/486 (4%)

Query: 67  LSPLV-TARNMYDAI----PHRYIVVFKDRVLPEEVDFHMEVVSEAHAQSVGKLDANDAF 121
           L+PLV TA+   DAI    P+RYIVVFK  V  EEV+FH E V +A  QSV  L A DAF
Sbjct: 134 LAPLVSTAQFNPDAISKIIPNRYIVVFKKGVPEEEVNFHKESVHQAQLQSVENLSAEDAF 193

Query: 122 FEATMDEEMGIMATSREGGILDSFDVNGMLRGYIGYFTQEIVDFIRMNPLVAFVEQDSMV 181
           F +T D     ++TS  GGI DSF+++ +  GYIGYFTQEI+D IR NPLV FVE+DS+V
Sbjct: 194 FTSTRDT---YLSTSEAGGIQDSFNIDNIFSGYIGYFTQEIIDLIRQNPLVDFVERDSVV 250

Query: 182 YANEFDTQNGAPWGLSRISHREKLNLGSFNKYLYDDAAGKGVTSYVIDTGINIDHKDFEG 241
            A EFDTQN APWGL+RISHRE+LNLGSFNKYLYDD AG+GVTSYVIDTG+NI+HKDFE 
Sbjct: 251 EATEFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNINHKDFEK 310

Query: 242 RAAWGKTVPTNDLDQDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVVK 301
           RA WGKT+P ND D DGNGHGTHCAGTIASKHYG            LRSNGSG+MSDVVK
Sbjct: 311 RAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMSDVVK 370

Query: 302 GVEFAAKSHQDAVKKNKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQ 361
           GVE+AAK+HQ   ++ KKGFKGSTANMSLGGGKSPALD+AVNAAV+AGIHFAVAAGNENQ
Sbjct: 371 GVEYAAKAHQKQAQEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQ 430

Query: 362 DACNSSPAAAENAITVGASTLADDRAYFSNWGKCVDIFAPGLNVLSTYIGSETATATLSG 421
           DACN+SPA+A+ AITVGASTL+DDRAYFSNWGKCVD+FAPGLN+LSTYIGS+ ATATLSG
Sbjct: 431 DACNTSPASADKAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDEATATLSG 490

Query: 422 TSMASPHVAGLLTYFLSLQPDSDSEYFH-AAGGITPSQLKKKLIAYSTKNALGDLPEDTV 480
           TSMASPHVAGLLTYFLSLQP SDSE+F      +TP QLKKKLI YSTK+ L D+PEDT 
Sbjct: 491 TSMASPHVAGLLTYFLSLQPGSDSEFFELGQDSLTPQQLKKKLIHYSTKDILFDIPEDTP 550

Query: 481 NYLIYNGGGQDLDDFWVKDLEEKVADAKDN--TASEFESIIDA-LEEKTDGLYEEIREIF 537
           N+LIYNGGGQDL  FW         D K +  + S+ E  +D  +  KTD L+E++R++ 
Sbjct: 551 NFLIYNGGGQDLSAFW--------NDTKKSHPSGSKHELNMDEFIGSKTDLLFEQVRDVL 602

Query: 538 EGLNII 543
           + LNII
Sbjct: 603 DKLNII 608

>Skud_5.29 Chr5 complement(39160..40986) [1827 bp, 608 aa] {ON}
           YEL060C (REAL)
          Length = 608

 Score =  656 bits (1692), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/486 (66%), Positives = 377/486 (77%), Gaps = 20/486 (4%)

Query: 67  LSPLVTARN-----MYDAIPHRYIVVFKDRVLPEEVDFHMEVVSEAHAQSVGKLDANDAF 121
           L+PLV+        M   IP+RYI+VFK  V  E  DFH E V +A  QSV  L A DAF
Sbjct: 134 LAPLVSTAQFDPAAMPKIIPNRYIIVFKKGVPQEATDFHKESVHQAQLQSVENLSAEDAF 193

Query: 122 FEATMDEEMGIMATSREGGILDSFDVNGMLRGYIGYFTQEIVDFIRMNPLVAFVEQDSMV 181
           F +T D  +   +TS  GGI DSF+++ M  GYIGYFTQEI+D IR NPLV FVE+DS+V
Sbjct: 194 FISTRDSSL---STSETGGIQDSFNIDNMFSGYIGYFTQEIIDLIRQNPLVDFVERDSVV 250

Query: 182 YANEFDTQNGAPWGLSRISHREKLNLGSFNKYLYDDAAGKGVTSYVIDTGINIDHKDFEG 241
            A +FDTQN APWGL+RISHRE+LNLGSFNKYLYDD AG+GVTSYVIDTG+N++HKDFE 
Sbjct: 251 EATDFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNVNHKDFEK 310

Query: 242 RAAWGKTVPTNDLDQDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVVK 301
           RA WGKT+P ND D DGNGHGTHCAGTIASKHYG            LRSNGSG+MSDVVK
Sbjct: 311 RAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMSDVVK 370

Query: 302 GVEFAAKSHQDAVKKNKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQ 361
           GVE+AA++HQ   ++ KKGFKGSTANMSLGGGKSPALD+AVNAAV+AGIHFAVAAGNENQ
Sbjct: 371 GVEYAARAHQKQAQEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQ 430

Query: 362 DACNSSPAAAENAITVGASTLADDRAYFSNWGKCVDIFAPGLNVLSTYIGSETATATLSG 421
           DACN+SPA+A+ AITVGASTL+DDRAYFSNWGKCVDIFAPGLN+LSTYIGS+ ATATLSG
Sbjct: 431 DACNTSPASADKAITVGASTLSDDRAYFSNWGKCVDIFAPGLNILSTYIGSDDATATLSG 490

Query: 422 TSMASPHVAGLLTYFLSLQPDSDSEYFH-AAGGITPSQLKKKLIAYSTKNALGDLPEDTV 480
           TSMASPHVAGLLTYFLSLQP SDSE+F      +TP QLK KLI YSTK+ L D+PEDT 
Sbjct: 491 TSMASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKNKLIHYSTKDILFDVPEDTP 550

Query: 481 NYLIYNGGGQDLDDFWVKDLEEKVADAKDNTASEFESIIDALE---EKTDGLYEEIREIF 537
           N LIYNGGGQDL  FW         D K + +S F+  ++  E    KTD ++E++R++ 
Sbjct: 551 NALIYNGGGQDLSAFW--------NDTKKSHSSRFKQELNMDEFIGSKTDLIFEQVRDVL 602

Query: 538 EGLNII 543
           + LNII
Sbjct: 603 DKLNII 608

>YEL060C Chr5 complement(40046..41953) [1908 bp, 635 aa] {ON}
           PRB1Vacuolar proteinase B (yscB), a serine protease of
           the subtilisin family; involved in protein degradation
           in the vacuole and required for full protein degradation
           during sporulation; activity inhibited by Pbi2p
          Length = 635

 Score =  657 bits (1694), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/486 (67%), Positives = 381/486 (78%), Gaps = 20/486 (4%)

Query: 67  LSPLV-TARNMYDAI----PHRYIVVFKDRVLPEEVDFHMEVVSEAHAQSVGKLDANDAF 121
           L+PLV TA+   DAI    P+RYI+VFK     EE+DFH E V +A  QSV  L A DAF
Sbjct: 161 LAPLVSTAQFNPDAISKIIPNRYIIVFKRGAPQEEIDFHKENVQQAQLQSVENLSAEDAF 220

Query: 122 FEATMDEEMGIMATSREGGILDSFDVNGMLRGYIGYFTQEIVDFIRMNPLVAFVEQDSMV 181
           F +T D  +   +TS  GGI DSF+++ +  GYIGYFTQEIVD IR NPLV FVE+DS+V
Sbjct: 221 FISTKDTSL---STSEAGGIQDSFNIDNLFSGYIGYFTQEIVDLIRQNPLVDFVERDSIV 277

Query: 182 YANEFDTQNGAPWGLSRISHREKLNLGSFNKYLYDDAAGKGVTSYVIDTGINIDHKDFEG 241
            A EFDTQN APWGL+RISHRE+LNLGSFNKYLYDD AG+GVTSYVIDTG+NI+HKDFE 
Sbjct: 278 EATEFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNINHKDFEK 337

Query: 242 RAAWGKTVPTNDLDQDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVVK 301
           RA WGKT+P ND D DGNGHGTHCAGTIASKHYG            LRSNGSG+MSDVVK
Sbjct: 338 RAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMSDVVK 397

Query: 302 GVEFAAKSHQDAVKKNKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQ 361
           GVE+AAK+HQ   ++ KKGFKGSTANMSLGGGKSPALD+AVNAAV+ GIHFAVAAGNENQ
Sbjct: 398 GVEYAAKAHQKEAQEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEVGIHFAVAAGNENQ 457

Query: 362 DACNSSPAAAENAITVGASTLADDRAYFSNWGKCVDIFAPGLNVLSTYIGSETATATLSG 421
           DACN+SPA+A+ AITVGASTL+DDRAYFSNWGKCVD+FAPGLN+LSTYIGS+ ATATLSG
Sbjct: 458 DACNTSPASADKAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATLSG 517

Query: 422 TSMASPHVAGLLTYFLSLQPDSDSEYFH-AAGGITPSQLKKKLIAYSTKNALGDLPEDTV 480
           TSMASPHVAGLLTYFLSLQP SDSE+F      +TP QLKKKLI YSTK+ L D+PEDT 
Sbjct: 518 TSMASPHVAGLLTYFLSLQPGSDSEFFELGQDSLTPQQLKKKLIHYSTKDILFDIPEDTP 577

Query: 481 NYLIYNGGGQDLDDFWVKDLEEKVADAKDNTASEFESIIDALE---EKTDGLYEEIREIF 537
           N LIYNGGGQDL  FW         D K + +S F+  ++  E    KTD +++++R+I 
Sbjct: 578 NVLIYNGGGQDLSAFW--------NDTKKSHSSGFKQELNMDEFIGSKTDLIFDQVRDIL 629

Query: 538 EGLNII 543
           + LNII
Sbjct: 630 DKLNII 635

>Suva_5.7 Chr5 complement(15849..17843) [1995 bp, 664 aa] {ON}
           YEL060C (REAL)
          Length = 664

 Score =  647 bits (1670), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/486 (66%), Positives = 381/486 (78%), Gaps = 19/486 (3%)

Query: 67  LSPLVTARN-----MYDAIPHRYIVVFKDRVLPEEVDFHMEVVSEAHAQSVGKLDANDAF 121
           L+PLV+        +   IP+RYI+VFK  V PEE  FH E V +A  QSV  L A DAF
Sbjct: 189 LAPLVSTEQFNPDAITKIIPNRYIIVFKKDVPPEEAAFHRETVQQAQLQSVENLAAEDAF 248

Query: 122 FEATMDEEMGIMATSREGGILDSFDVNGMLRGYIGYFTQEIVDFIRMNPLVAFVEQDSMV 181
           F +T D     +++S  GGI DSF+++ +  GYIGYFTQEIVD IR NPLV FVE+DS+V
Sbjct: 249 FISTRD---AALSSSEAGGIQDSFNIDSLFSGYIGYFTQEIVDLIRQNPLVDFVEKDSVV 305

Query: 182 YANEFDTQNGAPWGLSRISHREKLNLGSFNKYLYDDAAGKGVTSYVIDTGINIDHKDFEG 241
            A +FDTQN APWGL+R+SHRE+LNLGSFNKYLYDD AG+GVTSYVIDTG+N++HKDFE 
Sbjct: 306 EATDFDTQNSAPWGLARVSHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNVNHKDFEK 365

Query: 242 RAAWGKTVPTNDLDQDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVVK 301
           RA WGKT+P ND D DGNGHGTHCAGTIASKHYG            LRSNGSG+MSDV+K
Sbjct: 366 RAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMSDVLK 425

Query: 302 GVEFAAKSHQDAVKKNKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQ 361
           GVE+AAK+HQ   ++ KKGFKGSTANMSLGGGKSPALD+AVNAAV+AGIHFAVAAGNENQ
Sbjct: 426 GVEYAAKAHQKQAEEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQ 485

Query: 362 DACNSSPAAAENAITVGASTLADDRAYFSNWGKCVDIFAPGLNVLSTYIGSETATATLSG 421
           DACN+SPA+A+ AITVGASTL+DDRAYFSN+GKCVD+FAPGLN+LSTYIGS+ ATATLSG
Sbjct: 486 DACNTSPASADKAITVGASTLSDDRAYFSNYGKCVDVFAPGLNILSTYIGSDEATATLSG 545

Query: 422 TSMASPHVAGLLTYFLSLQPDSDSEYFH-AAGGITPSQLKKKLIAYSTKNALGDLPEDTV 480
           TSMASPHVAGLLTYFLSLQP SDSE+F      +TP QLKKKLI YSTK+ L D+P+DT 
Sbjct: 546 TSMASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKKKLIHYSTKDILFDIPDDTP 605

Query: 481 NYLIYNGGGQDLDDFWVKDLEEKVADAKDNTASEFESIIDALE---EKTDGLYEEIREIF 537
           N LIYNGGGQDL  FW  D +      K +++S F+  ++  E    KTD ++E++R++ 
Sbjct: 606 NALIYNGGGQDLSAFW-NDTK------KSHSSSGFKQELNLDEFIGSKTDLIFEQVRDVL 658

Query: 538 EGLNII 543
           + LNII
Sbjct: 659 DKLNII 664

>ACR012C Chr3 complement(378750..380375) [1626 bp, 541 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YEL060C
           (PRB1) and YOR003W (YSP3)
          Length = 541

 Score =  632 bits (1629), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/484 (64%), Positives = 367/484 (75%), Gaps = 9/484 (1%)

Query: 68  SPLVTARNMYDAIPHRYIVVFKDRVLPEEVDFHMEVVSEAHAQSVGKLDANDAFFEATMD 127
           SPL    ++  AIPH+YIVVF++ V  EE  FHME+V  AHA+SV +LD   AFF +T  
Sbjct: 59  SPLFRVDDVTRAIPHKYIVVFREGVSDEEAAFHMELVEAAHAESVARLDEQHAFFRSTRG 118

Query: 128 E--EMGIMATSREGGILDSFDVNGMLRGYIGYFTQEIVDFIRMNPLVAFVEQDSMVYANE 185
           E  E GI AT  EGGI   F +   LRGY+GYFT+++V  +R NP V FVE+DSMV+A++
Sbjct: 119 ENNEFGIAATRAEGGIEGEFALGEQLRGYVGYFTEDMVGLLRSNPHVHFVEEDSMVFASD 178

Query: 186 FDTQNGAPWGLSRISHREKLNLGSFNKYLYDDAAGKGVTSYVIDTGINIDHKDFEGRAAW 245
           F TQNGAPWGL+R+SHREKLN GSFNKYLYDD +G+GVTSYVIDTGINIDH DFE RA W
Sbjct: 179 FTTQNGAPWGLARVSHREKLNSGSFNKYLYDDNSGEGVTSYVIDTGINIDHVDFEDRALW 238

Query: 246 GKTVPTNDLDQDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVVKGVEF 305
           GKT+P ND D DGNGHGTHCAGTIASK YG            LRSNG+GSMSDV++GVE+
Sbjct: 239 GKTIPNNDADYDGNGHGTHCAGTIASKTYGVAKKANVVAVKVLRSNGTGSMSDVLRGVEY 298

Query: 306 AAKSHQDAVKKNKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACN 365
           A K+H+ A +K  KGFKGSTANMSLGGG+S ALD+AV+AAV AGIHFAVAAGNENQDACN
Sbjct: 299 AVKAHRKAAEKADKGFKGSTANMSLGGGRSQALDLAVDAAVDAGIHFAVAAGNENQDACN 358

Query: 366 SSPAAAENAITVGASTLADDRAYFSNWGKCVDIFAPGLNVLSTYIGSETATATLSGTSMA 425
           +SPAA++ AITVGASTLADDRAYFSNWG+CVD+FAPG+N+LSTYIGS+TA ATLSGTSMA
Sbjct: 359 TSPAASQKAITVGASTLADDRAYFSNWGRCVDLFAPGMNILSTYIGSDTAVATLSGTSMA 418

Query: 426 SPHVAGLLTYFLSLQPDSDSEYFHAAGGITPSQLKKKLIAYSTKNALGDLPEDTVNYLIY 485
           SPHVAGLLTYFLSLQPD DSE F     I+P  LKKK+I + TK+AL  LP  T N LIY
Sbjct: 419 SPHVAGLLTYFLSLQPDGDSE-FRNKQTISPEVLKKKVIDFGTKDALSSLPARTANVLIY 477

Query: 486 NGGGQDLDDFW------VKDLEEKVADAKDNTASEFESIIDALEEKTDGLYEEIREIFEG 539
           NGGG DL DFW      V   +   AD ++   S+ + +I  LE  TD ++   R I + 
Sbjct: 478 NGGGADLSDFWGNKPKKVSGPKFTYADDEEAMGSDLDRLIHELESSTDAMFSGFRTILDR 537

Query: 540 LNII 543
           +NII
Sbjct: 538 MNII 541

>TBLA0A07300 Chr1 complement(1815683..1817404) [1722 bp, 573 aa]
           {ON} Anc_6.14 YOR003W
          Length = 573

 Score =  627 bits (1618), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/465 (64%), Positives = 364/465 (78%), Gaps = 17/465 (3%)

Query: 80  IPHRYIVVFKDRVLPEEVDFHMEVVSEAHAQSVGKLDANDAFFEATMDEEMGIMATSREG 139
           IPHRYI+ FK  V PEE+DFH + ++E   QS+ +L  +  +F +    ++       + 
Sbjct: 125 IPHRYIITFKKDVAPEEIDFHQQSINELQQQSIAQLPHDHPYFNSVEGLDL-------QQ 177

Query: 140 GILDSFDVNGMLRGYIGYFTQEIVDFIRMNPLVAFVEQDSMVYANEFDTQNGAPWGLSRI 199
            I+DSF++N +L+GYIGYFT +++DFIR+NPLV FVEQDS V  NEFDTQNGAPWGL+RI
Sbjct: 178 PIIDSFNINSLLQGYIGYFTDDVIDFIRLNPLVQFVEQDSTVNINEFDTQNGAPWGLARI 237

Query: 200 SHREKLNLGSFNKYLYDDAAGKGVTSYVIDTGINIDHKDFEGRAAWGKTVPTNDLDQDGN 259
           SHRE+LNLGSFNKYL+DD AG+GVT+YVIDTG+N++H DFEGRA+WGKT+P ND D DGN
Sbjct: 238 SHRERLNLGSFNKYLFDDKAGEGVTAYVIDTGVNVEHNDFEGRASWGKTIPNNDEDLDGN 297

Query: 260 GHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVVKGVEFAAKSHQDAVKKNKK 319
           GHGTHCAGTIASKHYG            LRSNGSGSMSDV+KGVE+A  SH   VK  K 
Sbjct: 298 GHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGSMSDVLKGVEYATASHLADVKNKKS 357

Query: 320 GFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACNSSPAAAENAITVGA 379
           GFKGSTANMSLGGGKSP+LD+AVNAAVKAGIHFAVAAGNENQDACN+SPA+A+ AITVGA
Sbjct: 358 GFKGSTANMSLGGGKSPSLDLAVNAAVKAGIHFAVAAGNENQDACNTSPASAKYAITVGA 417

Query: 380 STLADDRAYFSNWGKCVDIFAPGLNVLSTYIGSETATATLSGTSMASPHVAGLLTYFLSL 439
           STL+DDRAYFSNWGKCVD+FAPGLN+LSTYIGS+ ATATLSGTSMASPHVAGLL+YFLSL
Sbjct: 418 STLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLSYFLSL 477

Query: 440 QPDSDSEYFHA-AGGITPSQLKKKLIAYSTKNALGDLPEDTVNYLIYNGGGQDLDDFWVK 498
           QP+ DSE+  +  GGITP+QLKK+LI+Y TK+ L D+PE T N L++NG GQDL DFW  
Sbjct: 478 QPEQDSEFATSRKGGITPAQLKKRLISYGTKDILLDIPELTPNVLVFNGAGQDLSDFWNI 537

Query: 499 DLEEKVADAKDNTASEFESIIDALEEKTDGLYEEIREIFEGLNII 543
               K AD + N       +   L+   D LY++   IF+ +N++
Sbjct: 538 ---SKPADLESN------EVYKNLDLVGDVLYDQFTGIFKKMNLL 573

>NCAS0F00220 Chr6 (32791..34878) [2088 bp, 695 aa] {ON} Anc_6.14
           YEL060C
          Length = 695

 Score =  621 bits (1602), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/482 (63%), Positives = 362/482 (75%), Gaps = 20/482 (4%)

Query: 35  VEETAASLGESILSSFSKEVTKKAAESGAGVTLSPLVTA-------------RNMYDAIP 81
           + +  A   E I+ S  K    K+ +    + ++PLVT                  + IP
Sbjct: 43  ITDVVAKYSEQIIESARK--IGKSVQDSVNLKMAPLVTPTPYPVVSGASANSNANSNIIP 100

Query: 82  HRYIVVFKDRVLPEEVDFHMEVVSEAHAQSVGKLDANDAFFEATMDEEMGIMATSREGGI 141
           +RYIVVFK  +LPEEVDFH E++++   +S  KL  +D FF A+  E+  I     +GGI
Sbjct: 101 NRYIVVFKKSILPEEVDFHKELINQIQLESAAKLPKDDKFFSASAIEDESI----NQGGI 156

Query: 142 LDSFDVNGMLRGYIGYFTQEIVDFIRMNPLVAFVEQDSMVYANEFDTQNGAPWGLSRISH 201
           L +F+++ +L GY+GYFT E+++ IRMNPLV +VE+DS+V A EFD QN APWGL+RISH
Sbjct: 157 LTTFNISNLLNGYVGYFTDEVLELIRMNPLVEYVEKDSLVQATEFDNQNNAPWGLARISH 216

Query: 202 REKLNLGSFNKYLYDDAAGKGVTSYVIDTGINIDHKDFEGRAAWGKTVPTNDLDQDGNGH 261
           RE+LNLGSFNKYLYDD AGKGVT YVIDTGIN +H DF  RA WGKT+P ND D DGNGH
Sbjct: 217 RERLNLGSFNKYLYDDDAGKGVTCYVIDTGINTEHNDFNKRAVWGKTIPLNDKDIDGNGH 276

Query: 262 GTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVVKGVEFAAKSHQDAVKKNKKGF 321
           GTHCAGTIAS HYG            LRSNGSGSMSDV+KGVEFAA+SH  A K+ KKGF
Sbjct: 277 GTHCAGTIASTHYGVAKNAEVVAVKVLRSNGSGSMSDVIKGVEFAAESHIKAAKEKKKGF 336

Query: 322 KGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACNSSPAAAENAITVGAST 381
           KGSTANMSLGGGKSP LD+AVNAAV AGIHFAVAAGNENQDACN+SPA+AE AITVGAST
Sbjct: 337 KGSTANMSLGGGKSPTLDLAVNAAVDAGIHFAVAAGNENQDACNTSPASAERAITVGAST 396

Query: 382 LADDRAYFSNWGKCVDIFAPGLNVLSTYIGSETATATLSGTSMASPHVAGLLTYFLSLQP 441
           L+DDRAYFSNWGKCVDIFAPGLN+LSTYIG + ATATLSGTSMASPHVAGLLTYFLSLQP
Sbjct: 397 LSDDRAYFSNWGKCVDIFAPGLNILSTYIGDDDATATLSGTSMASPHVAGLLTYFLSLQP 456

Query: 442 DSDSEYFHAAGGITPSQLKKKLIAYSTKNALGDLPEDTVNYLIYNGGGQDLDDFWVKDLE 501
            SDSE+F     +TP+Q+KKKLI YS+K+ L DLPE T N LI+NG G +LDD W K  +
Sbjct: 457 GSDSEFFDPT-ELTPAQMKKKLINYSSKDVLFDLPEGTPNKLIFNGAGGNLDDLWNKKSQ 515

Query: 502 EK 503
           E+
Sbjct: 516 EE 517

>NDAI0K02880 Chr11 complement(651446..653560) [2115 bp, 704 aa] {ON}
           Anc_6.14
          Length = 704

 Score =  610 bits (1573), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/498 (61%), Positives = 377/498 (75%), Gaps = 26/498 (5%)

Query: 65  VTLSPLVTARNMYDA----------IPHRYIVVFKDRVLPEEVDFHMEVVSEAHAQSVGK 114
           + L+PL+T     D           +P++YI+VFKD +  +E+ +H E++SE   QS  +
Sbjct: 214 IKLAPLITPTFGDDIHTQGFKHPRILPNKYIIVFKDSINIDEISYHKELISEIQQQSASR 273

Query: 115 LDANDAFFEATMDEEMGIMATSREGGILDSFDVNGMLRGYIGYFTQEIVDFIRMNPLVAF 174
           L  +  FF +T +EE       R GGI+ SF++N +L GY GYFTQE++D IR+NPLV +
Sbjct: 274 LPPHHHFFHSTSEEEEESF---RNGGIISSFNINNILSGYSGYFTQEVIDLIRLNPLVKY 330

Query: 175 VEQDSMVYANEFDTQNGAPWGLSRISHREKLNLGSFNKYLYDDAAGKGVTSYVIDTGINI 234
           VE+DS+V   EF+TQN APWGLSRISHRE+LNLGSFNKYLYDD AGKGVT +VIDTGIN+
Sbjct: 331 VERDSIVQTTEFNTQNNAPWGLSRISHRERLNLGSFNKYLYDDDAGKGVTCFVIDTGINV 390

Query: 235 DHKDFEGRAAWGKTVPTNDLDQDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSG 294
           +H DF  RA WGKT+P+ND D DGNGHGTHCAGTIAS HYG            LRSNGSG
Sbjct: 391 NHVDFGKRAIWGKTIPSNDQDIDGNGHGTHCAGTIASTHYGVAKNAEVVAVKVLRSNGSG 450

Query: 295 SMSDVVKGVEFAAKSHQDAVKKNKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAV 354
           SMSDV+KGVEFAA++H +  +KNKK +KGSTANMSLGGGKSP LD+AVNAAV+AGIHF+V
Sbjct: 451 SMSDVIKGVEFAAETHLNN-EKNKKDYKGSTANMSLGGGKSPTLDLAVNAAVEAGIHFSV 509

Query: 355 AAGNENQDACNSSPAAAENAITVGASTLADDRAYFSNWGKCVDIFAPGLNVLSTYIGS-E 413
           AAGNENQDACNSSPA+AENAITVGASTL+DDRAYFSNWG+CVD+FAPGLN+LSTY+G   
Sbjct: 510 AAGNENQDACNSSPASAENAITVGASTLSDDRAYFSNWGRCVDVFAPGLNILSTYVGDGN 569

Query: 414 TATATLSGTSMASPHVAGLLTYFLSLQPDSDSEYFHAA--GGITPSQLKKKLIAYSTKNA 471
             TATLSGTSMASPHVAGLLTYFLSLQPDS S +F++   G ITP QLKKKLIAYST + 
Sbjct: 570 DNTATLSGTSMASPHVAGLLTYFLSLQPDSKSGFFNSKSDGKITPEQLKKKLIAYSTSDI 629

Query: 472 LGDLPEDTVNYLIYNGGGQDLDDFWVKDLEEKVADAKDNTASE----FESII--DALEEK 525
           L DLP+ T N LIYNG G D+ D W   ++E+   A +  A E    FE+++  D++  K
Sbjct: 630 LYDLPDGTPNKLIYNGAGGDISDLWNGKVQEQ---AHEEPAHEDKINFENLVDSDSMSGK 686

Query: 526 TDGLYEEIREIFEGLNII 543
           TD  +++IR +FE +NII
Sbjct: 687 TDLFFDQIRNVFEKMNII 704

>ZYRO0C07942g Chr3 complement(605044..606690) [1647 bp, 548 aa] {ON}
           similar to uniprot|P09232 Saccharomyces cerevisiae
           YEL060C PRB1 Vacuolar proteinase B (yscB) a serine
           protease of the subtilisin family involved in protein
           degradation in the vacuole and required for full protein
           degradation during sporulation
          Length = 548

 Score =  598 bits (1542), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/497 (58%), Positives = 365/497 (73%), Gaps = 9/497 (1%)

Query: 47  LSSFSKEVTKKAAESGAGVTLSPLVTARNMYDAIPHRYIVVFKDRVLPEEVDFHMEVVSE 106
           L+ F+ ++T++  +       +PLV   +    + +RYI++FK  V P+E+ FH E++ +
Sbjct: 61  LAVFASKLTQEVQDR-----FAPLVVPEDTLGVLENRYIILFKKGVNPQEIGFHRELIEQ 115

Query: 107 AHAQSVGKLDANDAFFEATMDEEMGIMATSREGGILDSFDVNGMLRGYIGYFTQEIVDFI 166
            H Q V +L    +FFE      +  +  S  GGI  +FD+NGML GY GYF  +++D I
Sbjct: 116 VHLQEVSQLPEEHSFFEGI---RLDGVYDSPLGGIDHTFDINGMLMGYSGYFPSKVLDVI 172

Query: 167 RMNPLVAFVEQDSMVYANEFDTQNGAPWGLSRISHREKLNLGSFNKYLYDDAAGKGVTSY 226
           RM+PL+  VEQDS+VY  + DT+NGAPWGL+RISHRE+LNLGS+NKYLYD+  G GVTSY
Sbjct: 173 RMSPLIEMVEQDSVVYTQKADTENGAPWGLARISHRERLNLGSYNKYLYDEQGGSGVTSY 232

Query: 227 VIDTGINIDHKDFEGRAAWGKTVPTNDLDQDGNGHGTHCAGTIASKHYGXXXXXXXXXXX 286
           VIDTG+N+ H  F GRA WGKT+P  DLD+DGNGHGTHCAGTI S  YG           
Sbjct: 233 VIDTGVNVHHNQFGGRAKWGKTIPAGDLDEDGNGHGTHCAGTIGSSTYGVAKGADIVAVK 292

Query: 287 XLRSNGSGSMSDVVKGVEFAAKSHQDAVKKNKKGFKGSTANMSLGGGKSPALDMAVNAAV 346
            LRSNGSGSMSDV+KGVE+AA+ HQ+AVK+ K GFKGSTANMSLGGGKSP+LD AVNAAV
Sbjct: 293 VLRSNGSGSMSDVLKGVEWAAQDHQNAVKQKKPGFKGSTANMSLGGGKSPSLDQAVNAAV 352

Query: 347 KAGIHFAVAAGNENQDACNSSPAAAENAITVGASTLADDRAYFSNWGKCVDIFAPGLNVL 406
            AG++FAVAAGNE+QDACN+SPA+A   ITVGASTL+DDRAYFSN+GKCVD+FAPGLN+L
Sbjct: 353 AAGLNFAVAAGNEDQDACNTSPASASGPITVGASTLSDDRAYFSNYGKCVDVFAPGLNIL 412

Query: 407 STYIGSETATATLSGTSMASPHVAGLLTYFLSLQPDSDSEYFHAAGGITPSQLKKKLIAY 466
           STYIGS+++TATLSGTSMASPHVAGLL YFLSLQP SDSE F A   I+P QLKKKL+A+
Sbjct: 413 STYIGSDSSTATLSGTSMASPHVAGLLAYFLSLQPGSDSE-FDAGSSISPDQLKKKLLAF 471

Query: 467 STKNALGDLPEDTVNYLIYNGGGQDLDDFWVKDLEEKVADAKDNTASEFESIIDALEEKT 526
           STK+ L D+P  T N LIYNGGG DL  FW      +  +  +    E   ++D L  KT
Sbjct: 472 STKDVLSDIPSGTPNLLIYNGGGGDLSGFWGSKEVAQELEFNEKVDLELHDLVDELGSKT 531

Query: 527 DGLYEEIREIFEGLNII 543
           D ++ +IR + + L+II
Sbjct: 532 DAVFGQIRGLMDRLDII 548

>Kpol_1032.5 s1032 (6368..8410) [2043 bp, 680 aa] {ON} (6368..8410)
           [2043 nt, 681 aa]
          Length = 680

 Score =  595 bits (1533), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/504 (58%), Positives = 378/504 (75%), Gaps = 20/504 (3%)

Query: 44  ESILSSFSKEVTKKAAESGAGVTLSPLVTARNM-YD--AIPHRYIVVFKDRVLPEEVDFH 100
           + I+ S ++++ + A +SG  V  +PL +  N  Y+   IP++YI+VFK  V  +++  H
Sbjct: 193 DDIVDSVTQQIFESAEKSGEKVKYAPLHSMENTKYENLVIPNKYIIVFKKDVSVKDMQIH 252

Query: 101 MEVVSEAHAQSVGKLDANDAFFEATMDEEMGIMATSREGGILDSFDVNGMLRGYIGYFTQ 160
            ++++ A  Q           + +  DE     ++S  GGI ++F+V  +  GYIG+F +
Sbjct: 253 KDLIARAQFQ-----------YASVSDE----TSSSILGGIEEAFNVANLFHGYIGHFNE 297

Query: 161 EIVDFIRMNPLVAFVEQDSMVYANEFDTQNGAPWGLSRISHREKLNLGSFNKYLYDDAAG 220
           ++V FIR++P+V FVEQDS+V+ANE DTQN APWGL+RISHR+ LNLGS+NKYLYDD AG
Sbjct: 298 QLVQFIRLSPIVDFVEQDSIVHANEVDTQNNAPWGLARISHRDGLNLGSYNKYLYDDVAG 357

Query: 221 KGVTSYVIDTGINIDHKDFEGRAAWGKTVPTNDLDQDGNGHGTHCAGTIASKHYGXXXXX 280
           +GVT+YVIDTGINI HK+F GRA WGKT+P ND D DGNGHGTHCAGTIASK+YG     
Sbjct: 358 EGVTAYVIDTGINIKHKEFGGRAVWGKTIPENDQDVDGNGHGTHCAGTIASKNYGVAKNA 417

Query: 281 XXXXXXXLRSNGSGSMSDVVKGVEFAAKSHQDAVKKNKKGFKGSTANMSLGGGKSPALDM 340
                  LRS+GSG+MSDV+KGVE+AA SHQ A+++ KKGFKGSTANMSLGGGKS +LD+
Sbjct: 418 EVVAVKVLRSDGSGTMSDVLKGVEYAAFSHQKALREKKKGFKGSTANMSLGGGKSRSLDL 477

Query: 341 AVNAAVKAGIHFAVAAGNENQDACNSSPAAAENAITVGASTLADDRAYFSNWGKCVDIFA 400
           AV+AAVK+GIHFAVAAGNENQDACNSSPAA+ENAITVGASTL+DDRAYFSNWGKCVD+FA
Sbjct: 478 AVDAAVKSGIHFAVAAGNENQDACNSSPAASENAITVGASTLSDDRAYFSNWGKCVDVFA 537

Query: 401 PGLNVLSTYIGSETATATLSGTSMASPHVAGLLTYFLSLQPDSDSEYFHA-AGGITPSQL 459
           PGLN+LSTYIGS+ ATATLSGTSMASPHVAGLL+YFLS+QPD+DSE+F + +  I+P+QL
Sbjct: 538 PGLNILSTYIGSDEATATLSGTSMASPHVAGLLSYFLSMQPDADSEFFSSGSNSISPAQL 597

Query: 460 KKKLIAYSTKNALGDLPEDTVNYLIYNGGGQDLDDFWVKDLEEKVADAKDNTASEFESII 519
           KKKLIAYSTKN   DLPE T N L+YN  G ++ DFW    E      +     E E ++
Sbjct: 598 KKKLIAYSTKNLFQDLPEKTPNLLVYN-AGHNISDFWKPKSESSAEPNERAKEFELEDLV 656

Query: 520 DALEEKTDGLYEEIREIFEGLNII 543
           D+ +   D     I+++FE +++ 
Sbjct: 657 DSAQWIADTWLNGIQQVFERMDLF 680

>Ecym_3018 Chr3 (33738..35465) [1728 bp, 575 aa] {ON} similar to
           Ashbya gossypii ACR012C
          Length = 575

 Score =  583 bits (1504), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/472 (61%), Positives = 354/472 (75%), Gaps = 11/472 (2%)

Query: 79  AIPHRYIVVFKDRVLPEEVDFHMEVVSEAHAQSVGKLDANDAFFEAT--MDEEMGIMATS 136
           AIPHRYIV+FKD V   +V  H ++V+ AH +++ +LD   +FF+AT  M  E GI A S
Sbjct: 108 AIPHRYIVIFKDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMHHE-GISARS 166

Query: 137 REGGILDSFDVNGMLRGYIGYFTQEIVDFIRMNPLVAFVEQDSMVYANEFDTQNGAPWGL 196
            EGGI + F++ G LRGY GYFT  ++D IR + LV  +EQDS+V+A++F+TQ GAPWGL
Sbjct: 167 VEGGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWGL 226

Query: 197 SRISHREKLNLGSFNKYLYDDAAGKGVTSYVIDTGINIDHKDFEGRAAWGKTVPTNDLDQ 256
           +R+SHRE+LNLGSFNKYLYDD AGKGVT+YVIDTGINIDH +FEGRA WGKT+P+ND D 
Sbjct: 227 ARVSHRERLNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDADY 286

Query: 257 DGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVVKGVEFAAKSHQDAVKK 316
           DGNGHGTHCAGTIASK YG            LR+NG+G+MSDV++GVE+    H+ A   
Sbjct: 287 DGNGHGTHCAGTIASKTYGVAKNAKVVAVKVLRTNGTGTMSDVLRGVEYVVAEHRKA--S 344

Query: 317 NKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACNSSPAAAENAIT 376
               FKGSTANMSLGGGKS AL++AV+AAV AGIHFAVAAGNENQDACN+SPA+++  IT
Sbjct: 345 GDPNFKGSTANMSLGGGKSAALELAVDAAVAAGIHFAVAAGNENQDACNTSPASSKKCIT 404

Query: 377 VGASTLADDRAYFSNWGKCVDIFAPGLNVLSTYIGSETATATLSGTSMASPHVAGLLTYF 436
           V ASTL+DDRAYFSNWG CVDIFAPGLN+LSTYIGS+TA ATLSGTSMASPHVAGLL YF
Sbjct: 405 VAASTLSDDRAYFSNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASPHVAGLLAYF 464

Query: 437 LSLQPDSDSEYFHAAGGITPSQLKKKLIAYSTKNALGDLPEDTVNYLIYNGGGQDLDDFW 496
           LSLQPDS SEY+     I+P  LKKK++AY +KN L ++P  T N LI+NGGG  LD FW
Sbjct: 465 LSLQPDSGSEYY-TGSSISPEALKKKIVAYGSKNLLNNVPARTANNLIFNGGGGSLDSFW 523

Query: 497 ---VKDLEEKVADAKDNTASEF--ESIIDALEEKTDGLYEEIREIFEGLNII 543
                  E++   +    A +F  ES++D L   +  L+ EIR   + L++I
Sbjct: 524 NSKCDGCEQEKVSSSHGKADDFESESLMDCLHSTSHSLFGEIRNFLDRLDLI 575

>CAGL0B03619g Chr2 (361572..362978) [1407 bp, 468 aa] {ON} similar
           to uniprot|P09232 Saccharomyces cerevisiae YEL060c PRB1
           protease B or uniprot|P25036 Saccharomyces cerevisiae
           YOR003w YSP3
          Length = 468

 Score =  573 bits (1477), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/474 (61%), Positives = 355/474 (74%), Gaps = 17/474 (3%)

Query: 80  IPHRYIVVFKDRVLPEEVDFHMEVVSEAHAQSVGKLDANDAFFEATMDEEMGIMATSREG 139
           +PH+YIVV K  V PE V   +  VS AHA ++  L     FF     E +        G
Sbjct: 2   VPHKYIVVLKKGVSPEAVATFLNDVSAAHAAAIRDLPKEHDFFNFVNAEGL------PRG 55

Query: 140 GILDSFDVNGMLRGYIGYFTQEIVDFIRMNPLVAFVEQDSMVYANEFDTQNGAPWGLSRI 199
           GI D F++N + +G IGYF + +V  +  + +V FVE+DS+V+A+ FDTQN APWGL+RI
Sbjct: 56  GIKDLFNINDLFQGLIGYFPEPVVKLLEKSDIVEFVERDSVVHASNFDTQNNAPWGLARI 115

Query: 200 SHREKLNLGSFNKYLYDDAAGKGVTSYVIDTGINIDHKDFEGRAAWGKTVPTNDLDQDGN 259
           SHR++LNLG+FNKYLYD+A G+GVT+YVIDTGIN+ H +F+GRA WGKT+P NDLD DGN
Sbjct: 116 SHRDRLNLGNFNKYLYDNAGGEGVTAYVIDTGINVKHVEFDGRAQWGKTIPLNDLDIDGN 175

Query: 260 GHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVVKGVEFAAKSHQDAVKKNKK 319
           GHGTHCAGTIASKHYG            L+S+GSG+MSDV+KGVE+AA++H    K NKK
Sbjct: 176 GHGTHCAGTIASKHYGIAKKANVVAVKVLKSDGSGTMSDVIKGVEYAAQAHLKESKNNKK 235

Query: 320 GFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACNSSPAAAENAITVGA 379
            FKGSTANMSLGGGKSPALDMAVNAAV AGIHFAVAAGNENQDACN+SPA+AE AITVGA
Sbjct: 236 -FKGSTANMSLGGGKSPALDMAVNAAVSAGIHFAVAAGNENQDACNTSPASAEKAITVGA 294

Query: 380 STLADDRAYFSNWGKCVDIFAPGLNVLSTYIG-SETATATLSGTSMASPHVAGLLTYFLS 438
           STL+DDRAYFSNWGKCVDIFAPGLN+LSTYIG +   TA+LSGTSMASPHVAGLLTYFLS
Sbjct: 295 STLSDDRAYFSNWGKCVDIFAPGLNILSTYIGDTNRETASLSGTSMASPHVAGLLTYFLS 354

Query: 439 LQPDSDSEYFHAAG-GITPSQLKKKLIAYSTKNALGDLPE-DTVNYLIYNGGGQDLDDFW 496
           LQPDSDSE++ A+  G+TP+QLKKKLIAYSTKN L DLP+ D+ N LIYNG G DL  FW
Sbjct: 355 LQPDSDSEFYDASKHGVTPAQLKKKLIAYSTKNVLTDLPDPDSPNLLIYNGAGGDLGVFW 414

Query: 497 --VKDLEEKVADAKDNTASE--FESIIDALEEK---TDGLYEEIREIFEGLNII 543
                 E+     +   A+E   +S+   + ++   TD L+ ++R + + +NII
Sbjct: 415 NSTSADEQSAEHPEQRIAAELGLDSLAKMVGDRHAATDSLFGQVRNLLDKMNII 468

>KNAG0E00920 Chr5 complement(174432..176027) [1596 bp, 531 aa] {ON}
           Anc_6.14 YOR003W
          Length = 531

 Score =  562 bits (1449), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/461 (60%), Positives = 332/461 (72%), Gaps = 26/461 (5%)

Query: 83  RYIVVFKDRVLPEEVDFHMEVVSEAHAQSVGKLDANDAFFEATMDEEMGIMATSREGGIL 142
           +YI++FK+ V  E++  H +++ +                E +     GI+A      +L
Sbjct: 97  KYIILFKEGVTAEQISAHKQLLQQV-------------LLETSDVSAQGIVAD-----VL 138

Query: 143 DSFDVNGMLRGYIGYFTQEIVDFIRMNPLVAFVEQDSMVYANEFDTQNGAPWGLSRISHR 202
           DSFD+ G+L GY+   +  +++ +R +P V  VEQDS V+ NEFDTQN APWGL+RISHR
Sbjct: 139 DSFDLEGVLSGYVAELSPMVLELVRRSPFVQLVEQDSEVHTNEFDTQNNAPWGLARISHR 198

Query: 203 EKLNLGSFNKYLYDDAAGKGVTSYVIDTGINIDHKDFEGRAAWGKTVPTNDLDQDGNGHG 262
           + L+LGSFNKYLYDDAAG+GV SY+IDTGIN+ HK+FEGRA WGKT+P ND D+DGNGHG
Sbjct: 199 DPLSLGSFNKYLYDDAAGEGVDSYIIDTGINVKHKEFEGRAQWGKTIPDNDFDEDGNGHG 258

Query: 263 THCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVVKGVEFAAKSHQDAVKKNKKGFK 322
           THCAGTIASKHYG            LRSNGSGSMSDV+ GVEFAAK H    K N K FK
Sbjct: 259 THCAGTIASKHYGVAKRANVIAVKVLRSNGSGSMSDVIMGVEFAAKQHASKAKSNDKKFK 318

Query: 323 GSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACNSSPAAAENAITVGASTL 382
           GSTANMSLGGGKSP+LD  V+AAVK G+HF+VAAGNENQDACN+SPAA+E AITVGASTL
Sbjct: 319 GSTANMSLGGGKSPSLDRVVDAAVKLGLHFSVAAGNENQDACNTSPAASERAITVGASTL 378

Query: 383 ADDRAYFSNWGKCVDIFAPGLNVLSTYIGSETATATLSGTSMASPHVAGLLTYFLSLQPD 442
           +DDRAYFSNWG CVDIFAPGLN+LSTY GS+ ATATLSGTSMASPHVAGLLTYFLSLQP+
Sbjct: 379 SDDRAYFSNWGSCVDIFAPGLNILSTYTGSDDATATLSGTSMASPHVAGLLTYFLSLQPE 438

Query: 443 SDSEYFHAAGGITPSQLKKKLIAYSTKNALGDLPEDTVNYLIYNGGGQDLDDFWVKDLEE 502
             S+ F  +  ITP QLKKKL+ YSTK  L DLPEDT N LIYNGGG DL DFW      
Sbjct: 439 KSSQ-FGTSAQITPEQLKKKLLDYSTKGVLFDLPEDTPNALIYNGGGADLSDFWGD---- 493

Query: 503 KVADAKDNTASEFESIIDALEEKTDGLYEEIREIFEGLNII 543
                K +    F    D +   +D ++E++R +F  LNI 
Sbjct: 494 ---KGKKSHKPLFAHEYDNVWASSDAMFEQVRAMFGKLNIF 531

>KAFR0L00360 Chr12 (64781..66289) [1509 bp, 502 aa] {ON} Anc_6.14
           YOR003W
          Length = 502

 Score =  560 bits (1444), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/434 (62%), Positives = 335/434 (77%), Gaps = 10/434 (2%)

Query: 66  TLSPLVTARNMYDAIPHRYIVVFKDRVLPEEVDFHMEVVSEAHAQSVGKLDANDAFFEAT 125
           +L+P+  A +  + IPHRYI+VFKD V  E++ FH E+++  H Q      +ND  F   
Sbjct: 45  SLAPVHNA-DAENIIPHRYIIVFKDGVSKEQIQFHKELITTLHLQQSSAF-SND--FTEY 100

Query: 126 MDEEMGIMATSRE--GGILDSFDVNGMLRGYIGYFTQEIVDFIRMNPLVAFVEQDSMVYA 183
           +  ++ +  + R+  GGI+  FD++ +L GYI Y + E++ FIR+NPL+AF+E D+MV+ 
Sbjct: 101 LQTDINVPESMRQSLGGIVSDFDISSLLSGYIAYLSDELLHFIRLNPLIAFIEHDTMVHT 160

Query: 184 NEFDTQNGAPWGLSRISHREKLNLGSFNKYLYDDAAGKGVTSYVIDTGINIDHKDFEGRA 243
            +F+TQN APWGL+RISHRE LNL +FNKYLYDD AGK V +YVIDTG++++H +F  RA
Sbjct: 161 TDFNTQNNAPWGLARISHRESLNLANFNKYLYDDDAGKNVDAYVIDTGVDVNHVEFHSRA 220

Query: 244 AWGKTVPTNDLDQDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVVKGV 303
            WGKT+P ND D DGNGHGTH AGTI S+HYG            LRSNGSGSMSDVVKGV
Sbjct: 221 HWGKTIPLNDQDIDGNGHGTHVAGTIGSQHYGVAKSVNIIAVKVLRSNGSGSMSDVVKGV 280

Query: 304 EFAAKSHQDAVKKNKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDA 363
           EFA  SH + + KN+K  KGS ANMSLGGGKSPALD+AVNAAVKAGIHFAVAAGNENQ+A
Sbjct: 281 EFAVSSHLERM-KNEKNLKGSVANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQNA 339

Query: 364 CNSSPAAAENAITVGASTLADDRAYFSNWGKCVDIFAPGLNVLSTYIGS-ETATATLSGT 422
           CNSSPA+AE A+TVGAST++D+RAYFSNWG+CVDIFAPGLN+LSTYIG+ +  TATLSGT
Sbjct: 340 CNSSPASAEQAVTVGASTISDERAYFSNWGECVDIFAPGLNILSTYIGANDDVTATLSGT 399

Query: 423 SMASPHVAGLLTYFLSLQPDSDSEYFHAAGGITPSQLKKKLIAYSTKNALGDLPEDTVNY 482
           SMASPHVAGLL Y+LSLQP+  SE+  +   I+ SQLKKKLI Y+TK+ L DLPE T N 
Sbjct: 400 SMASPHVAGLLAYYLSLQPEKSSEF--STRAISTSQLKKKLIEYATKDVLEDLPEGTPNV 457

Query: 483 LIYNGGGQDLDDFW 496
           LIYNGGGQDL DFW
Sbjct: 458 LIYNGGGQDLSDFW 471

>Kpol_1045.75 s1045 complement(174970..176403) [1434 bp, 477 aa]
           {ON} complement(174972..176405) [1434 nt, 478 aa]
          Length = 477

 Score =  526 bits (1354), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 257/421 (61%), Positives = 309/421 (73%), Gaps = 6/421 (1%)

Query: 78  DAIPHRYIVVFKDRVLPEEVDFHMEVVSEAHAQSVGKLDANDAFFEATMDEEMGIMATSR 137
           + IP+ YIVVF + V   E+  H+E +S+   QSV  L  +  FF  T+     + +   
Sbjct: 33  EVIPYNYIVVFNEGVTQNEISLHIETMSQLQLQSVTDLPYDHEFF--TISTSSDVNSNGL 90

Query: 138 EGGILDSFDVNGMLRGYIGYFTQEIVDFIRMNPLVAFVEQDSMVYANEFDTQNGAPWGLS 197
            GG+ D F +   L GY G FT E+V+F+R++PLV F+E+DSMV+  E  TQ  APWGL+
Sbjct: 91  LGGVRDMFKIGNDLHGYTGMFTDEVVEFLRLSPLVKFIERDSMVHTTEATTQYNAPWGLA 150

Query: 198 RISHREKLNLGSFNKYLYDDAAGKGVTSYVIDTGINIDHKDFEGRAAWGKTVPTNDLDQD 257
           RISHR +LNL +FNKYLYDD  GKGV +YVIDTGINI + DF GRA WGKT+P  + + D
Sbjct: 151 RISHRSRLNLSTFNKYLYDDLGGKGVKAYVIDTGINITNVDFGGRAYWGKTIPAGEANVD 210

Query: 258 GNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVVKGVEFAAKSHQDAVKKN 317
           GNGHGTH AGTIAS HYG            LRSNG+GSMSDV+KGVE+   +HQ  V   
Sbjct: 211 GNGHGTHVAGTIASIHYGVAKQVKVYAVKVLRSNGAGSMSDVLKGVEYVVGAHQRDV--G 268

Query: 318 KKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACNSSPAAAENAITV 377
             GFKGS ANMSLGGGKS +LD+AVNAAV AG+HFAVAAGNENQDACN+SPAAAE AITV
Sbjct: 269 TAGFKGSVANMSLGGGKSRSLDLAVNAAVGAGVHFAVAAGNENQDACNTSPAAAERAITV 328

Query: 378 GASTLADDRAYFSNWGKCVDIFAPGLNVLSTYIGSETATATLSGTSMASPHVAGLLTYFL 437
           GASTL+D RAYFSNWG+CV IFAPGLN+LSTYIGS  ATATLSGTSMASPH+AGL+ YFL
Sbjct: 329 GASTLSDSRAYFSNWGQCVSIFAPGLNILSTYIGSPDATATLSGTSMASPHIAGLVAYFL 388

Query: 438 SLQPDSDSEYFH--AAGGITPSQLKKKLIAYSTKNALGDLPEDTVNYLIYNGGGQDLDDF 495
           SLQP   S+++    A  ITP QLKKK++A+ TKNAL DLP +T N + YNG G+ L+DF
Sbjct: 389 SLQPAVKSQFYSQGQATAITPDQLKKKIVAFGTKNALRDLPANTPNVIAYNGAGKSLEDF 448

Query: 496 W 496
           W
Sbjct: 449 W 449

>TPHA0M00230 Chr13 (45121..46878) [1758 bp, 585 aa] {ON} Anc_6.14
           YOR003W
          Length = 585

 Score =  517 bits (1331), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 271/473 (57%), Positives = 337/473 (71%), Gaps = 34/473 (7%)

Query: 83  RYIVVFKDRVLPEEVDFHMEVVSEAHAQSVGKLDANDAFFEATMDEEMGIMATS----RE 138
           RYI+VFK  V  E+VD H++++S              A F    +E+    A      R+
Sbjct: 135 RYIIVFKKGVFKEQVDQHLKMMS--------------ALFRRLSEEQRPAAAPGASALRD 180

Query: 139 G--GILDSFDVNGMLRGYIGYF-TQEIVDFIRMNPLVAFVEQDSMVYANEFDTQNGAPWG 195
           G   ++D+F+V G   GYI    + +IVDFIR+NPLV +VE+DS+V++ + +TQN APWG
Sbjct: 181 GFDRVMDTFEVAGAFSGYIATVASPKIVDFIRLNPLVDYVEKDSVVHSLD-ETQNNAPWG 239

Query: 196 LSRISHREKLNLGSFNKYLY-DDAAGKGVTSYVIDTGINIDHKDFEGRAAWGKTVPTNDL 254
           L+RISHRE LNLG+FNKYLY  ++AGKGVT+YV+DTGI++ H +F  RA WGKT+P ND 
Sbjct: 240 LARISHREGLNLGNFNKYLYASNSAGKGVTAYVVDTGISVSHLEFGERAKWGKTIPINDY 299

Query: 255 DQDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVVKGVEFAAKSHQDAV 314
           D DGNGHGTHCAGTI S+HYG            LRS+GSG+MSDV+KGVE+ A  H   +
Sbjct: 300 DIDGNGHGTHCAGTIGSEHYGVAKGANLVAVKVLRSDGSGTMSDVLKGVEWVALEHTKHL 359

Query: 315 KKNKK----GFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACNSSPAA 370
           ++++K     +KG+TANMSLGGGKSPALD AVNAAVKAG+HFAVAAGNENQDACNSSPAA
Sbjct: 360 EESRKDKNSNYKGATANMSLGGGKSPALDQAVNAAVKAGVHFAVAAGNENQDACNSSPAA 419

Query: 371 AENAITVGASTLADDRAYFSNWGKCVDIFAPGLNVLSTYIGSETATATLSGTSMASPHVA 430
           AENAITVGASTL+DDRAYFSN+GKCVDIFAPGLN+LSTYIG+  ATATLSGTSMASPHVA
Sbjct: 420 AENAITVGASTLSDDRAYFSNYGKCVDIFAPGLNILSTYIGTNDATATLSGTSMASPHVA 479

Query: 431 GLLTYFLSLQPDSDSEYFHAAGGITPSQLKKKLIAYSTKNALGDLPEDTVNYLIYNGGGQ 490
           GLLTY LSLQPD  SE++     +TP Q+KKK+I Y+TKNAL DLP DT N LIYNGG  
Sbjct: 480 GLLTYLLSLQPDKGSEFYVPNSELTPLQMKKKIIDYATKNALADLPADTPNKLIYNGGFN 539

Query: 491 DLDDFWVKDLEEKVADAKDNTASEFESIIDALEEKTDGLYEEIREIFEGLNII 543
              DFW      +    K N  S   S +D++++  +  +      F+ +NI 
Sbjct: 540 ST-DFWASAAAPQSHKVKTNRYS-LGSFLDSIQDSNNHWFN-----FDNMNIF 585

>Smik_15.172 Chr15 (298772..300208) [1437 bp, 478 aa] {ON} YOR003W
           (REAL)
          Length = 478

 Score =  503 bits (1295), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 237/419 (56%), Positives = 307/419 (73%), Gaps = 5/419 (1%)

Query: 78  DAIPHRYIVVFKDRVLPEEVDFHMEVVSEAHAQSVGKLDANDAFFEATMDEEMGIMATSR 137
           + IP+RYIVVF + +  + ++ H ++V EAH+ SV KL  +D F E        I    +
Sbjct: 65  ELIPYRYIVVFNEDISIKSIESHRKMVQEAHSVSVSKLAEDDVFLEVVSSS---IAPDLQ 121

Query: 138 EGGILDSFDVNGMLRGYIGYFTQEIVDFIRMNPLVAFVEQDSMVYANEFDTQNGAPWGLS 197
            GGI  SFD+NG+ RGY GYFT EI++ +  +PL+ F+EQ+S V  +    Q  APWGL 
Sbjct: 122 LGGIDSSFDINGLFRGYAGYFTDEILNLVSQDPLIKFIEQESTVRLSNTSMQKDAPWGLH 181

Query: 198 RISHREKLNLGSFNKYLYDDAAGKGVTSYVIDTGINIDHKDFEGRAAWGKTVPTNDLDQD 257
           RISHREK   G   +YLY+DAAG+GVTSYV+DTGI+ +H+DFEGRA WG  +P ND   D
Sbjct: 182 RISHREKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDTEHEDFEGRAVWGAVIPGNDEASD 241

Query: 258 GNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVVKGVEFAAKSHQDAVKKN 317
            NGHGTHCAG I SKHYG            LRSNG G++SDV+KG+E+ A+ H ++ +K 
Sbjct: 242 LNGHGTHCAGIIGSKHYGVAKNTKLVAVKVLRSNGEGTVSDVIKGIEYVAREHIESSRKK 301

Query: 318 KKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACNSSPAAAENAITV 377
            K FKGSTAN+SLG  KS A++MAV+AAV +G+HFA+AAGNEN+DAC SSPA A+ +ITV
Sbjct: 302 SKEFKGSTANLSLGSSKSLAMEMAVDAAVDSGVHFAIAAGNENEDACLSSPAGAQKSITV 361

Query: 378 GASTLADDRAYFSNWGKCVDIFAPGLNVLSTYIGSETATATLSGTSMASPHVAGLLTYFL 437
           GAST +DDRA+FSNWG CVD+FAPG+N++STYIGS  AT +LSGTSMA+PHVAG+L+YFL
Sbjct: 362 GASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGMLSYFL 421

Query: 438 SLQPDSDSEYFHAAGGITPSQLKKKLIAYSTKNALGDLPEDTVNYLIYNGGGQDLDDFW 496
           SLQP  DSEYF  A  ++P +LK+K++ +ST   LGD+ ++T N LIYNGGG+ LDD W
Sbjct: 422 SLQPAPDSEYFDNA--LSPQELKEKVLKFSTHGVLGDIGDNTPNRLIYNGGGKILDDLW 478

>YOR003W Chr15 (331455..332891) [1437 bp, 478 aa] {ON}  YSP3Putative
           precursor to the subtilisin-like protease III
          Length = 478

 Score =  502 bits (1292), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 237/417 (56%), Positives = 308/417 (73%), Gaps = 5/417 (1%)

Query: 80  IPHRYIVVFKDRVLPEEVDFHMEVVSEAHAQSVGKLDANDAFFEATMDEEMGIMATSREG 139
           +P+RY++VF + +  +++  HM+VV + H+ SVGKL  NDAF+           + S+ G
Sbjct: 67  LPYRYVIVFNEDISLQQIQSHMQVVQKDHSTSVGKLTENDAFWRVISSSVS---SKSQFG 123

Query: 140 GILDSFDVNGMLRGYIGYFTQEIVDFIRMNPLVAFVEQDSMVYANEFDTQNGAPWGLSRI 199
           GI + FD+NG+ RGY GYFT EI+  I  +P++ FVEQ++ V  +    Q  APWGL R+
Sbjct: 124 GIDNFFDINGLFRGYTGYFTDEIIKIISQDPIIKFVEQETTVKISNSSLQEEAPWGLHRV 183

Query: 200 SHREKLNLGSFNKYLYDDAAGKGVTSYVIDTGINIDHKDFEGRAAWGKTVPTNDLDQDGN 259
           SHREK   G   +YLY+DAAGKGVTSYV+DTGI+ +H+DFEGRA WG  +P ND   D N
Sbjct: 184 SHREKPKYGQDLEYLYEDAAGKGVTSYVLDTGIDTEHEDFEGRAEWGAVIPANDEASDLN 243

Query: 260 GHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVVKGVEFAAKSHQDAVKKNKK 319
           GHGTHCAG I SKH+G            LRSNG G++SDV+KG+E+  K H ++ KK  K
Sbjct: 244 GHGTHCAGIIGSKHFGVAKNTKIVAVKVLRSNGEGTVSDVIKGIEYVTKEHIESSKKKNK 303

Query: 320 GFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACNSSPAAAENAITVGA 379
            FKGSTAN+SLG  KS A++MAVNAAV +G+HFA+AAGNE++DAC SSPA AE +ITVGA
Sbjct: 304 EFKGSTANLSLGSSKSLAMEMAVNAAVDSGVHFAIAAGNEDEDACLSSPAGAEKSITVGA 363

Query: 380 STLADDRAYFSNWGKCVDIFAPGLNVLSTYIGSETATATLSGTSMASPHVAGLLTYFLSL 439
           ST +DDRA+FSNWG CVD+FAPG+N++STYIGS  AT +LSGTSMASPHVAG+L+YFLSL
Sbjct: 364 STFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMASPHVAGILSYFLSL 423

Query: 440 QPDSDSEYFHAAGGITPSQLKKKLIAYSTKNALGDLPEDTVNYLIYNGGGQDLDDFW 496
           QP  DSE+F+ A   +P +LK+K++ +ST+  LGD+ +DT N LIYNGGG+ LD FW
Sbjct: 424 QPAPDSEFFNDAP--SPQELKEKVLKFSTQGVLGDIGDDTPNKLIYNGGGKKLDGFW 478

>Suva_15.178 Chr15 (305907..307337) [1431 bp, 476 aa] {ON} YOR003W
           (REAL)
          Length = 476

 Score =  499 bits (1285), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 233/419 (55%), Positives = 307/419 (73%), Gaps = 7/419 (1%)

Query: 78  DAIPHRYIVVFKDRVLPEEVDFHMEVVSEAHAQSVGKLDANDAFFEATMDEEMGIMATSR 137
           +++P+RYI+ F +      ++ H  ++ E   +SV KL  +DAFF +T        +  +
Sbjct: 65  ESLPYRYIIAFHEDSSVRSIESHKRMIQEVQNESVSKLAKDDAFFVST-----SAPSDLQ 119

Query: 138 EGGILDSFDVNGMLRGYIGYFTQEIVDFIRMNPLVAFVEQDSMVYANEFDTQNGAPWGLS 197
            GGI   FD+NG+ RGY GYFT+E++  +  +P++ F+EQ+S V       Q  APWGL 
Sbjct: 120 FGGIDSFFDINGLFRGYTGYFTEEVIKRVLQDPIIKFIEQESTVKVTNSTFQEEAPWGLH 179

Query: 198 RISHREKLNLGSFNKYLYDDAAGKGVTSYVIDTGINIDHKDFEGRAAWGKTVPTNDLDQD 257
           RISHREK   G   +YLY+DAAG+GVTSYV+DTGI+I+H+DFEGRA WG  +P ND   D
Sbjct: 180 RISHREKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDINHEDFEGRAVWGAVIPDNDEASD 239

Query: 258 GNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVVKGVEFAAKSHQDAVKKN 317
            NGHGTHCAG I S+H+G            LRSNG G++SDV+KG+E+  K H D+ KK 
Sbjct: 240 LNGHGTHCAGIIGSRHFGVTKNTNLVAVKVLRSNGEGTVSDVIKGIEYVVKDHIDSSKKG 299

Query: 318 KKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACNSSPAAAENAITV 377
              FKGSTAN+SLG  KSPA++MAVNAAV++G+HFA+AAGNE++DAC SSPA AE +ITV
Sbjct: 300 GPKFKGSTANLSLGSSKSPAMEMAVNAAVESGVHFAIAAGNEDEDACLSSPAGAEKSITV 359

Query: 378 GASTLADDRAYFSNWGKCVDIFAPGLNVLSTYIGSETATATLSGTSMASPHVAGLLTYFL 437
           GAST +DDRA+FS+WG CVD+FAPG+N+LSTYIGS  A+ +LSGTSMA+PHVAG+L+YFL
Sbjct: 360 GASTFSDDRAFFSDWGTCVDVFAPGVNILSTYIGSRNASLSLSGTSMAAPHVAGILSYFL 419

Query: 438 SLQPDSDSEYFHAAGGITPSQLKKKLIAYSTKNALGDLPEDTVNYLIYNGGGQDLDDFW 496
           SLQP SDSE+F +   ++P QLK+K+I +ST+  LGD+ EDT N LIYNGGG+ LD+FW
Sbjct: 420 SLQPSSDSEFFDST--VSPQQLKEKIINFSTQGVLGDVGEDTPNRLIYNGGGRKLDNFW 476

>Skud_15.164 Chr15 (291471..292919) [1449 bp, 482 aa] {ON} YOR003W
           (REAL)
          Length = 482

 Score =  491 bits (1263), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 226/418 (54%), Positives = 301/418 (72%), Gaps = 5/418 (1%)

Query: 79  AIPHRYIVVFKDRVLPEEVDFHMEVVSEAHAQSVGKLDANDAFFEATMDEEMGIMATSRE 138
           ++P+RYI+VF + +    ++ H +++ +A   SV K+  +D+F               + 
Sbjct: 68  SLPYRYIIVFNEDITNRLIESHTQMIQKAQKVSVSKITEDDSFLRTV---SASASPNPQF 124

Query: 139 GGILDSFDVNGMLRGYIGYFTQEIVDFIRMNPLVAFVEQDSMVYANEFDTQNGAPWGLSR 198
           GGI  SFD+NG+ RGY GYFT E+++ +  +PLV F+E +S V  +    Q  APWGL R
Sbjct: 125 GGIDISFDINGLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQEDAPWGLHR 184

Query: 199 ISHREKLNLGSFNKYLYDDAAGKGVTSYVIDTGINIDHKDFEGRAAWGKTVPTNDLDQDG 258
           ISHRE+   G   +YLY+DAAG GVTSYV+DTGI+ +H+DFEGRA WG  +P ND   D 
Sbjct: 185 ISHRERAKYGQDLEYLYEDAAGTGVTSYVLDTGIDTEHEDFEGRAKWGAVIPENDEASDL 244

Query: 259 NGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVVKGVEFAAKSHQDAVKKNK 318
           NGHGTHCAG I S+H+G            LRSNG G++SDV+KG+E+ AK+H  + KK  
Sbjct: 245 NGHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIASSKKRG 304

Query: 319 KGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACNSSPAAAENAITVG 378
             FKGSTAN+SLG  KSPA++MAVNAAV  G+HFA+AAGNE++DAC SSPA AE +ITVG
Sbjct: 305 SKFKGSTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGAEKSITVG 364

Query: 379 ASTLADDRAYFSNWGKCVDIFAPGLNVLSTYIGSETATATLSGTSMASPHVAGLLTYFLS 438
           AST +DDRA+FSNWG CVD+FAPG+N++STYIGS  AT +LSGTSMA+PHVAG+L+Y LS
Sbjct: 365 ASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGILSYLLS 424

Query: 439 LQPDSDSEYFHAAGGITPSQLKKKLIAYSTKNALGDLPEDTVNYLIYNGGGQDLDDFW 496
           LQP  DSE+F+    ++P QLK+K++ +ST+  LGD+ E+T N L+YNGGG+ LD+FW
Sbjct: 425 LQPAQDSEFFYDT--VSPQQLKEKILKFSTRGVLGDVNEETPNRLVYNGGGKKLDEFW 480

>CAGL0E02651g Chr5 (251868..253325) [1458 bp, 485 aa] {ON} similar
           to uniprot|P25036 Saccharomyces cerevisiae YOR003w YSP3
           or uniprot|P09232 Saccharomyces cerevisiae YEL060c PRB1
          Length = 485

 Score =  447 bits (1150), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 224/417 (53%), Positives = 292/417 (70%), Gaps = 7/417 (1%)

Query: 80  IPHRYIVVFKDRVLPEEVDFHMEVVSEAHAQSVGKLDANDAFFEATMDEEMGIMATSREG 139
           IP+RYIV+FKD V  +E+  H+  + E ++ S+   D++  F +AT   ++    ++R  
Sbjct: 74  IPNRYIVLFKDFVTDKEIQSHLSAIEEINSSSIFLQDSD--FGKATQYNDI----STRGI 127

Query: 140 GILDSFDVNGMLRGYIGYFTQEIVDFIRMNPLVAFVEQDSMVYANEFDTQNGAPWGLSRI 199
           G+   F +   + GYIGYFT+    FI  +PLV  VE DS+V  N +  Q   PWGL RI
Sbjct: 128 GLQHEFSIGRSMTGYIGYFTETTAKFIANSPLVELVEHDSIVRINNYKMQEHVPWGLGRI 187

Query: 200 SHREKLNLGSFNKYLYDDAAGKGVTSYVIDTGINIDHKDFEGRAAWGKTVPTNDLDQDGN 259
           S REKL +     Y YDD  GK   ++VIDTGI +DH+DFEGRA+WGKT+  ND D D N
Sbjct: 188 SQREKLPILGKRFYHYDDRGGKDTVTFVIDTGIYVDHEDFEGRASWGKTIVENDNDYDLN 247

Query: 260 GHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVVKGVEFAAKSHQDAVKKNKK 319
           GHGTHCAGTIASKHYG            LRS+GSGSMSDV++GVE+  +++ D +KK K 
Sbjct: 248 GHGTHCAGTIASKHYGIAKQAEVIAVKVLRSDGSGSMSDVIRGVEYTVEAYND-LKKTKS 306

Query: 320 GFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACNSSPAAAENAITVGA 379
             KG+  NMSLG  KS AL+ A++AA  AGI FAVAAGNE+ DACNSSPA+A + ITVG 
Sbjct: 307 NLKGAAGNMSLGAWKSYALNRAMDAAAAAGISFAVAAGNESDDACNSSPASAWSPITVGG 366

Query: 380 STLADDRAYFSNWGKCVDIFAPGLNVLSTYIGSETATATLSGTSMASPHVAGLLTYFLSL 439
           STL+DD A+FSN+G+CVDIFAPG+N++STYIGS+ AT +LSGTSM+SPHVAG+L Y+LSL
Sbjct: 367 STLSDDVAFFSNYGRCVDIFAPGVNIMSTYIGSKNATESLSGTSMSSPHVAGVLAYYLSL 426

Query: 440 QPDSDSEYFHAAGGITPSQLKKKLIAYSTKNALGDLPEDTVNYLIYNGGGQDLDDFW 496
           QPD  S+++H    I+P  LKKK++ Y+T   L  LP +TVN L+YNGGG++L  FW
Sbjct: 427 QPDHKSQFYHEHSAISPKILKKKVLNYATNGTLSYLPAETVNLLVYNGGGKNLSKFW 483

>KAFR0B06550 Chr2 (1359770..1361140) [1371 bp, 456 aa] {ON} Anc_6.14
           YOR003W
          Length = 456

 Score =  400 bits (1028), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 203/419 (48%), Positives = 266/419 (63%), Gaps = 23/419 (5%)

Query: 78  DAIPHRYIVVFKDRVLPEEVDFHMEVVSEAHAQSVGKLDANDAFFEATMDEEMGIMATSR 137
           D I  +YIV+FK+  +  E + H + +         + D  D       D +        
Sbjct: 58  DIIKDQYIVIFKNSAMMAEKELHFKQLKNFIKTYSYEWDEKD-------DHKSN------ 104

Query: 138 EGGILDSFDVNGMLRGYIGYFTQEIVDFIRMNPLVAFVEQDSMVYANEFDTQNGAPWGLS 197
               L+ F +   L GYI     E +  +R +P+V  +E DS V+A +   Q   PWGLS
Sbjct: 105 ----LNIFKIGTTLSGYILRGPIETLQLLRQDPIVQLIEPDSKVHALKLKIQEDTPWGLS 160

Query: 198 RISHREKLNLGSFNKYLYDDAAGKGVTSYVIDTGINIDHKDFEGRAAWGKTVPTNDLDQD 257
           RIS R ++ +G    Y YDDA    VT+YV+DTGI I H+ F GRA WGKT+  ND+D+D
Sbjct: 161 RISQRPRVRIGQDQLYYYDDATSGNVTAYVLDTGIMISHEQFNGRARWGKTIVPNDVDED 220

Query: 258 GNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVVKGVEFAAKSHQDAVKKN 317
            +GHGTH AG IAS  +G            LRSNG G MSDV+KG+EF    H     KN
Sbjct: 221 NSGHGTHVAGIIASDKFGVAKTCEVVAVKVLRSNGEGDMSDVLKGIEFVVDDHS----KN 276

Query: 318 KKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACNSSPAAAENAITV 377
           K   KGS  N+SLG  KSPAL +A++AA+   IHFAVAAGNEN DAC +SPA A  AITV
Sbjct: 277 KNYSKGSVVNLSLGASKSPALVLAIDAAISENIHFAVAAGNENMDACYTSPADARRAITV 336

Query: 378 GASTLADDRAYFSNWGKCVDIFAPGLNVLSTYIGSETATATLSGTSMASPHVAGLLTYFL 437
           GAS  +D+RA+FSNWG+CVD+FAPG+NV+STYIGS+ AT +LSGTS A+P+ AGL+ Y+L
Sbjct: 337 GASIFSDERAFFSNWGECVDVFAPGMNVMSTYIGSDNATLSLSGTSAAAPYTAGLIAYYL 396

Query: 438 SLQPDSDSEYFHAAGGITPSQLKKKLIAYSTKNALGDLPEDTVNYLIYNGGGQDLDDFW 496
           SLQPD DS YF   G +TPS+LK+K++A+ +K+ L +LPE+T N +IYNG G++L  FW
Sbjct: 397 SLQPDKDSGYF--TGEMTPSKLKEKIVAFGSKDVLYELPENTPNIVIYNGAGRNLSHFW 453

>NCAS0D02630 Chr4 (506222..507577) [1356 bp, 451 aa] {ON} Anc_6.14
          Length = 451

 Score =  370 bits (950), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 189/433 (43%), Positives = 264/433 (60%), Gaps = 28/433 (6%)

Query: 68  SPLVTARNMYDAIPHRYIVVFKDRVLPEEVDFHMEVVSEAHAQSVGKLDANDAFFEATMD 127
           SP     +    IP++YIV+FK      + + H+                      AT++
Sbjct: 41  SPSNIIHHAASPIPNQYIVLFKSDTTDIQRETHL----------------------ATLN 78

Query: 128 EEMGIMATSREGGILDSFDVNGMLRGYIGYFTQEIVDFIRMNPLVAFVEQDSMVYANEFD 187
             +  + T  +  IL SF +   L+GY     ++++  +  +P++  +EQDS V+A    
Sbjct: 79  SWL--LNTDPQYTILHSFQLAHDLQGYTSRLPEQLIRSLATDPIIQSIEQDSYVHALGRQ 136

Query: 188 TQNGAPWGLSRISHREKLNLGSFNKYLYDDA-AGKGVTSYVIDTGINIDHKDFEGRAAWG 246
            Q  +PWGL+RIS RE+L L     Y YDD+ A      Y++DTGIN +H +F+GRA WG
Sbjct: 137 KQIDSPWGLARISQRERLKLLQDQFYHYDDSGASSNTKCYILDTGINENHNEFQGRAKWG 196

Query: 247 KT-VPTNDLDQDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVVKGVEF 305
               P     +D NGHGTHCAG I S  YG            L + G G MS V++G+E+
Sbjct: 197 AVFTPMEPNQEDENGHGTHCAGVIGSHEYGVAKNTTLIAVKVLDARGDGEMSAVIRGIEY 256

Query: 306 AAKSH-QDAVKKNKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDAC 364
             + H QD  K+++ GFKGS  N+SLG GKSPAL   + AAVK G+HFAVAAGNE+ DAC
Sbjct: 257 VTQQHEQDMKKQDQTGFKGSVINLSLGAGKSPALLRVIEAAVKLGVHFAVAAGNEDDDAC 316

Query: 365 NSSPAAAENAITVGASTLADDRAYFSNWGKCVDIFAPGLNVLSTYIGSE-TATATLSGTS 423
           ++SPA + +A+TVGAS+ +DDR +FSNWG CVD+FAPG+N++STYIG     T +LSGTS
Sbjct: 317 STSPADSPHALTVGASSFSDDRVFFSNWGPCVDVFAPGINIMSTYIGPHNNETTSLSGTS 376

Query: 424 MASPHVAGLLTYFLSLQPDSDSEYFHAAGGITPSQLKKKLIAYSTKNALGDLPEDTVNYL 483
           M++P V GL+ YFLSLQPD+ S+++      TP QLK K+I++ST+  L ++PE T N +
Sbjct: 377 MSAPFVTGLIAYFLSLQPDTKSQFYTGITSPTPYQLKYKIISFSTEGVLHEIPEGTPNRI 436

Query: 484 IYNGGGQDLDDFW 496
           +YNGGG  L DFW
Sbjct: 437 VYNGGGHSLKDFW 449

>NDAI0I02280 Chr9 complement(519169..520617) [1449 bp, 482 aa] {ON} 
          Length = 482

 Score =  338 bits (867), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 191/428 (44%), Positives = 261/428 (60%), Gaps = 26/428 (6%)

Query: 80  IPHRYIVVFKDRVLPEEVDFHMEVVSEAHAQSVGKLDANDAFFEATMDEEMGIMATSREG 139
           IP +YIV+F++     ++    + +S    +   K + ND + +     ++         
Sbjct: 63  IPDQYIVLFENDTTDLQISRFEQFLSSLIEEDNQKYNVNDNYSKVLSRFQI--------- 113

Query: 140 GILDSFDVNGML-RGYIGYFTQEIVDFI-RMNPLVAFVEQDSMVYANEFDTQNGAPWGLS 197
               S D  GM+ R  I  F +++ + I     ++  +E+DS V+ N+F TQ  + WGLS
Sbjct: 114 ----SNDTKGMIIRAPIDDFLEDVKNNIFNYQKIIKIIERDSYVHMNKFTTQIDSSWGLS 169

Query: 198 RISHREKLNLGSFNKYLYDD-AAGKGVTSYVIDTGINIDHKDFEGRAAWGKTVPTNDLD- 255
           RIS R  L L     Y YDD  +GKGV  Y++DTGIN +H +FEGRA+WG ++P  +   
Sbjct: 170 RISQRNHLKLLQDQFYFYDDNGSGKGVDCYILDTGINSNHIEFEGRASWGVSLPVTEPSL 229

Query: 256 QDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVVKGVEFAAKSHQDAVK 315
           +D NGHGTHCAG I SK YG            L   G GSMSDV+ G+EF A SH +   
Sbjct: 230 EDSNGHGTHCAGIIGSKTYGVAKETNLIAVKVLDFKGDGSMSDVILGLEFVANSHTNKTN 289

Query: 316 KNKKG------FKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACNSSPA 369
                      FKGS  N+SLG  KSP+LD+A+ +A K GIH  VAAGNE++DAC +SPA
Sbjct: 290 NISSSSSVHSEFKGSVVNLSLGAPKSPSLDIALESAKKIGIHITVAAGNEDEDACMTSPA 349

Query: 370 AAENAITVGASTLADDRAYFSNWGKCVDIFAPGLNVLSTYIG-SETATATLSGTSMASPH 428
            +   ITVGAS+ +DDRA+FSNWG CVD+FAPG+N+ STYIG +   T +LSG+SM+SP 
Sbjct: 350 DSPAVITVGASSFSDDRAFFSNWGPCVDVFAPGINIKSTYIGPNNNETLSLSGSSMSSPF 409

Query: 429 VAGLLTYFLSLQPDSDSEYFHAAGGITPSQLKKKLIAYSTKNALGDLPEDTVNYLIYNGG 488
           V+GL  Y+LSLQPD  S++  +   +TP QLK+K+I +ST   L +LP DT N L+YNGG
Sbjct: 410 VSGLTAYYLSLQPDVSSQFHDSL--MTPDQLKRKIIDFSTNGMLKELPLDTANKLVYNGG 467

Query: 489 GQDLDDFW 496
           G+DL  FW
Sbjct: 468 GKDLSGFW 475

>KNAG0F02970 Chr6 (563666..564928) [1263 bp, 420 aa] {ON} 
          Length = 420

 Score =  335 bits (858), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 169/377 (44%), Positives = 237/377 (62%), Gaps = 13/377 (3%)

Query: 122 FEATMDEE-----MGIMATSREGGILDSFDVNGMLRGY-IGYFTQEIVDFIRMNPLVAFV 175
           F+  +D E     + ++A        + F +   L G+ +  F    V F+   P V  V
Sbjct: 49  FKPMVDREEVEVGLSVLAGRFPLAQFEQFHIADELIGFTVKNFPFHNVYFLLQIPFVEMV 108

Query: 176 EQDSMVYANEFDTQNGAPWGLSRISHREKLNLGSFNKYLYDD-AAGKGVTSYVIDTGINI 234
           E +S VYA     Q   PWGL R+S R+++ +G    Y YD   + K V  Y++DTGI +
Sbjct: 109 ETNSKVYALNVTVQEDVPWGLMRLSQRDRVRIGDEQVYRYDTRGSAKDVNVYILDTGIQV 168

Query: 235 DHKDFEGRAAWGKTVPTNDLDQDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSG 294
           DH++FEGRA WGKT+  ND D+D NGHGTHCAG +    YG            L + G G
Sbjct: 169 DHEEFEGRARWGKTIAWNDPDRDDNGHGTHCAGIVGGATYGVAKEANLIAVKVLHATGDG 228

Query: 295 SMSDVVKGVEFAAKSHQDAVKKNKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAV 354
            MSDV++G+EFA   H   + +N+   +GS  N+SLG G+SPAL   V AA+  G+HFAV
Sbjct: 229 EMSDVIRGIEFAVNEH---LTRNQDEVRGSIINLSLGAGESPALQRVVTAALNKGVHFAV 285

Query: 355 AAGNENQDACNSSPAAAENAITVGASTLADDRAYFSNWGKCVDIFAPGLNVLSTYIG-SE 413
           AAGNE+ +AC SSPA  +  +TVG ST +DDRA+FSNWG C+D+FAPG+NV S+Y+G ++
Sbjct: 286 AAGNEDDNACYSSPANIDGVVTVGGSTFSDDRAFFSNWGPCIDVFAPGVNVKSSYVGAAK 345

Query: 414 TATATLSGTSMASPHVAGLLTYFLSLQPDSDSEYFHAAGGITPSQLKKKLIAYSTKNALG 473
             T +LSGTS ++PHVAGL+ Y LSL+PD+ S+ FH A    P+QLK+KL++ +T+  L 
Sbjct: 346 NKTLSLSGTSTSAPHVAGLMAYLLSLEPDTKSQ-FHTAWS-NPAQLKQKLVSLATEGKLF 403

Query: 474 DLPEDTVNYLIYNGGGQ 490
           ++P+DT N +I+NG  Q
Sbjct: 404 EVPDDTANLMIFNGVKQ 420

>CAGL0L13266g Chr12 (1418408..1420147) [1740 bp, 579 aa] {ON} some
           similarities with uniprot|P09232 Saccharomyces
           cerevisiae YEL060c or uniprot|P25036 Saccharomyces
           cerevisiae YOR003w YSP3
          Length = 579

 Score =  291 bits (746), Expect = 6e-91,   Method: Compositional matrix adjust.
 Identities = 159/437 (36%), Positives = 244/437 (55%), Gaps = 13/437 (2%)

Query: 78  DAIPHRYIVVFKDRVLPEEVDFHMEVVSEAHAQSVGKLDANDAFFEATMDEEMGIMATSR 137
           + +P+RYIV+FK+     E+  H++ V++   +    L  ND FF  T D+E    +T  
Sbjct: 67  NIVPYRYIVMFKNFAYTNEIKLHIQTVAKLQLRGSISLAPNDPFFHHTRDKEF---STEE 123

Query: 138 EGGILDSFDVNGMLRGYIGYFTQEIVDFIRMNPLVAFVEQDSMVYANEFDTQNGAPWGLS 197
            GG+L +FD+     GY+GYFT E+V+FIR   +V +VE DS++  ++ +T + + W L+
Sbjct: 124 LGGVLYTFDIGSGFNGYVGYFTDEVVEFIRKQSIVDYVEMDSILTIDDKETDSNSHWHLA 183

Query: 198 RISHREKLNLGSFNKYLYDDAAGKGVTSYVIDTGINIDHKDFEGRAAWGKTVPTNDLDQD 257
           RISHR KL L +FN+Y +D   G+ + +Y++DTG+   H  +  R   G  +  N+ ++D
Sbjct: 184 RISHRPKLGLSNFNEYKFDPNGGQNIDAYILDTGVYQTHAYYIERTIRGIVITPNEDERD 243

Query: 258 GNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVVKGVEFAAKSHQDAVKKN 317
            NGHGT  AG +  +  G            L   G G++S+++KG+ F    H   ++KN
Sbjct: 244 MNGHGTEMAGLVGGREVGVARKATLIDVKVLNWQGRGTVSNIIKGLSFVNHHHPQRIEKN 303

Query: 318 KKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACNSSPAAAENAITV 377
             G  G+    S+ G KS +L+ A +  V +GIH  V AG +  +ACNSSPA++   ITV
Sbjct: 304 --GVLGAVVLFSISGAKSRSLNTAFDKMVSSGIHVVVGAGTKGINACNSSPASSSKPITV 361

Query: 378 GASTLADDRAYFSNWGKCVDIFAPGLNVLSTYIGSE----TATATLSGTSMASPHVAGLL 433
              ++ D+     NWG CVDI+ PG  V +TY   E    T   +++G+S A+  VAGLL
Sbjct: 362 AGMSITDEPIDRGNWGSCVDIYGPGDRVRTTYPNLERNQFTNEISVTGSSAAAAQVAGLL 421

Query: 434 TYFLSLQPDSDSEYFHAAGGITPSQLKKKLIAYSTKNALGDLPEDTVNYLIYNGGGQDLD 493
            YF SLQP   +        +TP +LK++LI + TK  L +L   + N + +NG G +LD
Sbjct: 422 AYFASLQPGLGTP---DVIPLTPEELKERLIDFGTKGKLTNLERMSPNIIAFNGAGGNLD 478

Query: 494 DFWVKDLEEKVADAKDN 510
            F+  D  E V  A  N
Sbjct: 479 SFF-NDGSEIVPTATKN 494

>NCAS0D04390 Chr4 complement(836796..838274) [1479 bp, 492 aa] {ON}
           Anc_6.313
          Length = 492

 Score =  194 bits (492), Expect = 8e-55,   Method: Compositional matrix adjust.
 Identities = 137/364 (37%), Positives = 193/364 (53%), Gaps = 58/364 (15%)

Query: 111 SVGKLDANDAFFEATMDEEMGIMATSREGGILDSFDVNGMLRGYIGYFTQEIVDFIRMNP 170
           S+ + D+  +F ++T+     +    R+  I  +F + G  +G+    T ++++ I+ NP
Sbjct: 29  SLKQNDSIQSFMDSTITRGRSVKEYLRDK-IGKTFSI-GSFKGFTVDLTDDLLEAIKKNP 86

Query: 171 LVAFVEQDSMVYANE-------------FD-----------TQNGAPWGLSRISHREKLN 206
           LV+ V  +  V+A E             FD            Q GAP  L+R+S R++L 
Sbjct: 87  LVSDVVPNLRVHAFEDVKDEEGDDDGGQFDNKMQKGKCSVKVQYGAPRHLARLSRRKQLP 146

Query: 207 ---------LGSFNKYLYDD-AAGKGVTSYVIDTGINIDHKDFEGRAAWGKTVPTNDLDQ 256
                    L S  KY YD  + G  V +Y+ID+GI ++H++F GRA     +P  DL  
Sbjct: 147 YDFEDKEAYLDSL-KYFYDKRSQGASVNAYIIDSGIYLEHEEFNGRA-----IPGIDLTG 200

Query: 257 DG----NGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVVKGVEFAAKSHQD 312
           +G    NGHGTH AG + SK YG            L   G GS++ V+ G+EFA K  Q+
Sbjct: 201 EGSGDYNGHGTHVAGIVGSKSYGVAKKVKLIEIKVLNRLGQGSLAMVLGGIEFAVKHCQE 260

Query: 313 AVKKNKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACNSSPAAAE 372
             KK +       AN+SLG  ++  L+ A+ AA+ AG+   VAAGN N +AC  SPA+A 
Sbjct: 261 TSKKGR-----CVANLSLGSMRTAILNKAIKAAIDAGLVVVVAAGNNNLNACWYSPASAP 315

Query: 373 NAITVGASTLADDR----AYFSNWGKCVDIFAPGLNVLSTYIGSETATATLSGTSMASPH 428
            AITVGA    DDR    A FSNWG+C+DIFAPG+ + S  I  +    T SGTSMASP 
Sbjct: 316 EAITVGA---FDDRIDAIAKFSNWGQCLDIFAPGVVIKSLSIFKDKEDVTYSGTSMASPT 372

Query: 429 VAGL 432
           VAGL
Sbjct: 373 VAGL 376

>ZYRO0D08822g Chr4 (754340..755812) [1473 bp, 490 aa] {ON} similar
           to uniprot|P25381 Saccharomyces cerevisiae YCR045C
           Hypothetical ORF
          Length = 490

 Score =  191 bits (484), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 141/417 (33%), Positives = 195/417 (46%), Gaps = 72/417 (17%)

Query: 149 GMLRGYIGYFTQEIVDFIRMNPLVA-------FVEQDSMVYANEFD-------------- 187
           G  RG     +Q++V+ IR NPLVA       F   D ++   E                
Sbjct: 59  GSFRGITVDISQDVVEKIRNNPLVADLVPNIQFKAFDDVLGVQELQQNYHGDNLDDEDGF 118

Query: 188 ------TQNGAPWGLSRISHREKLNLG---------SFNKYLYDDAAGKGVTSYVIDTGI 232
                  Q  AP  L+R+S R  L            SFN Y Y    G+ + +Y+IDTGI
Sbjct: 119 NPFKVKVQGEAPRHLARLSRRAPLPYEFDDELRYEESFNYYYYKWHKGRNINAYIIDTGI 178

Query: 233 NIDHKDFEGRAAWGKTVPTNDLDQDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNG 292
             +HKDF GRA +G+   T +   D NGHGTH AG + S ++G            L + G
Sbjct: 179 YKEHKDFCGRAIFGRDF-TGEGPGDRNGHGTHVAGIVGSSNFGVAKKVNLIEVKALNNRG 237

Query: 293 SGSMSDVVKGVEFAAKSHQDAVKKNKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHF 352
            G+++ V+  VEFA    + +      G KG  AN+SLG  ++  ++ A+ AA +AG+  
Sbjct: 238 QGNLTTVISAVEFAVNHCKSS------GKKGCVANLSLGAVRNSVINQAIKAAHEAGLII 291

Query: 353 AVAAGNENQDACNSSPAAAENAITVGASTLADDR----AYFSNWGKCVDIFAPGLNVLST 408
            VAAGN N +AC +SPA+A  AITVGA    DDR    A FSNWG CVDIFA G+ V S 
Sbjct: 292 VVAAGNSNINACWNSPASAPEAITVGA---FDDRTDTIAKFSNWGPCVDIFASGVKVKSL 348

Query: 409 YIGSETATATLSGTSMASPHVAGLLTYFLSLQPDSDSEYFHAAGGITPSQLKKKLIAYST 468
                      SGTSMASP V GL+   L               G+ P  +K KL+  +T
Sbjct: 349 SAFPPHKPIAFSGTSMASPSVTGLVAILLD-------------KGVEPENIKAKLVELAT 395

Query: 469 KNALGD----LPEDTVNYLIYNGGGQDLDD-----FWVKDLEEKVADAKDNTASEFE 516
            + L          T N + +NG  ++ D+     + + DLE  V + ++      E
Sbjct: 396 HDLLQRRTLFFKPGTPNRIAFNGMEREDDEYDDAVYPIVDLESLVQELQNYQPPPLE 452

>TDEL0A07280 Chr1 complement(1276408..1277718) [1311 bp, 436 aa]
           {ON} Anc_6.313 YCR045C
          Length = 436

 Score =  189 bits (481), Expect = 9e-54,   Method: Compositional matrix adjust.
 Identities = 139/387 (35%), Positives = 191/387 (49%), Gaps = 59/387 (15%)

Query: 160 QEIVDFIRMNPLVA-FVEQDSMVYANEFD------------TQNGAPWGLSRISHREKLN 206
           +++VD IR +PLVA  V     V  +E D             Q GAP  LSR+S R +L 
Sbjct: 72  RDLVDRIRRSPLVAEVVPNIQFVAYDEHDFEGWNFNSRFIRRQRGAPRHLSRLSRRSQLP 131

Query: 207 L----------GSFNKYLYDDAAGKGVTSYVIDTGINIDHKDFEGRAAWGKTVPTNDLDQ 256
                      GSFN Y  +   G G+ +Y+IDTGI  +H +F GRA +G+ + T +   
Sbjct: 132 YDFEEEDDNYEGSFNYYYDNKHRGDGINAYIIDTGIYKEHAEFGGRAVFGEDL-TGEGPG 190

Query: 257 DGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVVKGVEFAAKSHQDAVKK 316
           DGNGHGTH AG + S  YG            L + G G+++ V+  +EFA         +
Sbjct: 191 DGNGHGTHVAGIVGSSKYGVAKDITLVEVKALTAKGQGNLTTVISAMEFAVNHC-----R 245

Query: 317 NKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACNSSPAAAENAIT 376
           + +G KG   N+SLG  ++  ++ AV AA +AGI   VAAGN N +AC +SPA+A  AIT
Sbjct: 246 SSEG-KGCVINLSLGAIRNSVINQAVKAAHEAGIVVVVAAGNSNINACLNSPASAPEAIT 304

Query: 377 VGASTLADDR----AYFSNWGKCVDIFAPGLNVLSTYIGSETATATLSGTSMASPHVAGL 432
           VGA    DDR    A FSNWG CVDIFAPG+ V S            SGTSMASP + GL
Sbjct: 305 VGA---FDDRTDSIAKFSNWGSCVDIFAPGVRVKSLASAPHLKPILFSGTSMASPSITGL 361

Query: 433 LTYFLSLQPDSDSEYFHAAGGITPSQLKKKLIAYSTKNALGD----LPEDTVNYLIYNGG 488
               L               G+   ++K  ++  +T +            T N + +NG 
Sbjct: 362 AAILLD-------------EGVPYDKIKDYILKMATNDVFQRRTLVFKPGTPNRVAFNGV 408

Query: 489 GQDLDDFW-----VKDLEEKVADAKDN 510
            ++ D F      V DL+  + D KD+
Sbjct: 409 KKNDDKFSNAVYPVVDLDLLIEDLKDS 435

>SAKL0A02002g Chr1 (176105..177544) [1440 bp, 479 aa] {ON} similar
           to uniprot|P25381 Saccharomyces cerevisiae YCR045C
           Hypothetical ORF
          Length = 479

 Score =  189 bits (479), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 133/374 (35%), Positives = 182/374 (48%), Gaps = 51/374 (13%)

Query: 149 GMLRGYIGYFTQEIVDFIRMNPLVAFV------------EQDSMVYANEFDTQNGAPWGL 196
           G   G+   F ++ V+ ++ NPLVA V            EQ +  Y+  +  Q  AP  L
Sbjct: 59  GKFEGFTADFPKDFVEKLKKNPLVADVVPNSVFNVFDQKEQIAEEYSRRYKVQEDAPRHL 118

Query: 197 SRISHREKLNLGS-------FNKYLYDDAAGKGVTSYVIDTGINIDHKDFEGRAAWGKTV 249
           +R+S R  L           FN Y      G  V +Y+IDTGI   HKD  GRA +G  +
Sbjct: 119 ARLSRRGPLPYSEEDGWYQEFNYYYDRKHRGDSVNAYIIDTGIYKQHKDLGGRAYFGADM 178

Query: 250 PTNDLDQDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVVKGVEFAAKS 309
              +   D NGHGTH AG + S+ +G            L + G G+++ V+  +EF+   
Sbjct: 179 -VGEGPGDYNGHGTHVAGIVGSRTFGVAKKVNLVEVKALNAKGQGNLTSVISSIEFS--- 234

Query: 310 HQDAVKKNKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACNSSPA 369
               V   KK      AN+SLG  ++  L+ AV AAV++G+   VAAGN N +AC +SPA
Sbjct: 235 ----VNHCKKSGMLCVANLSLGSLRNTVLNQAVEAAVESGLVVVVAAGNSNVNACWNSPA 290

Query: 370 AAENAITVGASTLADDR----AYFSNWGKCVDIFAPGLNVLSTYIGSETATATLSGTSMA 425
           +A +AITVGA    DDR    A FSNWG CVD+FA G+ V+S            SGTSMA
Sbjct: 291 SAISAITVGA---FDDRTDTIAKFSNWGMCVDVFASGVKVMSLSNMPPFKPVAYSGTSMA 347

Query: 426 SPHVAGLLTYFLSLQPDSDSEYFHAAGGITPSQLKKKLIAYSTKNALGD----LPEDTVN 481
           SP VAGL    L               GI P  +K+K+I  +T+N            T N
Sbjct: 348 SPSVAGLAAVLLD-------------SGIDPPDIKQKIIDLATENVFQKRTLVFKPGTPN 394

Query: 482 YLIYNGGGQDLDDF 495
            + +NG  ++ D F
Sbjct: 395 RIAFNGVRKEDDIF 408

>Kpol_1018.5 s1018 (14365..15762) [1398 bp, 465 aa] {ON}
           (14365..15762) [1398 nt, 466 aa]
          Length = 465

 Score =  188 bits (477), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 137/428 (32%), Positives = 206/428 (48%), Gaps = 64/428 (14%)

Query: 103 VVSEAHAQSVGKLDANDAFFEATMDEEMGIMATSREGGILDSFDVNGMLRGYIGYFTQEI 162
           +V E +   + K ++  +F ++T  + + I     +  I + F   G  R  +     ++
Sbjct: 17  IVGEEYLIKLKKSESIQSFLKSTKSQSLQI-KDDIKNHIRERFTF-GAFRALVIDLPNDM 74

Query: 163 VDFIRMNPLV----------AFVEQDS----MVYANEFDTQNGAPWGLSRISHREKLNLG 208
           ++ ++ NP +          AF    +    + Y+++   Q  AP  LSR+S R +L   
Sbjct: 75  IEKLKKNPTISEIIPNLKVNAFANSSTYSELLTYSDKIIIQREAPRHLSRLSRRGQLPYD 134

Query: 209 SFNKYLYDDA---------AGKGVTSYVIDTGINIDHKDFEGRAAWGKTVPTNDLDQDG- 258
             N   YD+A          G  V +Y+IDTGI  +H +FEGR  +       DL Q+G 
Sbjct: 135 INNIDRYDNAFDYYFDAKYQGSSVNAYIIDTGIYKEHPEFEGRVKFAI-----DLTQEGP 189

Query: 259 ---NGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVVKGVEFAAKSHQDAVK 315
              NGHGTH AG + SK +G            L   G G +S ++K +EF  +  +++V 
Sbjct: 190 GDENGHGTHIAGIVGSKTFGVAKKVNIIDVKALDKKGQGQLSTILKALEFTIRHCKESVD 249

Query: 316 KNKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACNSSPAAAENAI 375
           K         AN+S G  ++  +D A+  A  AGI   VAAGN N DAC +SPA++++ I
Sbjct: 250 KK------CVANLSFGAIRTAIIDEAIKEAHNAGIVLVVAAGNSNIDACWNSPASSKDVI 303

Query: 376 TVGASTLADDR----AYFSNWGKCVDIFAPGLNVLSTYIGSETATATLSGTSMASPHVAG 431
           TVGA    DDR    A FSNWG CVD+FAPG+ V S    + +    LSGTSMASP V+G
Sbjct: 304 TVGA---FDDRTETIARFSNWGSCVDVFAPGVKVKSLSHINGSDVLLLSGTSMASPSVSG 360

Query: 432 LLTYFLSLQPDSDSEYFHAAGGITPSQLKKKLIAYSTKNALGD----LPEDTVNYLIYNG 487
           +    L               G+ P  +K K+I  STKN        +  +T N +++NG
Sbjct: 361 IAAILLD-------------KGLNPKFVKSKIIESSTKNIFHQGTIMIKPNTPNLIVFNG 407

Query: 488 GGQDLDDF 495
             +  D F
Sbjct: 408 IEKMDDSF 415

>KNAG0I02470 Chr9 complement(479068..480495) [1428 bp, 475 aa] {ON}
           Anc_6.313 YCR045C
          Length = 475

 Score =  187 bits (474), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 143/409 (34%), Positives = 198/409 (48%), Gaps = 57/409 (13%)

Query: 139 GGILDSFDVNGMLRGYIGYFTQEIVDFIRMNPLVAFVEQDSMVYANEFDT---------- 188
           G I   F + G L+G     + +++D I+ +P V  V  + MV A E D           
Sbjct: 50  GKINKRFQI-GELKGLTMNLSHDVLDKIKRHPFVKEVVPNIMVKAFEGDAVEDESWLPKM 108

Query: 189 --QNGAPWGLSRISHREKLNLGSFNKYLYDD---------AAGKGVTSYVIDTGINIDHK 237
             Q GAP  L+RIS R +L     NK  Y D         A G    +Y++DTG+  DHK
Sbjct: 109 KRQRGAPRHLARISRRMQLPYDMNNKTRYRDSFNYYYDRWAQGATTRAYILDTGVMRDHK 168

Query: 238 DFEGRAAWGKTVPTNDLDQDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMS 297
           +FE R  +G T  T + + D NGHGTH AG + SK +G            L + G+G++ 
Sbjct: 169 EFEDRVEFG-TDCTGEGEGDLNGHGTHVAGLVGSKTFGVAKHVQLVDVKCLDALGAGTLV 227

Query: 298 DVVKGVEFA---AKSHQDAVKKNKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAV 354
            ++  +EFA    + H+D+             NMSLG  KS  L+ A+N   K GI   V
Sbjct: 228 SILSALEFAVQDCQEHEDS---------QCVLNMSLGSVKSNILNQAINEVEKKGIVVVV 278

Query: 355 AAGNENQDACNSSPAAAENAITVGASTLADDR----AYFSNWGKCVDIFAPGLNVLSTYI 410
           AAGN N +AC +SP++A  AITVGA    DDR    A FSNWG CVDIFAPG+NV S   
Sbjct: 279 AAGNFNMNACWTSPSSATGAITVGA---FDDRFDTIAKFSNWGPCVDIFAPGVNVASLVN 335

Query: 411 GSETATATLSGTSMASPHVAGLLTYFLS--LQPDSDSEYFHAAGGITPSQLKKKLIAYST 468
               +    SGTSMASP V G++   L   + P+   +Y       T    KK+ + +  
Sbjct: 336 RDWPSFVKYSGTSMASPIVCGMVALLLDDGVPPEDIRDYLQELA--TDGVFKKRTLVFKP 393

Query: 469 KNALGDLPEDTVNYLIYNGGGQDLDDFWVKDLEEKVADAKDNTASEFES 517
                     T N ++YNG  +  DD +  DL+    +  D+   E E+
Sbjct: 394 ---------GTPNSVLYNGNKKH-DDEYEDDLQYPQVEL-DDLVQELEN 431

>Kpol_1028.61 s1028 (138312..139868) [1557 bp, 518 aa] {ON}
           (138312..139868) [1557 nt, 519 aa]
          Length = 518

 Score =  187 bits (475), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 130/329 (39%), Positives = 172/329 (52%), Gaps = 43/329 (13%)

Query: 187 DTQNGAPWGLSRISHREKL--------NLGSFNKYLYDDA-AGKGVTSYVIDTGINIDHK 237
           + Q GAP  L RIS R +L            F  Y Y+D   G  + +Y++DTGI  +H 
Sbjct: 152 NVQYGAPRHLGRISSRGQLPFDIRNENEFKEFIHYYYEDQFKGSNIAAYILDTGIYAEHP 211

Query: 238 DFEGRAAWGKTVPTNDLDQDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMS 297
           DFE R   G  + T +   D NGHGTH AG + SK +G            L   GSG+++
Sbjct: 212 DFENRVIVGADM-TGEGPGDSNGHGTHVAGILGSKTFGVAKNVTLVEVKVLTGRGSGNLT 270

Query: 298 DVVKGVEFAAKSHQDAVKKNKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAG 357
            V+ G++FA   H   +++ +   K   ANMSLG  ++  ++ A++ A KAG+   VAAG
Sbjct: 271 TVLSGIQFAV-DHCRLMRETQG--KQCVANMSLGTVRNNIINAAIHEAFKAGLIMVVAAG 327

Query: 358 NENQDACNSSPAAAENAITVGASTLADDR----AYFSNWGKCVDIFAPGLNV--LSTYIG 411
           N N  AC +SPA+A+NAITVGA    DDR    AYFSNWG CVDIFAPG+ +  LS    
Sbjct: 328 NSNVSACWTSPASAKNAITVGA---FDDRTETIAYFSNWGACVDIFAPGVKIRSLSNSPE 384

Query: 412 SETATATLSGTSMASPHVAGLLTYFLSLQPDSDSEYFHAAGGITPSQLKKKLIAYSTKNA 471
           S     T SGTSMASP VAGL    L               G+ P  +K KL+  STK+ 
Sbjct: 385 SHHKHVTHSGTSMASPVVAGLAAILLD-------------KGVEPFDVKDKLLHLSTKDV 431

Query: 472 LGDL----PEDTVNYLIYNGGGQDLDDFW 496
              L       T N + YNG    ++DF+
Sbjct: 432 FNKLTLFFKYGTPNKIAYNG----IEDFF 456

>TBLA0F03970 Chr6 complement(985334..987538) [2205 bp, 734 aa] {ON}
           Anc_6.313 YCR045C
          Length = 734

 Score =  190 bits (482), Expect = 9e-52,   Method: Compositional matrix adjust.
 Identities = 140/377 (37%), Positives = 190/377 (50%), Gaps = 52/377 (13%)

Query: 185 EFDTQNGAPWGLSRISHREKL-----NLGSFNK---YLYDDA-AGKGVTSYVIDTGINID 235
           +F  Q GAP  L+RIS R+KL     N   F +   Y YDD   G+GV +YVIDTGI  +
Sbjct: 283 KFKVQRGAPRHLARISTRDKLPFNFRNANQFEEQLNYYYDDNDKGEGVLAYVIDTGILKE 342

Query: 236 HKDFEGRAAWGKTVPTNDLDQDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGS 295
           HKDFE R  +G T  T +   D NGHGTH AG I SK YG            +   GS  
Sbjct: 343 HKDFEDRVEFG-TDLTGEGAGDLNGHGTHVAGLIGSKTYGVDKKVKIIDVKAVSLTGSTQ 401

Query: 296 MSDVVKGVEFAAKSHQDAVKKNKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVA 355
           +S +++ +E+        V K     K    NMSLG      ++ AV +A+  G+ F VA
Sbjct: 402 LSHIIEAIEYTVNDCNSRVDK-----KACVVNMSLGSFYVKVINEAVESAIAEGVVFVVA 456

Query: 356 AGNENQDACNSSPAAAENAITVGASTLADDR----AYFSNWGKCVDIFAPGLNVLSTYIG 411
           AGN N DAC SSP +++NAITVGA    DDR    A FSNWG+CVDIFA G+ V S    
Sbjct: 457 AGNNNIDACWSSPGSSKNAITVGA---FDDRLDVIAKFSNWGECVDIFASGVEVKSLSSQ 513

Query: 412 SETATATLSGTSMASPHVAGLLTYFLSLQPDSDSEYFHAAGGITPSQLKKKLIAYSTKNA 471
                   SGTSMASP V G ++  LS              G+ P+ ++++++  STK  
Sbjct: 514 VPYKYIKYSGTSMASPIVCGFVSILLS-------------QGVKPNDVQEEMVKLSTK-- 558

Query: 472 LGDLPED-------TVNYLIYNG-------GGQDLDDFWVKDLEEKVADAKDNTASEFES 517
            GD           T N +++NG          ++++   +D EE++ D   N     +S
Sbjct: 559 -GDFTRRSLIFKPFTSNRILFNGMDPRDSYENDEMENDCGEDYEEEIIDRNSNKLLMEKS 617

Query: 518 IIDALEEKTDGLYEEIR 534
               L+   D +YE+IR
Sbjct: 618 SKLVLDLDLDLIYEDIR 634

>Smik_3.149 Chr3 complement(206258..207733) [1476 bp, 491 aa] {ON}
           YCR045C (REAL)
          Length = 491

 Score =  184 bits (466), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 124/320 (38%), Positives = 165/320 (51%), Gaps = 32/320 (10%)

Query: 189 QNGAPWGLSRISHREKLNL---------GSFNKYLYDDAAGKGVTSYVIDTGINIDHKDF 239
           Q+ AP  L+RIS   +L             FN Y  DD  G+ V +Y++DTGI  DH +F
Sbjct: 125 QSDAPRHLARISRHYQLPFDIEDKERYKSWFNYYYEDDYQGQDVNAYIMDTGIFADHPEF 184

Query: 240 EGRAAWGKTVPTNDLDQDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDV 299
           E R   G  + T +   D NGHGTH AG + SK YG            L  +GSG  S+V
Sbjct: 185 EDRVIQGIDL-TKEGFGDQNGHGTHVAGLVGSKTYGAAKKVNLVEVKVLGKDGSGEASNV 243

Query: 300 VKGVEFAAKSHQDAVKKNKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNE 359
           + G+EF     +   + ++   K   AN+SLG  +SP ++MAV  A++ GI F  AAGN 
Sbjct: 244 LSGLEFIV---EHCTRVSRPQGKKCVANLSLGSFRSPIINMAVEGAIEEGIVFVAAAGNF 300

Query: 360 NQDACNSSPAAAENAITVGA-STLADDRAYFSNWGKCVDIFAPGLNVLSTYIGSETATAT 418
           N DA  +SPA+AEN ITVGA     D  A FSNWG CV+IFAPG+ + S    +   T  
Sbjct: 301 NLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEIESLSHLNFNDTLV 360

Query: 419 LSGTSMASPHVAGLLTYFLSLQPDSDSEYFHAAGGITPSQLKKKLIAYSTKNALGD---- 474
           LSGTSM++P V G+    LS              GI P  + ++L   ST+N        
Sbjct: 361 LSGTSMSTPIVTGVAAVLLS-------------KGIEPEMIAQELEYLSTRNVFHRRTLF 407

Query: 475 LPEDTVNYLIYNGGGQDLDD 494
               T N ++YNG  + LDD
Sbjct: 408 FKPSTPNQILYNGVDK-LDD 426

>CAGL0L10802g Chr12 complement(1159230..1160783) [1554 bp, 517 aa]
           {ON} similar to uniprot|P25381 Saccharomyces cerevisiae
           YCR045c
          Length = 517

 Score =  182 bits (462), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 127/348 (36%), Positives = 166/348 (47%), Gaps = 61/348 (17%)

Query: 188 TQNGAPWGLSRISHREKLNL---------GSFNKYLYDDAAGKGVTSYVIDTGINIDHKD 238
           TQ+ AP  L+R+S R +L             FN Y Y    G+ V +YV+D+G+ IDH D
Sbjct: 159 TQSEAPRHLARLSRRSQLPYDFNDPTRYESDFNYYYYGWHQGRSVNAYVLDSGVMIDHCD 218

Query: 239 FEGRAAWGKTVPTNDLDQDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSD 298
           FEGRA +G     +    D NGHGTH AG I SK YG            L S GSG++  
Sbjct: 219 FEGRAYYGADFIRSGNSGDQNGHGTHVAGLIGSKTYGVSKKVNIIDVKVLDSVGSGTLDT 278

Query: 299 VVKGVEFAAK-----------------------SHQDAVKKNKKGFKGSTANMSLGGGKS 335
           V+ G+EF +                        SH D V+      K    N+SLG  +S
Sbjct: 279 VMSGLEFVSNHCNYKGKQGKQGKQGKPVWGSEDSHDDDVES-----KRCVINLSLGTFRS 333

Query: 336 PALDMAVNAAVKAGIHFAVAAGNENQDACNSSPAAAENAITVGASTLADDR----AYFSN 391
             ++ A+   +K GI   VAAGN N +AC +SPA+  + ITVGA    DDR    A FSN
Sbjct: 334 TIINEAIEELIKQGIVVVVAAGNSNMNACWTSPASVADVITVGA---FDDRIDSIAKFSN 390

Query: 392 WGKCVDIFAPGLNVLSTYIGSETATATLSGTSMASPHVAGLLTYFLSLQPDSDSEYFHAA 451
           WG CVDIFAPG+ V S            +GTSMA+P V GL+   L              
Sbjct: 391 WGNCVDIFAPGVLVKSLSNKFPYYPIEQTGTSMATPIVTGLVALLLD------------- 437

Query: 452 GGITPSQLKKKLIAYSTKNALGD----LPEDTVNYLIYNGGGQDLDDF 495
            GI P+Q+KK+L   +T N            T N + +NG  +D DD+
Sbjct: 438 SGIKPTQIKKRLNELATDNIFPRRTLLFKPGTPNRIAFNGVKRDDDDY 485

>Suva_3.84 Chr3 complement(121533..123116) [1584 bp, 527 aa] {ON}
           YCR045C (REAL)
          Length = 527

 Score =  182 bits (462), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 121/324 (37%), Positives = 168/324 (51%), Gaps = 40/324 (12%)

Query: 189 QNGAPWGLSRISHREKLNL---------GSFNKYLYDDAAGKGVTSYVIDTGINIDHKDF 239
           Q  AP  L+RIS   +L             FN Y  D+  G+GV +Y++DTGI+ +H +F
Sbjct: 161 QPDAPRHLARISRHHQLPFDLEDKDRYKSWFNYYYEDEYQGQGVNAYIMDTGIHAEHPEF 220

Query: 240 EGRAAWGKTVPTNDLDQDG----NGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGS 295
           E R   G      DL ++G    NGHGTH AG + S+ +G            L  +GSG 
Sbjct: 221 EDRVIQGV-----DLTKEGFGDENGHGTHVAGLVGSRTFGAAKKVSLVEVKVLGKDGSGE 275

Query: 296 MSDVVKGVEFAAKSHQDAVKKNKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVA 355
            S+V+ G+EF     +   K ++   K   AN+SLG  +SP ++MAV  A++ GI F  A
Sbjct: 276 ASNVLSGLEFIV---EHCTKVSRPQGKKCVANLSLGSFRSPIINMAVEGAIEEGIVFVAA 332

Query: 356 AGNENQDACNSSPAAAENAITVGA-STLADDRAYFSNWGKCVDIFAPGLNVLSTYIGSET 414
           AGN N DA  +SPA+AEN ITVGA     D  A FSNWG CV+IFAPG+ + S    ++ 
Sbjct: 333 AGNFNLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEIESLSHLNDN 392

Query: 415 ATATLSGTSMASPHVAGLLTYFLSLQPDSDSEYFHAAGGITPSQLKKKLIAYSTKNALGD 474
            +  LSGTSM++P V G+    LS              GI P  + +++   ST+N    
Sbjct: 393 ESLVLSGTSMSTPIVTGVAAVLLS-------------KGIEPELIAQEIEYLSTRNVFHR 439

Query: 475 ----LPEDTVNYLIYNGGGQDLDD 494
                   T N ++YNG  + LDD
Sbjct: 440 RTLFFKPSTPNQILYNGVDK-LDD 462

>KLTH0A06094g Chr1 complement(513667..515157) [1491 bp, 496 aa] {ON}
           similar to uniprot|P25381 Saccharomyces cerevisiae
           YCR045C Hypothetical ORF
          Length = 496

 Score =  181 bits (459), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 138/388 (35%), Positives = 185/388 (47%), Gaps = 77/388 (19%)

Query: 131 GIMATSREGGILDSFDVNGMLRGYIGYFTQEIVDFIRMNPLVAFVEQDSMVYANEFDT-- 188
           GI+    EG IL +F   G   G    F   +V  +R NPL+A +  +  V  N FD   
Sbjct: 43  GILDVFSEGKILRTFSF-GKFEGLTVDFPLSLVSKLRGNPLIAEIVPN--VEFNVFDAVE 99

Query: 189 -----------------------------------QNGAPWGLSRISHR-------EKLN 206
                                              Q  AP  L+RIS R       E ++
Sbjct: 100 GLEGWGDDEDEDGDYDDDNEEGEDEGDDDVLSIVAQKKAPRHLARISRRTALPYDPENIS 159

Query: 207 LGSFN-KYLYDDA-AGKGVTSYVIDTGINIDHKDFEGRAAWGKTVPTNDLDQDGNGHGTH 264
           + + N  Y YDD  +G  V +YVIDTGI  +H   EGRA +G  +   +   D NGHGTH
Sbjct: 160 VPATNFSYYYDDEFSGTCVNAYVIDTGIYKEHPQLEGRAKFGADL-VGEGPGDFNGHGTH 218

Query: 265 CAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVVKGVEFAAKSHQDAVKKNKKGFKGS 324
            AG I S+ +G            L + G G+++ V+  +EF        V   +K  +G 
Sbjct: 219 VAGLIGSRKFGVAKDVSLIEVKALNAKGQGNLTSVISAIEFT-------VNHCRKSRRGC 271

Query: 325 TANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACNSSPAAAENAITVGASTLAD 384
            AN+SLG  ++  L+ AV AA++AG+   VAAGN N +AC SSPA++ +AITVGA    D
Sbjct: 272 VANLSLGSFRNTVLNQAVEAALEAGVVIVVAAGNSNANACWSSPASSLSAITVGA---FD 328

Query: 385 DR----AYFSNWGKCVDIFAPGLNVLSTYIGSETATATLSGTSMASPHVAGLLTYFLSLQ 440
           DR    A FSNWG CVDIFAPG+ + S            SGTSMASP V+G++   L   
Sbjct: 329 DRTDTIARFSNWGNCVDIFAPGVKIESLSNVPPFKPVAFSGTSMASPIVSGMVANLL--- 385

Query: 441 PDSDSEYFHAAGGITPSQLKKKLIAYST 468
            DS         GI P  +K +LI  +T
Sbjct: 386 -DS---------GIHPFDIKTELIDLAT 403

>Skud_3.124 Chr3 complement(192464..194086) [1623 bp, 540 aa] {ON}
           YCR045C (REAL)
          Length = 540

 Score =  181 bits (460), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 123/320 (38%), Positives = 166/320 (51%), Gaps = 32/320 (10%)

Query: 189 QNGAPWGLSRISHREKLNL---------GSFNKYLYDDAAGKGVTSYVIDTGINIDHKDF 239
           Q+ AP  L+RIS   +L             FN Y  DD  G+ V +Y++DTGI  DH +F
Sbjct: 174 QSDAPRHLARISRHYQLPFDIEDKNRYKSWFNYYYEDDYLGQDVNAYIMDTGIFSDHPEF 233

Query: 240 EGRAAWGKTVPTNDLDQDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDV 299
           E R   G  + T +   D NGHGTH AG + SK YG            L  +GSG  S+V
Sbjct: 234 EDRVIQGIDL-TKEGFGDQNGHGTHVAGLVGSKTYGAAKKVNLVEVKVLGKDGSGEASNV 292

Query: 300 VKGVEFAAKSHQDAVKKNKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNE 359
           + G+EF     +   + ++   K   AN+SLG  +SP ++MAV  A++ GI F  AAGN 
Sbjct: 293 LSGLEFIV---EHCTRVSRPQGKKCVANLSLGSFRSPIINMAVEGAIEEGIVFVAAAGNF 349

Query: 360 NQDACNSSPAAAENAITVGA-STLADDRAYFSNWGKCVDIFAPGLNVLSTYIGSETATAT 418
           N DA  +SPA+AEN ITVGA     D  A FSNWG CV+IFAPG+ + S    +   T  
Sbjct: 350 NLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEIESLSHLNYEDTLI 409

Query: 419 LSGTSMASPHVAGLLTYFLSLQPDSDSEYFHAAGGITPSQLKKKLIAYSTKNALGD---- 474
           LSGTSM++P V G+    LS              GI P+ + +++   ST+N        
Sbjct: 410 LSGTSMSTPIVTGVAAVLLS-------------KGIEPALIAQEIEYLSTRNVFHRRTLF 456

Query: 475 LPEDTVNYLIYNGGGQDLDD 494
               T N ++YNG  + LDD
Sbjct: 457 FKPSTANQILYNGVDK-LDD 475

>YCR045C Chr3 complement(208135..209610) [1476 bp, 491 aa] {ON}
           RRT12Probable subtilisin-family protease with a role in
           formation of the dityrosine layer of spore walls;
           localizes to the spore wall and also the nuclear
           envelope and ER region in mature spores
          Length = 491

 Score =  179 bits (455), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 123/320 (38%), Positives = 163/320 (50%), Gaps = 32/320 (10%)

Query: 189 QNGAPWGLSRISHREKLNL---------GSFNKYLYDDAAGKGVTSYVIDTGINIDHKDF 239
           Q  AP  L+RIS   +L             FN Y   D  G+ V +Y++DTGI  DH +F
Sbjct: 125 QPDAPRHLARISRHYQLPFDVGDKDRYKSWFNYYYEHDYQGQDVNAYIMDTGIFADHPEF 184

Query: 240 EGRAAWGKTVPTNDLDQDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDV 299
           E R   G  + T +   D NGHGTH AG + SK YG            L  +GSG  S+V
Sbjct: 185 EDRVIQGIDL-TKEGFGDQNGHGTHVAGLVGSKTYGAAKRVNLVEVKVLGKDGSGEASNV 243

Query: 300 VKGVEFAAKSHQDAVKKNKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNE 359
           + G+EF     +   K ++   K   AN+SLG  +SP ++MAV  A++ GI F  AAGN 
Sbjct: 244 LSGLEFIV---EHCTKVSRPQGKKCVANLSLGSFRSPIINMAVEGAIEEGIVFVAAAGNF 300

Query: 360 NQDACNSSPAAAENAITVGA-STLADDRAYFSNWGKCVDIFAPGLNVLSTYIGSETATAT 418
           N DA  +SPA+AEN ITVGA     D  A FSNWG CV+IFAPG+ + S    +   T  
Sbjct: 301 NLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEIESLSHLNYNDTLI 360

Query: 419 LSGTSMASPHVAGLLTYFLSLQPDSDSEYFHAAGGITPSQLKKKLIAYSTKNALGD---- 474
           LSGTSM++P V G+    LS              GI P  + +++   ST+N        
Sbjct: 361 LSGTSMSTPIVTGVAAILLS-------------KGIEPEMIAQEIEYLSTRNVFHRRTLF 407

Query: 475 LPEDTVNYLIYNGGGQDLDD 494
               T N ++YNG  + LDD
Sbjct: 408 FKPSTPNQILYNGVDK-LDD 426

>Ecym_2105 Chr2 (185014..186846) [1833 bp, 610 aa] {ON} similar to
           Ashbya gossypii AAR069W
          Length = 610

 Score =  177 bits (448), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 127/324 (39%), Positives = 167/324 (51%), Gaps = 42/324 (12%)

Query: 189 QNGAPWGLSRISHREKLNLGS-------FNKYLYDDAAGKGVTSYVIDTGINIDHKDFEG 241
           Q+GAP  L+R   R  L   +       FN Y   +  G+ V  Y++D+GI+  H +FEG
Sbjct: 270 QSGAPRHLARNCRRSGLPFDTSGSKDYEFNYYYDAEHLGETVNVYILDSGIHKSHPEFEG 329

Query: 242 RAAWGKTVPTNDLDQDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVVK 301
           RA +G    TN+   D NGHGTH AG + SK YG            +  +G GS S+++ 
Sbjct: 330 RAVFGIDT-TNEGPGDLNGHGTHVAGLVGSKTYGAAKKATIYEVKVMTVDGRGSTSNIIA 388

Query: 302 GVEFAAKSHQDAVKKNKKGFKGSTANMSLGG---GKSPALDMAVNAAVKAGIHFAVAAGN 358
           GVEFA K  Q + KK         ANMSLGG   G S ALD AV AA++ G+ F VAAGN
Sbjct: 389 GVEFAVKHCQQSGKK-------CVANMSLGGLSFGHS-ALDSAVEAAIEEGLVFVVAAGN 440

Query: 359 ENQDACNSSPAAAENAITVGASTLADDR----AYFSNWGKCVDIFAPGLNVLSTYIGSET 414
             + AC  SPA  + AITVGA    DDR    A FSN+GKCVDIFAPG+ V S       
Sbjct: 441 SKERACWYSPAKVKTAITVGA---FDDRSDIIASFSNYGKCVDIFAPGVAVSSLSNSPYN 497

Query: 415 ATATLSGTSMASPHVAGLLTYFLSLQPDSDSEYFHAAGGITPSQLKKKLIAYSTKNALGD 474
               L+GTSM++P  AG++   L               G+    +K++LI  STK     
Sbjct: 498 TVRVLNGTSMSAPITAGVVAVLLDQ-------------GVKHEDVKERLIDLSTKGVFHR 544

Query: 475 ---LPEDTVNYLIYNGGGQDLDDF 495
              +   T +  ++NG  Q+ D F
Sbjct: 545 RRLVSSRTPDRTLFNGVPQEDDVF 568

>KAFR0J02450 Chr10 complement(469452..470888) [1437 bp, 478 aa] {ON}
           Anc_6.313 YCR045C
          Length = 478

 Score =  173 bits (438), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 129/368 (35%), Positives = 182/368 (49%), Gaps = 56/368 (15%)

Query: 160 QEIVDFIRMNPLVAFVEQDSMVYANEFD--------------TQNGAPWGLSRISHREKL 205
           Q+I++ ++ NPLVA +  + +  A E D               Q+ AP  L+RIS R+KL
Sbjct: 76  QKIMEKLKQNPLVADIVPNILFKAFENDELNNEQTQEYVSHVVQSEAPRHLARISRRDKL 135

Query: 206 -----NLGS----FNKYLYDDAAGKGVTSYVIDTGINIDHKDFEGRAAWGKTVPTNDLDQ 256
                N+ S    FN Y   +  G  V +Y++D+G++ +  DFEGR  +G    T D + 
Sbjct: 136 PYDFTNVSSYKKSFNYYYGKEHKGADVRAYILDSGVSRNLTDFEGRVEFGFDF-TGDGEG 194

Query: 257 DGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVVKGVEFAAK-SHQDAVK 315
           D NGHGTH AG + SK YG            L   G G++  V+  +EFA    H+   K
Sbjct: 195 DSNGHGTHVAGLVGSKTYGVAKGVTMVDVKCLDEIGFGTLITVLSAIEFAVNDCHEHPEK 254

Query: 316 KNKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACNSSPAAAENAI 375
           +         AN+SLG  K+  ++ A+ AA + G+   VAAGN N +AC +SPA+AE AI
Sbjct: 255 R-------CVANLSLGSFKNAIINKAIQAATEDGVVMVVAAGNFNINACWTSPASAEEAI 307

Query: 376 TVGASTLADDR----AYFSNWGKCVDIFAPGLNVLSTYIGSETATATLSGTSMASPHVAG 431
           TVGA    DDR    A FSNWG CVDI+APG+ V S          + SGTSMASP V G
Sbjct: 308 TVGA---FDDRIDTIAKFSNWGPCVDIYAPGVAVESLANFPMVKNISYSGTSMASPIVCG 364

Query: 432 LLTYFLSLQPDSDSEYFHAAGGITPSQLKKKLIAYSTKNALGD----LPEDTVNYLIYNG 487
            +   L               GI    +K  LI  +T +           +T N +++NG
Sbjct: 365 QVAILLD-------------KGIPNDDIKSTLIKMATDDVFQKRTLLFKPNTPNRVLFNG 411

Query: 488 GGQDLDDF 495
             ++ D +
Sbjct: 412 IEKEDDQY 419

>NDAI0I00560 Chr9 (114935..116386) [1452 bp, 483 aa] {ON} Anc_6.313
          Length = 483

 Score =  172 bits (436), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 142/397 (35%), Positives = 194/397 (48%), Gaps = 60/397 (15%)

Query: 80  IPHRYIVVFKDRVLPEEVDFHMEVVSEAHAQSVGKLDANDAFFEATMDEEMGIMATSREG 139
           I H  I VF+   L E    H  +VS  ++ S+       +F ++T      +M     G
Sbjct: 5   ILHSVIFVFQ---LIEFTAAHEYLVSLKNSDSI------QSFMDSTYAHGQ-LMKDYLHG 54

Query: 140 GILDSFDVNGMLRGYIGYFTQEIVDFIRMNPLVAFVEQDSMVYANEFD------------ 187
            I  +F   G  RG     T+++V  I+ NPLV  V  +  ++A ++D            
Sbjct: 55  KISKTFSF-GSFRGLTVNLTKDVVSAIKENPLVVDVVPNMKIHAFDYDDFENNDGYDDIK 113

Query: 188 --------------TQNGAPWGLSRISHREKLNLGSFNKYLYDDA---------AGKGVT 224
                          QNGAP  L+R+S R  L     +K  Y+D+          G  V 
Sbjct: 114 QPEELFDKNSYLVKVQNGAPRHLARLSRRMPLPYDFDDKDAYNDSLSYYYSKWHQGTDVN 173

Query: 225 SYVIDTGINIDHKDFEGRAAWGKTVPTNDLDQDGNGHGTHCAGTIASKHYGXXXXXXXXX 284
           +Y+ID+GI+I+ ++FEGRA  G  + T +   D NGHGTH AG + SK YG         
Sbjct: 174 AYIIDSGIDINQEEFEGRATHGLDL-TGEGPGDRNGHGTHVAGLVGSKTYGVAKNVTLVE 232

Query: 285 XXXLRSNGSGSMSDVVKGVEFAAKSHQDAVKKNKKGFKGSTANMSLGGGKSPALDMAVNA 344
              L   GSGS+  V+  +EF   +H    K  K       AN+SLG    P L+ A+ A
Sbjct: 233 VKALDRQGSGSLITVISALEFVV-NHCGKSKSKK-----CVANLSLGAFMMPLLNEAIKA 286

Query: 345 AVKAGIHFAVAAGNENQDACNSSPAAAENAITVGASTLADDR----AYFSNWGKCVDIFA 400
            V +G+   VAAGN N DAC  SPA+ ++AITVGA    DDR    A FSNWG CVDIFA
Sbjct: 287 TVDSGVVVVVAAGNGNIDACWCSPASEKSAITVGA---FDDRIDTIAKFSNWGSCVDIFA 343

Query: 401 PGLNVLSTYIGSETATATLSGTSMASPHVAGLLTYFL 437
           PG+ + S  I     +   SGTSMASP VAG+++  L
Sbjct: 344 PGVAISSLSIKDNQKSVEFSGTSMASPQVAGIVSILL 380

>AAR069W Chr1 (460781..463087) [2307 bp, 768 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCR045C
          Length = 768

 Score =  175 bits (443), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 118/300 (39%), Positives = 158/300 (52%), Gaps = 39/300 (13%)

Query: 184 NEFDTQNGAPWGLSRISHREKLNLG-------SFNKYLYDDAAGKGVTSYVIDTGINIDH 236
           +++  Q  AP  L+R   R  L          +FN Y  ++  G+GV  YV+D+GI   H
Sbjct: 423 HQYAIQVDAPRHLARTCRRTGLPFDPSGDKEYTFNYYYDEEHLGEGVNVYVLDSGIYKSH 482

Query: 237 KDFEGRAAWGKTVPTNDLDQDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSM 296
            +F+GRA +G    T +   D NGHGTH AG + S+ +G            +  +G GS 
Sbjct: 483 PEFDGRAHFGIDT-TKEGPGDLNGHGTHVAGLVGSRTFGIAKKANIYEIKVMTVDGRGST 541

Query: 297 SDVVKGVEFAAKSHQDAVKKNKKGFKGSTANMSLGG---GKSPALDMAVNAAVKAGIHFA 353
           S+++ GVEFA K  Q + K+         ANMSLGG   G S ALD AV AA++ G+ F 
Sbjct: 542 SNIIAGVEFAVKHCQQSGKR-------CVANMSLGGLSFGHS-ALDSAVEAAIEEGLVFV 593

Query: 354 VAAGNENQDACNSSPAAAENAITVGASTLADDR----AYFSNWGKCVDIFAPGLNVLSTY 409
           VAAGN  + AC  SPA  + AITVGA    DDR    A FSN+GKCVDIFAPG+ V S  
Sbjct: 594 VAAGNSKERACWYSPAKVKTAITVGA---FDDRSDIIASFSNYGKCVDIFAPGVAVASLS 650

Query: 410 IGSETATATLSGTSMASPHVAGLLTYFLSLQPDSDSEYFHAAGGITPSQLKKKLIAYSTK 469
                    L+GTSM++P  AG++   L               GI P ++K  L++ STK
Sbjct: 651 NSPSNTMRVLNGTSMSAPITAGVVAVLLDQ-------------GIEPHEVKDHLLSISTK 697

>Kwal_23.6183 s23 complement(1485143..1486624) [1482 bp, 493 aa]
           {ON} YCR045C - Hypothetical ORF [contig 15] FULL
          Length = 493

 Score =  169 bits (428), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 149/439 (33%), Positives = 205/439 (46%), Gaps = 94/439 (21%)

Query: 127 DEEMGIMATSREGGILDSFDVNGMLRGYIGYFTQEIVDFIRMNPLVAFV----------- 175
           DE + I +   +G IL +F   G   G+   F   ++  +R NPLVA +           
Sbjct: 42  DEFLNIFS---QGKILKTFSF-GKFEGFTVDFPLSLISKLRNNPLVAEIVPNVEFNVFDG 97

Query: 176 EQDSMVYAN----------------------EFDTQNGAPWGLSRISHREKLNLGSFN-- 211
           E+D   + +                      +F  Q  AP  L+RIS R  L     N  
Sbjct: 98  EEDPSYWDDDNGDDEYDEDEDEDDEDNSEFPDFVAQKNAPRHLARISRRSALPYNPENIA 157

Query: 212 ------KYLYDDA-AGKGVTSYVIDTGINIDHKDFEGRAAWGKTVPTNDLDQDGNGHGTH 264
                  Y YDD+  G  V +YVIDTGI  +H+ F+GRA +G  +   +   D NGHGTH
Sbjct: 158 PKTSNFSYYYDDSFPGTCVNAYVIDTGIFKEHRQFQGRAKFGADL-VGEGPGDLNGHGTH 216

Query: 265 CAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVVKGVEFAAKSHQDAVKKNKKGFKGS 324
            AG I S+ YG            L + G G+++ V+  +EF        V   +K  +G 
Sbjct: 217 VAGLIGSQKYGVAKDVSLIEVKALNAKGQGNLTSVISAIEFT-------VNHCRKSKRGC 269

Query: 325 TANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACNSSPAAAENAITVGASTLAD 384
            AN+SLG  ++  L+ AV AA++AG+   VAAGN N +AC SSPA++ +AI+VGA    D
Sbjct: 270 VANLSLGSFRNSVLNQAVEAALEAGVVVVVAAGNSNANACWSSPASSLSAISVGA---FD 326

Query: 385 DR----AYFSNWGKCVDIFAPGLNVLSTYIGSETATATLSGTSMASPHVAGLLTYFLSLQ 440
           DR    A FSNWG CVD+FAPG+ + S        +   SGTSMASP V G++   L   
Sbjct: 327 DRTDTIARFSNWGNCVDLFAPGVKIASLSNIPPFKSVAYSGTSMASPLVTGMVAVLLD-- 384

Query: 441 PDSDSEYFHAAGGITPSQLKKKLIAYST-----KNALGDLPEDTVNYLIYNG-------- 487
                       GI P  +K++LI  +T     K AL   P  T N + + G        
Sbjct: 385 -----------SGIHPFDIKEELINTATDSVFHKRALLFKP-GTPNRVAFTGVEKEDDIF 432

Query: 488 -----GGQDLDDFWVKDLE 501
                 G D+D   VKDLE
Sbjct: 433 EDAVYPGVDIDQL-VKDLE 450

>TPHA0D03760 Chr4 complement(792115..793938) [1824 bp, 607 aa] {ON}
           Anc_6.313 YCR045C
          Length = 607

 Score =  164 bits (415), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 119/318 (37%), Positives = 159/318 (50%), Gaps = 37/318 (11%)

Query: 187 DTQNGAPWGLSRISHREKL--------NLGSFNKYLYDDA-AGKGVTSYVIDTGINIDHK 237
           D Q GAP  L ++S R +L            F  Y YD    G     Y+IDTG+  +HK
Sbjct: 148 DIQFGAPRHLGKLSSRHQLPYNVKDEKEFKEFIHYYYDRYYQGTNSVVYIIDTGVYKEHK 207

Query: 238 DFEGRAAWGKTVPTNDLDQDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMS 297
           +F  R  +G      +   D NGHGTH AG I SK +G            L   G G+++
Sbjct: 208 EFGNRVHFGGDF-IGEGKGDYNGHGTHVAGLIGSKTFGVAKNVTLFDVKVLDQKGFGNLT 266

Query: 298 DVVKGVEFAAKSHQDAVKKNKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAG 357
            V++G+EFA  + +  +K+   G K    NMSLG  ++P ++ A+  A  +GI   VAAG
Sbjct: 267 SVLEGIEFAVNNCK--LKQQPMG-KNCVINMSLGTIRNPIINEAIKEAFLSGITPVVAAG 323

Query: 358 NENQDACNSSPAAAENAITVGASTLADDR----AYFSNWGKCVDIFAPGLNVLSTYIGSE 413
           N N  AC +SPA++  AITVGA    DDR    A FSNWG+CVDIFAPG+ + S      
Sbjct: 324 NNNFSACWTSPASSNFAITVGA---MDDRTDTIAVFSNWGQCVDIFAPGVRIKSLSNRML 380

Query: 414 TATATLSGTSMASPHVAGLLTYFLSLQPDSDSEYFHAAGGITPSQLKKKLIAYSTKNALG 473
                 SGTSMASP VAGL+   +               G    ++K+KLI  S+K+   
Sbjct: 381 ENGVIHSGTSMASPIVAGLVAILME-------------KGYKCDEIKQKLIDDSSKSIFS 427

Query: 474 DL----PEDTVNYLIYNG 487
            L       T N +IYNG
Sbjct: 428 KLTLFFKYGTPNRVIYNG 445

>KLLA0F06028g Chr6 (576687..578213) [1527 bp, 508 aa] {ON} some
           similarities with uniprot|P25036 Saccharomyces
           cerevisiae YOR003W YSP3 subtilisin-like protease III
          Length = 508

 Score =  158 bits (400), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 129/331 (38%), Positives = 173/331 (52%), Gaps = 43/331 (12%)

Query: 182 YANEFDTQNGAPWGLSRISHR------EKLNLGSFNKYLY-DDAAGKGVTSYVIDTGINI 234
           ++++F +Q+ AP  L+RIS R      EK +  S  KY Y ++  G+GV  YV+D+G+N 
Sbjct: 147 FSDDFISQSRAPRHLARISRRAQLPVIEKDDTSSGLKYHYHEEHQGEGVFVYVLDSGVNH 206

Query: 235 DHKDFEGRAAWGKTVPTNDLDQDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSG 294
           DH DFEGRA  G    T +   D  GHGTH AG I SK YG            L S G G
Sbjct: 207 DHPDFEGRAMKGIDT-TGEGSGDLVGHGTHVAGLIGSKTYGVAKKVNIVEVKVLDSMGKG 265

Query: 295 SMSDVVKGVEFAAKSHQDAVKKNKKGFKGSTANMSLGG-GKSPALDMAVNAAVKAGIHFA 353
           +++++++G+E+    +Q   KK K        NMSLG  G    LD AV+A ++ G+   
Sbjct: 266 TVTNIIEGLEYVV--NQCIGKKRK-----CVINMSLGAPGTHSILDKAVSAVIEEGVVVV 318

Query: 354 VAAGNENQDACNSSPAAAENAITVGASTLADDR----AYFSNWGKCVDIFAPGLNVLSTY 409
           VA GN   +AC  SPA    AITV A    DDR    A FSNWG C+DI+APG+NV S  
Sbjct: 319 VAGGNSGLNACWYSPAKVRKAITVAA---MDDRTDLMAPFSNWGACIDIWAPGVNVKSLS 375

Query: 410 IGSETATATLSGTSMASPHVAGLLTYFLSLQPDSDSEYFHAAGGITPSQLKKKLIAYST- 468
                 T  LSGTSMASP VAG    +L               G  P++++K L   +T 
Sbjct: 376 -NKGRGTFVLSGTSMASPIVAGAAAIYLD-------------QGADPAEVRKILSKTATR 421

Query: 469 ----KNALGDLPEDTVNYLIYNGGGQDLDDF 495
               K A+   P  T N ++Y G  Q+ D+F
Sbjct: 422 GVFKKRAIAVRPR-TPNKVLYTGNNQEDDEF 451

>TBLA0A06700 Chr1 (1634983..1636476) [1494 bp, 497 aa] {ON}
           Anc_6.313 YCR045C
          Length = 497

 Score =  138 bits (347), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 93/258 (36%), Positives = 127/258 (49%), Gaps = 11/258 (4%)

Query: 185 EFDTQNGAPWGLSRISHREKLNLGS---FNKYLYDDAAGKGVTSYVIDTGINIDHKDFEG 241
           ++ TQ  AP  LSR S   KL   S   +N Y   D  G  VT YV+D+GI +DH +FEG
Sbjct: 141 KYSTQFNAPRHLSRASRITKLPTASNFTYNYYYPRDYQGANVTVYVLDSGIRMDHPEFEG 200

Query: 242 RAAWGKTVPTNDLDQDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVVK 301
           R        T+    D  GHGT  AG I SK YG            L + G G++  +++
Sbjct: 201 RILEAYDF-TDSGVGDNYGHGTSVAGIIGSKTYGVAKNVNLIDIKVLNNKGKGNVFSILQ 259

Query: 302 GVEFAAKSHQDAVKKNKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQ 361
           G++F  K  ++    N         N SLG      L+ A      AGI    AAGN   
Sbjct: 260 GLQFITKHCEENTNGN------CIINASLGAINIQILNKAFEEVHNAGIPVICAAGNNAV 313

Query: 362 DACNSSPAAAENAITVGASTLADDR-AYFSNWGKCVDIFAPGLNVLSTYIGSETATATLS 420
           +AC  +PA ++   TVG+    DD  A FSNWG+CVD+ APG+ V +    ++  +   S
Sbjct: 314 NACWITPAGSKGVFTVGSFDDRDDTIATFSNWGRCVDMMAPGVYVRTLLYTNQKGSRESS 373

Query: 421 GTSMASPHVAGLLTYFLS 438
           GTS+++P V GL    LS
Sbjct: 374 GTSVSTPIVTGLAAILLS 391

>Kwal_33.13372 s33 (190864..191997) [1134 bp, 377 aa] {ON} YCR045C -
           Hypothetical ORF [contig 118] FULL
          Length = 377

 Score =  134 bits (336), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 90/293 (30%), Positives = 150/293 (51%), Gaps = 12/293 (4%)

Query: 151 LRGYIGYFTQEIVDFIRMNPLVAFVEQDSMVYANEFDTQNGAPWGLSRISHREKLNLGSF 210
            R   G F Q +++ +  +  +  +  D ++   E+  Q  AP  L+R+S +  L  GS 
Sbjct: 55  FRAIYGDFPQRLLENLYYDGRITAMSMDHILTPAEYIVQEHAPAHLARLSQKSTLR-GSD 113

Query: 211 NKYLYDDAAGKGVTSYVIDTGINIDHKDFEGRAAWGKTVPTNDLDQ-DGNGHGTHCAGTI 269
             Y+Y    G GV  Y++DTGI+  H + EGR      + +N +   D +GHGT  AG I
Sbjct: 114 GTYIYHSNGGNGVDVYLLDTGIDDLHPELEGRVQKIADLTSNPVSHGDPHGHGTAVAGVI 173

Query: 270 ASKHYGXXXXXXXXXXXXLRSNGSGSMSDVVKGVEFAAKSHQDAVKKNKKGFKGSTANMS 329
            S  +G              S G+ ++  V++ +E A+K    +V +     + S   + 
Sbjct: 174 GSATFGSAKKCNLFDVRVADSTGNATLIGVIRALEHASK--LASVTQ-----RPSVVVIP 226

Query: 330 LGGGKSPALDMAVNAAVK-AGIHFAVAAGNENQDACNSSPAAAENAITVGA--STLADDR 386
               K+  L+ A+ A ++   +   VA GN NQ+AC+SSPA+A  A+T+G+   T  D  
Sbjct: 227 FTMRKNVILNSAIEAVIRDQSLPVVVAGGNFNQNACDSSPASAYGALTIGSIDVTKGDSL 286

Query: 387 AYFSNWGKCVDIFAPGLNVLSTYIGSETATATLSGTSMASPHVAGLLTYFLSL 439
           A F+N+G C+D FA G+N+ S   G   +    SGTS+++   +G++ Y++SL
Sbjct: 287 APFTNYGDCIDTFAAGVNITSLTTGDYESNTQYSGTSISAGIASGVVAYYMSL 339

>KLTH0F02288g Chr6 (186895..188037) [1143 bp, 380 aa] {ON} weakly
           similar to uniprot|P25381 Saccharomyces cerevisiae
           YCR045C Hypothetical ORF
          Length = 380

 Score =  132 bits (333), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 105/325 (32%), Positives = 169/325 (52%), Gaps = 18/325 (5%)

Query: 124 ATMDEEMG-IMATSREGGILDSFDVNGMLRGYIGYFTQEIV-DFIRMNPLVAFVEQDSMV 181
           A+++E +G   A +  GG + +  +    R   G F Q+++ DF R   +VA +  D  +
Sbjct: 27  ASVEEVLGEQYAATVAGGGVGAITLGNSFRAIYGEFPQQLLEDFYRSGQIVA-MSMDRPL 85

Query: 182 YANEFDTQNGAPWGLSRISHREKLNLGSFN---KYLYDDAAGKGVTSYVIDTGINIDHKD 238
              E+  Q  AP  L+R+S +  L  G+ +    Y+Y   AG GV  Y++DTGI+  H  
Sbjct: 86  GVAEYMVQQHAPNHLARLSQKSSLRGGNGSDNGAYIYHSNAGNGVDVYLLDTGIDGTHPA 145

Query: 239 FEGRAAWGKTVPTNDLDQ-DGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMS 297
           FEGR        ++ +   D +GHGT  AG I S  +G              S G  S+ 
Sbjct: 146 FEGRVQKAADFSSDPVATGDPHGHGTAVAGVIGSSVFGVAKKCNLFDVRVANSTGHASLI 205

Query: 298 DVVKGVEFAAKSHQDAVKKNKKGFKGSTANMSLGGGKSPALDMAVNAAVK-AGIHFAVAA 356
            V++ +E A+K    AV K     + S   + L   ++  L+ AV A V+   I   VAA
Sbjct: 206 GVLRALEHASK--LAAVTK-----RPSLITIPLEMPRNTILNSAVEAVVRDLSIPVVVAA 258

Query: 357 GNENQDACNSSPAAAENAITVGASTLA--DDRAYFSNWGKCVDIFAPGLNVLSTYIGSET 414
           GNEN+ AC+ SPA A  A+T+G+  +A  D  A F+N+ +CVD+F  G++V +  +   +
Sbjct: 259 GNENRSACSVSPAGAYGALTIGSIDVARNDALAPFTNFAECVDLFTAGVDVATLGL-DHS 317

Query: 415 ATATLSGTSMASPHVAGLLTYFLSL 439
           +   LSGTS+++   +GL+ Y++S+
Sbjct: 318 SEHHLSGTSISAGVASGLVAYYMSI 342

>Kpol_2000.69 s2000 complement(151054..152214) [1161 bp, 386 aa]
           {ON} complement(151054..152214) [1161 nt, 387 aa]
          Length = 386

 Score =  118 bits (296), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 91/313 (29%), Positives = 154/313 (49%), Gaps = 24/313 (7%)

Query: 142 LDSFDVNGMLRGYIGYFTQEIVDFIRMNPLVAFVEQDSMVYANEFDTQNGAPWGLSRISH 201
           +D   +     G+ G F  E++  +  +P VA +  D M+Y  E+  QN AP  L+R+S+
Sbjct: 52  VDKIVIGSDFHGFSGEFEDEVMSELYGDPRVASISIDRMLYLQEYLRQNDAPEHLARLSN 111

Query: 202 ---REKLNLGSFNKYLYDDAAGKGVTSYVIDTGINIDHKDFEGRAAWGKTVPTNDLDQ-- 256
                +++  + N +++   AG GV  Y++D+GI+  H  F  R    K +   D     
Sbjct: 112 GVSNSRVSAKNENAFIFHSHAGIGVDVYIVDSGIDSQHPAFMNR-HISKLIDLTDNPIPV 170

Query: 257 -DGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSG-SMSDVVKGVEFAAKSHQDAV 314
            D +GHGT  AG + S  +G            + +  +G  +S ++K +EF  ++H  A 
Sbjct: 171 GDPHGHGTAIAGLVTSDTFGVMKKANLFDVRVVDAESNGVKLSKLLKSLEF-IENHSRAT 229

Query: 315 KKNKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACNSSPAAAENA 374
                  + S A +     K+  L+ A+  ++   I   V AGN++  ACN SPA+A N+
Sbjct: 230 ------MRPSVAVLPFSMSKNAILNSAIE-SMPNSIAIVVPAGNQHHMACNFSPASARNS 282

Query: 375 ITVGASTLADDR-----AYFSNWGKCVDIFAPGLN---VLSTYIGSETATATLSGTSMAS 426
            ++ +    D R     A FSN+G+CVD+F  G+    + +T    E   + +SGTSM+ 
Sbjct: 283 QSILSVGSLDYRSSIEIASFSNYGECVDVFTSGVQMDTLHATTNSDENYISKVSGTSMSC 342

Query: 427 PHVAGLLTYFLSL 439
              AG + Y++SL
Sbjct: 343 AIAAGTVGYYMSL 355

>ZYRO0F16764g Chr6 complement(1390437..1391597) [1161 bp, 386 aa]
           {ON} conserved hypothetical protein
          Length = 386

 Score =  105 bits (261), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 96/342 (28%), Positives = 152/342 (44%), Gaps = 39/342 (11%)

Query: 141 ILDSFDVNGMLRGYIGYFTQEIVDFIRMNPLVAFVEQDSMVYANEFDTQNGAPWGLSRIS 200
           I D F++ G  R + G F+  I+  +  +P V  + +D  +   E   QN AP  L  +S
Sbjct: 45  ITDIFEL-GSFRAFTGDFSGPILQKLYNDPNVLAISRDGSLKLQEIVLQNNAPSHLVGLS 103

Query: 201 HREKLNLGSFNKYLYDDAAGKGVTSYVIDTGINIDHKDFEG----RAAWGKTVPTNDLDQ 256
               L   S   ++Y    G GV  Y++DTGI+I H +       R A     P      
Sbjct: 104 SISPL---SHQPFIYRSNGGNGVDVYLLDTGIDIKHPNLSKLNILRMADLTQSPVPQ-GT 159

Query: 257 DGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVVKGVEFAAKSHQDAVKK 316
           D  GHGT  AG IAS+ +G              SNG   +S +++ +    + H +  K+
Sbjct: 160 DPQGHGTAMAGIIASETFGVLKKCNLVDVRVADSNGDVKLSTILQALTLTQR-HIEGTKR 218

Query: 317 NKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACNSSPA----AAE 372
                      + +  G +P L  A+ A+    +   + AGN  QDA N SPA      +
Sbjct: 219 PSV----VVIPLEVEDGNNPILTEAI-ASFDQSVPIIIPAGNNAQDALNFSPANVNPKPK 273

Query: 373 NAITVGASTLADDRAYFSNWGKCVDIFAPGLNVL---STYIGSE----TATATLSGTSMA 425
           N I VG+  + ++   F+N+G  VD+F  G  +    ST + S+    + T  +SGTS +
Sbjct: 274 NIIVVGSVDVNNNPTKFTNYGSNVDVFTVGEQITTLQSTDLDSQGLSNSLTRQVSGTSAS 333

Query: 426 SPHVAGLLTYFLSLQPDSDSEYFHAAGGITPSQLKKKLIAYS 467
           S   AG++ Y++SL             G+  +Q   K++ YS
Sbjct: 334 SAITAGVIGYYMSL-------------GLNSTQSINKVLQYS 362

>TDEL0C06230 Chr3 complement(1135740..1136834) [1095 bp, 364 aa]
           {ON} Anc_1.78
          Length = 364

 Score = 97.8 bits (242), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 85/305 (27%), Positives = 141/305 (46%), Gaps = 23/305 (7%)

Query: 142 LDSFDVNGMLRGYIGYFTQEIVDFIRMNPLVAFVEQDSMVYANEFDTQNGAPWGLSRISH 201
           ++   V    +   G F+ E ++++  +  V  + +D  +   E+  Q G+P  LS++S 
Sbjct: 44  IEMITVGDQFKALAGEFSVEDLEYLYHDERVVAISRDRDLKLQEYKVQYGSPRHLSQLS- 102

Query: 202 REKLNLGSFNKYLYDDAAGKGVTSYVIDTGINIDHKDFEG----RAAWGKTVPTNDLDQD 257
               + GSF    +D  +G  V  YV DTGI+  H   +     + A   + P      D
Sbjct: 103 ----SGGSFT---FDPVSGNLVDVYVFDTGIDFKHPGLQNVNPHKLADFTSSPVPR-GAD 154

Query: 258 GNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVVKGVEFAAKSHQDAVKKN 317
            +GHGT  AG IAS+ +G               +G   +S ++KG+  A+ +H    K+ 
Sbjct: 155 PHGHGTMMAGLIASETFGVLKSCSLVDVRVADKDGEVKLSTLMKGIS-ASVAHARFTKRP 213

Query: 318 KKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACNSSPAAAENAITV 377
                  T      G K+  LD  + A  K  I   + AGN+  DAC+ SP    N + +
Sbjct: 214 SVFVLPMTI-----GKKNHILDNFLQAIPK-DIAIVLPAGNQQTDACDLSPPNDHNILVI 267

Query: 378 GASTLADDRAYFSNWGKCVDIFAPGLNVL---STYIGSETATATLSGTSMASPHVAGLLT 434
           G+    +  A FSN+G CVD++  G ++L   ST  G+E    + +GTS +    AG++ 
Sbjct: 268 GSLDRDNRLADFSNYGNCVDVYTSGTDILTLRSTDSGNEVLLQSSNGTSASCAIGAGIVG 327

Query: 435 YFLSL 439
           Y +S+
Sbjct: 328 YHMSM 332

>TPHA0B04520 Chr2 complement(1065861..1067027) [1167 bp, 388 aa]
           {ON} Anc_1.78
          Length = 388

 Score = 91.7 bits (226), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 73/272 (26%), Positives = 125/272 (45%), Gaps = 35/272 (12%)

Query: 189 QNGAPWGLSRISHREKLNLGSF----NKYLYDDAAGKGVTSYVIDTGINIDHKDFEGRAA 244
           Q  AP  L R++ ++ +    +    N+Y++ D +G GV  Y++DTGI+I H  +     
Sbjct: 97  QTDAPKHLGRLT-KDSIKSSQYHYANNQYIFSDTSGNGVDIYIVDTGIDIQHPIYLQNNI 155

Query: 245 WG------KTVPTNDLDQDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGS-GSMS 297
                     +P+ D     NGHGT  AG I S  +G            + +N    +MS
Sbjct: 156 HKLIDLTTSPIPSGDF----NGHGTAMAGIINSDPFGVLKSANLVDVRVVDANTKHATMS 211

Query: 298 DVVKGVEFAAKSHQDAVKKNKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAG 357
            V+  +    K  Q       K  + S   +     K+  L+ A+    K  I   + AG
Sbjct: 212 RVLSALSLIEKHEQ-------KTMRPSIIVLPFQTEKNTILESAIENISKK-IPVIIPAG 263

Query: 358 NENQDACNSSPAAAE---NAITVGASTLADDRAY-----FSNWGKCVDIFAPGLNVLSTY 409
           N++Q+AC  SP   +   N + VG+   ++++ Y     FSN+G CVDI+  G+++ +  
Sbjct: 264 NKHQNACKLSPMGIKKLSNVLVVGSLEYSEEQNYLDIAKFSNYGSCVDIYTSGVDISTLK 323

Query: 410 I---GSETATATLSGTSMASPHVAGLLTYFLS 438
               G +     ++GTS +   VAG++ Y++S
Sbjct: 324 TSSNGGKELIHNVTGTSYSCGIVAGVVGYYMS 355

>TBLA0A05410 Chr1 (1328472..1329620) [1149 bp, 382 aa] {ON} Anc_1.78
          Length = 382

 Score = 81.6 bits (200), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 80/281 (28%), Positives = 123/281 (43%), Gaps = 26/281 (9%)

Query: 172 VAFVEQDSMVYANEFDTQNGAPWGLSRISHREKLNLGSFNKYLYDDAAGKGVTSYVIDTG 231
           +A +  D  +   E   Q  AP  L+++   E  +    N+++YD  AG GV  Y+ DTG
Sbjct: 80  IAAISIDRQLEPQEMIVQKDAPRHLTKLLETEAGD----NEFVYDSTAGNGVDIYIFDTG 135

Query: 232 INIDHKDFEG-RAAWGKTVPTNDL-DQDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLR 289
           I  +       R      +P   + DQ+   HGT  +G I S  +G              
Sbjct: 136 IARNSPGLSASRIHDMPGMPGPPIRDQEILEHGTAMSGLIGSPAFGVLKKCNLIDVNVGD 195

Query: 290 SNGSGSMSDVVKGVEFAAKSHQDAVKKNKKGFKGSTANMSLGGGKSPALDMAVNAAVKAG 349
            NG   MS V+KG+       Q  VK      + S  N S    K+  L+ A +   +  
Sbjct: 196 ENGKVFMSKVLKGLNLV----QQHVKHTN---RPSVINFSYCTLKNAILNSAFDNFPR-D 247

Query: 350 IHFAVAAGNENQDACNSSPAAAE---NAITVGASTLADD---RAYFSNWGKCVDIFAPGL 403
           +  AVAAGN  Q  C+ SP   +   + +  G+  + DD    + FSN+G CV  +APG 
Sbjct: 248 VPIAVAAGNYKQPGCSFSPVGCQRNKSLLAFGSLLMNDDGITLSDFSNYGSCVGSYAPGE 307

Query: 404 NVLSTYI------GSETATATLSGTSMASPHVAGLLTYFLS 438
            +L+  I       S      +SGTS +S   AG++ Y+++
Sbjct: 308 GLLTFGIPDTSRPNSRDTVIIISGTSGSSALGAGVIGYYMA 348

>Skud_14.101 Chr14 (191111..193570) [2460 bp, 819 aa] {ON} YNL238W
           (REAL)
          Length = 819

 Score = 36.2 bits (82), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 35/69 (50%), Gaps = 10/69 (14%)

Query: 212 KYLYDDAAGKGVTSYVIDTGINIDHKD----FEGRAAW----GKTVPTNDLDQDGNGHGT 263
           K  Y++  G GV + ++D G++ +++D    F    +W       +P   L  D   HGT
Sbjct: 158 KLWYNNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSWDFNDNTNLPKPRLSDD--YHGT 215

Query: 264 HCAGTIASK 272
            CAG IA+K
Sbjct: 216 RCAGEIAAK 224

>NCAS0F00490 Chr6 (89926..92889) [2964 bp, 987 aa] {ON} Anc_5.85
           YGR240C
          Length = 987

 Score = 35.0 bits (79), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 32/63 (50%), Gaps = 3/63 (4%)

Query: 290 SNGSGSMSDVVKGVEFAAKSHQDAVKKNKKGFKGSTANMSLGGGKSPALDMAVNAAVKAG 349
           +N S S SDV +    +A    + +K+   G K     +   GG SP ++ AV A V+ G
Sbjct: 174 ANVSESSSDVSRDASLSAI---NMLKQTLSGQKKKKIAVMTSGGDSPGMNAAVRAVVRTG 230

Query: 350 IHF 352
           IHF
Sbjct: 231 IHF 233

>YNL238W Chr14 (202428..204872) [2445 bp, 814 aa] {ON}
           KEX2Subtilisin-like protease (proprotein convertase), a
           calcium-dependent serine protease involved in the
           activation of proproteins of the secretory pathway
          Length = 814

 Score = 35.0 bits (79), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 34/66 (51%), Gaps = 10/66 (15%)

Query: 215 YDDAAGKGVTSYVIDTGINIDHKD----FEGRAAW----GKTVPTNDLDQDGNGHGTHCA 266
           Y++  G GV + ++D G++ +++D    F    +W       +P   L  D   HGT CA
Sbjct: 161 YNNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSWDFNDNTNLPKPRLSDD--YHGTRCA 218

Query: 267 GTIASK 272
           G IA+K
Sbjct: 219 GEIAAK 224

>Suva_14.106 Chr14 (196428..198857) [2430 bp, 809 aa] {ON} YNL238W
           (REAL)
          Length = 809

 Score = 35.0 bits (79), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 34/66 (51%), Gaps = 10/66 (15%)

Query: 215 YDDAAGKGVTSYVIDTGINIDHKD----FEGRAAW----GKTVPTNDLDQDGNGHGTHCA 266
           Y++  G GV + ++D G++ +++D    F    +W       +P   L  D   HGT CA
Sbjct: 161 YNNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSWDFNDNTNLPKPRLSDD--YHGTRCA 218

Query: 267 GTIASK 272
           G IA+K
Sbjct: 219 GEIAAK 224

>ZYRO0F15598g Chr6 complement(1278928..1281300) [2373 bp, 790 aa]
           {ON} similar to uniprot|P13134 YNL238W Saccharomyces
           cerevisiae KEX2 Subtilisin-like protease (proprotein
           convertase)
          Length = 790

 Score = 34.7 bits (78), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 33/65 (50%), Gaps = 10/65 (15%)

Query: 215 YDDAAGKGVTSYVIDTGINIDHKD----FEGRAAW----GKTVPTNDLDQDGNGHGTHCA 266
           Y++  G GV + ++D G++ + +D    F    +W       +P   LD D   HGT CA
Sbjct: 154 YENITGHGVVAAIVDDGLDYESEDLKDNFCKEGSWDFNDNTKLPKPRLDDD--YHGTRCA 211

Query: 267 GTIAS 271
           G IA+
Sbjct: 212 GEIAA 216

>SAKL0G00440g Chr7 (41016..43526) [2511 bp, 836 aa] {ON} similar to
           uniprot|P13134 YNL238W Saccharomyces cerevisiae KEX2
           Subtilisin-like protease (proprotein convertase)
          Length = 836

 Score = 34.7 bits (78), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 33/65 (50%), Gaps = 10/65 (15%)

Query: 215 YDDAAGKGVTSYVIDTGINIDHKD----FEGRAAW----GKTVPTNDLDQDGNGHGTHCA 266
           Y++  G GV + ++D G++ +++D    F    +W       +P   L  D   HGT CA
Sbjct: 185 YENITGHGVVAAIVDDGLDYENRDLKDNFCAEGSWDFNDNTPLPKPRLRDD--YHGTRCA 242

Query: 267 GTIAS 271
           G IA+
Sbjct: 243 GEIAA 247

>Smik_14.97 Chr14 (181672..184116) [2445 bp, 814 aa] {ON} YNL238W
           (REAL)
          Length = 814

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 34/66 (51%), Gaps = 10/66 (15%)

Query: 215 YDDAAGKGVTSYVIDTGINIDHKD----FEGRAAW----GKTVPTNDLDQDGNGHGTHCA 266
           Y++  G GV + ++D G++ +++D    F    +W       +P   L  D   HGT CA
Sbjct: 161 YNNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSWDFNDNTNLPKPRLLDD--YHGTRCA 218

Query: 267 GTIASK 272
           G IA+K
Sbjct: 219 GEIAAK 224

>TPHA0P01790 Chr16 complement(373247..375646) [2400 bp, 799 aa] {ON}
           Anc_2.6 YNL238W
          Length = 799

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 32/60 (53%), Gaps = 10/60 (16%)

Query: 220 GKGVTSYVIDTGINIDHKD----FEGRAAW----GKTVPTNDLDQDGNGHGTHCAGTIAS 271
           GKGV + ++D G++ + +D    F    +W     K +PT  L  D   HGT CAG IA+
Sbjct: 163 GKGVVAAIVDDGLDHNSEDLKDNFCEEGSWDFNENKKLPTPKLIDD--YHGTRCAGEIAA 220

>KAFR0A08040 Chr1 complement(1609550..1611850) [2301 bp, 766 aa]
           {ON} Anc_2.6 YNL238W
          Length = 766

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 32/65 (49%), Gaps = 10/65 (15%)

Query: 215 YDDAAGKGVTSYVIDTGINIDHKD----FEGRAAW----GKTVPTNDLDQDGNGHGTHCA 266
           Y +  GKGV + V+D G++ ++ D    F    +W       +P   L  D   HGT CA
Sbjct: 152 YQNITGKGVVAAVVDDGLDYENPDIKDNFCKEGSWDFNANTNLPKPTLADD--YHGTRCA 209

Query: 267 GTIAS 271
           G IA+
Sbjct: 210 GEIAA 214

>NDAI0F03890 Chr6 complement(921561..924062) [2502 bp, 833 aa] {ON}
           Anc_2.6 YNL238W
          Length = 833

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 33/68 (48%), Gaps = 10/68 (14%)

Query: 212 KYLYDDAAGKGVTSYVIDTGINIDHKD----FEGRAAW----GKTVPTNDLDQDGNGHGT 263
           K  Y++  G+G+   ++D G++ ++ D    F    +W       +P   L  D   HGT
Sbjct: 172 KLWYENITGEGIVVAIVDDGLDYENPDLKDNFSAEGSWDFNDNTQLPKPRLADD--YHGT 229

Query: 264 HCAGTIAS 271
            CAG IA+
Sbjct: 230 RCAGEIAA 237

>NDAI0D02620 Chr4 complement(606774..609737) [2964 bp, 987 aa] {ON}
           Anc_5.85
          Length = 987

 Score = 33.5 bits (75), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 26/47 (55%)

Query: 306 AAKSHQDAVKKNKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHF 352
           A+ S  + +K++  G K     +   GG SP ++ AV A V+ GIHF
Sbjct: 187 ASTSAINLLKQSLAGQKKKKIAVMTSGGDSPGMNAAVRAVVRTGIHF 233

>KNAG0F00770 Chr6 (137641..140121) [2481 bp, 826 aa] {ON} Anc_2.6
           YNL238W
          Length = 826

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 31/65 (47%), Gaps = 10/65 (15%)

Query: 215 YDDAAGKGVTSYVIDTGINIDHKD----FEGRAAW----GKTVPTNDLDQDGNGHGTHCA 266
           Y +  G GV   ++D G++ ++ D    F    +W      T+P   L  D   HGT CA
Sbjct: 165 YGNVTGSGVVVAIVDDGVDYENPDIADNFCAEGSWDFNDNTTLPKPRLADD--YHGTRCA 222

Query: 267 GTIAS 271
           G IA+
Sbjct: 223 GEIAA 227

>KNAG0K00580 Chr11 complement(101850..104819) [2970 bp, 989 aa] {ON}
           Anc_5.85 YGR240C
          Length = 989

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 27/56 (48%), Gaps = 6/56 (10%)

Query: 304 EFAAKSHQDAVKKNKKGF-----KGSTANMSLGGGKSPALDMAVNAAVKAGIHFAV 354
           E +  S +DA+ K K        K   A M+  GG SP +  AV A V+ GIHF  
Sbjct: 182 ELSTSSSEDALTKLKTSLGSLQPKKKIAVMT-SGGDSPGMCAAVRAVVRTGIHFGC 236

>Kpol_1050.72 s1050 complement(157470..160439) [2970 bp, 989 aa]
           {ON} complement(157470..160439) [2970 nt, 990 aa]
          Length = 989

 Score = 32.7 bits (73), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 21/33 (63%), Gaps = 1/33 (3%)

Query: 320 GFKGSTANMSLGGGKSPALDMAVNAAVKAGIHF 352
           G K   A M+  GG SP ++ AV A V+AGIH+
Sbjct: 204 GIKKKLAVMT-SGGDSPGMNAAVRAVVRAGIHY 235

>TPHA0A05200 Chr1 complement(1168851..1171826) [2976 bp, 991 aa]
           {ON} Anc_5.85 YGR240C
          Length = 991

 Score = 32.3 bits (72), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 28/50 (56%), Gaps = 5/50 (10%)

Query: 304 EFAAKSHQDAVKKNKKG-FKGSTANMSLGGGKSPALDMAVNAAVKAGIHF 352
           EF  KS    + K+K G  K   A M+  GG SP ++ AV A V+ GIH+
Sbjct: 194 EFLQKS---LINKSKNGSIKKKIAVMT-SGGDSPGMNAAVRAVVRTGIHY 239

>NCAS0A00880 Chr1 (173726..176227) [2502 bp, 833 aa] {ON} Anc_2.6
           YNL238W
          Length = 833

 Score = 32.3 bits (72), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 33/68 (48%), Gaps = 10/68 (14%)

Query: 212 KYLYDDAAGKGVTSYVIDTGINIDH----KDFEGRAAW----GKTVPTNDLDQDGNGHGT 263
           +  Y++  G G+ + ++D G++ D+     +F    +W       +P   L  D   HGT
Sbjct: 183 QLWYENVTGTGIVAAIVDDGVDYDNDNIKDNFSREGSWDFNDNGPLPKPKLKDD--YHGT 240

Query: 264 HCAGTIAS 271
            CAG IA+
Sbjct: 241 RCAGEIAA 248

>ZYRO0B08140g Chr2 (635368..638322) [2955 bp, 984 aa] {ON} highly
           similar to uniprot|P16861 Saccharomyces cerevisiae
           YGR240C PFK1 Alpha subunit of heterooctameric
           phosphofructokinase involved in glycolysis indispensable
           for anaerobic growth activated by fructose-2 6-
           bisphosphate and AMP mutation inhibits glucose induction
           of cell cycle-related genes
          Length = 984

 Score = 32.0 bits (71), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 29/47 (61%), Gaps = 3/47 (6%)

Query: 306 AAKSHQDAVKKNKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHF 352
           A K  ++++ +++K  K   A M+  GG SP ++ AV A V+ GIHF
Sbjct: 190 AVKELKNSLARSQK--KKKIAVMT-SGGDSPGMNAAVRAVVRTGIHF 233

>TBLA0D02710 Chr4 (669879..671627) [1749 bp, 582 aa] {ON} Anc_8.481
           YPL030W
          Length = 582

 Score = 32.0 bits (71), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 18/34 (52%)

Query: 456 PSQLKKKLIAYSTKNALGDLPEDTVNYLIYNGGG 489
           PS     ++AY  KNAL   P   V  +I NGGG
Sbjct: 530 PSTRNAAIVAYENKNALASFPTQEVYEVIQNGGG 563

>Ecym_6486 Chr6 complement(941694..944039) [2346 bp, 781 aa] {ON}
           similar to Ashbya gossypii ABL203W
          Length = 781

 Score = 32.0 bits (71), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 32/65 (49%), Gaps = 10/65 (15%)

Query: 215 YDDAAGKGVTSYVIDTGINIDHKD----FEGRAAW----GKTVPTNDLDQDGNGHGTHCA 266
           Y++  G GV + ++D G++ + +D    F    +W       +P   L  D   HGT CA
Sbjct: 154 YNNITGHGVVAAIVDDGLDYESEDLKDNFCAEGSWDFNANTALPKPILGDD--NHGTRCA 211

Query: 267 GTIAS 271
           G IA+
Sbjct: 212 GEIAA 216

>KAFR0F01270 Chr6 (243255..246236) [2982 bp, 993 aa] {ON} 
          Length = 993

 Score = 31.6 bits (70), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 28/59 (47%), Gaps = 4/59 (6%)

Query: 139 GGILDSFDVNGMLRGYIGYFTQEIVDFIR----MNPLVAFVEQDSMVYANEFDTQNGAP 193
           GG+ +  D+ G  R Y+G     I++ +R    MNPL+   E D +  +    T  G P
Sbjct: 537 GGVYNEADIRGHRRTYVGAMCGSIINALRKASTMNPLILLDEIDKIGTSPAGRTNTGDP 595

>Kpol_1015.8 s1015
           complement(19725..20576,20692..20940,20990..20998,
           21041..22462) [2532 bp, 843 aa] {ON}
           complement(19725..20576,20692..20940,20990..20998,
           21041..22462) [2532 nt, 844 aa]
          Length = 843

 Score = 31.6 bits (70), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 32/65 (49%), Gaps = 10/65 (15%)

Query: 215 YDDAAGKGVTSYVIDTGINIDHKD----FEGRAAW----GKTVPTNDLDQDGNGHGTHCA 266
           Y+   GKGV   ++D G++ + +D    F    +W     + +P   L  D   HGT CA
Sbjct: 157 YEGITGKGVVVAIVDDGLDYESEDLKDNFCKEGSWDFNENQNLPKPLLYDD--YHGTRCA 214

Query: 267 GTIAS 271
           G IA+
Sbjct: 215 GEIAA 219

>TDEL0G01090 Chr7 (223036..225987) [2952 bp, 983 aa] {ON} Anc_5.85
           YGR240C
          Length = 983

 Score = 31.6 bits (70), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 22/41 (53%)

Query: 312 DAVKKNKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHF 352
           + +++   G K     +   GG SP ++ AV A V+ GIHF
Sbjct: 190 EILRQTLSGQKKKKIAVMTSGGDSPGMNAAVRAVVRTGIHF 230

>CAGL0J07546g Chr10 complement(733686..736055) [2370 bp, 789 aa]
           {ON} similar to uniprot|P13134 Saccharomyces cerevisiae
           YNL238w KEX2 endoproteinase of late golgi compartment
          Length = 789

 Score = 31.6 bits (70), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 31/61 (50%), Gaps = 10/61 (16%)

Query: 219 AGKGVTSYVIDTGINI---DHKD-FEGRAAW----GKTVPTNDLDQDGNGHGTHCAGTIA 270
            GKGV + +ID G++    D KD F    +W     + +P   L  D   HGT CAG IA
Sbjct: 169 TGKGVVAAIIDDGVDYTSPDLKDNFCKEGSWDFNENQQLPMPLLSDDN--HGTRCAGEIA 226

Query: 271 S 271
           +
Sbjct: 227 A 227

>KLTH0H00418g Chr8 (46022..48457) [2436 bp, 811 aa] {ON} similar to
           uniprot|P13134 YNL238W Saccharomyces cerevisiae KEX2
           Subtilisin-like protease (proprotein convertase)
          Length = 811

 Score = 31.2 bits (69), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 30/65 (46%), Gaps = 10/65 (15%)

Query: 215 YDDAAGKGVTSYVIDTGINIDHKD----FEGRAAW----GKTVPTNDLDQDGNGHGTHCA 266
           Y++  G  V   V+D G++ + +D    F    +W       +P   L  D   HGT CA
Sbjct: 155 YENVTGHNVVVAVVDDGLDYESEDLKDNFSAEGSWDFNDNGPMPKPRLSDDY--HGTRCA 212

Query: 267 GTIAS 271
           G IA+
Sbjct: 213 GEIAA 217

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.131    0.372 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 53,524,580
Number of extensions: 2389877
Number of successful extensions: 5787
Number of sequences better than 10.0: 97
Number of HSP's gapped: 5746
Number of HSP's successfully gapped: 99
Length of query: 543
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 428
Effective length of database: 40,294,809
Effective search space: 17246178252
Effective search space used: 17246178252
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 68 (30.8 bits)