Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_56.22367na 1ON51751728040.0
KLTH0C11440gna 1ON50850817470.0
KLTH0B03806g5.184ON52252012981e-175
Kwal_33.150415.184ON52251212871e-173
SAKL0G13288g5.184ON54050911841e-157
Kpol_2002.895.184ON52351611071e-146
Smik_6.2915.184ON53551410601e-139
YGR177C (ATF2)5.184ON53553210321e-134
Suva_7.4705.184ON54653110201e-132
Skud_7.5075.184ON53553010081e-131
CAGL0D05918g5.184ON56453310051e-130
Smik_15.559na 2ON52451410001e-130
NCAS0A069205.184ON5185149961e-129
Skud_15.544na 2ON5245139971e-129
YOR377W (ATF1)na 2ON5255149941e-129
Suva_8.434na 2ON5255179801e-127
NDAI0D019805.184ON5385279601e-123
TPHA0E031705.184ON5345199581e-123
KAFR0D017305.184ON5345139541e-123
KNAG0H026505.184ON5445138571e-108
KLLA0F15202g5.184ON5175147631e-94
CAGL0K00737g5.119ON4573781322e-07
KNAG0G007005.119ON4562161133e-05
NDAI0D023605.119ON4705061062e-04
KLTH0C02178g5.119ON4641861044e-04
YGR212W (SLI1)5.119ON4684121029e-04
NCAS0A073905.119ON478353930.009
TDEL0E051105.119ON469492860.060
Smik_16.945.119ON466360860.064
Skud_7.5485.119ON475178830.16
AGR066W8.287ON157799751.8
SAKL0E06710g2.324ON63447741.8
SAKL0G01254g5.651ON592166732.3
ADL293W2.324ON57747723.3
SAKL0G15004g5.119ON456199697.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_56.22367
         (517 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_56.22367 s56 (67552..69105) [1554 bp, 517 aa] {ON} YOR377W ...  1084   0.0  
KLTH0C11440g Chr3 complement(940466..941992) [1527 bp, 508 aa] {...   677   0.0  
KLTH0B03806g Chr2 complement(309522..311090) [1569 bp, 522 aa] {...   504   e-175
Kwal_33.15041 s33 (927424..928992) [1569 bp, 522 aa] {ON} YGR177...   500   e-173
SAKL0G13288g Chr7 complement(1139419..1141041) [1623 bp, 540 aa]...   460   e-157
Kpol_2002.89 s2002 (209104..210675) [1572 bp, 523 aa] {ON} (2091...   431   e-146
Smik_6.291 Chr6 complement(456731..458338) [1608 bp, 535 aa] {ON...   412   e-139
YGR177C Chr7 complement(848829..850436) [1608 bp, 535 aa] {ON}  ...   402   e-134
Suva_7.470 Chr7 complement(806476..808116) [1641 bp, 546 aa] {ON...   397   e-132
Skud_7.507 Chr7 complement(822986..824593) [1608 bp, 535 aa] {ON...   392   e-131
CAGL0D05918g Chr4 (563388..565082) [1695 bp, 564 aa] {ON} simila...   391   e-130
Smik_15.559 Chr15 (992130..993704) [1575 bp, 524 aa] {ON} YOR377...   389   e-130
NCAS0A06920 Chr1 (1373157..1374713) [1557 bp, 518 aa] {ON} Anc_5...   388   e-129
Skud_15.544 Chr15 (985246..986820) [1575 bp, 524 aa] {ON} YOR377...   388   e-129
YOR377W Chr15 (1046226..1047803) [1578 bp, 525 aa] {ON}  ATF1Alc...   387   e-129
Suva_8.434 Chr8 (783961..785538) [1578 bp, 525 aa] {ON} YOR377W ...   382   e-127
NDAI0D01980 Chr4 (468576..470192) [1617 bp, 538 aa] {ON} Anc_5.184    374   e-123
TPHA0E03170 Chr5 complement(670756..672360) [1605 bp, 534 aa] {O...   373   e-123
KAFR0D01730 Chr4 complement(345374..346978) [1605 bp, 534 aa] {O...   372   e-123
KNAG0H02650 Chr8 (492038..493672) [1635 bp, 544 aa] {ON} Anc_5.1...   334   e-108
KLLA0F15202g Chr6 (1401627..1403180) [1554 bp, 517 aa] {ON} simi...   298   1e-94
CAGL0K00737g Chr11 complement(81263..82636) [1374 bp, 457 aa] {O...    55   2e-07
KNAG0G00700 Chr7 complement(132337..133707) [1371 bp, 456 aa] {O...    48   3e-05
NDAI0D02360 Chr4 (545485..546897) [1413 bp, 470 aa] {ON} Anc_5.1...    45   2e-04
KLTH0C02178g Chr3 complement(196605..197999) [1395 bp, 464 aa] {...    45   4e-04
YGR212W Chr7 (917040..918446) [1407 bp, 468 aa] {ON}  SLI1N-acet...    44   9e-04
NCAS0A07390 Chr1 (1463090..1464526) [1437 bp, 478 aa] {ON} Anc_5...    40   0.009
TDEL0E05110 Chr5 (941876..943285) [1410 bp, 469 aa] {ON} Anc_5.1...    38   0.060
Smik_16.94 Chr16 complement(178129..179529) [1401 bp, 466 aa] {O...    38   0.064
Skud_7.548 Chr7 (891732..893159) [1428 bp, 475 aa] {ON} YGR212W ...    37   0.16 
AGR066W Chr7 (837181..841914) [4734 bp, 1577 aa] {ON} Syntenic h...    33   1.8  
SAKL0E06710g Chr5 (548443..550347) [1905 bp, 634 aa] {ON} simila...    33   1.8  
SAKL0G01254g Chr7 complement(106478..108256) [1779 bp, 592 aa] {...    33   2.3  
ADL293W Chr4 (187231..188964) [1734 bp, 577 aa] {ON} Syntenic ho...    32   3.3  
SAKL0G15004g Chr7 (1288241..1289611) [1371 bp, 456 aa] {ON} simi...    31   7.2  

>Kwal_56.22367 s56 (67552..69105) [1554 bp, 517 aa] {ON} YOR377W
           (ATF1) - Alcohol acetyltransferase [contig 186] FULL
          Length = 517

 Score = 1084 bits (2804), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 517/517 (100%), Positives = 517/517 (100%)

Query: 1   MRSIEKADVLEKMEELGHVRRLGHLENYFALCQRQNLYSNFSMFCALSNSCTPSQFAAAL 60
           MRSIEKADVLEKMEELGHVRRLGHLENYFALCQRQNLYSNFSMFCALSNSCTPSQFAAAL
Sbjct: 1   MRSIEKADVLEKMEELGHVRRLGHLENYFALCQRQNLYSNFSMFCALSNSCTPSQFAAAL 60

Query: 61  RAICVEHPILVHTVTPKNWPNHMEYYASEEFVNNPVLEHEKMRLLERVDLSDIVMNEQDE 120
           RAICVEHPILVHTVTPKNWPNHMEYYASEEFVNNPVLEHEKMRLLERVDLSDIVMNEQDE
Sbjct: 61  RAICVEHPILVHTVTPKNWPNHMEYYASEEFVNNPVLEHEKMRLLERVDLSDIVMNEQDE 120

Query: 121 YSETVSKILAEFAQNGGIYTREIFDIIATVRIPYGDPTKPNWRFLCIPEKSGPNWNKFIF 180
           YSETVSKILAEFAQNGGIYTREIFDIIATVRIPYGDPTKPNWRFLCIPEKSGPNWNKFIF
Sbjct: 121 YSETVSKILAEFAQNGGIYTREIFDIIATVRIPYGDPTKPNWRFLCIPEKSGPNWNKFIF 180

Query: 181 ISNHCSMDGTSASNLFRDICTQLNDLSMKEDKSNLVFDYALDCDSLKKLPSPIDERIEYR 240
           ISNHCSMDGTSASNLFRDICTQLNDLSMKEDKSNLVFDYALDCDSLKKLPSPIDERIEYR
Sbjct: 181 ISNHCSMDGTSASNLFRDICTQLNDLSMKEDKSNLVFDYALDCDSLKKLPSPIDERIEYR 240

Query: 241 PPLSYFPQFLGSNFVRKHIGYHSNGPLVSRVDALDEGTACYTEFLNLTSQQMKEVKKKLK 300
           PPLSYFPQFLGSNFVRKHIGYHSNGPLVSRVDALDEGTACYTEFLNLTSQQMKEVKKKLK
Sbjct: 241 PPLSYFPQFLGSNFVRKHIGYHSNGPLVSRVDALDEGTACYTEFLNLTSQQMKEVKKKLK 300

Query: 301 SKAPQCTMTPFLQACLLVSMYDSGKVFTGSMREWFFDVVIPMNTVQLLPDDGEVQSMYKY 360
           SKAPQCTMTPFLQACLLVSMYDSGKVFTGSMREWFFDVVIPMNTVQLLPDDGEVQSMYKY
Sbjct: 301 SKAPQCTMTPFLQACLLVSMYDSGKVFTGSMREWFFDVVIPMNTVQLLPDDGEVQSMYKY 360

Query: 361 GSNIGGSRYNYLISSFNVGHEEEAFWNLVDYYRIVFESAREKNHYLYPLGALMMDAVCQK 420
           GSNIGGSRYNYLISSFNVGHEEEAFWNLVDYYRIVFESAREKNHYLYPLGALMMDAVCQK
Sbjct: 361 GSNIGGSRYNYLISSFNVGHEEEAFWNLVDYYRIVFESAREKNHYLYPLGALMMDAVCQK 420

Query: 421 SNVDKLVVDDLIGKPREGAVFSNLGFISQEIDNKIYYMNDLVFSQTLGSLRHGFTLSSCT 480
           SNVDKLVVDDLIGKPREGAVFSNLGFISQEIDNKIYYMNDLVFSQTLGSLRHGFTLSSCT
Sbjct: 421 SNVDKLVVDDLIGKPREGAVFSNLGFISQEIDNKIYYMNDLVFSQTLGSLRHGFTLSSCT 480

Query: 481 IEKAGMNIVACAALGTVENRSDWAEVCELFKKRILSI 517
           IEKAGMNIVACAALGTVENRSDWAEVCELFKKRILSI
Sbjct: 481 IEKAGMNIVACAALGTVENRSDWAEVCELFKKRILSI 517

>KLTH0C11440g Chr3 complement(940466..941992) [1527 bp, 508 aa] {ON}
           similar to uniprot|P53296 Saccharomyces cerevisiae
           YGR177C ATF2 Alcohol acetyltransferase may play a role
           in steroid detoxification forms volatile esters during
           fermentation which is important in brewing
          Length = 508

 Score =  677 bits (1747), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/508 (60%), Positives = 405/508 (79%)

Query: 10  LEKMEELGHVRRLGHLENYFALCQRQNLYSNFSMFCALSNSCTPSQFAAALRAICVEHPI 69
           ++ ++E GH R LGHLENYF++ QRQ LY+NFSM+C LS  C+P Q A ALR+IC+++PI
Sbjct: 1   MDSLKERGHARPLGHLENYFSITQRQKLYANFSMYCELSKPCSPKQLAYALRSICLQNPI 60

Query: 70  LVHTVTPKNWPNHMEYYASEEFVNNPVLEHEKMRLLERVDLSDIVMNEQDEYSETVSKIL 129
           LVH V PK+WPNH+EYYAS+EF+  P L+HE MRLL+ V LSDIVMNEQ+EY   VS+ +
Sbjct: 61  LVHQVLPKHWPNHLEYYASDEFLAQPTLQHEDMRLLDNVLLSDIVMNEQEEYGTVVSEAI 120

Query: 130 AEFAQNGGIYTREIFDIIATVRIPYGDPTKPNWRFLCIPEKSGPNWNKFIFISNHCSMDG 189
            EF+QNGG Y+++IFDIIA +RIPYGDP KPNWR LC PE     W KFI+I+NHCS DG
Sbjct: 121 EEFSQNGGQYSKKIFDIIADIRIPYGDPLKPNWRLLCFPEGESNLWRKFIYITNHCSSDG 180

Query: 190 TSASNLFRDICTQLNDLSMKEDKSNLVFDYALDCDSLKKLPSPIDERIEYRPPLSYFPQF 249
            SA+NL RD+  QLN +      S+++F+Y+ D + L+KLP PI+ RI+Y+PP+SY  Q 
Sbjct: 181 RSAANLMRDLSEQLNHVPETLPDSDIIFNYSSDYEGLRKLPDPIENRIDYKPPISYLLQL 240

Query: 250 LGSNFVRKHIGYHSNGPLVSRVDALDEGTACYTEFLNLTSQQMKEVKKKLKSKAPQCTMT 309
           L S++VR ++GY+S GPLV+R+D + E    Y+ FLN +++QMK +K+KLKS+ P CTMT
Sbjct: 241 LSSSYVRDYLGYYSKGPLVTRIDEVGENKTYYSYFLNFSAEQMKTIKQKLKSRLPGCTMT 300

Query: 310 PFLQACLLVSMYDSGKVFTGSMREWFFDVVIPMNTVQLLPDDGEVQSMYKYGSNIGGSRY 369
           PFLQAC L SMY SG+VF+ SMREWFFDVVI MNT Q+LPDD E++SMYKYGSN+GG+RY
Sbjct: 301 PFLQACWLTSMYKSGRVFSKSMREWFFDVVITMNTAQMLPDDPELRSMYKYGSNVGGTRY 360

Query: 370 NYLISSFNVGHEEEAFWNLVDYYRIVFESAREKNHYLYPLGALMMDAVCQKSNVDKLVVD 429
           NYLISSFNVG +++AFW+LVDYY+ VF SA EK HYL+PLGALM+D++ +KSN+DK+++D
Sbjct: 361 NYLISSFNVGEDKDAFWSLVDYYQGVFNSAMEKKHYLFPLGALMLDSLREKSNMDKVIMD 420

Query: 430 DLIGKPREGAVFSNLGFISQEIDNKIYYMNDLVFSQTLGSLRHGFTLSSCTIEKAGMNIV 489
           DL+GKPR+G + SN+G+  Q+ +   YY+ DLVF+Q+LGSLRH F  +SCT +  GMNIV
Sbjct: 421 DLLGKPRQGVILSNVGYFQQKKETDGYYVRDLVFAQSLGSLRHTFVCNSCTTDVGGMNIV 480

Query: 490 ACAALGTVENRSDWAEVCELFKKRILSI 517
           ACAA G+V +  DWA+VCELFK++ L++
Sbjct: 481 ACAAQGSVASEHDWADVCELFKEQTLAL 508

>KLTH0B03806g Chr2 complement(309522..311090) [1569 bp, 522 aa] {ON}
           similar to uniprot|P40353 Saccharomyces cerevisiae
           YOR377W ATF1 Alcohol acetyltransferase with potential
           roles in lipid and sterol metabolism responsible for the
           major part of volatile acetate ester production during
           fermentation
          Length = 522

 Score =  504 bits (1298), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 233/520 (44%), Positives = 350/520 (67%), Gaps = 8/520 (1%)

Query: 3   SIEKADV-LEKMEELGHVRRLGHLENYFALCQRQNLYSNFSMFCALSNSCTPSQFAAALR 61
           +  +AD  LE++E+ GH RRLG+LENYFAL QRQ+LYSNF MFC L  +C+ ++ A ALR
Sbjct: 2   TTSQADTKLEELEKRGHARRLGNLENYFALGQRQDLYSNFGMFCELDRACSENELAEALR 61

Query: 62  AICVEHPILVHTVTPKNWPNHMEYYASEEFVNNPVLEHEKMRLLERVDLSDIVMNEQDEY 121
            +C+E+P+L+HTV  K     + +Y + E+++ P  +H+ +R+L+RV  +D+++N+Q+EY
Sbjct: 62  GMCLEYPLLLHTVLEKKEAQDVNFYQTSEYLSKPWPQHDYIRVLQRVRFADVLLNDQEEY 121

Query: 122 SETVSKILAEFAQNGGIYTREIFDIIATVRIPYGDPTKPNWRFLCIPEKSGPN---WNKF 178
           +E V+  L EFA NGG Y+ E+F++I  VRIPY   ++PNWR +C PE+       W K 
Sbjct: 122 AEIVNAALKEFASNGGQYSSEVFELINKVRIPYCHNSRPNWRIMCFPEEGNAQSREWRKI 181

Query: 179 IFISNHCSMDGTSASNLFRDICTQLNDLSMKEDKSNLVFDYALDCDSLKKLPSPIDERIE 238
           + +SNHCS DG S++N F D+   LN+L     +++++FDY+ D ++L KLP+PI+ +I 
Sbjct: 182 LLLSNHCSSDGMSSANFFHDLQDHLNNLPPSLPQADVIFDYSQDHETLGKLPAPIETQIS 241

Query: 239 YRPPLSYFPQFLGSNFVRKHIGYHSNGPLVSRVDALDEGTACYTEFLNLTSQQMKEVKKK 298
           Y  P SYF Q +G+  +R++ GY S  P + RV+    G   Y+ FL +T  ++  VKKK
Sbjct: 242 YVGPKSYFAQLVGNQVLREYFGYKSPTPPIPRVNE-PGGNDFYSYFLKITPSEVAAVKKK 300

Query: 299 LKSKA-PQCTMTPFLQACLLVSMYDSGKVFTGSMREWFFDVVIPMNTVQLLPDDGEVQSM 357
           LK+K  P CT+TPF QAC   ++Y SG VF+ S  +   ++++ MNT QLLP+D +++  
Sbjct: 301 LKNKLDPSCTLTPFFQACWFAALYKSGIVFSKSFSQQLSNIMVAMNTAQLLPEDKQLKKQ 360

Query: 358 YKYGSNIGGSRYNYLISSFNVGHEEEAFWNLVDYYRIVFESAREKNHYLYPLGALMMDAV 417
           Y+YG+N+GGS YNY ISSFNV  + EAFW LV YY+ VF  A+ K H+LYPLGALM+D++
Sbjct: 361 YRYGANVGGSHYNYQISSFNVADKPEAFWKLVRYYQDVFVDAKRKKHFLYPLGALMIDSI 420

Query: 418 CQKSNVDKLVVDDLIGKPREGAVFSNLGFISQEIDNKI--YYMNDLVFSQTLGSLRHGFT 475
            +  N+D  V + ++GK R G + SN+G+  Q+    +  +++ DL+F+QT GS R  F 
Sbjct: 421 YKTKNIDLAVTNSILGKSRLGTMLSNVGYFPQKARATVGGFHIQDLIFAQTTGSFRFTFD 480

Query: 476 LSSCTIEKAGMNIVACAALGTVENRSDWAEVCELFKKRIL 515
           ++ C  +  G+NI AC A G +  R DW ++CELFK  IL
Sbjct: 481 INLCATDIGGLNITACVAEGALPTREDWKKLCELFKTIIL 520

>Kwal_33.15041 s33 (927424..928992) [1569 bp, 522 aa] {ON} YGR177C
           (ATF2) - 1:1 [contig 96] FULL
          Length = 522

 Score =  500 bits (1287), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 232/512 (45%), Positives = 343/512 (66%), Gaps = 7/512 (1%)

Query: 10  LEKMEELGHVRRLGHLENYFALCQRQNLYSNFSMFCALSNSCTPSQFAAALRAICVEHPI 69
           ++ +E  GH RRLG+LENYFA+ QRQ+LYSNF MFC     C+ S+ AAA+R +C+E P+
Sbjct: 10  MDDLERRGHARRLGNLENYFAIAQRQDLYSNFGMFCEFERGCSQSELAAAIRGVCLEFPL 69

Query: 70  LVHTVTPKNWPNHMEYYASEEFVNNPVLEHEKMRLLERVDLSDIVMNEQDEYSETVSKIL 129
           L+HTV  K       +Y  EE+++ P  +H+ +R+LE+V ++D+V+NEQ EY+E V + L
Sbjct: 70  LLHTVVAKKRDEDAGFYQREEYLSKPWPDHDYIRVLEKVQMADVVLNEQPEYAELVEEAL 129

Query: 130 AEFAQNGGIYTREIFDIIATVRIPYGDPTKPNWRFLCIPEKSGPN--WNKFIFISNHCSM 187
             FA+ GG YT E+F++I  +RIPY   ++PNWR +C PE+      W KF+F+SNHCS 
Sbjct: 130 ERFAECGGRYTSEVFEVINEIRIPYSHQSRPNWRLVCFPEEGEEKAIWRKFLFLSNHCSS 189

Query: 188 DGTSASNLFRDICTQLNDLSMKEDKSNLVFDYALDCDSLKKLPSPIDERIEYRPPLSYFP 247
           DG SA+N F D+   LN L     +++++FDY  D + L +LPSPI+++I Y  P S+F 
Sbjct: 190 DGISAANFFHDLQRHLNQLPSDAAENDVIFDYDRDHEKLAELPSPIEKQISYVSPKSFFA 249

Query: 248 QFLGSNFVRKHIGYHSNGPLVSRVDALDEGTACYTEFLNLTSQQMKEVKKKLKSK-APQC 306
           + +G+  +R+++GY S  P +SRV     G   ++ F N+T  Q+  VK++LKSK +   
Sbjct: 250 RLVGAQVIREYVGYKSPCPTISRV-CEPNGNRFHSYFFNITPDQVNSVKQRLKSKLSVAG 308

Query: 307 TMTPFLQACLLVSMYDSGKVFTGSMREWFFDVVIPMNTVQLLPDDGEVQSMYKYGSNIGG 366
           T+TP+ QAC   ++  S K+FT S +E   ++++ MNT QLLP+D  ++  Y+YG+N+GG
Sbjct: 309 TLTPYFQACWFAALAKSNKIFTNSFKEQLTNIMVAMNTAQLLPEDESIRKQYRYGANVGG 368

Query: 367 SRYNYLISSFNVGHEEEAFWNLVDYYRIVFESAREKNHYLYPLGALMMDAVCQKSNVDKL 426
           S YNY ISSFNV  +  AFW LV+YY+ VF +A++KNH LY LGALM+D++ +K N+D  
Sbjct: 369 SHYNYQISSFNVADDPVAFWKLVEYYQTVFINAKQKNHSLYSLGALMVDSIYEKKNIDLA 428

Query: 427 VVDDLIGKPREGAVFSNLGFISQEI---DNKIYYMNDLVFSQTLGSLRHGFTLSSCTIEK 483
           V + L+GK R G + SNLG+  Q+     +  +++ DLVF+QT GS R+ F L+ C  + 
Sbjct: 429 VTNALLGKQRLGTMMSNLGYFPQKSRVPSHHKFHILDLVFAQTTGSFRYSFDLNMCATDV 488

Query: 484 AGMNIVACAALGTVENRSDWAEVCELFKKRIL 515
            G+NI AC A GT+ +R DW  +CELFK  IL
Sbjct: 489 GGLNIAACVAEGTLSSRQDWHALCELFKNIIL 520

>SAKL0G13288g Chr7 complement(1139419..1141041) [1623 bp, 540 aa]
           {ON} similar to uniprot|P53296 Saccharomyces cerevisiae
           YGR177C ATF2 Alcohol acetyltransferase may play a role
           in steroid detoxification forms volatile esters during
           fermentation which is important in brewing
          Length = 540

 Score =  460 bits (1184), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 216/509 (42%), Positives = 331/509 (65%), Gaps = 3/509 (0%)

Query: 9   VLEKMEELGHVRRLGHLENYFALCQRQNLYSNFSMFCALSNSCTPSQFAAALRAICVEHP 68
           +  ++ + GH RR+GHLENYFAL  RQ LY+NFSM+C L+ +C+  Q   A+R+IC+++P
Sbjct: 13  ITPELIDRGHARRMGHLENYFALTNRQKLYTNFSMYCELNEACSKDQLVYAIRSICLKYP 72

Query: 69  ILVHTVTPKNWPNHMEYYASEEFVNNPVLEHEKMRLLERVDLSDIVMNEQDEYSETVSKI 128
            L+HTV PKN PN  E+Y+S+E+++ P   H+ +++++ +++ DI+MN Q EY+  VS++
Sbjct: 73  TLIHTVVPKNLPNSEEFYSSQEYLSKPWPVHDFIKVIDHLEIDDILMNNQPEYASLVSQL 132

Query: 129 LAEFAQNGGIYTREIFDIIATVRIPYGDPTKPNWRFLCIPE--KSGPNWNKFIFISNHCS 186
              F  NG  Y++E+ +I++ V IPY    +PNWR +C+PE  +S   W +FIF+SNHCS
Sbjct: 133 EDLFVHNGFKYSKEVAEILSPVAIPYCHQGRPNWRLICLPEEDRSTEKWRRFIFVSNHCS 192

Query: 187 MDGTSASNLFRDICTQLNDLSMKEDKSNLVFDYALDCDSLKKLPSPIDERIEYRPPLSYF 246
            DG+SA N F+++  +L+D   K   S  VFDY  D   L KLP PI+ERI+++PPLS+ 
Sbjct: 193 SDGSSAINFFKELVNELDDEPEKISNSTTVFDYTADHLQLNKLPKPIEERIDFKPPLSHI 252

Query: 247 PQFLGSNFVRKHIGYHSNGPLVSRVDALDEGTACYTEFLNLTSQQMKEVKKKLKSKA-PQ 305
           P++L ++F+    GY S G   + VD + +    Y+   N ++ +M +++  +K     +
Sbjct: 253 PRYLTNSFISSSFGYRSPGGHTTPVDEIRDSNTHYSYMFNFSTAEMNQIRNTIKKHVHDR 312

Query: 306 CTMTPFLQACLLVSMYDSGKVFTGSMREWFFDVVIPMNTVQLLPDDGEVQSMYKYGSNIG 365
           CTMTPFLQA   V++Y SGKVFT S+ EW  D+V+ MN+ QLLPDD ++   YK+GSNI 
Sbjct: 313 CTMTPFLQAAWFVALYRSGKVFTRSIMEWTTDIVVAMNSRQLLPDDEDLLDSYKFGSNIA 372

Query: 366 GSRYNYLISSFNVGHEEEAFWNLVDYYRIVFESAREKNHYLYPLGALMMDAVCQKSNVDK 425
           G+ YNYLISSFNVG ++  FW LV YY  VF  AR  N +LY +G +M+D      N+D 
Sbjct: 373 GTHYNYLISSFNVGEDKAKFWKLVGYYHDVFIKARGNNDFLYTMGMMMLDGFVNNKNIDL 432

Query: 426 LVVDDLIGKPREGAVFSNLGFISQEIDNKIYYMNDLVFSQTLGSLRHGFTLSSCTIEKAG 485
            V  + +   R G++ SN+G+      +  Y + DL+F+Q+ G+L   + ++ C+ + +G
Sbjct: 433 TVRTNTLSSDRGGSILSNVGYFPLRNHSTDYKIQDLIFAQSPGALAFTYGINVCSTDVSG 492

Query: 486 MNIVACAALGTVENRSDWAEVCELFKKRI 514
           MN V   A   + +R DW ++CELFK+ I
Sbjct: 493 MNFVMSMAKNALNDRKDWEDLCELFKETI 521

>Kpol_2002.89 s2002 (209104..210675) [1572 bp, 523 aa] {ON}
           (209104..210675) [1572 nt, 524 aa]
          Length = 523

 Score =  431 bits (1107), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 209/516 (40%), Positives = 318/516 (61%), Gaps = 12/516 (2%)

Query: 9   VLEKMEELGHVRRLGHLENYFALCQRQNLYSNFSMFCALSNSCTPSQFAAALRAICVEHP 68
           + +++ + GH RR+G LENYFAL QRQNLY NF+++  ++      Q   A R + +++P
Sbjct: 8   ITQELVDRGHARRMGQLENYFALLQRQNLYKNFNVYGEINEPIDKFQLGTAFRQMLLKYP 67

Query: 69  ILVHTVTPKNWPNHMEYYASEEFVNNPVLEHEKMRLLERVDLSDIVMNEQDEYSETVSKI 128
           IL+H + P+ +P+H EYYAS+E++NNP   ++ ++++E +DL DI++N Q EY   V K+
Sbjct: 68  ILMHVIVPRKYPHHEEYYASDEYLNNPQPINDYIKVMENIDLEDILLNSQPEYEAIVGKL 127

Query: 129 LAEFAQNGGIYTREIFDIIATVRIPYGDPTKPNWRFLCIPEK-SGPNWNKFIFISNHCSM 187
           L ++  +G  YT  + +II  + IP  D TKPNWR LC+P K S   W+ F++ISNHC+ 
Sbjct: 128 LDQYKSDGYKYTNRMIEIIGDISIPICDQTKPNWRLLCLPTKESDKKWHAFVYISNHCAA 187

Query: 188 DGTSASNLFRDICTQLNDLSMK-----EDKSNLVFDYALDCDSLKKLPSPIDERIEYRPP 242
           DG ++ N F DI   LND S +       + NLV +YA D  ++ K P PI ER+EYRP 
Sbjct: 188 DGMTSMNFFHDIVNGLNDKSSETVTEVNGRMNLV-NYAKDHKNISKFPKPITERVEYRPS 246

Query: 243 LSYFPQFLGSNFVRKHIGYHSNGPLVSRVDALDEGTACYTEFLNLTSQQMKEVKKKLKSK 302
           LS  P+F+  N  R  + Y S   L + VD +D  T  Y   LN T++++ +++K +K+ 
Sbjct: 247 LSQLPKFMIGNIARTKLNYKSPCALTTTVDKVDMQTFDY--ILNFTNEEVGKIRKHIKAN 304

Query: 303 APQ-CTMTPFLQACLLVSMYDSGKVFTGSMREWFFDVVIPMNTVQLLPDDGEVQSMYKYG 361
                T+TPFLQ CL V++Y  G +F  ++ EW  D V+P+N  + LP+D E++  YKYG
Sbjct: 305 THNGVTLTPFLQTCLFVTLYQFGTIFQKTLLEWGLDSVLPVNARKYLPEDAELRDSYKYG 364

Query: 362 SNIGGSRYNYLISSFNVGHEE-EAFWNLVDYYRIVFESAREKNHYLYPLGALMMDAVCQK 420
           SN+GG  Y  LISSFN+ ++E E FW+LVDYY   ++ A          G LM D + + 
Sbjct: 365 SNVGGIHYFNLISSFNIKNDEAETFWSLVDYYHANYQKAYHNGDTFVGFGLLMSDFIVKN 424

Query: 421 SNVDKLVVDDLIGKPREGAVFSNLGFISQEIDNKIYYMNDLVFSQTLGSLRHGFTLSSCT 480
            NVDKL+ +D + + R G + SNLGF  Q+  N+ YY+NDL+F+QT GS++  F LS C+
Sbjct: 425 KNVDKLIKEDYVNQKRGGVILSNLGFFPQDTRNE-YYLNDLIFAQTFGSMKFTFGLSLCS 483

Query: 481 IEKAGMNIVACAALGTVENRSDWAEVCELFKKRILS 516
               G+NI          +R  + + C+ +K+ I++
Sbjct: 484 TNVNGLNIGISVVRDAFNDRETFEKFCKHYKETIIN 519

>Smik_6.291 Chr6 complement(456731..458338) [1608 bp, 535 aa] {ON}
           YGR177C (REAL)
          Length = 535

 Score =  412 bits (1060), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 194/514 (37%), Positives = 309/514 (60%), Gaps = 19/514 (3%)

Query: 17  GHVRRLGHLENYFALCQRQNLYSNFSMFCALSNSCTPSQFAAALRAICVEHPILVHTVTP 76
           GH RR+GHLENYFA+  RQN+YSNF+++  L+ S +  Q   ALR +  ++PIL HTV P
Sbjct: 19  GHARRMGHLENYFAILSRQNMYSNFTVYAELNKSVSRRQLKLALRILLHKYPILAHTVIP 78

Query: 77  KNWPNHMEYYASEEFVNNPVLEHEKMRLLERVDLSDIVMNEQDEYSETVSKILAEFAQNG 136
           K +P+H  YY SEE++N P  +H+ ++++  ++L+D++MN Q  Y E + K+  +F ++ 
Sbjct: 79  KKYPDHEAYYCSEEYLNTPFPQHDFIKVIPHLELNDLIMNNQPAYREVIEKVSEQFRRDD 138

Query: 137 GIYTREIFDIIATVRIPYGDPTKPNWRFLCIPEKS---GPNWNKFIFISNHCSMDGTSAS 193
              T  + ++I  V +P GD  +PNWR +C+P K+      W  F+++SNHC  DG S +
Sbjct: 139 FKVTNSLIELITPVIVPLGDLKRPNWRLICLPGKNTSQADTWTNFVYVSNHCGSDGVSGT 198

Query: 194 NLFRDICTQLNDL---------SMKEDKSNLVFDYALDCDSLKKLPSPIDERIEYRPPLS 244
           N F+D+   L ++          + ED  +++ DY  D   + K P PI +RI+Y+P ++
Sbjct: 199 NFFQDLAVLLAEIEEHGFDYDEQLIED--DVIIDYNEDYGEISKFPIPITDRIDYKPKVT 256

Query: 245 YFPQFLGSNFVRKHIGYH--SNGPLVSRVDALDEGTACYTEFLNLTSQQMKEVKKKLKSK 302
             P F    F+ +H  Y   S   + +R +   +  A Y   L+ ++++  +++ ++K  
Sbjct: 257 SLPSFFLKAFIYEHCNYKTSSESTVTARYNPSTKANASYNHLLHFSTKETDQIRAEIKKN 316

Query: 303 APQ-CTMTPFLQACLLVSMYDSGKVFTGSMREWFFDVVIPMNTVQLLPDDGEVQSMYKYG 361
               CT+TPF+QAC  V++Y   K+FT S  E+ FDV +P NT + LP D E++  YKYG
Sbjct: 317 VHDGCTITPFIQACFFVALYRYDKLFTKSFLEYGFDVALPSNTRRFLPKDKELRDAYKYG 376

Query: 362 SNIGGSRYNYLISSFNVGH-EEEAFWNLVDYYRIVFESAREKNHYLYPLGALMMDAVCQK 420
           +N+GGS Y YLISSFN+   + + FW+LV+YY   F  + E   +L  LGAL +D + Q 
Sbjct: 377 ANVGGSHYAYLISSFNISEGDNDKFWSLVEYYHDCFLRSYENGDHLIGLGALQLDFIVQN 436

Query: 421 SNVDKLVVDDLIGKPREGAVFSNLGFISQEIDNKIYYMNDLVFSQTLGSLRHGFTLSSCT 480
            N+D+L+V   + + R GA+ SN+G + Q+   K YY+ DL+FSQ+ G+LR  F L+ C+
Sbjct: 437 KNIDELIVKSYLDQQRGGAIISNVGLVRQDT-TKPYYIRDLIFSQSAGALRFAFGLNICS 495

Query: 481 IEKAGMNIVACAALGTVENRSDWAEVCELFKKRI 514
               GMN+      GT+ +R +W   CE+F + I
Sbjct: 496 TNVNGMNMDMSVVQGTLRDRGEWESFCEIFYQAI 529

>YGR177C Chr7 complement(848829..850436) [1608 bp, 535 aa] {ON}
           ATF2Alcohol acetyltransferase, may play a role in
           steroid detoxification; forms volatile esters during
           fermentation, which is important for brewing and
           winemaking
          Length = 535

 Score =  402 bits (1032), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 192/532 (36%), Positives = 315/532 (59%), Gaps = 21/532 (3%)

Query: 1   MRSIE--KADVLEKMEELGHVRRLGHLENYFALCQRQNLYSNFSMFCALSNSCTPSQFAA 58
           M  IE  +  + +++ + GH RR+GHLENYFA+  RQ +YSNF+++  L+      Q   
Sbjct: 1   MEDIEGYEPHITQELIDRGHARRMGHLENYFAVLSRQKMYSNFTVYAELNKGVNKRQLML 60

Query: 59  ALRAICVEHPILVHTVTPKNWPNHMEYYASEEFVNNPVLEHEKMRLLERVDLSDIVMNEQ 118
            L+ +  ++  L HT+ PK++P+H  YY+SEE+++ P  +H+ ++++  ++  D++MN Q
Sbjct: 61  VLKVLLQKYSTLAHTIIPKHYPHHEAYYSSEEYLSKPFPQHDFIKVISHLEFDDLIMNNQ 120

Query: 119 DEYSETVSKILAEFAQNGGIYTREIFDIIATVRIPYGDPTKPNWRFLCIPEKSG---PNW 175
            EY E + KI  +F ++    T  + ++I+ V IP G+P +PNWR +C+P K       W
Sbjct: 121 PEYREVMEKISEQFKKDDFKVTNRLIELISPVIIPLGNPKRPNWRLICLPGKDTDGFETW 180

Query: 176 NKFIFISNHCSMDGTSASNLFRDICTQLNDLSMK---------EDKSNLVFDYALDCDSL 226
             F++++NHC  DG S SN F+D+      +  K         ED+  ++ DY  D   +
Sbjct: 181 KNFVYVTNHCGSDGVSGSNFFKDLALLFCKIEEKGFDYDEEFIEDQ--VIIDYDRDYTEI 238

Query: 227 KKLPSPIDERIEYRPPLSYFPQFLGSNFVRKHIGYH--SNGPLVSRVDALDEGTACYTEF 284
            KLP PI +RI+Y+P L+  P+F  + F+ +H  +   S   L +R        A Y   
Sbjct: 239 SKLPKPITDRIDYKPALTSLPKFFLTTFIYEHCNFKTSSESTLTARYSPSSNANASYNYL 298

Query: 285 LNLTSQQMKEVKKKLKSKAPQ-CTMTPFLQACLLVSMYDSGKVFTGSMREWFFDVVIPMN 343
           L+ +++Q+++++ ++K      CT+TPF+QAC LV++Y   K+FT S+ E+ FDV IP N
Sbjct: 299 LHFSTKQVEQIRAQIKKNVHDGCTLTPFIQACFLVALYRLDKLFTKSLLEYGFDVAIPSN 358

Query: 344 TVQLLPDDGEVQSMYKYGSNIGGSRYNYLISSFNVGH-EEEAFWNLVDYYRIVFESAREK 402
             + LP+D E++  YKYGSN+GGS Y YLISSF++   + + FW+LV+YY   F  + + 
Sbjct: 359 ARRFLPNDEELRDSYKYGSNVGGSHYAYLISSFDIPEGDNDKFWSLVEYYYDRFLESYDN 418

Query: 403 NHYLYPLGALMMDAVCQKSNVDKLVVDDLIGKPREGAVFSNLGFISQEIDNKIYYMNDLV 462
             +L  LG L +D + +  N+D L+ +  + + R GA+ SN G +SQ+   K YY+ DL+
Sbjct: 419 GDHLIGLGVLQLDFIVENKNIDSLLANSYLHQQRGGAIISNTGLVSQDT-TKPYYVRDLI 477

Query: 463 FSQTLGSLRHGFTLSSCTIEKAGMNIVACAALGTVENRSDWAEVCELFKKRI 514
           FSQ+ G+LR  F L+ C+    GMN+      GT+ +R +W   C+LF + I
Sbjct: 478 FSQSAGALRFAFGLNVCSTNVNGMNMDMSVVQGTLRDRGEWESFCKLFYQTI 529

>Suva_7.470 Chr7 complement(806476..808116) [1641 bp, 546 aa] {ON}
           YGR177C (REAL)
          Length = 546

 Score =  397 bits (1020), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 195/531 (36%), Positives = 318/531 (59%), Gaps = 18/531 (3%)

Query: 1   MRSIEKAD--VLEKMEELGHVRRLGHLENYFALCQRQNLYSNFSMFCALSNSCTPSQFAA 58
           M S+E+ +  V +++ + GH RR+GHLENYFA+ +RQN+YSNF+++  L+ + +  Q   
Sbjct: 1   MDSLEEYEPHVTQELIDRGHARRMGHLENYFAVLRRQNMYSNFTVYGELNKAVSKRQLRL 60

Query: 59  ALRAICVEHPILVHTVTPKNWPNHMEYYASEEFVNNPVLEHEKMRLLERVDLSDIVMNEQ 118
           ALR + +++PIL HT+ PK +P H  YY S+E++N P  +H+ ++++  ++L D++MN Q
Sbjct: 61  ALRLLLLKYPILSHTIVPKKYPEHEAYYLSQEYLNKPFPQHDFIKVISHLELDDVIMNNQ 120

Query: 119 DEYSETVSKILAEFAQNGGIYTREIFDIIATVRIPYGDPTKPNWRFLCIPEKSGPN---- 174
            EY E +SK+  +F ++    T  + ++I  + +P  DP +PNWR +C+P     +    
Sbjct: 121 SEYKEVISKVSEQFKKDNFKVTSSLIELITPIIVPICDPERPNWRLICLPSTDTTSADEA 180

Query: 175 WNKFIFISNHCSMDGTSASNLFRDICTQLNDLSMK----EDK---SNLVFDYALDCDSLK 227
           W  F+++SNHC  DG S +N F+D+   L+ +  K    E++   +N++ DY  D + + 
Sbjct: 181 WTNFVYVSNHCGSDGISGTNFFQDLTALLSTIEEKGFDYEEEIVDNNVIIDYNEDHNEVS 240

Query: 228 KLPSPIDERIEYRPPLSYFPQFLGSNFVRKHIGYHSNGPL--VSRVDALDEGTACYTEFL 285
           K P PI +RI+YRP L+  P+F   N + ++  + ++  L   SR  +     A +   L
Sbjct: 241 KFPIPITDRIDYRPSLTSLPKFFLKNILAEYCEFRTSNELTVTSRYTSSPNANASFNHLL 300

Query: 286 NLTSQQMKEVKKKLKSKA-PQCTMTPFLQACLLVSMYDSGKVFTGSMREWFFDVVIPMNT 344
           + ++   ++++ ++K      CT+TPF+QAC  V++Y   KVFT S+ E+ FDV +P +T
Sbjct: 301 HFSANDTQQIRSEIKKNVHAGCTITPFIQACFFVALYRHDKVFTKSLLEYGFDVALPSST 360

Query: 345 VQLLPDDGEVQSMYKYGSNIGGSRYNYLISSFNVGH-EEEAFWNLVDYYRIVFESAREKN 403
            + LP D E++  YKYGSN+GGS Y YLISSF+V   +   FW LV+YY   F  + +  
Sbjct: 361 RRFLPKDEELRDTYKYGSNVGGSHYTYLISSFDVPEGDTNKFWRLVEYYHDCFLKSYDNG 420

Query: 404 HYLYPLGALMMDAVCQKSNVDKLVVDDLIGKPREGAVFSNLGFISQEIDNKIYYMNDLVF 463
            +L  LG L +D + Q  NVD ++    +   R GA+ SN GF+ Q+   K YY  DL+F
Sbjct: 421 DHLIGLGTLQLDFIVQNKNVDDMISTSYLDHQRGGAIISNTGFVRQDT-TKPYYARDLIF 479

Query: 464 SQTLGSLRHGFTLSSCTIEKAGMNIVACAALGTVENRSDWAEVCELFKKRI 514
           SQ+ G+LR  F L+ C+   AGMN+      GT+ +R +W   C++F   I
Sbjct: 480 SQSAGALRFAFGLNVCSTNVAGMNMDMSVVQGTLRDRGEWESFCDVFYHAI 530

>Skud_7.507 Chr7 complement(822986..824593) [1608 bp, 535 aa] {ON}
           YGR177C (REAL)
          Length = 535

 Score =  392 bits (1008), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 190/530 (35%), Positives = 313/530 (59%), Gaps = 17/530 (3%)

Query: 1   MRSIEKAD--VLEKMEELGHVRRLGHLENYFALCQRQNLYSNFSMFCALSNSCTPSQFAA 58
           M  IE+ +  V +++   GH RR+GHLENYFA+  RQN+YSNF+++  L+          
Sbjct: 1   MDDIEEYEPHVTQELINRGHARRMGHLENYFAILCRQNMYSNFTVYAELNKGVNKRHLQL 60

Query: 59  ALRAICVEHPILVHTVTPKNWPNHMEYYASEEFVNNPVLEHEKMRLLERVDLSDIVMNEQ 118
           ALR +  ++PIL HTV PK +P    YY+SEE++N P  +H+ ++++  +++ D++MN Q
Sbjct: 61  ALRLLLQKYPILAHTVIPKKYPGQEAYYSSEEYLNKPFPQHDFIKVISHLEVDDLIMNNQ 120

Query: 119 DEYSETVSKILAEFAQNGGIYTREIFDIIATVRIPYGDPTKPNWRFLCIPEKSGP---NW 175
            EY + + KI  +F ++    T  + ++IA + IP  DP +PNWR +C+P ++      W
Sbjct: 121 PEYKDAIDKISRQFEKDDYKVTSSLIELIAPIVIPLCDPKRPNWRLICLPSRNTSGVETW 180

Query: 176 NKFIFISNHCSMDGTSASNLFRDICTQLN-------DLSMKEDKSNLVFDYALDCDSLKK 228
             F+++SNHC  DG S +N F+D+            D   +  + N++ +Y  D + + K
Sbjct: 181 TNFVYVSNHCGSDGISGTNFFQDLALLFTAIEEKGFDYEEQITEDNVIINYDEDYNEIAK 240

Query: 229 LPSPIDERIEYRPPLSYFPQFLGSNFVRKHIGYHSN--GPLVSRVDALDEGTACYTEFLN 286
            P PI +RI+YRP L+  P F   NF+ +H  + ++    + +R +      A Y   L+
Sbjct: 241 FPIPITDRIDYRPALTSMPSFFLKNFIYEHCTFKTSNKSTVTARHNLSTRANASYNHLLH 300

Query: 287 LTSQQMKEVKKKLKSKAPQ-CTMTPFLQACLLVSMYDSGKVFTGSMREWFFDVVIPMNTV 345
            ++++ ++++ ++K      CT+TPF+QAC  V++Y   K+FT S  E+ FDV +P ++ 
Sbjct: 301 FSTEETEQIRAEIKKNVHDGCTITPFIQACFFVALYRYDKLFTKSFFEYGFDVALPSSSR 360

Query: 346 QLLPDDGEVQSMYKYGSNIGGSRYNYLISSFNVGH-EEEAFWNLVDYYRIVFESAREKNH 404
           + LP + E++  YKYGSN+GG+ Y YLISSFN+   + + FW+LV YY   F  + +   
Sbjct: 361 RFLPKEEELRDTYKYGSNVGGTHYAYLISSFNIPEGDTDKFWSLVGYYHDCFLKSYDNGD 420

Query: 405 YLYPLGALMMDAVCQKSNVDKLVVDDLIGKPREGAVFSNLGFISQEIDNKIYYMNDLVFS 464
           +L  LG L +D + Q  N+D+L+V   + K R GA+ SN G + Q+   K YY+ DL+FS
Sbjct: 421 HLIGLGTLQLDFIVQNKNLDELIVSSYLNKQRGGAIISNTGLVRQDT-TKPYYVQDLIFS 479

Query: 465 QTLGSLRHGFTLSSCTIEKAGMNIVACAALGTVENRSDWAEVCELFKKRI 514
           Q+ G+LR  F L+ C+    GMN+   A  GT+ +R +W   C++F + I
Sbjct: 480 QSAGALRFAFGLNVCSTNVNGMNMDVSAVQGTLRDRGEWESFCKVFYQAI 529

>CAGL0D05918g Chr4 (563388..565082) [1695 bp, 564 aa] {ON} similar
           to uniprot|P53296 Saccharomyces cerevisiae YGR177c ATF2
           alcohol O-acetyltransferase or uniprot|P40353
           Saccharomyces cerevisiae YOR377w ATF1
          Length = 564

 Score =  391 bits (1005), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 203/533 (38%), Positives = 311/533 (58%), Gaps = 34/533 (6%)

Query: 11  EKMEELGHVRRLGHLENYFALCQRQNLYSNFSMFCALSNSCTPSQFAAALRAICVEHPIL 70
           E + E GH RR+GHLENYFA+ QRQ LY+NF+M+  L+   T  Q A A+R I + HPI+
Sbjct: 30  ESLLERGHSRRMGHLENYFAIMQRQKLYTNFNMYGELNKEVTREQLAVAIRQILLRHPIM 89

Query: 71  VHTVTPKNWPNHMEYYASEEFVNNPVLEHEKMRLL-ERVDLSDIVMNEQDE-YSETVSKI 128
           +  + PK +P H EYY S+++ N P  E++ +R++  ++ LSDI++NEQ E Y E +  I
Sbjct: 90  MQAIIPKKFPEHEEYYTSDDYYNTPFPENDFLRVITSKIKLSDIIINEQSEDYGEIIDMI 149

Query: 129 LAEFAQNGGIYTREIFDIIATVRIPYGDPTKPNWRFLCIP--EKSGPNWNKFIFISNHCS 186
           L+E+ +NG  +   + ++I  + IP G+P KPNWR LC+P  E  G  W KF++ISNHC 
Sbjct: 150 LSEYKKNGYKFDAYMQELIGNIVIPIGNPNKPNWRLLCLPSAEGGGAQWKKFVYISNHCC 209

Query: 187 MDGTSASNLFRDICTQLNDLSMKEDKS-------NLVFDYALDCDSLKKLPSPIDERIEY 239
            D  SA NLF+DI     ++S+ E  S       +++ DY  D   + KLP+PI ER+EY
Sbjct: 210 SDAISAVNLFQDIA---ENVSLIEQNSWAVPYADDVIVDYEQDVADIAKLPAPITERVEY 266

Query: 240 RPPLSYFPQFLGSNFVRKHIGYHSNGPLVSR----------VDALDEGTACYTEFLNLTS 289
           RPPLS  P+ +  +F++  + + S+  L +R            A+  G  CY   LN T 
Sbjct: 267 RPPLSKLPKIMLVSFLKTALNFKSDA-LETRCNDEYSGEPETSAVQMGDVCYDSILNYTC 325

Query: 290 QQMKEVKKKLKSKA-PQCTMTPFLQACLLVSMYDSGKV------FTGSMREWFFDVVIPM 342
           +++  ++ ++K     +CT+TPF+QA   V+M+ S K+      F   M EW  D+  P 
Sbjct: 326 EEVAVIRDRIKHNVHGKCTVTPFIQAAFFVAMHQSRKLLGQKQGFKEWMSEWGVDMATPS 385

Query: 343 NTVQLLPDDGEVQSMYKYGSNIGGSRYNYLISSFNVGHEE-EAFWNLVDYYRIVFESARE 401
           +T + LP+D EV+ MYKYGSN+GG  Y Y+IS   V  EE E FW+LV+YY  +  ++  
Sbjct: 386 STRRYLPEDPEVRDMYKYGSNVGGIHYLYMISGMKVEREETEKFWSLVEYYHDILLASHS 445

Query: 402 KNHYLYPLGALMMDAVCQKSNVDKLVVDDLIGKPREGAVFSNLGFISQEIDNKIYYMNDL 461
                  LG LM+D +  K NVDKL+ D+ + + R G + SN G+  Q+   + Y++ DL
Sbjct: 446 NGDQTVGLGTLMLDVIVDKKNVDKLIRDEYLYQKRGGVIMSNAGYFHQD-PAQAYHVTDL 504

Query: 462 VFSQTLGSLRHGFTLSSCTIEKAGMNIVACAALGTVENRSDWAEVCELFKKRI 514
           VF Q  G+L+  F ++  +    GMN+       T+ +R+++ E   +  + I
Sbjct: 505 VFGQRPGALKFSFGVNVVSTNIGGMNLNVGMVRRTLRDRAEFREFIGILDRVI 557

>Smik_15.559 Chr15 (992130..993704) [1575 bp, 524 aa] {ON} YOR377W
           (REAL)
          Length = 524

 Score =  389 bits (1000), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 192/514 (37%), Positives = 297/514 (57%), Gaps = 5/514 (0%)

Query: 6   KADVLEKMEELGHVRRLGHLENYFALCQRQNLYSNFSMFCALSNSCTPSQFAAALRAICV 65
           + + LEKM + GH RR+G +E+ +    RQNLY NFS +  L++ CT  Q   ALR +C+
Sbjct: 12  QHECLEKMIQNGHARRMGSVEDLYVALNRQNLYRNFSTYAELNDYCTRDQLTLALRELCL 71

Query: 66  EHPILVHTVTPKNWPNHMEYYASEEFVNNPVLEHEKMRLLERVDLSDIVMNEQDEYSETV 125
           ++P L+H V P  WPNH  YY S E+ + P  +H+ + +L+ + L  +V+N+Q +YS  +
Sbjct: 72  KNPTLLHIVLPTRWPNHETYYRSSEYYSRPHPKHDYISVLQELKLDGVVLNDQPQYSAIM 131

Query: 126 SKILAEFAQNGGIYTREIFDIIATVRIPYGDPTKPNWRFLCIPEKSGPNWNKFIFISNHC 185
            +IL EF  + G YT +IF     + IPY  P  PNWR +C+PE+    W KFIF+SNHC
Sbjct: 132 KQILEEFKNSNGTYTAKIFKYTTKLTIPYFGPNGPNWRLICLPEEHTDRWKKFIFVSNHC 191

Query: 186 SMDGTSASNLFRDICTQLNDLSMKEDKSNLVFDYALDCDSLKKLPSPIDERIEYRPPLSY 245
             DG S+ + F D+  +LN +     K++ +F Y  D   L+KLP PI+  I++RPP  +
Sbjct: 192 MSDGRSSIHFFHDLRDELNRIKTPPRKTDYIFQYESDYQLLRKLPEPIERVIDFRPPYLF 251

Query: 246 FPQFLGSNFVRKHIGYHSNGPLVSRVDALDEGTACYTEFLNLTSQQMKEVKKKLK-SKAP 304
            P+ L S F+  H+ + S G +  R++ +++     T+ + +T  +++E++ K+K +   
Sbjct: 252 IPKSLFSGFIYNHLRFSSKG-ICMRMEDMEKCDDVVTDIITITPSELQEIRAKIKLNIQG 310

Query: 305 QCTMTPFLQACLLVSMYDSGKVFTGSMREWFFDVVIPMNTVQLLPDDGEVQSMYKYGSNI 364
           +CT+TPFLQ C  VS++  GK F     EW  D+ IP +    LPDD EV+ MY+YG+N+
Sbjct: 311 KCTITPFLQVCWFVSLHKWGKFFKPLNFEWLTDIFIPADCRSELPDDEEVRQMYRYGANV 370

Query: 365 GGSRYNYLISSFNVGHEEEAFWNLVDYYRIVFESAREKNHYLYPLGALMMDAVCQKSNVD 424
           G   +   IS F++   EE FW L+ +Y  V  +A +   +L+ LG  +   V +  N+D
Sbjct: 371 GFVDFTPWISEFDMNDSEENFWPLIKHYHEVISAALKDKKHLHGLGFNIQGFVQKYVNID 430

Query: 425 KLVVDDLIGKPREGAVFSNLGFISQ--EIDNKIYYMNDLVFSQTLGSLRHGFTLSSCTIE 482
           K + D  IGK R G + SN+G  +Q  E D K Y + DL F Q  GS    F+L  C+  
Sbjct: 431 KAMCDRAIGKARGGTLLSNVGMFNQVKEPDTK-YSIRDLAFGQFQGSWHQAFSLGVCSTN 489

Query: 483 KAGMNIVACAALGTVENRSDWAEVCELFKKRILS 516
             GMNI+  +    V ++    E+C +FK  +L 
Sbjct: 490 VKGMNILVASTKNVVGSQESLEELCSIFKSLLLG 523

>NCAS0A06920 Chr1 (1373157..1374713) [1557 bp, 518 aa] {ON}
           Anc_5.184
          Length = 518

 Score =  388 bits (996), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 200/514 (38%), Positives = 309/514 (60%), Gaps = 15/514 (2%)

Query: 6   KADVLEKMEELGHVRRLGHLENYFALCQRQNLYSNFSMFCALSNSCTPSQFAAALRAICV 65
           K  + +++ E GH RR+GHLENYFAL QRQ LY+NFS++  L+          ALR+I  
Sbjct: 12  KPYIADELIERGHARRMGHLENYFALLQRQKLYTNFSIYGELNKEVKDVDLTRALRSIIF 71

Query: 66  EHPILVHTVTPKNWPNHMEYYASEEFVNNPVLEHEKMRLLERVDLSDIVMNEQDEYSETV 125
           ++PIL HT+ PK +P+   +Y SEE++N P  EH+ +++L ++ LSDI++NEQ+E+ E V
Sbjct: 72  KNPILAHTIVPKKYPDQEPFYQSEEYLNAPYPEHDFIKVLPKLSLSDILINEQEEFREIV 131

Query: 126 SKILAEFAQNGGIYTREIFDIIATVRIPYGDPTKPNWRFLCIPEKSGPNWNKFIFISNHC 185
             IL +F +  G+ T +I   +A V IP  DP++PNWR   +         KF +ISNHC
Sbjct: 132 DDILTQFKEANGVITPDIMKAVAYVIIPICDPSRPNWRLFRLSP------TKFFYISNHC 185

Query: 186 SMDGTSASNLFRDICTQLNDLSMKEDKSNL-VFDYALDCDSLKKLPSPIDERIEYRPPLS 244
           + D  S  N+F+DICT+L+    +  + +L +F+Y  D +S  K+  PI + IEYRP L+
Sbjct: 186 TSDAISGVNIFQDICTELSQNDEEPFRDDLQIFNYEEDWESFHKIYIPITDIIEYRPALT 245

Query: 245 YFPQFLGSNFVRKHIGYHSNGPLVSRVDALDEGTACYTEFLNLTSQQMKEVKKKLKSKAP 304
             P+ + S  V+  + Y  N P        D+G       +  T+ ++  +++ +K    
Sbjct: 246 SLPKIIASALVKGFLNYR-NWP-TELTSTNDKGIPFDFNIITFTNDEVNSIRETVKKY-- 301

Query: 305 QCTMTPFLQACLLVSMYDSGKVF-TGSMREWFFDVVIPMNTVQLLPDDGEVQSMYKYGSN 363
            CT TPFLQAC  V+M+++GK+F   S REW  DV IP N+ + L D+ E++ +YKYGSN
Sbjct: 302 NCTFTPFLQACWFVAMFNNGKIFHMDSWREWGLDVAIPSNSRRFLADE-ELKDIYKYGSN 360

Query: 364 IGGSRYNYLISSFNVG-HEEEAFWNLVDYYRIVFESAREKNHYLYPLGALMMDAVCQKSN 422
           +GG  Y +LISSFN+   E+E FW+LV YY+  +  + E   +   LG LMMD + ++ N
Sbjct: 361 VGGLHYTHLISSFNIQLDEKEKFWDLVQYYQDGYTKSYENGDHFSGLGLLMMDGLVKRQN 420

Query: 423 VDKLVVDDLIGKPREGAVFSNLGFISQEIDNKIYYMNDLVFSQTLGSLRHGFTLSSCTIE 482
           +DK++  D + K R G +FSN GF  Q+   + Y++NDL+F+Q+ G+++  F L+  T  
Sbjct: 421 IDKVISSDYLHKTRAGVLFSNAGFFPQD-RTQAYHVNDLLFTQSQGAMKFSFGLNIATTN 479

Query: 483 KAGMNIVACAALGTVENRSDWAEVCELFKKRILS 516
             GMNI    A GT ++     ++ + F + I S
Sbjct: 480 IGGMNIAINVAQGTFDDEEGIIDLSQDFYRNIKS 513

>Skud_15.544 Chr15 (985246..986820) [1575 bp, 524 aa] {ON} YOR377W
           (REAL)
          Length = 524

 Score =  388 bits (997), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 189/513 (36%), Positives = 294/513 (57%), Gaps = 3/513 (0%)

Query: 6   KADVLEKMEELGHVRRLGHLENYFALCQRQNLYSNFSMFCALSNSCTPSQFAAALRAICV 65
           + + LE+M + GH RR+G +E+ +    RQ LY NFS +  LS+ C+  Q   ALR IC+
Sbjct: 12  QHECLERMIQNGHARRMGSVEDLYVALNRQKLYRNFSAYAELSDYCSKDQLTLALRNICL 71

Query: 66  EHPILVHTVTPKNWPNHMEYYASEEFVNNPVLEHEKMRLLERVDLSDIVMNEQDEYSETV 125
           ++P L+H V P  WP+H  YY S E+ ++P  EH+ + +L  + L  +++NEQ E  + V
Sbjct: 72  KNPTLLHIVLPTRWPDHENYYLSSEYYSHPHPEHDYISVLPELKLDGVIINEQPENGKIV 131

Query: 126 SKILAEFAQNGGIYTREIFDIIATVRIPYGDPTKPNWRFLCIPEKSGPNWNKFIFISNHC 185
            +IL EF  + G Y  +IF +   + IPY  PT PNWR +C+PE+    W KFIF+SNHC
Sbjct: 132 RQILEEFRNSNGTYNAKIFKLTTALTIPYFGPTSPNWRLICLPEEHTDKWKKFIFVSNHC 191

Query: 186 SMDGTSASNLFRDICTQLNDLSMKEDKSNLVFDYALDCDSLKKLPSPIDERIEYRPPLSY 245
             DG S+ + F D+  +LND+     K + +F Y  D   L+KLP PI++ I++RPP  +
Sbjct: 192 MSDGRSSIHFFHDLKAELNDIKTPPKKLDYLFKYENDYQLLRKLPEPIEKVIDFRPPYLF 251

Query: 246 FPQFLGSNFVRKHIGYHSNGPLVSRVDALDEGTACYTEFLNLTSQQMKEVKKKLKSKAP- 304
            P+ L S F+  H+ + S G + +R+D +++      E + ++  +++E++ K+KS    
Sbjct: 252 IPKSLLSGFIYNHLRFASRG-ICTRMDDMEKSDDVVAEIITISPSELQEIRTKIKSNIQG 310

Query: 305 QCTMTPFLQACLLVSMYDSGKVFTGSMREWFFDVVIPMNTVQLLPDDGEVQSMYKYGSNI 364
           +CT+TPFLQ C  VS++  GK F     EW  D+ IP +    LPDD EV+ MY+YG+N+
Sbjct: 311 KCTLTPFLQVCWFVSLHQWGKFFKPLNFEWLTDIFIPADCRPQLPDDEEVRQMYRYGANV 370

Query: 365 GGSRYNYLISSFNVGHEEEAFWNLVDYYRIVFESAREKNHYLYPLGALMMDAVCQKSNVD 424
           G   +   I   N+   +E FW L+++Y  V   A   N +L+ LG  +   V +  N+D
Sbjct: 371 GFVDFTPWICESNMNDNKENFWPLIEHYHQVISGALRDNKHLHGLGLNIQGFVQKYVNID 430

Query: 425 KLVVDDLIGKPREGAVFSNLGFISQ-EIDNKIYYMNDLVFSQTLGSLRHGFTLSSCTIEK 483
           K + D  IGK R G + SN+G   Q +  N  Y + DL F Q  GS    F+L  C+ + 
Sbjct: 431 KAMCDRAIGKARGGTLLSNVGMFKQLDSSNCNYSIKDLAFGQFQGSWHQAFSLGVCSTDV 490

Query: 484 AGMNIVACAALGTVENRSDWAEVCELFKKRILS 516
            GMNI+  +    V ++    E+C ++K  +L 
Sbjct: 491 KGMNIIVASTKNVVGSQESLEELCRVYKAMLLG 523

>YOR377W Chr15 (1046226..1047803) [1578 bp, 525 aa] {ON}
           ATF1Alcohol acetyltransferase with potential roles in
           lipid and sterol metabolism; responsible for the major
           part of volatile acetate ester production during
           fermentation
          Length = 525

 Score =  387 bits (994), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 194/514 (37%), Positives = 297/514 (57%), Gaps = 5/514 (0%)

Query: 6   KADVLEKMEELGHVRRLGHLENYFALCQRQNLYSNFSMFCALSNSCTPSQFAAALRAICV 65
           + + L++M + GH RR+G +E+ +    RQNLY NF  +  LS+ CT  Q   ALR IC+
Sbjct: 13  QQECLKEMIQNGHARRMGSVEDLYVALNRQNLYRNFCTYGELSDYCTRDQLTLALREICL 72

Query: 66  EHPILVHTVTPKNWPNHMEYYASEEFVNNPVLEHEKMRLLERVDLSDIVMNEQDEYSETV 125
           ++P L+H V P  WPNH  YY S E+ + P   H+ + +L+ + LS +V+NEQ EYS  +
Sbjct: 73  KNPTLLHIVLPTRWPNHENYYRSSEYYSRPHPVHDYISVLQELKLSGVVLNEQPEYSAVM 132

Query: 126 SKILAEFAQNGGIYTREIFDIIATVRIPYGDPTKPNWRFLCIPEKSGPNWNKFIFISNHC 185
            +IL EF  + G YT +IF +  T+ IPY  PT P+WR +C+PE+    W KFIF+SNHC
Sbjct: 133 KQILEEFKNSKGSYTAKIFKLTTTLTIPYFGPTGPSWRLICLPEEHTEKWKKFIFVSNHC 192

Query: 186 SMDGTSASNLFRDICTQLNDLSMKEDKSNLVFDYALDCDSLKKLPSPIDERIEYRPPLSY 245
             DG S+ + F D+  +LN++     K + +F Y  D   L+KLP PI++ I++RPP  +
Sbjct: 193 MSDGRSSIHFFHDLRDELNNIKTPPKKLDYIFKYEEDYQLLRKLPEPIEKVIDFRPPYLF 252

Query: 246 FPQFLGSNFVRKHIGYHSNGPLVSRVDALDEGTACYTEFLNLTSQQMKEVKKKLKSKAP- 304
            P+ L S F+  H+ + S G +  R+D +++     TE +N++  + + +K  +KS    
Sbjct: 253 IPKSLLSGFIYNHLRFSSKG-VCMRMDDVEKTDDVVTEIINISPTEFQAIKANIKSNIQG 311

Query: 305 QCTMTPFLQACLLVSMYDSGKVFTGSMREWFFDVVIPMNTVQLLPDDGEVQSMYKYGSNI 364
           +CT+TPFL  C  VS++  GK F     EW  D+ IP +    LPDD E++ MY+YG+N+
Sbjct: 312 KCTITPFLHVCWFVSLHKWGKFFKPLNFEWLTDIFIPADCRSQLPDDDEMRQMYRYGANV 371

Query: 365 GGSRYNYLISSFNVGHEEEAFWNLVDYYRIVFESAREKNHYLYPLGALMMDAVCQKSNVD 424
           G   +   IS F++   +E FW L+++Y  V   A     +L+ LG  +   V +  N+D
Sbjct: 372 GFIDFTPWISEFDMNDNKENFWPLIEHYHEVISEALRNKKHLHGLGFNIQGFVQKYVNID 431

Query: 425 KLVVDDLIGKPREGAVFSNLGFISQ--EIDNKIYYMNDLVFSQTLGSLRHGFTLSSCTIE 482
           K++ D  IGK R G + SN+G  +Q  E D K Y + DL F Q  GS    F+L  C+  
Sbjct: 432 KVMCDRAIGKRRGGTLLSNVGLFNQLEEPDAK-YSICDLAFGQFQGSWHQAFSLGVCSTN 490

Query: 483 KAGMNIVACAALGTVENRSDWAEVCELFKKRILS 516
             GMNIV  +    V ++    E+C ++K  +L 
Sbjct: 491 VKGMNIVVASTKNVVGSQESLEELCSIYKALLLG 524

>Suva_8.434 Chr8 (783961..785538) [1578 bp, 525 aa] {ON} YOR377W
           (REAL)
          Length = 525

 Score =  382 bits (980), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 189/517 (36%), Positives = 302/517 (58%), Gaps = 6/517 (1%)

Query: 3   SIEKADVLEKMEELGHVRRLGHLENYFALCQRQNLYSNFSMFCALSNSCTPSQFAAALRA 62
           S+ + + L KM + GH RR+G +E+ +A   RQ LY NFS +  L++ CT  Q A ALR 
Sbjct: 9   SLVQDECLAKMIQNGHSRRMGSVEDLYAALNRQKLYRNFSTYSELNDYCTKDQLALALRN 68

Query: 63  ICVEHPILVHTVTPKNWPNHMEYYASEEFVNNPVLEHEKMRLLERVDLSDIVMNEQDEYS 122
           IC+++P L+H V P  WP+H  YY S E+ + P  +H+ + +L  +    +++NEQ E++
Sbjct: 69  ICLKNPTLLHIVLPARWPDHENYYLSSEYYSQPHPKHDYISVLPELKFDGVILNEQPEHN 128

Query: 123 ETVSKILAEFAQNGGIYTREIFDIIATVRIPYGDPTKPNWRFLCIPEKSGPN-WNKFIFI 181
             + +IL E   + G YT +IF +   + IPY  PT P WR +C+PE+   + W KFIF+
Sbjct: 129 ALMKQILEELKDSNGSYTAKIFKLTTALTIPYAGPTSPTWRLICLPEEGYTDKWKKFIFL 188

Query: 182 SNHCSMDGTSASNLFRDICTQLNDLSMKEDKSNLVFDYALDCDSLKKLPSPIDERIEYRP 241
           SNHC  DG ++ + F+D+  +LN++     K + +F Y  D   L+KLP PI+  I++RP
Sbjct: 189 SNHCMCDGRTSIHFFQDLRDELNNIKTPPKKLDYIFQYEKDYQLLRKLPEPIENMIDFRP 248

Query: 242 PLSYFPQFLGSNFVRKHIGYHSNGPLVSRVDALDEGTACYTEFLNLTSQQMKEVKKKLKS 301
           P  + P+ L S F+  H+ + S G + +R+D L++     TE + ++  ++++++ K+KS
Sbjct: 249 PYMFIPKSLISGFIYSHLRFSSKG-VCTRMDELEKNDDIVTEIITISPSELQKIRTKIKS 307

Query: 302 KAP-QCTMTPFLQACLLVSMYDSGKVFTGSMREWFFDVVIPMNTVQLLPDDGEVQSMYKY 360
             P +CT+TPFL+ C  VS++  GK F     EW  DV IP +   LLP+D +V++MY+Y
Sbjct: 308 NIPGKCTITPFLEVCWFVSLHKWGKFFKPLKFEWLTDVFIPADCRSLLPEDEDVRAMYRY 367

Query: 361 GSNIGGSRYNYLISSFNVGHEEEAFWNLVDYYRIVFESAREKNHYLYPLGALMMDAVCQK 420
           G+N+G   +   IS FN+   +E FW L+ +Y  V   A     +L  LG  +   V + 
Sbjct: 368 GANVGFVDFTPWISEFNMNDSKENFWPLIAHYHEVISGAINDKKHLNGLGFNIQGLVQKY 427

Query: 421 SNVDKLVVDDLIGKPREGAVFSNLGFI--SQEIDNKIYYMNDLVFSQTLGSLRHGFTLSS 478
            N+DK++ D  +GK R G + SN+G    S+E D++ Y + DL F Q  GS    F+L  
Sbjct: 428 VNIDKVMRDRALGKSRGGTLLSNVGIFHQSEETDSR-YSIRDLAFGQFQGSWHQAFSLGV 486

Query: 479 CTIEKAGMNIVACAALGTVENRSDWAEVCELFKKRIL 515
           C+    GMNIV  +    V ++    E+C ++K  +L
Sbjct: 487 CSTNVKGMNIVISSTKNAVGSQELLEELCAMYKALLL 523

>NDAI0D01980 Chr4 (468576..470192) [1617 bp, 538 aa] {ON} Anc_5.184
          Length = 538

 Score =  374 bits (960), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 204/527 (38%), Positives = 310/527 (58%), Gaps = 26/527 (4%)

Query: 7   ADVLEKMEELGHVRRLGHLENYFALCQRQNLYSNFSMFCALSNSCTPSQFAAALRAICVE 66
            +V  K+ E GH RR+GHLENYFAL QRQ LY+NF ++   +   + SQ   +LR I  +
Sbjct: 19  VEVSTKLIERGHARRMGHLENYFALLQRQELYTNFQIYGEFNEPVSDSQLRESLREILFK 78

Query: 67  HPILVHTVTPKNWPNHMEYYASEEFVNNPVLEHEKMRLLERVDLSDIVMN-EQDEYSETV 125
           HPIL HT+ PK+ P+  ++Y SE+++N P   H+ +R+L  + LSDI++N +Q+EYS+ +
Sbjct: 79  HPILAHTIIPKDQPDFRKWYQSEKYLNTPYPLHDFIRILPELKLSDILINKQQEEYSDIL 138

Query: 126 SKILAEFAQNGGIYTREIFDIIATVRIPYGDPTKPNWRFLCIPEKSGPNWNKFIFISNHC 185
             IL EF     I T  +    + +R+P  DP +PNWR L +  +      +FI++SNHC
Sbjct: 139 PGILNEFESEKKI-TSSLLSRASCLRVPIYDPKRPNWRLLRLSPR------QFIYVSNHC 191

Query: 186 SMDGTSASNLFRDICTQL------NDLSMKEDK--SNLVFDYALDCDSLKKLPSPIDERI 237
             D  S  NLF+DI   L      +    ++DK  +N +F+Y  D     KL  PI ++I
Sbjct: 192 CSDAISGVNLFQDIAEHLSSSSTSSSFPREDDKNDNNTIFNYNSDWKFFNKLYDPITDKI 251

Query: 238 EYRPPLSYFPQFLGSNFVRKHIGYHS-NGPLVSRVDALDEGTACYTEF--LNLTSQQMKE 294
           EYRP +   P+F  S FV+ ++ Y + NG    RVD          +F  L  T++++  
Sbjct: 252 EYRPKVKALPKFACSIFVKSYLSYFNWNGLPTMRVDQPLPLLHKQFQFQLLEFTNEELNT 311

Query: 295 VKKKLKSKAPQCTMTPFLQACLLVSMYDSGKVFT-GSMREWFFDVVIPMNTVQLL--PDD 351
           ++ K+K+    CT TPFLQAC  ++MY  GKVF   S +EW  D+ +P ++ + L   DD
Sbjct: 312 IRDKIKTMG--CTFTPFLQACWFIAMYKCGKVFNLKSWKEWAIDIAVPSSSRRFLIEEDD 369

Query: 352 GEVQSMYKYGSNIGGSRYNYLISSFNVGHEE-EAFWNLVDYYRIVFESAREKNHYLYPLG 410
             ++ MYKYGSN+GG  Y+YLISSFN+   E + F+ LV YY+  +  + E   +L  LG
Sbjct: 370 NSLKEMYKYGSNVGGFHYSYLISSFNIDRSENDKFFELVQYYQDGYSKSYENGDHLIGLG 429

Query: 411 ALMMDAVCQKSNVDKLVVDDLIGKPREGAVFSNLGFISQEIDNKIYYMNDLVFSQTLGSL 470
            +MMD + Q+ N+DK++ DD + + R G +FSN GF  Q+ ++K Y++ DLVF+Q  GS+
Sbjct: 430 IMMMDGIVQRKNIDKMIKDDYLNQTRAGVLFSNAGFFPQD-ESKKYHVTDLVFNQAQGSM 488

Query: 471 RHGFTLSSCTIEKAGMNIVACAALGTVENRSDWAEVCELFKKRILSI 517
           +  F L+  +    G+ I    A GT +  +D+A +C  FK  I+S 
Sbjct: 489 KFSFGLNIASTNVNGLKISVNVAEGTFDETADFAHLCNEFKANIVSF 535

>TPHA0E03170 Chr5 complement(670756..672360) [1605 bp, 534 aa] {ON}
           Anc_5.184 YGR177C
          Length = 534

 Score =  373 bits (958), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 186/519 (35%), Positives = 308/519 (59%), Gaps = 12/519 (2%)

Query: 6   KADVLEKMEELGHVRRLGHLENYFALCQRQNLYSNFSMFCALSNSCTPSQFAAALRAICV 65
           K  + E++ E GH RR+GHL++YFA+ QRQ LY+NF+++C L+      Q + A R + +
Sbjct: 12  KPYITEELIERGHARRMGHLQDYFAIIQRQKLYNNFNIYCELNEKVNKVQLSHAFREMFL 71

Query: 66  EHPILVHTVTPKNWPNHMEYYASEEFVNNPVLEHEKMRLLERVDLSDIVMNEQDEYSETV 125
           ++P L+  + PK +P H  YY SEE+++ P   H+ +R+L  V+++DI+MNEQDEY    
Sbjct: 72  QYPALIEYIVPKFYPKHEAYYRSEEYLSKPCPIHDYIRVLNEVNINDIIMNEQDEYKSIT 131

Query: 126 SKILAEFAQNGGIYTREIFDIIATVRIPYGDPTKPNWRFLCIPEK-SGPNWNKFIFISNH 184
           +KI   F +N   ++ EI ++++T++I   DP KPNWR +C+P K S   W  FI +SNH
Sbjct: 132 TKISDIFVKNDYKFSNEISEMVSTIKIAICDPKKPNWRIICLPSKTSSTEWKDFILVSNH 191

Query: 185 CSMDGTSASNLFRDICTQLNDLSMKEDKSNL------VFDYALDCDSLKKLPSPIDERIE 238
              DGTSA N F D+   L+  +  E+ + +      + +Y+ D   + KLP PI ERI 
Sbjct: 192 FDSDGTSAVNFFEDLTNILSKQANVENDTIVIGNDINIINYSKDYKLISKLPIPITERIS 251

Query: 239 YRPPLSYFPQFLGSNFVRKHIGYHSNGPLVSRVDALDEGTACYTEFLNLTSQQMKEVKKK 298
           Y P LS  P+F+  N  +  + Y S+G   +  + + E    Y   +N +S+++ ++KK 
Sbjct: 252 YTPTLSSIPKFIVGNICKTKLQYTSDGG-DTPAEFVSEDPLTYDYLINFSSEEVAKMKKT 310

Query: 299 LKS-KAPQCTMTPFLQACLLVSMYDSGKVFT-GSMREWFFDVVIPMNTVQLLPDDGEVQS 356
           +K+      T+TPF+QAC  V+MY   K+    +  +W  D  +  N  +LLPDD E + 
Sbjct: 311 IKNCLYNSVTLTPFIQACFFVAMYKYNKILNLNNWWQWGVDCALATNARRLLPDDPETRD 370

Query: 357 MYKYGSNIGGSRYNYLISSFNVGH-EEEAFWNLVDYYRIVFESAREKNHYLYPLGALMMD 415
           +Y+YGSN+GG+ Y  LIS FN+   E + F+ LVDYY   ++++      L   G L  D
Sbjct: 371 LYRYGSNVGGTHYFNLISQFNINEFEYDKFFKLVDYYHKNYQNSYRNGDELVGFGVLFSD 430

Query: 416 AVCQKSNVDKLVVDDLIGKPREGAVFSNLGFISQEIDNKIYYMNDLVFSQTLGSLRHGFT 475
            +   +N+DK + DD     R G +FSN+G+ ++++  K+ ++N+++FSQ+ G ++  F 
Sbjct: 431 LIINNTNMDKTIKDDYTNHKRGGLLFSNVGYRNEDLTKKV-HVNNIIFSQSPGCMKFTFG 489

Query: 476 LSSCTIEKAGMNIVACAALGTVENRSDWAEVCELFKKRI 514
           L+  + +K GMNI+     G+V++R ++ + C  F+K +
Sbjct: 490 LNLISTDKCGMNILMNGVRGSVKSRENFEDFCRFFRKTV 528

>KAFR0D01730 Chr4 complement(345374..346978) [1605 bp, 534 aa] {ON}
           Anc_5.184 YGR177C
          Length = 534

 Score =  372 bits (954), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 185/513 (36%), Positives = 305/513 (59%), Gaps = 17/513 (3%)

Query: 4   IEKADVLEKMEELGHVRRLGHLENYFALCQRQNLYSNFSMFCALSNSCTPSQFAAALRAI 63
           + + D+ +++ + GH RR+GHLENYFA+ QRQ LYSNF+++  ++ S + +    ALR +
Sbjct: 30  VAEYDIPQELIDRGHARRMGHLENYFAMLQRQELYSNFAVYLKMNKSVSRNDLKHALREV 89

Query: 64  CVEHPILVHTVTPKNWPNHMEYYASEEFVNNPVLEHEKMRLLERVDLSDIVMNEQDEYSE 123
            +E+ +L HT+ PK +P+H  +Y SE+++N P  +H+ M++L  + L DI++N+Q EY+E
Sbjct: 90  ILENSVLAHTIVPKYYPDHEAFYKSEKYLNVPYPKHDFMKILPSLSLEDIIINDQSEYTE 149

Query: 124 TVSKILAEFAQNGGIYTREIFDIIATVRIPYGDPTKPNWRFLCIPEKSGPNWNKFIFISN 183
            V+ I+ +F ++ G  T ++ +I++ + IP  D ++PNWR LC+P+ +   ++ F++ISN
Sbjct: 150 VVNSIIDQFVKDNGKITNKLSEIVSNICIPIYDQSRPNWRLLCLPDNTD-EYSNFVYISN 208

Query: 184 HCSMDGTSASNLFRDICTQLNDLSMKEDKS--NLVFDYALDCDSLKKLPSPIDERIEYRP 241
           HC  DGTS  NLF+D+   LN     E  S  +L+++Y  D D + KLP+ I +R++YRP
Sbjct: 209 HCCSDGTSGINLFQDLVKSLNGKKSPEMTSPDSLIYNYEKDFDKISKLPAAITDRVDYRP 268

Query: 242 PLSYFPQFLGSNFVRKHIGYHSNGPLVSRVDALDEGTACYTEFLNLTSQQMKEVKKKLKS 301
            L   PQF+ S   +    Y S  P+ ++++ + +    +   LN T  ++ +++  +K 
Sbjct: 269 ALWKLPQFMLSTLGKVFFSYKSPAPVSTKIN-MSKPQPSFHNILNFTPDELNKIRIAIKK 327

Query: 302 KAPQCTMTPFLQACLLVSMYDSGKVFTGSMREWFFDVVIPMNTVQLLPDDGEVQSMYKYG 361
            A  CTMT FLQ CL +++ + G        E+ FD+ +P NT + LP++  V S YKYG
Sbjct: 328 NA--CTMTSFLQTCLFITLKEHGIFANRKWNEFGFDITVPSNTRKDLPEE-LVTSQYKYG 384

Query: 362 SNIGGSRYNYLISSFNVGHEEEAFWNLVDYYRIVFESAREKNHYLYPLGALMMDAVCQKS 421
           SN+GG  Y++LISSF      E FW L  YY  V + A     +L PLG +M+D V  K 
Sbjct: 385 SNVGGLHYSFLISSFIA----ENFWKLCSYYSAVLKQA----DFLRPLGTIMLDFVVNKQ 436

Query: 422 NVDKLVVDDLIGKPREGAVFSNLGFISQEIDNKIYYMNDLVFSQTLGSLRHGFTLSSCTI 481
           N+D ++ D  + K R G + SN+G+  Q  D     + DL+  Q +G L   + ++ C+ 
Sbjct: 437 NIDSMISDSYLNKKRGGIILSNVGYFEQNDDE--CEILDLMLMQNVGGLNFSYAVNICST 494

Query: 482 EKAGMNIVACAALGTVENRSDWAEVCELFKKRI 514
              GMNI      GT+++R D+   C+  K  +
Sbjct: 495 NLGGMNICLSIVEGTLKDRDDFNAFCDELKTTV 527

>KNAG0H02650 Chr8 (492038..493672) [1635 bp, 544 aa] {ON} Anc_5.184
           YGR177C
          Length = 544

 Score =  334 bits (857), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 188/513 (36%), Positives = 294/513 (57%), Gaps = 32/513 (6%)

Query: 15  ELGHVRRLGHLENYFALCQRQNLYSNFSMFCALSNS--CTPSQFAAALRAICVEHPILVH 72
           E GH RR+GHLENYFAL QRQ+LYSNFS++   + S       F AAL+ I  ++PILVH
Sbjct: 34  ERGHARRMGHLENYFALLQRQDLYSNFSIYGQFNRSIDVRSKAFLAALKDIFCKNPILVH 93

Query: 73  TVTPKNWPNHMEYYASEEFVNNPVLEHEKMRLLERVDLSDIVMNEQDEYSETVSKILAEF 132
           T+ PK +P   EYY SEE++N P  EH+ +++L R+ L  +++N Q+   + VS+I+A++
Sbjct: 94  TIVPKRYPYEEEYYRSEEYLNEPFPEHDYIKVLPRLSLESVILNFQETQQQVVSEIIAQY 153

Query: 133 AQNGGIYTREIFDIIATVRIPYGDPTKPNWRFLCIPEK-------SGPNWNKFIFISNHC 185
            ++       + ++++ +RIP  DP KPNW  +C+P K        G  + K I++SNHC
Sbjct: 154 RRDDYQVKNVLTELVSQIRIPICDPGKPNWGLICLPMKVDDEKKEEGVRFGKVIYVSNHC 213

Query: 186 SMDGTSASNLFRDICTQLN---DLSMKEDKSNLVFDYALDCDSLKKLPSPIDERIEYRPP 242
             D  +  NLF+DI   LN   D S+ +D +  +FDY++D  ++ K+P PI +RI+YRP 
Sbjct: 214 CADAMTGINLFQDIIANLNRATDESVSDDTT--IFDYSVDHSAISKIPIPITDRIDYRPA 271

Query: 243 LSYFPQFLGSNFVRKHIGYHSNGPLVSRVDALDEGTACYTEFLNLTSQQMKEVKKKLKSK 302
           LS  P+F+ S  ++K+  Y SN P   R+    E  A +   +N  S+QM  ++  ++++
Sbjct: 272 LSSLPKFMVSTMLKKYFDYRSNAPETKRI---SEQNANWHSIVNFPSEQMDVIRTAVRTQ 328

Query: 303 APQCTMTPFLQACLLVSMYDSGKVFTGSMREWFFDVVIPMNTVQLLPDDGEVQSMYKYGS 362
              C++T FLQ CL V++ +SG        E  FD+ +P +T ++LP D      YKYGS
Sbjct: 329 G--CSVTAFLQTCLSVALQNSGVFQNRRYSELGFDISVPSDTRRILPGD-LAADQYKYGS 385

Query: 363 NIGGSRYNYLISSFNVGHEEEAFWNLVDYYRIVFESAREKNHYLYPLGALMMDAVCQKSN 422
           N+ G  Y+Y I SF    +E  FW L  YY  V   A     YL  LG +M+D V +K N
Sbjct: 386 NVAGLHYSYFIPSF----QETEFWPLTQYYTGVLRGA----DYLIGLGTIMLDFVYKKQN 437

Query: 423 VDKLVVDDLIGKPREGAVFSNLGFI----SQEIDNKIYYMNDLVFSQTLGSLRHGFTLSS 478
           +DKL+ +  +G  R G + SN+G +    ++      + + DL F Q +G L   + ++ 
Sbjct: 438 IDKLISESYLGNRRGGIILSNVGALVTGGAEATKADRWTLRDLKFVQDVGVLNFSYVVNV 497

Query: 479 CTIEKAGMNIVACAALGTVENRSDWAEVCELFK 511
            +    GMN+    A G++ +R+ +  VC  F+
Sbjct: 498 VSTPAGGMNVCLSCAQGSLPSRAQFDAVCAEFQ 530

>KLLA0F15202g Chr6 (1401627..1403180) [1554 bp, 517 aa] {ON} similar
           to uniprot|P53296 Saccharomyces cerevisiae YGR177C ATF2
           Alcohol acetyltransferase may play a role in steroid
           detoxification forms volatile esters during fermentation
           which is important in brewing
          Length = 517

 Score =  298 bits (763), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 164/514 (31%), Positives = 286/514 (55%), Gaps = 13/514 (2%)

Query: 12  KMEELGHVRRLGHLENYFALCQRQNLYSNFSMFCALSNSCTPSQFAAALRAICVEHPILV 71
           K  E GH RR G++E    +  RQ LYSNF +   L ++ +  Q A ALRA+ + +PIL 
Sbjct: 9   KKLERGHARRAGYVEEVLLMEHRQKLYSNFVVHGELKSAASELQLAHALRALFLRYPILA 68

Query: 72  HTVTPKNWPNHMEYYASEEFVNNPVLEHEKMRLLERVDLSDIVMNEQDEYSETVSKILAE 131
            T+ P+ W     YY SE F N P L  + + +++++ L D++MN+Q E+S+  ++IL +
Sbjct: 69  TTIIPEYWNEKETYYTSEAFYNKPGLAEDYVSVVDQLKLEDVIMNKQPEHSKFYNEILNQ 128

Query: 132 FAQNGGIYTREIFDIIATVRIPYGDPTKPNWRFLCIP----EKSGPNWNKFIFISNHCSM 187
           +  +G  Y  ++  +++       DPTKP++R + +P    +K    +   ++I+NH + 
Sbjct: 129 WEHDGFKYGDDLSVVVSQYTFSCWDPTKPHFRLVLLPSADDKKGARGFKDILYITNHVTS 188

Query: 188 DGTSASNLFRDICTQLNDLSMKE-DKSNLVFDYALDCDSLKKLPSPIDERIEYRPPLSYF 246
           DGTS +NL  D+  +L   S     +   +  Y  D + L KLP PI+E++ Y    S+ 
Sbjct: 189 DGTSGANLLEDLSIELGKFSGTNLQQLEYLLHYGRDYEQLPKLPDPIEEKVSYGVNPSFI 248

Query: 247 PQFLGSNFVRKHIGYHSNGPLVSRVDALDEGTACYTEFLNLTS-QQMK-EVKKKLKSKAP 304
             FL S   +K +    + P+   +DA       +   ++ T  Q+M+  VK KL  KA 
Sbjct: 249 ASFLLSQMGKKLLTKKWDQPITRPIDASPASHMAHIIKIDPTGMQKMRARVKDKLNGKA- 307

Query: 305 QCTMTPFLQACLLVSMYDSGKVFTGSMREWFFDVVIPMNTVQLLPDDGEVQSMYKYGSNI 364
             T+TPF+QAC  VS Y++G        E+F ++ +PMNT Q LP+D EV+  ++YG+ +
Sbjct: 308 --TLTPFMQACWFVSCYEAGLFDDRKWNEFFINMAVPMNTRQYLPEDPEVRDRFRYGTVV 365

Query: 365 GGSRYNYLISSFNVGHEEEAFWNLVDYYRIVFESAREKNHYLYPLGALMMDAVCQKSNVD 424
           GG+ +N+LISSFN+   ++ FW+L +YY+  F   RE+       G L  D V + +N+D
Sbjct: 366 GGTNFNFLISSFNITSNQQ-FWDLTEYYQQWFTKTREEGLATKTFGTLFADFVSKSNNLD 424

Query: 425 KLVVDDLIGKPREGAVFSNLGFISQEI-DNKIYYMNDLVFSQTLGSLRHGFTLSSCTIEK 483
           KL+  D++ + R  A+ SN+G+  Q+  ++  + + DL+FSQ    +   F+L   + + 
Sbjct: 425 KLIKQDMMHQRRAFALLSNVGYRPQKAQESNPFQLQDLIFSQAACEMPFVFSLCCVSTDI 484

Query: 484 AGMNIVACAALGTVENRSDWAEVCELFKKRILSI 517
            GM++       ++ ++  W ++C++F+K + ++
Sbjct: 485 GGMSLTLTCCEESI-SQQQWHKICQVFEKNLTTL 517

>CAGL0K00737g Chr11 complement(81263..82636) [1374 bp, 457 aa] {ON}
           similar to uniprot|P53304 Saccharomyces cerevisiae
           YGR212w
          Length = 457

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 84/378 (22%), Positives = 144/378 (38%), Gaps = 84/378 (22%)

Query: 19  VRRLGHLENYFALCQRQNLYSNFSMFCALSNSCTPSQFAAALRAICVEHPILVHTVTPKN 78
           VR LG +E YF      NL+S FS+   L++    S F  ALR +   H  L        
Sbjct: 2   VRHLGGIEQYFYQRSSLNLHSCFSVGVELNSLPNRSDFICALRRVVNSHFQLYCNA---- 57

Query: 79  WPNHMEYYASEEFVNNPVLEHEKMRLLERVDLSDIVMNEQDEYSETVSKILAEFAQNGGI 138
                 Y ++ E V NP+   E ++  + VD  D      D Y E               
Sbjct: 58  ------YKSNNEVVVNPI--GEPIKFDDVVDYMD-----WDTYGE--------------- 89

Query: 139 YTREIFDIIATVRIPYGDPTKPNWRFLCIPEKSGPNWNKFIFISNHCSMDGTSASNLFRD 198
              EI  +       YG   KP W+ + +P+      NK IF ++H   DG +    + +
Sbjct: 90  --EEINSVFRKYNFEYG-VDKPLWKVIVVPKA-----NKMIFATDHLFFDGIATVLFWTE 141

Query: 199 ICTQLNDLSMKED--------KSNLVFDYALDCDSLKKLPSPIDERIEYRPPL------- 243
           +   L +L    D        +     D    C   +KLP P   +++ RP +       
Sbjct: 142 LLKSLEELKQDNDLDVDEIIYRPGGSTDSIDQCHPYEKLPIPFSWKVK-RPIVKALFTIA 200

Query: 244 --------SYFPQFLGSNFVRKHIGYHSNGPLVSRVDALDEGTACYTEFLNLTSQQMKEV 295
                   +   QF        ++  +SN     ++   +   +     L ++S ++K +
Sbjct: 201 PGAVVSQDASIIQFDEYKIPEDYLKKNSNDDGCYQIKNTNRQIS-----LKMSSNKLKVI 255

Query: 296 KKKLKSKAPQCTMTPFLQACLLVSMYDSGKV----FTGSMREWFFDVVIPMNTVQLLPDD 351
            K  K      + T +L A L +++   GK+    ++GS  ++     +PMNT   + + 
Sbjct: 256 MKDCKQH--HVSFTAYLTAVLYLAL---GKIPKEKYSGSTIKY----EVPMNTRNRISNS 306

Query: 352 GEVQSMYKYGSNIGGSRY 369
           GE  +   YG+ + G  +
Sbjct: 307 GEYSN--SYGTFVAGGEF 322

>KNAG0G00700 Chr7 complement(132337..133707) [1371 bp, 456 aa] {ON}
           Anc_5.119 YGR212W
          Length = 456

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 54/216 (25%), Positives = 88/216 (40%), Gaps = 45/216 (20%)

Query: 20  RRLGHLENYFALCQRQNLYSNFSMFCALSNSCTPSQFAAALRAICVEHPILVHTVTPKNW 79
           R+L  LE +F    +  L+S F +   L  + + +QFA A+    V+ P L  TV     
Sbjct: 3   RQLSSLEQFFYYRSKWGLHSCFLLGVTLDRTPSQAQFAHAIHECLVKFPQLTTTVV---- 58

Query: 80  PNHMEYYASEEFVNNPVLEHEKMRLLERVDLSDIVMNEQDEYSETVSKILAE-FAQNGGI 138
                    E     P   +  + L  R D  D V  E  ++ +  +++  E F +    
Sbjct: 59  ---------ELEQGTPTFANITVPL--RYD--DFV--EVKQWGQWDAQLANEIFKEYNFQ 103

Query: 139 YTREIFDIIATVRIPYGDPTKPNWRFLCIPEKSGPNWNKFIFISNHCSMDGTSASNLFRD 198
           YT E                KP WR L +P+ S      F+ + +H   DG S  NL+R 
Sbjct: 104 YTVE----------------KPLWRILAMPKSS-----TFVLLVDHVLFDGMSTVNLWRC 142

Query: 199 ICTQLNDLSMKEDKSNLVFDYALDCDSLKKLPSPID 234
           +   L      E  S+++++ + + D L + P P D
Sbjct: 143 LLENLG----PESTSDVLYEPSNEADQLGQRPHPYD 174

>NDAI0D02360 Chr4 (545485..546897) [1413 bp, 470 aa] {ON} Anc_5.119
           YGR212W
          Length = 470

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 101/506 (19%), Positives = 196/506 (38%), Gaps = 104/506 (20%)

Query: 20  RRLGHLENYFALCQRQNLYSNFSMFCALSNSCTPSQFAAALRAICVEHPILVHTVTPKNW 79
           R L  LEN+F      NL+S F +   L+      Q   AL+     +P L   +T KN 
Sbjct: 5   RELSSLENFFYHRSEVNLHSCFYLALLLNALPAKKQLYKALQDTIATYPQLHQNIT-KN- 62

Query: 80  PNHMEYYASEEFVNNPVLEHEKMRLLERVDLSDIVMNEQDEYSETVSKILAEFAQNGGIY 139
               EY   E+    P            ++  D+V                EF       
Sbjct: 63  -KEDEYLYVEDIKKTP------------IEFEDVV----------------EFVAWEKFE 93

Query: 140 TREIFDIIATVRIPYGDPTKPNWRFLCIPEKSGPNWNKFIFISNHCSMDGTSASNLFRDI 199
            +EI  I  T    Y +  +P W+ L +     P+ N FI + +H   DG SA  ++   
Sbjct: 94  EKEINSIFQTYNFHYRN-DRPLWKILVV-----PSLNTFILLLDHALFDGISAVKIWETF 147

Query: 200 CTQLNDLSMKEDKSNLVFDYALDCDSLKKL----------PSPIDERIE---YRPPLSYF 246
             +LN  S  E+    V  Y  + +    L          P PI  +++        +++
Sbjct: 148 MEKLNKSSEIENIDVTVPLYIPEENHEGTLVASQHPYDIWPVPIAWKVKSFIATKLFNWY 207

Query: 247 PQ-----------FLGSNFVRKHIG-YHSNGPLVSRVDALDEGTACYTEFLNLTSQQMKE 294
           PQ           F G  F    +  Y  +G  V+     ++ T    + + +   +++ 
Sbjct: 208 PQAIISPNSNLFEFKGYKFPEGFLSQYPKDG--VTSFKVRNDNTQ---KLIKMAPGKLET 262

Query: 295 VKKKLKSKAPQCTMTPFLQACLLVSMYD-SGKVFTGSMREWFFDVVIPMNTVQLLPDDGE 353
           + K  K+ A   ++T ++ A +++++ + + + +TG++      V IP+NT  +  +   
Sbjct: 263 ILKNCKTNA--VSLTSYIVAIIIIALRNVTQESYTGNL----LKVSIPINTRNICANQVN 316

Query: 354 V-QSMYKYGSNIGGSRYNYLISSFNVGHEEEAFWNLVDYYRIVFESAREKNHYLYPLGAL 412
             + M + G+ +G   + + I+S      +   W++          AR+   ++     +
Sbjct: 317 TPEEMLQLGNFVGSMDFEHPINS------DSGIWDI----------ARDVQQFITKNTTV 360

Query: 413 -MMDAVCQKSNVDKLVVDDLIGK--------PREGAVFSNLGFISQE---IDNKIYYMND 460
            + D +     +D +  ++ + K        P      +NLGF S +   +++  Y++ D
Sbjct: 361 GISDIINNIKLLDGINCEEFVKKKIEFSSNGPASTFEVTNLGFQSFKGSCMESSSYFIKD 420

Query: 461 LVFSQTLGSLRHGFTLSSCTIEKAGM 486
            VF++  G +   FT S  +    G+
Sbjct: 421 AVFNEPQG-MSDIFTCSVISTPIGGL 445

>KLTH0C02178g Chr3 complement(196605..197999) [1395 bp, 464 aa] {ON}
           weakly similar to uniprot|P53304 Saccharomyces
           cerevisiae YGR212W SLI1 N-acetyltransferase confers
           resistance to the sphingolipid biosynthesis inhibitor
           myriocin (ISP-1) by inactivating it co-operates with
           Ypk1p in mediating resistance to myriocin converts
           myriocin into N-acetyl-myriocin
          Length = 464

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 51/186 (27%), Positives = 78/186 (41%), Gaps = 40/186 (21%)

Query: 19  VRRLGHLENYFALCQRQNLYSNFSMFCALSNSCTPSQFAAALRAICVEHPILVHTVTPKN 78
           ++ L  LE +F    +Q L+S F +   L+ S T S+   A+RA+  E+P L   V  +N
Sbjct: 1   MKSLSGLEEFFYYRSKQGLHSCFVVAITLNKSPTRSEIVQAVRAVVPEYPQLYSDVVTRN 60

Query: 79  WPNHMEYYASEEFVNNPVLEHEKMRLLERVDLSDIVMNEQDEYSETVSKILAEFAQNGGI 138
                          + VLE  +  L+    LSD+V     E++E  S  L E   N   
Sbjct: 61  --------------GSLVLEPLQSTLV----LSDVV-----EFTEMES--LDEEHSN--- 92

Query: 139 YTREIFDIIATVRIPYGDPTKPNWRFLCIPEKSGPNWNKFIFISNHCSMDGTSASNLFRD 198
                  I   V   YG   KP W+ L + ++       F+  S+H  +DG SA+  +  
Sbjct: 93  ------KIFKEVTFVYG-AEKPLWKVLILKDQ-----RTFVLCSDHLILDGLSATVFWGS 140

Query: 199 ICTQLN 204
               LN
Sbjct: 141 FMRSLN 146

>YGR212W Chr7 (917040..918446) [1407 bp, 468 aa] {ON}
           SLI1N-acetyltransferase, confers resistance to the
           sphingolipid biosynthesis inhibitor myriocin (ISP-1) by
           converting it into N-acetyl-myriocin, co-operates with
           Ypk1p in mediating resistance to myriocin
          Length = 468

 Score = 43.9 bits (102), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 93/412 (22%), Positives = 164/412 (39%), Gaps = 91/412 (22%)

Query: 21  RLGHLENYFALCQRQNLYSNFSMFCALSNSCTPSQFAAALRAICVEHPILVHTVTPKNWP 80
           +L  +E+YF    R NL+S F +   L+     SQ  AAL+   ++H  L   V      
Sbjct: 4   KLSAIESYFFHRSRLNLHSCFYVGIKLNELPKKSQLIAALKYTVIQHERLTCNV------ 57

Query: 81  NHMEYYASEEFVNNPVLEHEKMRLLERVDLSDIV--MNEQDEYSETVSKILAEFAQNGGI 138
              +    E F+ N         +LE +   D+V   ++ D+  ET              
Sbjct: 58  -FYDELKKENFLQN---------ILEPLKFCDLVEYRHDWDQLGET-------------- 93

Query: 139 YTREIFDIIATVRIPYGDPTKPNWRFLCIPEKSGPNWNKFIFISNHCSMDGTSASNLFRD 198
              EI  I       Y +  KP W+ L +     PN N+ + +++H  MDG SA +++  
Sbjct: 94  ---EINHIFQRYNFSYNE-NKPLWKILIL-----PNQNQMLLLTDHVLMDGMSAIHVWE- 143

Query: 199 ICTQLNDLSMKE--DKSNLVFDYALDCDSLKKLPSPI--DERIEY-----RPPLS----Y 245
             T +  L M++  +    ++  +L+  + K + +P+  D  I +     R  +S    +
Sbjct: 144 --TFMEGLQMQQPVEIDETIYSPSLNSSTEKIMSAPLYGDWPIPWNWHIVRQLVSRLHYW 201

Query: 246 FPQFLGSNFVRKHIGYHSNG-PLVSRVDALDEGTACYT--------EFLNLTSQQMKEVK 296
           FPQ +  N  R  I + +   P     D   +GT  Y         EF  L+   + ++ 
Sbjct: 202 FPQTVVKN-NRNLIQFANYSFPKDLLDDKPSDGTQKYKVKNTNHQWEF-RLSPTHLNDIL 259

Query: 297 KKLKSKAPQCTMTPFLQACLLVSMYD-SGKVFTGSMREWFFDVVIPMNT------VQLLP 349
           +  + KA   ++T  L A +  S    +   +TGS    F  + +PMN       V  LP
Sbjct: 260 Q--ECKANNTSLTSLLGALVCTSFEKIAAHEYTGS----FLKIELPMNIRKPFERVLKLP 313

Query: 350 DDGEVQSMYKYGSNIGGSRYNYLISSFNVGHEEEAFWNLVDYYRIVFESARE 401
            D ++      G+ I    +N+ +      H+    W++    +    S+ E
Sbjct: 314 SDDKL----AVGNFIAVIEFNHKL------HQNRGIWDIASQIQRAIRSSSE 355

>NCAS0A07390 Chr1 (1463090..1464526) [1437 bp, 478 aa] {ON}
           Anc_5.119 YGR212W
          Length = 478

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 77/353 (21%), Positives = 134/353 (37%), Gaps = 74/353 (20%)

Query: 19  VRRLGHLENYFALCQRQNLYSNFSMFCALSNSCTPSQFAAALRAICVEHPILVHTVTPKN 78
           VR+L  LE++F    R NL+S F +   L+      Q   +L+A   ++P L + +T K 
Sbjct: 3   VRKLTSLEDFFCERSRLNLHSCFYLAVELNRLPNKQQLFKSLKAPIAKYPQLHYNITTKE 62

Query: 79  WPNHMEYYASEEFVNNPVLEHEKMRLLERVDLSDIVMNEQDEYSETVSKILAEFAQNGGI 138
                + Y  E  + +P+             L D+      EY E       +FA++   
Sbjct: 63  --TSGDIYIKE--IESPIF------------LEDVC-----EYKE-----WEQFAED--- 93

Query: 139 YTREIFDIIATVRIPYGDPTKPNWRFLCIPEKSGPNWNKFIFISNHCSMDGTSASNLFRD 198
              EI  I  +    Y D   P W+ L IP K        + + +H   DG SA   +  
Sbjct: 94  ---EINSIFQSYNFQY-DQDTPLWKILLIPSK-----RIMVLLIDHVLFDGMSAVKFWEC 144

Query: 199 ICTQLNDLSMKEDKSNLVFDYAL------------DCDSLKKLPSPIDERIEYR------ 240
               L+ +S++  + + + +  L               + +  P P   +I+ R      
Sbjct: 145 FVGSLS-MSVESTEDDKILEMPLFQHEQANKTQSASSHAYESWPIPWSWKIKRRIAAMLW 203

Query: 241 ---------PPLSYFPQFLGSNFVRKHIGYHSNGPLVSRVDALDEGTACYTEFLNLTSQQ 291
                    PP + F QF   +F    +  + N    S    +      +T  LN+ +  
Sbjct: 204 NWYPSAILAPPSNLF-QFKKYSFPDGLLRQYPNDTSNSTGYVVRNDNRQWT--LNVPTNS 260

Query: 292 MKEVKKKLKSKAPQCTMTPFLQACLLVSMYDSGKVFTGSMREWFFDVVIPMNT 344
           ++++ K  K      ++T FL   + +++   GK  + S       V IPMNT
Sbjct: 261 LQKILKSCKEN--NVSLTSFLVGLMTIAL---GKCNSDSYSGDIVSVGIPMNT 308

>TDEL0E05110 Chr5 (941876..943285) [1410 bp, 469 aa] {ON} Anc_5.119
           YGR212W
          Length = 469

 Score = 37.7 bits (86), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 107/492 (21%), Positives = 179/492 (36%), Gaps = 85/492 (17%)

Query: 20  RRLGHLENYFALCQRQNLYSNFSMFCALSNSCTPSQFAAALRAICVEHPILVHTVTPKNW 79
           R+L  LE +F    R NL+S F +   L+      Q A ALR+    HP L   V     
Sbjct: 5   RKLSSLERFFYDRSRLNLHSCFFLGLQLNQLPDKHQIAHALRSTIANHPKLHQNV----- 59

Query: 80  PNHMEYYASEEFVNNPVLEHEKMRLLERVDLSDIVMNEQDEYSETVSKILAEFAQNGGIY 139
                  A +   N P +++     ++ +   D+V                E+    G  
Sbjct: 60  -------AIDPEDNIPYIKN-----VDTIKFDDVV----------------EYVSWDGFD 91

Query: 140 TREIFDIIATVRIPYGDPTKPNWRFLCIPEKSGPNWNKFIFISNHCSMDGTSASNLFRDI 199
              I  I  T   PY +  KP W+ L   ++     N+ + + +H   DG SA   ++  
Sbjct: 92  DNTICHIFQTYNFPY-NIEKPLWKVLVYAKE-----NRLLLLLDHALFDGMSAVIFWKSF 145

Query: 200 CTQLNDLSMKEDKSNLVFDYALDCDSLKKLPSPIDER--IEYRPPLS---------YFPQ 248
            + L+  S   D  +L+  Y L  D + +  S + E     +   L+         + P 
Sbjct: 146 MSSLS--SDARDDFDLL--YELTGDPMVQEDSHVYENWPTSWSSTLTKAIAGVIFKFMPS 201

Query: 249 FL---GSNFVRKHIGYHSNGPLVSRVDALDEGTACYTEFLNLTSQQMKEVKKKLKS--KA 303
            +   G + +R + GY     L++     D           L  Q   +    + S  K+
Sbjct: 202 VITSVGKDQLRFN-GYSFPDSLLTHKPDDDSSYEIRNNNRQLNLQVQPDHLNGIISACKS 260

Query: 304 PQCTMTPFLQACLLVSMYDSGKVFTGSMREWFFDVVIPMNT------VQLLPDDGEVQSM 357
            Q ++T F+ A  L+SM    K+  G        + IPMNT      V  +PD       
Sbjct: 261 HQVSLTSFITA--LISMSLQLKIEDGDYSGSKIMIDIPMNTRGACADVLDIPDTSVTMGN 318

Query: 358 YKYGSNIGGSRYNYLISSFNVGHEEEAFWNLVDYYRIVFESAREKNHYLYPLGALMMDAV 417
           +  G N+           +N+G  EE  W +    +    + + K   L  +  + +  V
Sbjct: 319 FVAGLNV----------EYNLGESEE-LWQIARTVQAAL-NKQTKTDILETVNKVRLLDV 366

Query: 418 CQKSNVDKLVVDDLIGKPREGAVFSNLGF--ISQEIDNKIYYMNDLVFSQTLGSLRHGFT 475
              +   +  V      P      +NLGF   +    N  Y + D VF++  G L   FT
Sbjct: 367 ADTTEFIRQKVK--ATGPSGTFEVTNLGFQEFADAQSNHGYLVEDAVFNEPQG-LSDIFT 423

Query: 476 LSSCTIEKAGMN 487
               +  + G+N
Sbjct: 424 CCIISTPRGGLN 435

>Smik_16.94 Chr16 complement(178129..179529) [1401 bp, 466 aa] {ON}
           YGR212W (REAL)
          Length = 466

 Score = 37.7 bits (86), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 80/360 (22%), Positives = 131/360 (36%), Gaps = 98/360 (27%)

Query: 21  RLGHLENYFALCQRQNLYSNFSMFCALSNSCTPSQFAAALRAICVEHPILVHTVTPKNWP 80
           RL  +E YF    + NL+S F +   L+          AL+    +H  L   V      
Sbjct: 4   RLSAIEGYFFHRSKLNLHSCFYVGVKLNKLPDTRHLITALKYTLTQHERLTCNV------ 57

Query: 81  NHMEYYASEEFVNNPVLEHEKMRLLERVD----LSDIVMNEQDEYSETVSKILAEFAQNG 136
               +Y           E E    L+ +D      DIV                E+  N 
Sbjct: 58  ----FYD----------ESENEYFLQNIDKPFKFGDIV----------------EYHHNW 87

Query: 137 GIYTR-EIFDIIATVRIPYGDPTKPNWRFLCIPEKSGPNWNKFIFISNHCSMDGTSASNL 195
              T  EI  I       Y +  KP W+ L IP     N N+ + +++H  MDG SA ++
Sbjct: 88  NHLTEVEINYIFQNYNFSYSE-HKPLWKLLIIP-----NQNQMLLLTDHVLMDGISAVHV 141

Query: 196 FRDICTQLNDLSMKEDKSNLVFDYALDCDSLKKLPSPIDERIEYRP-----PLS------ 244
           +      L +  ++E+++  V+   L         SP++E     P     P+       
Sbjct: 142 WETFMEGLQEQQLRENET--VYSPVL---------SPLNEEFILAPVYGDWPIPWNWHVI 190

Query: 245 ---------YFPQFLGSNFVRKHIGYHSN----------GPLVSRVDALDEGTACYTEFL 285
                    +FPQ + SN   K +   +N           P+        + T C+ EF 
Sbjct: 191 RQLASRLYYWFPQIIVSN--NKSLIQFANYTFPKDLLEDNPINESHTYKVKNTNCHWEF- 247

Query: 286 NLTSQQMKEVKKKLKSKAPQCTMTPFLQACLLVSMYDSG-KVFTGSMREWFFDVVIPMNT 344
            L+   +K + +  + K    ++T  L A +  S  ++    +TGS    F  + +PMNT
Sbjct: 248 QLSPAHLKTILQ--ECKIHNTSLTSLLGALVCKSFEETAVHDYTGS----FLKIELPMNT 301

>Skud_7.548 Chr7 (891732..893159) [1428 bp, 475 aa] {ON} YGR212W
           (REAL)
          Length = 475

 Score = 36.6 bits (83), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 42/178 (23%), Positives = 68/178 (38%), Gaps = 39/178 (21%)

Query: 21  RLGHLENYFALCQRQNLYSNFSMFCALSNSCTPSQFAAALRAICVEHPILVHTVTPKNWP 80
           +L  +E YF    + NL+S F +   L+      Q   AL++   +H  L   +      
Sbjct: 12  KLSAIEKYFFQRSQLNLHSCFYVGIKLNELPEKGQIITALKSTVAKHERLTFNLIYDKLN 71

Query: 81  N-HMEYYASEEFVNNPVLEHEKMRLLERVDLSDIVMNEQDEYSETVSKILAEFAQNGGIY 139
           N H    A+E FV   V+ +                ++ D   ET               
Sbjct: 72  NEHYLQNAAEPFVFGDVVAYH---------------HDWDHLKET--------------- 101

Query: 140 TREIFDIIATVRIPYGDPTKPNWRFLCIPEKSGPNWNKFIFISNHCSMDGTSASNLFR 197
             EI  I      PY +  KP W+ L IP +     N+ + +++H  MDG SA +++ 
Sbjct: 102 --EINHIFQEHNFPYSE-HKPLWKILIIPSQ-----NQMLLMTDHVLMDGMSAVHVWE 151

>AGR066W Chr7 (837181..841914) [4734 bp, 1577 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YDR127W (ARO1)
          Length = 1577

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 39/99 (39%), Gaps = 25/99 (25%)

Query: 104  LLERVDLSDIVMNEQDEYSETVS--KILAEFAQNGGIYTREIFDIIATVRIPYGDPTKP- 160
            +L +   S  V++      ET S  K+L +FA  GG+      DI  T++    DPT+P 
Sbjct: 946  VLNKYSRSGYVISTGGGIVETASSRKLLQDFAATGGVVLHLYRDIDETIKFLRTDPTRPA 1005

Query: 161  -------------NWRFLCIPEKSGPNWNKFIFISNHCS 186
                          W  LC         + + F S HCS
Sbjct: 1006 YIEEVRGVWDRREKWYHLC---------SSYSFFSPHCS 1035

>SAKL0E06710g Chr5 (548443..550347) [1905 bp, 634 aa] {ON} similar
           to uniprot|Q07528 Saccharomyces cerevisiae YDL113C ATG20
           Protein required for transport of aminopeptidase I
           (Lap4p) through the cytoplasm-to-vacuole targeting
           pathway binds phosphatidylinositol-3-phosphate involved
           in localization of membranes to the preautophagosome
           potential Cdc28p substrate
          Length = 634

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 26/47 (55%)

Query: 333 EWFFDVVIPMNTVQLLPDDGEVQSMYKYGSNIGGSRYNYLISSFNVG 379
           E    +++ +  + L+P   E QS+  YG +I GS+ NYL+ S   G
Sbjct: 197 ESLRKILVKLFPMTLIPPIPEKQSITSYGKSITGSKSNYLLPSEGAG 243

>SAKL0G01254g Chr7 complement(106478..108256) [1779 bp, 592 aa] {ON}
           similar to uniprot|P36150 Saccharomyces cerevisiae
           YKR069W MET1 S-adenosyl-L-methionine uroporphyrinogen
           III transmethylase
          Length = 592

 Score = 32.7 bits (73), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 42/166 (25%), Positives = 67/166 (40%), Gaps = 22/166 (13%)

Query: 88  SEEFVNNPVLEHEKMRLLER-VDLSDIVMNEQDEYSETVSKILAEFAQNGGIYTREIFDI 146
           S +F N P     K  LL+R   LSD+    +      V ++         +  REI+  
Sbjct: 58  SAKFANEP-----KFSLLDRCFQLSDLTTLGRPLVGRVVDRVFVNLPSEDSLLIREIYQQ 112

Query: 147 IATVRIPYGDPTKP---NWRFLCI---PEKSG-----PNWNKFIFISNHCSMDGTS--AS 193
              +RIP     +P   N+  +     P KSG         +   ++N    +  S   S
Sbjct: 113 CIKLRIPINTSQRPEFSNFNLISTYNDPAKSGLQIAVTTNGQGCLLANRIKREVISRLPS 172

Query: 194 NLFRDICT--QLNDLSMKEDKSNLVFDYALDCDSLKKLPSPIDERI 237
           N+ + +    QL D  + ED S L+  Y L+ D L+ L   +DE +
Sbjct: 173 NISQVVINMGQLRDRIINEDHSQLISTYYLNKD-LQDLGYGMDEDV 217

>ADL293W Chr4 (187231..188964) [1734 bp, 577 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL113C
          Length = 577

 Score = 32.3 bits (72), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 25/47 (53%)

Query: 333 EWFFDVVIPMNTVQLLPDDGEVQSMYKYGSNIGGSRYNYLISSFNVG 379
           E    ++I +  + L+P   E QS+  YG +I GS  NY++ S   G
Sbjct: 136 ESLRKILIKLFPMTLIPPIPEKQSLTSYGKSIAGSNANYVLPSEAAG 182

>SAKL0G15004g Chr7 (1288241..1289611) [1371 bp, 456 aa] {ON} similar
           to uniprot|P53304 Saccharomyces cerevisiae YGR212W SLI1
           N-acetyltransferase confers resistance to the
           sphingolipid biosynthesis inhibitor myriocin (ISP-1) by
           inactivating it co-operates with Ypk1p in mediating
           resistance to myriocin converts myriocin into N-acetyl-
           myriocin
          Length = 456

 Score = 31.2 bits (69), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 46/199 (23%), Positives = 81/199 (40%), Gaps = 40/199 (20%)

Query: 19  VRRLGHLENYFALCQRQNLYSNFSMFCALSNSCTPSQFAAALRAICVEHPILVHTVTPKN 78
           +RRL   E YF   QR+NL  +   + A++ + +PS+             +L H +T K 
Sbjct: 1   MRRLSSFEEYFY--QRRNLNLHSCFYLAITLNESPSR------------ELLSHVIT-KV 45

Query: 79  WPNHMEYYASEEFVNNPVLEHEKMRLLERVDLSDIVMNEQDEYSETVSKILAEFAQNGGI 138
            P + + Y+      N  L+ EK  +++ ++ S I  N+           + E+ Q   +
Sbjct: 46  IPRYPQLYS------NVFLQDEK-PIVKPIE-SFIYFND-----------VVEYMQEEQL 86

Query: 139 YTREIFDIIATVRIPYGDPTKPNWRFLCIPEKSGPNWNKFIFISNHCSMDGTSASNLFRD 198
               I  I  TV+  Y D   P W+ L +    G      +    H   DG S      +
Sbjct: 87  TEELINQIFRTVKFKYHDDV-PIWKILAL--NGG---RSLVLCLEHLFFDGLSGVKFLEN 140

Query: 199 ICTQLNDLSMKEDKSNLVF 217
           I  +LN +    +  ++V+
Sbjct: 141 IMEELNTIECFSNYQDIVY 159

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.136    0.413 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 57,095,945
Number of extensions: 2572506
Number of successful extensions: 6566
Number of sequences better than 10.0: 36
Number of HSP's gapped: 6583
Number of HSP's successfully gapped: 36
Length of query: 517
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 403
Effective length of database: 40,409,475
Effective search space: 16285018425
Effective search space used: 16285018425
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 68 (30.8 bits)