Re-run this search with the SEG filter switched off

Re-run this search as BLASTP i.e. protein query (default)

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_56.223626.13ON49349325000.0
KLTH0C11462g6.13ON49249222980.0
SAKL0E00946g6.13ON49348822350.0
Ecym_30166.13ON48947221660.0
TDEL0G045806.13ON48447320960.0
KLLA0D00902g6.13ON49246120950.0
Kpol_1032.46.13ON46746020670.0
ACR013C6.13ON48848320500.0
CAGL0A01045g6.13ON48347720320.0
Smik_6.4706.13ON48848719770.0
Kpol_1045.766.13ON48546019760.0
YPL262W (FUM1)6.13ON48846519690.0
TPHA0J002706.13ON49646119640.0
Skud_16.166.13ON48846519630.0
NCAS0D026206.13ON49348019620.0
ZYRO0C07964g6.13ON50547719590.0
Suva_16.436.13ON48849219440.0
KNAG0E027506.13ON49848219220.0
KAFR0B065206.13ON49546918980.0
NDAI0I024706.13ON47547118840.0
TBLA0G010006.13ON46545918540.0
TBLA0A071306.13ON50046218160.0
YLR359W (ADE13)4.197ON4823211189e-06
Smik_12.4464.197ON4823211171e-05
Suva_10.4594.197ON4821811152e-05
CAGL0B02794g4.197ON4821811143e-05
KLLA0A08404g1.354ON4612261125e-05
Skud_12.4434.197ON4823211125e-05
Skud_8.701.354ON4632241116e-05
Smik_8.831.354ON4632381108e-05
SAKL0D09746g1.354ON4642381108e-05
Suva_15.2011.354ON4632381091e-04
TPHA0B010404.197ON4821811072e-04
NDAI0J019504.197ON4823151072e-04
YHR018C (ARG4)1.354ON4632381053e-04
Kwal_47.180664.197ON4823121053e-04
TBLA0A083204.197ON4822641053e-04
NCAS0J012004.197ON4823131045e-04
ZYRO0G00748g1.354ON4622261036e-04
TBLA0F034801.354ON4662151028e-04
KAFR0A062304.197ON4821811028e-04
KNAG0I015601.354ON4622261010.001
KNAG0B058404.197ON4821791010.001
Ecym_27491.354ON4702861000.001
ZYRO0B07964g4.197ON4821811000.001
Kpol_1042.164.197ON4821811000.001
Kpol_1018.1251.354ON460238990.002
Ecym_24524.197ON482187990.002
KLLA0B13189g4.197ON482181990.002
TDEL0D022201.354ON465225980.002
AEL019W1.354ON469217970.003
SAKL0B04972g4.197ON482179940.007
TPHA0A021901.354ON463238890.029
ABL006C4.197ON482185890.030
TDEL0E017604.197ON482179880.039
KLTH0A03344g4.197ON482179850.090
Kwal_27.127821.354ON465261820.20
KLTH0G19338g1.354ON465257820.20
Suva_4.4946.148ON85092800.41
Ecym_63581.256ON84889761.2
KNAG0D034804.117ON116272761.3
TDEL0G04710na 1ON40653723.1
Suva_4.2233.167ON61669714.6
KLTH0E14586g3.321ON1365219706.7
AGL217W8.808ON41461697.2
BLASTX 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Kwal_56.22362
         (1482 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_56.22362 s56 (65537..67018) [1482 bp, 493 aa] {ON} YPL262W ...   967   0.0  
KLTH0C11462g Chr3 complement(942263..943741) [1479 bp, 492 aa] {...   889   0.0  
SAKL0E00946g Chr5 (72220..73701) [1482 bp, 493 aa] {ON} highly s...   865   0.0  
Ecym_3016 Chr3 (30897..32366) [1470 bp, 489 aa] {ON} similar to ...   838   0.0  
TDEL0G04580 Chr7 complement(836367..837821) [1455 bp, 484 aa] {O...   811   0.0  
KLLA0D00902g Chr4 (83648..85126) [1479 bp, 492 aa] {ON} highly s...   811   0.0  
Kpol_1032.4 s1032 (3761..5164) [1404 bp, 467 aa] {ON} (3761..516...   800   0.0  
ACR013C Chr3 complement(381119..382585) [1467 bp, 488 aa] {ON} S...   794   0.0  
CAGL0A01045g Chr1 complement(104865..106316) [1452 bp, 483 aa] {...   787   0.0  
Smik_6.470 Chr6 complement(772380..773846) [1467 bp, 488 aa] {ON...   766   0.0  
Kpol_1045.76 s1045 complement(177447..178904) [1458 bp, 485 aa] ...   765   0.0  
YPL262W Chr16 (47336..48802) [1467 bp, 488 aa] {ON}  FUM1Fumaras...   763   0.0  
TPHA0J00270 Chr10 (61961..63451) [1491 bp, 496 aa] {ON} Anc_6.13...   761   0.0  
Skud_16.16 Chr16 (26407..27873) [1467 bp, 488 aa] {ON} YPL262W (...   760   0.0  
NCAS0D02620 Chr4 complement(504150..505631) [1482 bp, 493 aa] {O...   760   0.0  
ZYRO0C07964g Chr3 complement(607609..609126) [1518 bp, 505 aa] {...   759   0.0  
Suva_16.43 Chr16 (62871..64337) [1467 bp, 488 aa] {ON} YPL262W (...   753   0.0  
KNAG0E02750 Chr5 (547746..549242) [1497 bp, 498 aa] {ON} Anc_6.1...   744   0.0  
KAFR0B06520 Chr2 (1352364..1353851) [1488 bp, 495 aa] {ON} Anc_6...   735   0.0  
NDAI0I02470 Chr9 complement(567782..569209) [1428 bp, 475 aa] {O...   730   0.0  
TBLA0G01000 Chr7 (252070..253467) [1398 bp, 465 aa] {ON} Anc_6.1...   718   0.0  
TBLA0A07130 Chr1 (1770536..1772038) [1503 bp, 500 aa] {ON} Anc_6...   704   0.0  
YLR359W Chr12 (844282..845730) [1449 bp, 482 aa] {ON}  ADE13Aden...    50   9e-06
Smik_12.446 Chr12 (783341..784789) [1449 bp, 482 aa] {ON} YLR359...    50   1e-05
Suva_10.459 Chr10 (803809..805257) [1449 bp, 482 aa] {ON} YLR359...    49   2e-05
CAGL0B02794g Chr2 complement(269303..270751) [1449 bp, 482 aa] {...    49   3e-05
KLLA0A08404g Chr1 complement(743192..744577) [1386 bp, 461 aa] {...    48   5e-05
Skud_12.443 Chr12 (784448..785896) [1449 bp, 482 aa] {ON} YLR359...    48   5e-05
Skud_8.70 Chr8 complement(121600..122991) [1392 bp, 463 aa] {ON}...    47   6e-05
Smik_8.83 Chr8 complement(120320..121711) [1392 bp, 463 aa] {ON}...    47   8e-05
SAKL0D09746g Chr4 complement(808721..810115) [1395 bp, 464 aa] {...    47   8e-05
Suva_15.201 Chr15 complement(348498..349889) [1392 bp, 463 aa] {...    47   1e-04
TPHA0B01040 Chr2 complement(235467..236915) [1449 bp, 482 aa] {O...    46   2e-04
NDAI0J01950 Chr10 (485753..487201) [1449 bp, 482 aa] {ON} Anc_4....    46   2e-04
YHR018C Chr8 complement(140011..141402) [1392 bp, 463 aa] {ON}  ...    45   3e-04
Kwal_47.18066 s47 (668459..669907) [1449 bp, 482 aa] {ON} YLR359...    45   3e-04
TBLA0A08320 Chr1 complement(2043721..2045169) [1449 bp, 482 aa] ...    45   3e-04
NCAS0J01200 Chr10 (209722..211170) [1449 bp, 482 aa] {ON} Anc_4....    45   5e-04
ZYRO0G00748g Chr7 (57164..58552) [1389 bp, 462 aa] {ON} highly s...    44   6e-04
TBLA0F03480 Chr6 (857021..858421) [1401 bp, 466 aa] {ON} Anc_1.3...    44   8e-04
KAFR0A06230 Chr1 complement(1257709..1259157) [1449 bp, 482 aa] ...    44   8e-04
KNAG0I01560 Chr9 (303704..305092) [1389 bp, 462 aa] {ON} Anc_1.3...    44   0.001
KNAG0B05840 Chr2 (1150025..1151473) [1449 bp, 482 aa] {ON} Anc_4...    44   0.001
Ecym_2749 Chr2 complement(1453019..1454431) [1413 bp, 470 aa] {O...    43   0.001
ZYRO0B07964g Chr2 complement(620761..622209) [1449 bp, 482 aa] {...    43   0.001
Kpol_1042.16 s1042 (40749..42197) [1449 bp, 482 aa] {ON} (40749....    43   0.001
Kpol_1018.125 s1018 complement(330965..332347) [1383 bp, 460 aa]...    43   0.002
Ecym_2452 Chr2 (881643..883091) [1449 bp, 482 aa] {ON} similar t...    43   0.002
KLLA0B13189g Chr2 complement(1153780..1155228) [1449 bp, 482 aa]...    43   0.002
TDEL0D02220 Chr4 (428430..429827) [1398 bp, 465 aa] {ON} Anc_1.3...    42   0.002
AEL019W Chr5 (600410..601819) [1410 bp, 469 aa] {ON} Syntenic ho...    42   0.003
SAKL0B04972g Chr2 (430349..431797) [1449 bp, 482 aa] {ON} highly...    41   0.007
TPHA0A02190 Chr1 (452902..454293) [1392 bp, 463 aa] {ON} Anc_1.3...    39   0.029
ABL006C Chr2 complement(385134..386582) [1449 bp, 482 aa] {ON} S...    39   0.030
TDEL0E01760 Chr5 complement(337315..338763) [1449 bp, 482 aa] {O...    39   0.039
KLTH0A03344g Chr1 (289188..290636) [1449 bp, 482 aa] {ON} highly...    37   0.090
Kwal_27.12782 s27 complement(1373166..1374563) [1398 bp, 465 aa]...    36   0.20 
KLTH0G19338g Chr7 complement(1665123..1666520) [1398 bp, 465 aa]...    36   0.20 
Suva_4.494 Chr4 (862220..864772) [2553 bp, 850 aa] {ON} YBR237W ...    35   0.41 
Ecym_6358 Chr6 complement(694398..696944) [2547 bp, 848 aa] {ON}...    34   1.2  
KNAG0D03480 Chr4 complement(625236..628724) [3489 bp, 1162 aa] {...    34   1.3  
TDEL0G04710 Chr7 (860069..861289) [1221 bp, 406 aa] {ON}               32   3.1  
Suva_4.223 Chr4 complement(395869..397719) [1851 bp, 616 aa] {ON...    32   4.6  
KLTH0E14586g Chr5 (1293773..1297870) [4098 bp, 1365 aa] {ON} wea...    32   6.7  
AGL217W Chr7 (290043..291287) [1245 bp, 414 aa] {ON} Syntenic ho...    31   7.2  

>Kwal_56.22362 s56 (65537..67018) [1482 bp, 493 aa] {ON} YPL262W
            (FUM1) - mitochondrial and cytoplasmic fumarase (fumarate
            hydralase) [contig 186] FULL
          Length = 493

 Score =  967 bits (2500), Expect = 0.0
 Identities = 493/493 (100%), Positives = 493/493 (100%)
 Frame = +1

Query: 1    MFKVTTEAANKALISGSKARLISTSSSLGQKYRVETDAFGEIKVPTDKLWGAQTQRSLEN 180
            MFKVTTEAANKALISGSKARLISTSSSLGQKYRVETDAFGEIKVPTDKLWGAQTQRSLEN
Sbjct: 1    MFKVTTEAANKALISGSKARLISTSSSLGQKYRVETDAFGEIKVPTDKLWGAQTQRSLEN 60

Query: 181  FKIGGQRERMPEPIVKAFGILKKSAAIVNESLGTLDPKVSKPIQDAADEVISGKLIDHFP 360
            FKIGGQRERMPEPIVKAFGILKKSAAIVNESLGTLDPKVSKPIQDAADEVISGKLIDHFP
Sbjct: 61   FKIGGQRERMPEPIVKAFGILKKSAAIVNESLGTLDPKVSKPIQDAADEVISGKLIDHFP 120

Query: 361  LVVFQTGSGTQSNMNANEVISNRAIQLVGGEVGSKSIHPNNHCNQAQSSNDTFPSVMHIA 540
            LVVFQTGSGTQSNMNANEVISNRAIQLVGGEVGSKSIHPNNHCNQAQSSNDTFPSVMHIA
Sbjct: 121  LVVFQTGSGTQSNMNANEVISNRAIQLVGGEVGSKSIHPNNHCNQAQSSNDTFPSVMHIA 180

Query: 541  AVTEVTHLLLPELIALRDAFAKKAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNG 720
            AVTEVTHLLLPELIALRDAFAKKAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNG
Sbjct: 181  AVTEVTHLLLPELIALRDAFAKKAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNG 240

Query: 721  ISRVEHSLHNLKFLAQGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAH 900
            ISRVEHSLHNLKFLAQGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAH
Sbjct: 241  ISRVEHSLHNLKFLAQGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAH 300

Query: 901  DAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 1080
            DAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE
Sbjct: 301  DAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 360

Query: 1081 AMTQVCVQVMGNNAAITFAGASGQFELNVFKPVMISNLLSSIRLLGDACYSFRVHCVEGI 1260
            AMTQVCVQVMGNNAAITFAGASGQFELNVFKPVMISNLLSSIRLLGDACYSFRVHCVEGI
Sbjct: 361  AMTQVCVQVMGNNAAITFAGASGQFELNVFKPVMISNLLSSIRLLGDACYSFRVHCVEGI 420

Query: 1261 QANEDKIAKLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLSSAEFD 1440
            QANEDKIAKLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLSSAEFD
Sbjct: 421  QANEDKIAKLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLSSAEFD 480

Query: 1441 EWVVPENMVGPKP 1479
            EWVVPENMVGPKP
Sbjct: 481  EWVVPENMVGPKP 493

>KLTH0C11462g Chr3 complement(942263..943741) [1479 bp, 492 aa] {ON}
            highly similar to uniprot|P08417 Saccharomyces cerevisiae
            YPL262W FUM1 Fumarase converts fumaric acid to L-malic
            acid in the TCA cycle cytosolic and mitochondrial
            localization determined by the N-terminal mitochondrial
            targeting sequence and protein conformation
          Length = 492

 Score =  889 bits (2298), Expect = 0.0
 Identities = 445/492 (90%), Positives = 470/492 (95%)
 Frame = +1

Query: 1    MFKVTTEAANKALISGSKARLISTSSSLGQKYRVETDAFGEIKVPTDKLWGAQTQRSLEN 180
            MFK+T E ANK+L    K RLISTSS++ QK RVETDAFGEI VP DK WGAQTQRSLEN
Sbjct: 1    MFKLTAEVANKSLSGSPKTRLISTSSAISQKCRVETDAFGEINVPADKYWGAQTQRSLEN 60

Query: 181  FKIGGQRERMPEPIVKAFGILKKSAAIVNESLGTLDPKVSKPIQDAADEVISGKLIDHFP 360
            FKIGG RERMPEP+V+AFGILKKSAAIVNESLGTLDPK+SKPIQ AADEVISGKL+DHFP
Sbjct: 61   FKIGGARERMPEPVVRAFGILKKSAAIVNESLGTLDPKISKPIQQAADEVISGKLVDHFP 120

Query: 361  LVVFQTGSGTQSNMNANEVISNRAIQLVGGEVGSKSIHPNNHCNQAQSSNDTFPSVMHIA 540
            LVVFQTGSGTQSNMNANEVISNRAI++VGG++G+KSIHPNNHCNQAQSSNDTFPSVMHIA
Sbjct: 121  LVVFQTGSGTQSNMNANEVISNRAIEIVGGKMGTKSIHPNNHCNQAQSSNDTFPSVMHIA 180

Query: 541  AVTEVTHLLLPELIALRDAFAKKAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNG 720
            AVTE+TH LLPEL ALRD+FA K++EF+SIVKIGRTHLQDATPLTLGQEFSGYVQQLTNG
Sbjct: 181  AVTEITHSLLPELTALRDSFATKSKEFESIVKIGRTHLQDATPLTLGQEFSGYVQQLTNG 240

Query: 721  ISRVEHSLHNLKFLAQGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAH 900
            ISRVE SL +LKFLAQGGTAVGTGLNTKVGF EKIAEQVSKETGIDFKTAPNKFEALAAH
Sbjct: 241  ISRVEQSLIHLKFLAQGGTAVGTGLNTKVGFGEKIAEQVSKETGIDFKTAPNKFEALAAH 300

Query: 901  DAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 1080
            DA+VECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE
Sbjct: 301  DAIVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 360

Query: 1081 AMTQVCVQVMGNNAAITFAGASGQFELNVFKPVMISNLLSSIRLLGDACYSFRVHCVEGI 1260
            AMTQVCVQVMGNNAAITFAGASGQFELNVFKPVMISNLLSS+RLLGDACYSFRVHCV+GI
Sbjct: 361  AMTQVCVQVMGNNAAITFAGASGQFELNVFKPVMISNLLSSVRLLGDACYSFRVHCVDGI 420

Query: 1261 QANEDKIAKLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLSSAEFD 1440
            +AN DKIAKLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALEL VL+SAEFD
Sbjct: 421  EANRDKIAKLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELKVLTSAEFD 480

Query: 1441 EWVVPENMVGPK 1476
            +WVVPENMVGPK
Sbjct: 481  QWVVPENMVGPK 492

>SAKL0E00946g Chr5 (72220..73701) [1482 bp, 493 aa] {ON} highly
            similar to uniprot|P08417 Saccharomyces cerevisiae
            YPL262W FUM1 Fumarase converts fumaric acid to L-malic
            acid in the TCA cycle cytosolic and mitochondrial
            localization determined by the N-terminal mitochondrial
            targeting sequence and protein conformation
          Length = 493

 Score =  865 bits (2235), Expect = 0.0
 Identities = 431/488 (88%), Positives = 460/488 (94%), Gaps = 1/488 (0%)
 Frame = +1

Query: 16   TEAANKALISGSKARLISTSSSLGQ-KYRVETDAFGEIKVPTDKLWGAQTQRSLENFKIG 192
            T AAN+ L+  S  R++STSSSL Q KYR+ETDAFGEIKVP DK WGAQTQRS ENFKIG
Sbjct: 5    TAAANRNLLPSSSIRMLSTSSSLAQQKYRIETDAFGEIKVPADKYWGAQTQRSFENFKIG 64

Query: 193  GQRERMPEPIVKAFGILKKSAAIVNESLGTLDPKVSKPIQDAADEVISGKLIDHFPLVVF 372
            G RERMPE +V+AFG+LKKSAAIVNESLGTLDP++SKPIQ AADEVI GKL+DHFPLVVF
Sbjct: 65   GARERMPEAVVRAFGVLKKSAAIVNESLGTLDPEISKPIQKAADEVIQGKLMDHFPLVVF 124

Query: 373  QTGSGTQSNMNANEVISNRAIQLVGGEVGSKSIHPNNHCNQAQSSNDTFPSVMHIAAVTE 552
            QTGSGTQSNMNANEVISNRAI+++GGE GSK +HPNNHCNQAQSSNDTFPSVMHIAAVTE
Sbjct: 125  QTGSGTQSNMNANEVISNRAIEIIGGEKGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTE 184

Query: 553  VTHLLLPELIALRDAFAKKAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRV 732
            +TH LLPEL ALRD+F KK+ EF SIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGI+RV
Sbjct: 185  ITHSLLPELTALRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIARV 244

Query: 733  EHSLHNLKFLAQGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAHDAVV 912
            E SLH+LKFLAQGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAHDAVV
Sbjct: 245  EQSLHHLKFLAQGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAHDAVV 304

Query: 913  ECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQ 1092
            ECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQ
Sbjct: 305  ECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQ 364

Query: 1093 VCVQVMGNNAAITFAGASGQFELNVFKPVMISNLLSSIRLLGDACYSFRVHCVEGIQANE 1272
            VCVQVMGNNAAITFAGASGQFELNVFKPVMISNLLSS+RLL DA YSFRVHCV+GI+ANE
Sbjct: 365  VCVQVMGNNAAITFAGASGQFELNVFKPVMISNLLSSVRLLADASYSFRVHCVDGIKANE 424

Query: 1273 DKIAKLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLSSAEFDEWVV 1452
            D+I+KLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESAL+LGVL+  EFDEWV+
Sbjct: 425  DRISKLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALQLGVLNEKEFDEWVI 484

Query: 1453 PENMVGPK 1476
            PE M+GPK
Sbjct: 485  PEKMIGPK 492

>Ecym_3016 Chr3 (30897..32366) [1470 bp, 489 aa] {ON} similar to
            Ashbya gossypii ACR013C
          Length = 489

 Score =  838 bits (2166), Expect = 0.0
 Identities = 414/472 (87%), Positives = 444/472 (94%)
 Frame = +1

Query: 58   RLISTSSSLGQKYRVETDAFGEIKVPTDKLWGAQTQRSLENFKIGGQRERMPEPIVKAFG 237
            R++ST++ L QK+R+ETDAFGEIKVP +K WGAQTQRSLENFKIGG RERMPEPI+KAFG
Sbjct: 16   RMMSTTAGLNQKFRIETDAFGEIKVPANKYWGAQTQRSLENFKIGGPRERMPEPIIKAFG 75

Query: 238  ILKKSAAIVNESLGTLDPKVSKPIQDAADEVISGKLIDHFPLVVFQTGSGTQSNMNANEV 417
            ILKKSAAIVNESLGTLDPK+SKPIQ AADEVI GKL+DHFPLVVFQTGSGTQSNMNANEV
Sbjct: 76   ILKKSAAIVNESLGTLDPKISKPIQQAADEVIEGKLLDHFPLVVFQTGSGTQSNMNANEV 135

Query: 418  ISNRAIQLVGGEVGSKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEVTHLLLPELIALRDA 597
            ISNRAI+L+GGE+G+K IHPNNHCNQAQSSNDTFPSVMHIAAVTE+T+ LLPEL ALRD+
Sbjct: 136  ISNRAIELIGGELGTKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNTLLPELTALRDS 195

Query: 598  FAKKAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHSLHNLKFLAQGGT 777
            F KK +EF  IVKIGRTHLQDATPLTLGQEF GY QQ+TNGI+RVE SLH+LKFLAQGGT
Sbjct: 196  FQKKTEEFSHIVKIGRTHLQDATPLTLGQEFGGYTQQITNGITRVEQSLHHLKFLAQGGT 255

Query: 778  AVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTLACSLFK 957
            AVGTGLNTKVGFAEKIAEQVSKET I+FKTAPNKFEALAAHDAVVECSGALNT+ACSLFK
Sbjct: 256  AVGTGLNTKVGFAEKIAEQVSKETNIEFKTAPNKFEALAAHDAVVECSGALNTVACSLFK 315

Query: 958  IANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFA 1137
            IANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQ CVQVMGNN+ ITFA
Sbjct: 316  IANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQACVQVMGNNSTITFA 375

Query: 1138 GASGQFELNVFKPVMISNLLSSIRLLGDACYSFRVHCVEGIQANEDKIAKLLHESLMLVT 1317
            GASGQFELNVFKPVMISNLL+SIRLL DA YSFRVHCV+GI+ANEDKIAK+LHESLMLVT
Sbjct: 376  GASGQFELNVFKPVMISNLLNSIRLLADASYSFRVHCVDGIKANEDKIAKILHESLMLVT 435

Query: 1318 ALNPKIGYDAASKVAKNAHKKGITLKESALELGVLSSAEFDEWVVPENMVGP 1473
            ALNPKIGYD+A KVAKNAHKK ITLKESALELGVLS  EF EWVVPE M+GP
Sbjct: 436  ALNPKIGYDSACKVAKNAHKKNITLKESALELGVLSEEEFSEWVVPEKMIGP 487

>TDEL0G04580 Chr7 complement(836367..837821) [1455 bp, 484 aa] {ON}
            Anc_6.13 YPL262W
          Length = 484

 Score =  811 bits (2096), Expect = 0.0
 Identities = 403/473 (85%), Positives = 438/473 (92%)
 Frame = +1

Query: 61   LISTSSSLGQKYRVETDAFGEIKVPTDKLWGAQTQRSLENFKIGGQRERMPEPIVKAFGI 240
            ++  S+  GQ +RVETDAFGEIKV  D+ WGAQTQRSLENF+IGG RERMPEPIV+AFG+
Sbjct: 13   VVKMSTKAGQ-FRVETDAFGEIKVAADRYWGAQTQRSLENFRIGGPRERMPEPIVRAFGV 71

Query: 241  LKKSAAIVNESLGTLDPKVSKPIQDAADEVISGKLIDHFPLVVFQTGSGTQSNMNANEVI 420
            LKKSAA+VNESLGTLDPKV++PI+ AADEV  GKL  HFPLVVFQTGSGTQSNMNANEVI
Sbjct: 72   LKKSAAVVNESLGTLDPKVAEPIKQAADEVAQGKLTAHFPLVVFQTGSGTQSNMNANEVI 131

Query: 421  SNRAIQLVGGEVGSKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEVTHLLLPELIALRDAF 600
            SNRAI+L+GGE+GSK IHPNNHCNQAQSSNDTFPSVMHIAAVTE+T  LLPEL  LRD+ 
Sbjct: 132  SNRAIELIGGELGSKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITRHLLPELAHLRDSL 191

Query: 601  AKKAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHSLHNLKFLAQGGTA 780
              K++EF  IVKIGRTHLQDATPLTLGQEFSGYVQQ++NGI RVE SLH LK+LAQGGTA
Sbjct: 192  DAKSKEFSDIVKIGRTHLQDATPLTLGQEFSGYVQQVSNGIDRVEGSLHRLKYLAQGGTA 251

Query: 781  VGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTLACSLFKI 960
            VGTGLNTK+GFAEKIAEQVSKETG+DFKTAPNKFEALAAHDAVVE SGALNT+ACSLFKI
Sbjct: 252  VGTGLNTKIGFAEKIAEQVSKETGLDFKTAPNKFEALAAHDAVVEASGALNTVACSLFKI 311

Query: 961  ANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAG 1140
            A DIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEA+TQVCVQVMGNNAAITFAG
Sbjct: 312  AQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAG 371

Query: 1141 ASGQFELNVFKPVMISNLLSSIRLLGDACYSFRVHCVEGIQANEDKIAKLLHESLMLVTA 1320
            ASGQFELNVFKPVMISNLLSS+RLL DA YSFRVHCV+GI AN D+I KL+HESLMLVTA
Sbjct: 372  ASGQFELNVFKPVMISNLLSSVRLLADASYSFRVHCVDGIIANRDRIGKLMHESLMLVTA 431

Query: 1321 LNPKIGYDAASKVAKNAHKKGITLKESALELGVLSSAEFDEWVVPENMVGPKP 1479
            LNPKIGYDAASKVAKNAHKKGITLK+SAL+LGVL+ +EFDEWVVPENM+GPKP
Sbjct: 432  LNPKIGYDAASKVAKNAHKKGITLKQSALDLGVLTESEFDEWVVPENMIGPKP 484

>KLLA0D00902g Chr4 (83648..85126) [1479 bp, 492 aa] {ON} highly
            similar to uniprot|P08417 Saccharomyces cerevisiae
            YPL262W FUM1 Fumarase converts fumaric acid to L-malic
            acid in the TCA cycle cytosolic and mitochondrial
            localization determined by the N-terminal mitochondrial
            targeting sequence and protein conformation
          Length = 492

 Score =  811 bits (2095), Expect = 0.0
 Identities = 405/461 (87%), Positives = 435/461 (94%)
 Frame = +1

Query: 94   YRVETDAFGEIKVPTDKLWGAQTQRSLENFKIGGQRERMPEPIVKAFGILKKSAAIVNES 273
            YRVETDAFGEI+VP+DK WGAQTQRSL+NFKIGG RERMPEPIVKAFG+LKKSAA+VNE 
Sbjct: 31   YRVETDAFGEIQVPSDKYWGAQTQRSLQNFKIGGPRERMPEPIVKAFGVLKKSAAVVNER 90

Query: 274  LGTLDPKVSKPIQDAADEVISGKLIDHFPLVVFQTGSGTQSNMNANEVISNRAIQLVGGE 453
            LGTLDP+++KPI+ AADEV  GKL++HFPLVVFQTGSGTQSNMNANEVISNRAI+L+GGE
Sbjct: 91   LGTLDPEIAKPIKQAADEVAQGKLMEHFPLVVFQTGSGTQSNMNANEVISNRAIELIGGE 150

Query: 454  VGSKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEVTHLLLPELIALRDAFAKKAQEFDSIV 633
            +GSK IHPNNHCNQAQSSNDTFPSVMHIAAVTE+TH LLPEL  L+ A  +K+ EF  IV
Sbjct: 151  LGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEITHHLLPELEGLKVALKQKSDEFQHIV 210

Query: 634  KIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHSLHNLKFLAQGGTAVGTGLNTKVGF 813
            KIGRTHLQDATPLTLGQEFSGYVQQ+ NGI+RV+ SL++LKFLAQGGTAVGTGLNTKVGF
Sbjct: 211  KIGRTHLQDATPLTLGQEFSGYVQQVENGIARVKQSLYHLKFLAQGGTAVGTGLNTKVGF 270

Query: 814  AEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTLACSLFKIANDIRYLGSGP 993
            AE IAEQVSKETGIDFKTAPNKFEALAAHDAVVE SGALNTLA SLFKIANDIRYLGSGP
Sbjct: 271  AEDIAEQVSKETGIDFKTAPNKFEALAAHDAVVEASGALNTLAVSLFKIANDIRYLGSGP 330

Query: 994  RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFK 1173
            RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGN+AAITFAGASGQFELNVFK
Sbjct: 331  RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNHAAITFAGASGQFELNVFK 390

Query: 1174 PVMISNLLSSIRLLGDACYSFRVHCVEGIQANEDKIAKLLHESLMLVTALNPKIGYDAAS 1353
            PVMISNLLSSIRLLGDA  SFR+HCVEGI+ANED+IAKLLHESLMLVTALNPKIGYDAAS
Sbjct: 391  PVMISNLLSSIRLLGDASNSFRIHCVEGIKANEDRIAKLLHESLMLVTALNPKIGYDAAS 450

Query: 1354 KVAKNAHKKGITLKESALELGVLSSAEFDEWVVPENMVGPK 1476
            KVAKNAHKKGITLKESALEL VLSS EFD+WV+PE M+GPK
Sbjct: 451  KVAKNAHKKGITLKESALELKVLSSEEFDQWVIPEKMIGPK 491

>Kpol_1032.4 s1032 (3761..5164) [1404 bp, 467 aa] {ON} (3761..5164)
            [1404 nt, 468 aa]
          Length = 467

 Score =  800 bits (2067), Expect = 0.0
 Identities = 397/460 (86%), Positives = 427/460 (92%)
 Frame = +1

Query: 94   YRVETDAFGEIKVPTDKLWGAQTQRSLENFKIGGQRERMPEPIVKAFGILKKSAAIVNES 273
            +R+ETD FGEIKVP DK WGAQTQRS ENFKIGG RERMPEP+VKAFG+LKKSAAIVNE 
Sbjct: 7    FRLETDGFGEIKVPADKYWGAQTQRSYENFKIGGPRERMPEPVVKAFGVLKKSAAIVNEE 66

Query: 274  LGTLDPKVSKPIQDAADEVISGKLIDHFPLVVFQTGSGTQSNMNANEVISNRAIQLVGGE 453
             G LD  +SK IQ AADEVI GKL +HFPLVVFQTGSGTQSNMNANEVISNRAI+L GG 
Sbjct: 67   FGILDAGISKLIQQAADEVIEGKLNEHFPLVVFQTGSGTQSNMNANEVISNRAIELKGGI 126

Query: 454  VGSKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEVTHLLLPELIALRDAFAKKAQEFDSIV 633
            +GSK IHPNNHCN AQSSNDTFP+VMHIAAVTE+TH L+P++  L+DA A K++EF+ IV
Sbjct: 127  MGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTEITHHLIPKMTELKDALANKSKEFEHIV 186

Query: 634  KIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHSLHNLKFLAQGGTAVGTGLNTKVGF 813
            KIGRTHLQDATPLTLGQEFSGYVQQL NGI+R+EHSL NLKFLAQGGTAVGTGLNTK+GF
Sbjct: 187  KIGRTHLQDATPLTLGQEFSGYVQQLINGIARIEHSLINLKFLAQGGTAVGTGLNTKIGF 246

Query: 814  AEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTLACSLFKIANDIRYLGSGP 993
            AE+IAEQVSKETGI+FKTAPNKFEALAAHDA+VE SGALNT+ACSLFKIA DIRYLGSGP
Sbjct: 247  AERIAEQVSKETGIEFKTAPNKFEALAAHDAIVESSGALNTVACSLFKIAQDIRYLGSGP 306

Query: 994  RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFK 1173
            RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFK
Sbjct: 307  RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFK 366

Query: 1174 PVMISNLLSSIRLLGDACYSFRVHCVEGIQANEDKIAKLLHESLMLVTALNPKIGYDAAS 1353
            PVMISNLLSSIRLLGDAC+SF +HCVEGIQANEDKI KLLHESLMLVTALNPKIGYD+A+
Sbjct: 367  PVMISNLLSSIRLLGDACHSFTIHCVEGIQANEDKINKLLHESLMLVTALNPKIGYDSAT 426

Query: 1354 KVAKNAHKKGITLKESALELGVLSSAEFDEWVVPENMVGP 1473
            KVAKNAHKKGITLKESALELGVL+  EFDEWVVPE M+GP
Sbjct: 427  KVAKNAHKKGITLKESALELGVLTEDEFDEWVVPEKMLGP 466

>ACR013C Chr3 complement(381119..382585) [1467 bp, 488 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YPL262W
            (FUM1)
          Length = 488

 Score =  794 bits (2050), Expect = 0.0
 Identities = 390/483 (80%), Positives = 438/483 (90%)
 Frame = +1

Query: 28   NKALISGSKARLISTSSSLGQKYRVETDAFGEIKVPTDKLWGAQTQRSLENFKIGGQRER 207
            ++  +  S AR + +++   Q++RVETDAFGEI+VP DK WGAQTQRSLENF+IGG RER
Sbjct: 5    SRGCVGSSAARRLMSTAGAPQQFRVETDAFGEIRVPADKYWGAQTQRSLENFRIGGARER 64

Query: 208  MPEPIVKAFGILKKSAAIVNESLGTLDPKVSKPIQDAADEVISGKLIDHFPLVVFQTGSG 387
            MPEP+V+AFG+LKKSAA+VNE LGTL+P ++K IQ AADEV  G+L++HFPLVVFQTGSG
Sbjct: 65   MPEPVVRAFGVLKKSAAVVNEQLGTLEPGIAKAIQQAADEVAQGQLMEHFPLVVFQTGSG 124

Query: 388  TQSNMNANEVISNRAIQLVGGEVGSKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEVTHLL 567
            TQSNMNANEVISNRAI+L+GGE+GSK +HPNNHCNQAQSSNDTFPSVMHIAAVTE+T  L
Sbjct: 125  TQSNMNANEVISNRAIELLGGELGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITRSL 184

Query: 568  LPELIALRDAFAKKAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHSLH 747
            LPEL ALR +F +K  EF  IVKIGRTHLQDATPLTLGQEFSGY QQ+ NGI+RVEH+  
Sbjct: 185  LPELEALRVSFQRKTDEFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQE 244

Query: 748  NLKFLAQGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGA 927
            +L+FLAQGGTAVGTGLNT+ GFAE+IA QVS+ETG++F+TAPNKFEALAAHDAVVE SGA
Sbjct: 245  SLRFLAQGGTAVGTGLNTRRGFAEQIAAQVSRETGLEFRTAPNKFEALAAHDAVVEASGA 304

Query: 928  LNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQV 1107
            LNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEA+TQ CVQV
Sbjct: 305  LNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQACVQV 364

Query: 1108 MGNNAAITFAGASGQFELNVFKPVMISNLLSSIRLLGDACYSFRVHCVEGIQANEDKIAK 1287
            MGNNAAITFAGASGQFELNVFKPVMI+NLLSS+RLL DA  SFRVHCV+GIQ NED+IAK
Sbjct: 365  MGNNAAITFAGASGQFELNVFKPVMIANLLSSVRLLADAARSFRVHCVDGIQDNEDRIAK 424

Query: 1288 LLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLSSAEFDEWVVPENMV 1467
            LLHESLMLVTALNPKIGYDAAS VAKNAHKKGITL+ SALELGVL+ AEFDEWVVPE M+
Sbjct: 425  LLHESLMLVTALNPKIGYDAASAVAKNAHKKGITLRASALELGVLTDAEFDEWVVPEKMI 484

Query: 1468 GPK 1476
            GP+
Sbjct: 485  GPR 487

>CAGL0A01045g Chr1 complement(104865..106316) [1452 bp, 483 aa] {ON}
            highly similar to uniprot|P08417 Saccharomyces cerevisiae
            YPL262w FUM1 fumarate hydratase
          Length = 483

 Score =  787 bits (2032), Expect = 0.0
 Identities = 394/477 (82%), Positives = 429/477 (89%)
 Frame = +1

Query: 43   SGSKARLISTSSSLGQKYRVETDAFGEIKVPTDKLWGAQTQRSLENFKIGGQRERMPEPI 222
            S +K  LI  S+ +   YRVETD FGEIKVP DK WGAQTQRS +NFKIGG RERMPEPI
Sbjct: 6    SRAKTSLIGYSARM-MHYRVETDTFGEIKVPADKYWGAQTQRSFQNFKIGGARERMPEPI 64

Query: 223  VKAFGILKKSAAIVNESLGTLDPKVSKPIQDAADEVISGKLIDHFPLVVFQTGSGTQSNM 402
            V+AFG+LKKSAAIVNE LGTLD +++ PIQ AADEV  GKL DHFPLVVFQTGSGTQSNM
Sbjct: 65   VRAFGVLKKSAAIVNEKLGTLDSEIAGPIQQAADEVAKGKLNDHFPLVVFQTGSGTQSNM 124

Query: 403  NANEVISNRAIQLVGGEVGSKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEVTHLLLPELI 582
            NANEVISNRAI+L+GGE+GSK IHPNNHCNQAQSSNDTFPSVMHIAAVTE+T+ LLPE+ 
Sbjct: 125  NANEVISNRAIELIGGELGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNSLLPEIT 184

Query: 583  ALRDAFAKKAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHSLHNLKFL 762
             L+DA  KKA+EF  IVKIGRTHLQDATPLTLGQEFSGYVQQL NGI+R+E++L +LK+L
Sbjct: 185  QLKDALHKKAEEFQDIVKIGRTHLQDATPLTLGQEFSGYVQQLVNGIARIENTLPHLKYL 244

Query: 763  AQGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTLA 942
            AQGGTAVGTGLNTK GF + IAEQ+SKETGIDFKTAPNKFEALAAHDA+VE SGALNT+A
Sbjct: 245  AQGGTAVGTGLNTKEGFDKLIAEQISKETGIDFKTAPNKFEALAAHDAIVEASGALNTVA 304

Query: 943  CSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNA 1122
            CSLFKIA DIRYLGSGPRCGYGEL LPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNA
Sbjct: 305  CSLFKIAQDIRYLGSGPRCGYGELHLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNA 364

Query: 1123 AITFAGASGQFELNVFKPVMISNLLSSIRLLGDACYSFRVHCVEGIQANEDKIAKLLHES 1302
            A+TFAGA+GQFELNVFKPVMISNLLSSIRLL DAC+SFRVHCVEGI+AN +KI   LH S
Sbjct: 365  AVTFAGANGQFELNVFKPVMISNLLSSIRLLADACHSFRVHCVEGIEANREKINHNLHNS 424

Query: 1303 LMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLSSAEFDEWVVPENMVGP 1473
            LMLVTALNPKIGYDAASK+AKNA KK ITLKESALEL  L+S EFDEWV+PENMVGP
Sbjct: 425  LMLVTALNPKIGYDAASKIAKNAFKKNITLKESALELKYLTSEEFDEWVIPENMVGP 481

>Smik_6.470 Chr6 complement(772380..773846) [1467 bp, 488 aa] {ON}
            YPL262W (REAL)
          Length = 488

 Score =  766 bits (1977), Expect = 0.0
 Identities = 385/487 (79%), Positives = 427/487 (87%)
 Frame = +1

Query: 16   TEAANKALISGSKARLISTSSSLGQKYRVETDAFGEIKVPTDKLWGAQTQRSLENFKIGG 195
            T ++ KA +  S    I   +S    +R ETDAFGEI VP DK WGAQTQRS +NFKIGG
Sbjct: 5    TNSSCKAFVQSSYKFNIRRMNST---FRTETDAFGEINVPADKYWGAQTQRSFQNFKIGG 61

Query: 196  QRERMPEPIVKAFGILKKSAAIVNESLGTLDPKVSKPIQDAADEVISGKLIDHFPLVVFQ 375
             RERMP P+V AFG+LKKSAAIVNESLG LDPK+SK IQ+AADEV SGKL DHFPLVVFQ
Sbjct: 62   ARERMPLPLVHAFGVLKKSAAIVNESLGGLDPKISKAIQEAADEVASGKLDDHFPLVVFQ 121

Query: 376  TGSGTQSNMNANEVISNRAIQLVGGEVGSKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEV 555
            TGSGTQSNMNANEVISNRAI+++GG++GSK +HPNNHCNQ+QSSNDTFP+VMHIAA  ++
Sbjct: 122  TGSGTQSNMNANEVISNRAIEILGGKIGSKEVHPNNHCNQSQSSNDTFPTVMHIAASLQI 181

Query: 556  THLLLPELIALRDAFAKKAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVE 735
             + L+PEL  L++A   K++EFD IVKIGRTHLQDATPLTLGQEFSGYVQQ+ NGI RV 
Sbjct: 182  QNELIPELANLKNALEAKSKEFDHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVA 241

Query: 736  HSLHNLKFLAQGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVE 915
            HSL  L FLAQGGTAVGTGLNTK GF  KIAEQ+SKETG+ F+TAPNKFEALAAHDA+VE
Sbjct: 242  HSLKTLSFLAQGGTAVGTGLNTKPGFDVKIAEQISKETGLKFQTAPNKFEALAAHDAIVE 301

Query: 916  CSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQV 1095
            CSGALNTLACSLFKIA DIRYLGSGPRCGY EL LPENEPGSSIMPGKVNPTQNEA+TQV
Sbjct: 302  CSGALNTLACSLFKIAQDIRYLGSGPRCGYHELMLPENEPGSSIMPGKVNPTQNEALTQV 361

Query: 1096 CVQVMGNNAAITFAGASGQFELNVFKPVMISNLLSSIRLLGDACYSFRVHCVEGIQANED 1275
            CVQVMGNNAAITFAG+ GQFELNVFKPVMI+NLL+SIRL+ DA YSFRVHCVEGI+ANE 
Sbjct: 362  CVQVMGNNAAITFAGSQGQFELNVFKPVMIANLLNSIRLITDAAYSFRVHCVEGIKANEP 421

Query: 1276 KIAKLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLSSAEFDEWVVP 1455
            +I +LL +SLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVL+  EFDEWVVP
Sbjct: 422  RIHELLTKSLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLTEKEFDEWVVP 481

Query: 1456 ENMVGPK 1476
            ENM+GPK
Sbjct: 482  ENMLGPK 488

>Kpol_1045.76 s1045 complement(177447..178904) [1458 bp, 485 aa] {ON}
            complement(177449..178906) [1458 nt, 486 aa]
          Length = 485

 Score =  765 bits (1976), Expect = 0.0
 Identities = 381/460 (82%), Positives = 416/460 (90%)
 Frame = +1

Query: 94   YRVETDAFGEIKVPTDKLWGAQTQRSLENFKIGGQRERMPEPIVKAFGILKKSAAIVNES 273
            +RVETD FGEIKVP +K WGAQT+RS ENFKIGG RERMPE +V+AFG+LKK AAIVN  
Sbjct: 24   FRVETDGFGEIKVPANKYWGAQTERSFENFKIGGSRERMPEAVVRAFGVLKKCAAIVNTE 83

Query: 274  LGTLDPKVSKPIQDAADEVISGKLIDHFPLVVFQTGSGTQSNMNANEVISNRAIQLVGGE 453
            LG LDP  SK IQ AADEV +GKL DHFPLVVFQTGSGTQSNMNANEVISNRAI+L GG 
Sbjct: 84   LGGLDPATSKLIQQAADEVATGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIELKGGV 143

Query: 454  VGSKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEVTHLLLPELIALRDAFAKKAQEFDSIV 633
            +GSK IHPNNHCN AQSSNDTFP+VMHIAAVT+++  LLPEL  LRDA A K+ EF+ IV
Sbjct: 144  LGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTQISQHLLPELTHLRDALAAKSAEFEHIV 203

Query: 634  KIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHSLHNLKFLAQGGTAVGTGLNTKVGF 813
            KIGRTHLQDATPLTLGQEFSGYVQQLTNGI R+E +  NL+FLAQGGTAVGTGLNTK G+
Sbjct: 204  KIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQQNLRFLAQGGTAVGTGLNTKNGW 263

Query: 814  AEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTLACSLFKIANDIRYLGSGP 993
            AE+IA ++SKETG+ FKTAPNKFEALAAHDA+VE SGALNT+ACSLFKIA DIRYLGSGP
Sbjct: 264  AERIAAEISKETGLAFKTAPNKFEALAAHDAIVEASGALNTVACSLFKIAQDIRYLGSGP 323

Query: 994  RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFK 1173
            RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAA+TFAGASGQFELNVFK
Sbjct: 324  RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAVTFAGASGQFELNVFK 383

Query: 1174 PVMISNLLSSIRLLGDACYSFRVHCVEGIQANEDKIAKLLHESLMLVTALNPKIGYDAAS 1353
            PV+ISNLLSS++LLGDA  SFRVHCVEGI+ANE KI++LLH SLMLVTALNPKIGYDAA+
Sbjct: 384  PVLISNLLSSVQLLGDASRSFRVHCVEGIKANEAKISELLHRSLMLVTALNPKIGYDAAT 443

Query: 1354 KVAKNAHKKGITLKESALELGVLSSAEFDEWVVPENMVGP 1473
            KVAKNAHKKGITLKESALELGVL+  EFDEWVVPE M+GP
Sbjct: 444  KVAKNAHKKGITLKESALELGVLTEKEFDEWVVPEKMLGP 483

>YPL262W Chr16 (47336..48802) [1467 bp, 488 aa] {ON}  FUM1Fumarase,
            converts fumaric acid to L-malic acid in the TCA cycle;
            cytosolic and mitochondrial distribution determined by
            the N-terminal targeting sequence, protein conformation,
            and status of glyoxylate shunt; phosphorylated in
            mitochondria
          Length = 488

 Score =  763 bits (1969), Expect = 0.0
 Identities = 378/465 (81%), Positives = 417/465 (89%)
 Frame = +1

Query: 82   LGQKYRVETDAFGEIKVPTDKLWGAQTQRSLENFKIGGQRERMPEPIVKAFGILKKSAAI 261
            +   +R ETDAFGEI VP DK WGAQTQRS +NFKIGG RERMP P+V AFG+LKKSAAI
Sbjct: 24   MNSSFRTETDAFGEIHVPADKYWGAQTQRSFQNFKIGGARERMPLPLVHAFGVLKKSAAI 83

Query: 262  VNESLGTLDPKVSKPIQDAADEVISGKLIDHFPLVVFQTGSGTQSNMNANEVISNRAIQL 441
            VNESLG LDPK+SK IQ AADEV SGKL DHFPLVVFQTGSGTQSNMNANEVISNRAI++
Sbjct: 84   VNESLGGLDPKISKAIQQAADEVASGKLDDHFPLVVFQTGSGTQSNMNANEVISNRAIEI 143

Query: 442  VGGEVGSKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEVTHLLLPELIALRDAFAKKAQEF 621
            +GG++GSK +HPNNHCNQ+QSSNDTFP+VMHIAA  ++ + L+PEL  L++A   K++EF
Sbjct: 144  LGGKIGSKQVHPNNHCNQSQSSNDTFPTVMHIAASLQIQNELIPELTNLKNALEAKSKEF 203

Query: 622  DSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHSLHNLKFLAQGGTAVGTGLNT 801
            D IVKIGRTHLQDATPLTLGQEFSGYVQQ+ NGI RV HSL  L FLAQGGTAVGTGLNT
Sbjct: 204  DHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSLKTLSFLAQGGTAVGTGLNT 263

Query: 802  KVGFAEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTLACSLFKIANDIRYL 981
            K GF  KIAEQ+SKETG+ F+TAPNKFEALAAHDA+VECSGALNTLACSLFKIA DIRYL
Sbjct: 264  KPGFDVKIAEQISKETGLKFQTAPNKFEALAAHDAIVECSGALNTLACSLFKIAQDIRYL 323

Query: 982  GSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFEL 1161
            GSGPRCGY EL LPENEPGSSIMPGKVNPTQNEA+TQVCVQVMGNNAAITFAG+ GQFEL
Sbjct: 324  GSGPRCGYHELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAGSQGQFEL 383

Query: 1162 NVFKPVMISNLLSSIRLLGDACYSFRVHCVEGIQANEDKIAKLLHESLMLVTALNPKIGY 1341
            NVFKPVMI+NLL+SIRL+ DA YSFRVHCVEGI+ANE +I +LL +SLMLVTALNPKIGY
Sbjct: 384  NVFKPVMIANLLNSIRLITDAAYSFRVHCVEGIKANEPRIHELLTKSLMLVTALNPKIGY 443

Query: 1342 DAASKVAKNAHKKGITLKESALELGVLSSAEFDEWVVPENMVGPK 1476
            DAASKVAKNAHKKGITLKESALELGVL+  EFDEWVVPE+M+GPK
Sbjct: 444  DAASKVAKNAHKKGITLKESALELGVLTEKEFDEWVVPEHMLGPK 488

>TPHA0J00270 Chr10 (61961..63451) [1491 bp, 496 aa] {ON} Anc_6.13
            YPL262W
          Length = 496

 Score =  761 bits (1964), Expect = 0.0
 Identities = 370/461 (80%), Positives = 418/461 (90%)
 Frame = +1

Query: 94   YRVETDAFGEIKVPTDKLWGAQTQRSLENFKIGGQRERMPEPIVKAFGILKKSAAIVNES 273
            +R+ETD FGEIKVP +K WGAQT+RS ENF+IGG RERMP+P+VKAFG+LKKSAAIVNE 
Sbjct: 36   FRIETDGFGEIKVPANKYWGAQTERSFENFRIGGPRERMPDPVVKAFGVLKKSAAIVNEG 95

Query: 274  LGTLDPKVSKPIQDAADEVISGKLIDHFPLVVFQTGSGTQSNMNANEVISNRAIQLVGGE 453
             GTLDP++SK IQ+AADEVI GKL DHFPLVVFQTGSGTQSNMNANEVISNRAI+L+GG 
Sbjct: 96   YGTLDPQISKVIQEAADEVIQGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGT 155

Query: 454  VGSKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEVTHLLLPELIALRDAFAKKAQEFDSIV 633
            +GSK +HPNNH NQAQSSND+FP+VMHIAAVTE+T  L+PE+  LRDA   K+++F  IV
Sbjct: 156  LGSKQVHPNNHVNQAQSSNDSFPTVMHIAAVTEITDHLIPEVANLRDALESKSKDFAHIV 215

Query: 634  KIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHSLHNLKFLAQGGTAVGTGLNTKVGF 813
            KIGRTHLQDATPLTLGQEFSGYVQQLTNGI R+EHSL NLKFLAQGGTAVGTGLNT++GF
Sbjct: 216  KIGRTHLQDATPLTLGQEFSGYVQQLTNGIGRIEHSLINLKFLAQGGTAVGTGLNTRIGF 275

Query: 814  AEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTLACSLFKIANDIRYLGSGP 993
            AEKIAEQ+SKETG+ FKTAPNKFEALAAHDA+VE SGA+ T+A SLFKIA DIRYLGSGP
Sbjct: 276  AEKIAEQISKETGVAFKTAPNKFEALAAHDAIVEASGAITTVATSLFKIAQDIRYLGSGP 335

Query: 994  RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFK 1173
            RCGYGELSLPENEPGSSIMPGK+NPTQNEA+TQVC Q++GNN  I FAG  GQFELNVFK
Sbjct: 336  RCGYGELSLPENEPGSSIMPGKINPTQNEAVTQVCAQIIGNNQTIIFAGTQGQFELNVFK 395

Query: 1174 PVMISNLLSSIRLLGDACYSFRVHCVEGIQANEDKIAKLLHESLMLVTALNPKIGYDAAS 1353
            PVMISNLLSSIRLLGD   SFR+HCVEGI+ANE++IA L+++SLMLVTALNPKIGYD A+
Sbjct: 396  PVMISNLLSSIRLLGDVSKSFRIHCVEGIKANEERIADLMNKSLMLVTALNPKIGYDEAT 455

Query: 1354 KVAKNAHKKGITLKESALELGVLSSAEFDEWVVPENMVGPK 1476
            KVAKNAHKKGITLKESA++LG L+ +EFDEWVVPE M+GPK
Sbjct: 456  KVAKNAHKKGITLKESAMQLGSLTESEFDEWVVPEKMIGPK 496

>Skud_16.16 Chr16 (26407..27873) [1467 bp, 488 aa] {ON} YPL262W (REAL)
          Length = 488

 Score =  760 bits (1963), Expect = 0.0
 Identities = 375/465 (80%), Positives = 417/465 (89%)
 Frame = +1

Query: 82   LGQKYRVETDAFGEIKVPTDKLWGAQTQRSLENFKIGGQRERMPEPIVKAFGILKKSAAI 261
            +   +R+ETDAFGEI VP DK WGAQTQRS +NFKIGG RERMP P+V AFG+LKKSAA+
Sbjct: 24   MNSTFRIETDAFGEINVPADKYWGAQTQRSFQNFKIGGARERMPLPLVHAFGVLKKSAAV 83

Query: 262  VNESLGTLDPKVSKPIQDAADEVISGKLIDHFPLVVFQTGSGTQSNMNANEVISNRAIQL 441
            VNESLG LDPK+SK IQ AADEV SGKL DHFPLVVFQTGSGTQSNMNANEVISNRAI++
Sbjct: 84   VNESLGGLDPKISKAIQQAADEVTSGKLDDHFPLVVFQTGSGTQSNMNANEVISNRAIEI 143

Query: 442  VGGEVGSKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEVTHLLLPELIALRDAFAKKAQEF 621
            +GG++GSK +HPNNHCNQ+QSSNDTFP+VMHIAA  ++ + L+PEL  L++A   K++EF
Sbjct: 144  LGGKIGSKEVHPNNHCNQSQSSNDTFPTVMHIAASLQIQNELIPELTNLKNALEAKSKEF 203

Query: 622  DSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHSLHNLKFLAQGGTAVGTGLNT 801
            + IVKIGRTHLQDATPLTLGQEFSGYVQQ+ NGI RV HSL  L FLAQGGTAVGTGLNT
Sbjct: 204  EHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSLKTLSFLAQGGTAVGTGLNT 263

Query: 802  KVGFAEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTLACSLFKIANDIRYL 981
            K GF  KIAEQ+S ETG+ F+TAPNKFEALAAHDA+VECSGALNTLACSLFKIA DIRYL
Sbjct: 264  KPGFDIKIAEQISSETGLKFQTAPNKFEALAAHDAIVECSGALNTLACSLFKIAQDIRYL 323

Query: 982  GSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFEL 1161
            GSGPRCGY EL LPENEPGSSIMPGKVNPTQNEA+TQVCVQVMGNNAAITFAG+ GQFEL
Sbjct: 324  GSGPRCGYHELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAGSQGQFEL 383

Query: 1162 NVFKPVMISNLLSSIRLLGDACYSFRVHCVEGIQANEDKIAKLLHESLMLVTALNPKIGY 1341
            NVFKPVMI+NLL+SIRL+ D+ YSFRVHCVEGI+ANE +I +LL +SLMLVTALNPKIGY
Sbjct: 384  NVFKPVMIANLLNSIRLITDSAYSFRVHCVEGIKANEPRIHELLTKSLMLVTALNPKIGY 443

Query: 1342 DAASKVAKNAHKKGITLKESALELGVLSSAEFDEWVVPENMVGPK 1476
            DAASKVAKNAHKKGITLKESALELGVL+  EFDEWVVPENM+GPK
Sbjct: 444  DAASKVAKNAHKKGITLKESALELGVLTEKEFDEWVVPENMLGPK 488

>NCAS0D02620 Chr4 complement(504150..505631) [1482 bp, 493 aa] {ON}
            Anc_6.13 YPL262W
          Length = 493

 Score =  760 bits (1962), Expect = 0.0
 Identities = 373/480 (77%), Positives = 429/480 (89%)
 Frame = +1

Query: 40   ISGSKARLISTSSSLGQKYRVETDAFGEIKVPTDKLWGAQTQRSLENFKIGGQRERMPEP 219
            +  S+  L +T+++  Q+YR+ETD+FGEIKVP DK WGAQTQRS +NFKIGG RER+P+P
Sbjct: 14   LQASRMSLSTTTAASQQQYRIETDSFGEIKVPADKYWGAQTQRSFQNFKIGGSRERIPDP 73

Query: 220  IVKAFGILKKSAAIVNESLGTLDPKVSKPIQDAADEVISGKLIDHFPLVVFQTGSGTQSN 399
            I+ AFGILKKSAAIVNESLGTLDPKV+ PI+ AADEV+ GKL DHFPLVVFQTGSGTQ+N
Sbjct: 74   IITAFGILKKSAAIVNESLGTLDPKVADPIKKAADEVVQGKLKDHFPLVVFQTGSGTQTN 133

Query: 400  MNANEVISNRAIQLVGGEVGSKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEVTHLLLPEL 579
            MN NEVISNRAI+LVGG++GSK IHPNNHCNQ+QSSNDTFPSVMHIAAV E+T+ L+PEL
Sbjct: 134  MNVNEVISNRAIELVGGKLGSKQIHPNNHCNQSQSSNDTFPSVMHIAAVLEITNSLIPEL 193

Query: 580  IALRDAFAKKAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHSLHNLKF 759
              L+DA   KA+EF  IVKIGRTHLQDATPLTLGQEFSGYVQQL NGI R+E SL++LKF
Sbjct: 194  TKLKDALDVKAKEFADIVKIGRTHLQDATPLTLGQEFSGYVQQLENGIYRIESSLYHLKF 253

Query: 760  LAQGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTL 939
            LAQGGTAVGTGLNTK+GF + IAE+VSKETGI+FKTAPNKFEALAAHDA+V  SGALNT+
Sbjct: 254  LAQGGTAVGTGLNTKIGFDKLIAEEVSKETGIEFKTAPNKFEALAAHDAIVFASGALNTV 313

Query: 940  ACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNN 1119
            A SLFKIA DIRYLGSGPRCGYGEL LPENEPGSSIMPGKVNPTQNEAMTQVCVQ+MGNN
Sbjct: 314  AGSLFKIAQDIRYLGSGPRCGYGELQLPENEPGSSIMPGKVNPTQNEAMTQVCVQIMGNN 373

Query: 1120 AAITFAGASGQFELNVFKPVMISNLLSSIRLLGDACYSFRVHCVEGIQANEDKIAKLLHE 1299
              I+ AG+ GQFELNV+KP+MI+NLL+SIRL+ DAC SFR+HC++ ++AN+DKI + L++
Sbjct: 374  QTISIAGSQGQFELNVYKPLMIANLLNSIRLMTDACKSFRIHCIDDLKANKDKINENLNK 433

Query: 1300 SLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLSSAEFDEWVVPENMVGPKP 1479
            SLMLVTALNPKIGYDAASK+AKNAH K ITLKESALEL  L++ EFDEWVVPENM+GPKP
Sbjct: 434  SLMLVTALNPKIGYDAASKIAKNAHLKNITLKESALELKYLTAEEFDEWVVPENMIGPKP 493

>ZYRO0C07964g Chr3 complement(607609..609126) [1518 bp, 505 aa] {ON}
            highly similar to uniprot|P08417 Saccharomyces cerevisiae
            YPL262W FUM1 Fumarase converts fumaric acid to L-malic
            acid in the TCA cycle cytosolic and mitochondrial
            localization determined by the N-terminal mitochondrial
            targeting sequence and protein conformation
          Length = 505

 Score =  759 bits (1959), Expect = 0.0
 Identities = 379/477 (79%), Positives = 424/477 (88%)
 Frame = +1

Query: 49   SKARLISTSSSLGQKYRVETDAFGEIKVPTDKLWGAQTQRSLENFKIGGQRERMPEPIVK 228
            S+   + T++   Q++RVETDAFGEIKVP DK WGAQTQRS ENF+IGGQRERMPE +V 
Sbjct: 29   SQISQLHTTTPWLQEHRVETDAFGEIKVPADKYWGAQTQRSFENFRIGGQRERMPEAVVH 88

Query: 229  AFGILKKSAAIVNESLGTLDPKVSKPIQDAADEVISGKLIDHFPLVVFQTGSGTQSNMNA 408
            AFGILKK+ A VNE+ G LDPK++  I+ AADEV SGKL DHFPLVVFQTGSGTQSNMNA
Sbjct: 89   AFGILKKATATVNEANGQLDPKLAVAIKQAADEVASGKLKDHFPLVVFQTGSGTQSNMNA 148

Query: 409  NEVISNRAIQLVGGEVGSKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEVTHLLLPELIAL 588
            NEVISNRAI+L+GG++GSKS+HPNNH N +QSSNDTFP+VMHIAAV  +T  LLP L AL
Sbjct: 149  NEVISNRAIELLGGKLGSKSVHPNNHINMSQSSNDTFPTVMHIAAVLAITKDLLPNLTAL 208

Query: 589  RDAFAKKAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHSLHNLKFLAQ 768
            +D+  KK++EF  IVKIGRTHLQDATPLTLGQEFSGYVQQ+ NGI RVE +L +LK LAQ
Sbjct: 209  KDSLQKKSEEFADIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTLDSLKLLAQ 268

Query: 769  GGTAVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTLACS 948
            GGTAVGTGLNTK+G+AE +A +V+KETGIDF+TAPNKFEALAAHDAVVE SGALNTLA S
Sbjct: 269  GGTAVGTGLNTKIGWAENVAAEVAKETGIDFQTAPNKFEALAAHDAVVEASGALNTLAVS 328

Query: 949  LFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAI 1128
            LFKIA DIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEA+TQVCVQV GN++AI
Sbjct: 329  LFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVFGNHSAI 388

Query: 1129 TFAGASGQFELNVFKPVMISNLLSSIRLLGDACYSFRVHCVEGIQANEDKIAKLLHESLM 1308
            TFAGASGQFELNVFKPVMISNLLSSI LL DA YSFRVHCV+GIQAN + IAKLLHESLM
Sbjct: 389  TFAGASGQFELNVFKPVMISNLLSSINLLSDASYSFRVHCVDGIQANRENIAKLLHESLM 448

Query: 1309 LVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLSSAEFDEWVVPENMVGPKP 1479
            LVTALNPKIGYDAASKVAKNAHK GITLKESAL+L +L++ EFD WVVPE+M+GPKP
Sbjct: 449  LVTALNPKIGYDAASKVAKNAHKNGITLKESALQLNILTAEEFDHWVVPEHMIGPKP 505

>Suva_16.43 Chr16 (62871..64337) [1467 bp, 488 aa] {ON} YPL262W (REAL)
          Length = 488

 Score =  753 bits (1944), Expect = 0.0
 Identities = 378/492 (76%), Positives = 423/492 (85%)
 Frame = +1

Query: 1    MFKVTTEAANKALISGSKARLISTSSSLGQKYRVETDAFGEIKVPTDKLWGAQTQRSLEN 180
            M + +  +    L S  K  +   +S+    +R ETDAFGEI VP DK WGAQTQRS +N
Sbjct: 1    MLRFSNSSCKAILQSSYKVNIRRMNST----FRTETDAFGEINVPADKYWGAQTQRSFQN 56

Query: 181  FKIGGQRERMPEPIVKAFGILKKSAAIVNESLGTLDPKVSKPIQDAADEVISGKLIDHFP 360
            FKIGG RERMP P+V AFG+LKKSAAIVNESLG LDPKVSK IQ AADEV +GKL DHFP
Sbjct: 57   FKIGGARERMPLPLVHAFGVLKKSAAIVNESLGGLDPKVSKAIQQAADEVAAGKLDDHFP 116

Query: 361  LVVFQTGSGTQSNMNANEVISNRAIQLVGGEVGSKSIHPNNHCNQAQSSNDTFPSVMHIA 540
            LVVFQTGSGTQSNMNANEVISNRAI+++GG++GSK +HPNN CNQ+QSSNDTFP+VMHIA
Sbjct: 117  LVVFQTGSGTQSNMNANEVISNRAIEILGGKIGSKQVHPNNDCNQSQSSNDTFPTVMHIA 176

Query: 541  AVTEVTHLLLPELIALRDAFAKKAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNG 720
            A  ++   L+PEL  L++A   K++EF+ IVKIGRTHLQDATPLTLGQEFSGYVQQ+ NG
Sbjct: 177  ASLQIEKELIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENG 236

Query: 721  ISRVEHSLHNLKFLAQGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAH 900
            I RV H+L  L FLAQGGTAVGTGLNTK GF  KIAEQ+SKETG+ F+TAPNKFEALAAH
Sbjct: 237  IQRVAHTLKTLSFLAQGGTAVGTGLNTKPGFDVKIAEQISKETGLKFQTAPNKFEALAAH 296

Query: 901  DAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 1080
            DA+VECSGALNTLACSLFKIA DIRYLGSGPRCGY EL LPENEPGSSIMPGKVNPTQNE
Sbjct: 297  DAIVECSGALNTLACSLFKIAQDIRYLGSGPRCGYNELMLPENEPGSSIMPGKVNPTQNE 356

Query: 1081 AMTQVCVQVMGNNAAITFAGASGQFELNVFKPVMISNLLSSIRLLGDACYSFRVHCVEGI 1260
            A+TQVCVQVMGNNAAITF G+ GQFELNVFKPVMI+NLL+SIRL+ DA  SFR+HCVEGI
Sbjct: 357  ALTQVCVQVMGNNAAITFGGSQGQFELNVFKPVMIANLLNSIRLIADASRSFRIHCVEGI 416

Query: 1261 QANEDKIAKLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLSSAEFD 1440
            +ANE +I +LL +SLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVL+  EFD
Sbjct: 417  KANEPRIHELLTKSLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLTEKEFD 476

Query: 1441 EWVVPENMVGPK 1476
            EWVVPENM+GPK
Sbjct: 477  EWVVPENMLGPK 488

>KNAG0E02750 Chr5 (547746..549242) [1497 bp, 498 aa] {ON} Anc_6.13
            YPL262W
          Length = 498

 Score =  744 bits (1922), Expect = 0.0
 Identities = 368/482 (76%), Positives = 422/482 (87%)
 Frame = +1

Query: 34   ALISGSKARLISTSSSLGQKYRVETDAFGEIKVPTDKLWGAQTQRSLENFKIGGQRERMP 213
            AL+  +  R +S S+   Q++RVETD+FGEI VP D+ WGAQTQRS +NFKIGG RE++P
Sbjct: 17   ALLRNNLRRNMSASAITNQEFRVETDSFGEINVPADRYWGAQTQRSFQNFKIGGDREKIP 76

Query: 214  EPIVKAFGILKKSAAIVNESLGTLDPKVSKPIQDAADEVISGKLIDHFPLVVFQTGSGTQ 393
            EP+V+AFGILKKSAA VNE+LGTLD  ++  I+ AADEV  GKL DHFPLVVFQTGSGTQ
Sbjct: 77   EPVVRAFGILKKSAATVNENLGTLDKSIAAKIKLAADEVAEGKLSDHFPLVVFQTGSGTQ 136

Query: 394  SNMNANEVISNRAIQLVGGEVGSKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEVTHLLLP 573
            SNMNANEVISNRAI+L+GGE+GSK +HPNNH NQ+QSSNDTFP+VMHIAA TE+ + L+P
Sbjct: 137  SNMNANEVISNRAIELLGGELGSKQVHPNNHVNQSQSSNDTFPTVMHIAATTEIANKLIP 196

Query: 574  ELIALRDAFAKKAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHSLHNL 753
            EL  L+DA   K +EF SIVKIGRTHLQDATPLTLGQEFSGYVQQ+ NGI RV+ SL++L
Sbjct: 197  ELQNLKDALQHKVEEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVQSSLYHL 256

Query: 754  KFLAQGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALN 933
             FLAQGGTAVGTGLNTKVGF + +AE+VSKETG+ F+TAPNKFEALAAHDA+VE SGALN
Sbjct: 257  HFLAQGGTAVGTGLNTKVGFDKLVAEEVSKETGLHFETAPNKFEALAAHDAIVEASGALN 316

Query: 934  TLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMG 1113
            TLACSLFKIA DIRYLGSGPRCGYGEL LP NEPGSSIMPGKVNPTQNEAMTQVCVQVMG
Sbjct: 317  TLACSLFKIAQDIRYLGSGPRCGYGELILPANEPGSSIMPGKVNPTQNEAMTQVCVQVMG 376

Query: 1114 NNAAITFAGASGQFELNVFKPVMISNLLSSIRLLGDACYSFRVHCVEGIQANEDKIAKLL 1293
            NN+ ITFAG+ GQFELNV+KP+MISNLLSSIRLL DA  SFR+HC+  ++AN+DKI + L
Sbjct: 377  NNSTITFAGSQGQFELNVYKPLMISNLLSSIRLLTDASKSFRIHCLNDLKANKDKIDENL 436

Query: 1294 HESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLSSAEFDEWVVPENMVGP 1473
            ++SLMLVTALNPKIGYDAA+KVAKNAH K ITLKESALELGVL+  EFDEWV+PENM+ P
Sbjct: 437  NKSLMLVTALNPKIGYDAAAKVAKNAHHKNITLKESALELGVLTEKEFDEWVIPENMISP 496

Query: 1474 KP 1479
            KP
Sbjct: 497  KP 498

>KAFR0B06520 Chr2 (1352364..1353851) [1488 bp, 495 aa] {ON} Anc_6.13
            YPL262W
          Length = 495

 Score =  735 bits (1898), Expect = 0.0
 Identities = 360/469 (76%), Positives = 420/469 (89%)
 Frame = +1

Query: 70   TSSSLGQKYRVETDAFGEIKVPTDKLWGAQTQRSLENFKIGGQRERMPEPIVKAFGILKK 249
            T SS+   +R ETD+FGEI VP DK WGAQTQRSL+NFKIGG+RE++P PI++AFGILKK
Sbjct: 26   TMSSIKSSFRAETDSFGEINVPNDKYWGAQTQRSLQNFKIGGEREKIPIPIIEAFGILKK 85

Query: 250  SAAIVNESLGTLDPKVSKPIQDAADEVISGKLIDHFPLVVFQTGSGTQSNMNANEVISNR 429
            SAAIVNE LGTLD +++K I  AADEV  GKL DHFPLVVFQTGSGTQSNMNANEVISNR
Sbjct: 86   SAAIVNERLGTLDSELAKNIIIAADEVSQGKLNDHFPLVVFQTGSGTQSNMNANEVISNR 145

Query: 430  AIQLVGGEVGSKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEVTHLLLPELIALRDAFAKK 609
            AI+L+GG++GSK++HPNNH NQ+QSSNDTFP+VMHIAA+ E+T  LLPEL +L+++  KK
Sbjct: 146  AIELMGGKLGSKTVHPNNHVNQSQSSNDTFPTVMHIAAMLEITRKLLPELNSLKNSLDKK 205

Query: 610  AQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHSLHNLKFLAQGGTAVGT 789
            + EF+ IVKIGRTHLQDATPLTLGQEFSGYVQQ+TNGI R+E +L++LKFLAQGGTAVGT
Sbjct: 206  SNEFNDIVKIGRTHLQDATPLTLGQEFSGYVQQMTNGIRRIETALYHLKFLAQGGTAVGT 265

Query: 790  GLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTLACSLFKIAND 969
            GLNTK GF + IAEQ+S+ETGI+F+TAPNKFEALAAHDA+VE SGALNTLACSLFKIA D
Sbjct: 266  GLNTKAGFDKLIAEQISEETGINFETAPNKFEALAAHDAIVEVSGALNTLACSLFKIAQD 325

Query: 970  IRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASG 1149
            IRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVC+QVMGN++ ITFAG+ G
Sbjct: 326  IRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCIQVMGNHSTITFAGSQG 385

Query: 1150 QFELNVFKPVMISNLLSSIRLLGDACYSFRVHCVEGIQANEDKIAKLLHESLMLVTALNP 1329
            QFELNV+KP++ISNLLSSIRLL DA YSFRVHC++G++AN + I + L++SLMLVTALNP
Sbjct: 386  QFELNVYKPLLISNLLSSIRLLTDASYSFRVHCIDGLKANRENITENLNKSLMLVTALNP 445

Query: 1330 KIGYDAASKVAKNAHKKGITLKESALELGVLSSAEFDEWVVPENMVGPK 1476
             IGYD ASK+AKNAH K ITLKESALELG+L+  +F EWV+PE M+GPK
Sbjct: 446  YIGYDNASKIAKNAHHKNITLKESALELGLLTEEQFSEWVIPEKMIGPK 494

>NDAI0I02470 Chr9 complement(567782..569209) [1428 bp, 475 aa] {ON}
            Anc_6.13 YPL262W
          Length = 475

 Score =  730 bits (1884), Expect = 0.0
 Identities = 356/471 (75%), Positives = 418/471 (88%)
 Frame = +1

Query: 67   STSSSLGQKYRVETDAFGEIKVPTDKLWGAQTQRSLENFKIGGQRERMPEPIVKAFGILK 246
            S + S    +RVETD+FGEIKVP++K WGAQTQRS +NFKIGG+RE++P PI+KAFGILK
Sbjct: 5    SKTPSNESSFRVETDSFGEIKVPSNKYWGAQTQRSFQNFKIGGEREKIPLPIIKAFGILK 64

Query: 247  KSAAIVNESLGTLDPKVSKPIQDAADEVISGKLIDHFPLVVFQTGSGTQSNMNANEVISN 426
            KSAAIVN+SLGTLDP ++ PI  A+DEVI GKL DHFPLVVFQTGSGTQ+NMNANEVISN
Sbjct: 65   KSAAIVNQSLGTLDPSIATPIIKASDEVIQGKLNDHFPLVVFQTGSGTQTNMNANEVISN 124

Query: 427  RAIQLVGGEVGSKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEVTHLLLPELIALRDAFAK 606
            RA +L+G E+GSK IHPNNH NQ+QSSNDTFPSVMHIAAV E+ + L+P+L  L+++   
Sbjct: 125  RANELIGAELGSKKIHPNNHVNQSQSSNDTFPSVMHIAAVLELNNNLIPQLTELKNSLDN 184

Query: 607  KAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHSLHNLKFLAQGGTAVG 786
            KA+E+ +IVKIGRTHLQDATPLTLGQEFSGYVQQLTNGI R++ SL++LKFLAQGGTAVG
Sbjct: 185  KAKEYANIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIQASLYHLKFLAQGGTAVG 244

Query: 787  TGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTLACSLFKIAN 966
            TGLNTKVGF + IA++VSKETGIDF+TAPNKFEALAAHDA+V  S A+ T+A SLFKIA 
Sbjct: 245  TGLNTKVGFDKMIAQEVSKETGIDFETAPNKFEALAAHDAIVFASSAITTVAGSLFKIAQ 304

Query: 967  DIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGAS 1146
            DIRYLGSGPRCGYGEL LPENEPGSSIMPGKVNPTQNEAMTQV +Q+MGNN  I  AG+ 
Sbjct: 305  DIRYLGSGPRCGYGELQLPENEPGSSIMPGKVNPTQNEAMTQVALQIMGNNQTIVMAGSQ 364

Query: 1147 GQFELNVFKPVMISNLLSSIRLLGDACYSFRVHCVEGIQANEDKIAKLLHESLMLVTALN 1326
            GQFELNV+KP+MI+NLL+SIRL+ DAC+SF++HCV+G++AN DKI + LH+SLMLVTALN
Sbjct: 365  GQFELNVYKPLMIANLLNSIRLMSDACHSFKIHCVDGLKANTDKINENLHKSLMLVTALN 424

Query: 1327 PKIGYDAASKVAKNAHKKGITLKESALELGVLSSAEFDEWVVPENMVGPKP 1479
            PKIGYDAASK+AKNAH K ITLKESALELG+L+  EFD+WV+PENM+GPKP
Sbjct: 425  PKIGYDAASKLAKNAHAKNITLKESALELGLLTEEEFDQWVIPENMIGPKP 475

>TBLA0G01000 Chr7 (252070..253467) [1398 bp, 465 aa] {ON} Anc_6.13
            YPL262W
          Length = 465

 Score =  718 bits (1854), Expect = 0.0
 Identities = 347/459 (75%), Positives = 410/459 (89%)
 Frame = +1

Query: 97   RVETDAFGEIKVPTDKLWGAQTQRSLENFKIGGQRERMPEPIVKAFGILKKSAAIVNESL 276
            R+E D FGE++VP +K WGAQTQR+L NF IGG+RERMPEP++ A+GILKKS AIVNESL
Sbjct: 5    RIEVDGFGELEVPANKYWGAQTQRALNNFHIGGERERMPEPLILAYGILKKSVAIVNESL 64

Query: 277  GTLDPKVSKPIQDAADEVISGKLIDHFPLVVFQTGSGTQSNMNANEVISNRAIQLVGGEV 456
            GTLDPK+SK IQ+AADEV  G L +HFPLVVFQTGSGTQ+NMN NEVISNRAI+++GG++
Sbjct: 65   GTLDPKISKAIQEAADEVAKGSLNEHFPLVVFQTGSGTQTNMNVNEVISNRAIEILGGQL 124

Query: 457  GSKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEVTHLLLPELIALRDAFAKKAQEFDSIVK 636
            GSK++HPNNH NQ+QS+ND+FP+ MHI+AV EV   LLPEL  LRDA   K+ EF+ IVK
Sbjct: 125  GSKTVHPNNHVNQSQSTNDSFPTAMHISAVREVVFKLLPELEKLRDALKDKSIEFNKIVK 184

Query: 637  IGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHSLHNLKFLAQGGTAVGTGLNTKVGFA 816
            IGRTHLQDATPLTLGQEFSGYVQQ+ NGI+RV++SL NLKF+AQGGTAVGTG+NTK  F 
Sbjct: 185  IGRTHLQDATPLTLGQEFSGYVQQVENGITRVQNSLTNLKFIAQGGTAVGTGINTKKDFD 244

Query: 817  EKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTLACSLFKIANDIRYLGSGPR 996
              +A+Q+S ETGI+FKTAPNKFEALA+HDA+VECSGALNTLACSLFKI+ DIR+LGSGPR
Sbjct: 245  ILVAKQISLETGIEFKTAPNKFEALASHDAIVECSGALNTLACSLFKISQDIRFLGSGPR 304

Query: 997  CGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFKP 1176
            CGYGELSLPENEPGSSIMPGKVNPTQNEAM Q C+QVMGNN+AITFAGASGQFELN +KP
Sbjct: 305  CGYGELSLPENEPGSSIMPGKVNPTQNEAMCQACIQVMGNNSAITFAGASGQFELNTYKP 364

Query: 1177 VMISNLLSSIRLLGDACYSFRVHCVEGIQANEDKIAKLLHESLMLVTALNPKIGYDAASK 1356
            +MISNLL+SIRLL D+C SFR+HC+ GI+ANEDKI KLL+ESLMLVTALNPKIGYDAA+ 
Sbjct: 365  LMISNLLNSIRLLTDSCNSFRIHCIVGIRANEDKINKLLNESLMLVTALNPKIGYDAATA 424

Query: 1357 VAKNAHKKGITLKESALELGVLSSAEFDEWVVPENMVGP 1473
            +AK+AHK G+TLKE+AL+  +L++ +FDEW+VPE+MV P
Sbjct: 425  IAKDAHKNGLTLKEAALKSKLLTAEQFDEWIVPESMVHP 463

>TBLA0A07130 Chr1 (1770536..1772038) [1503 bp, 500 aa] {ON} Anc_6.13
            YPL262W
          Length = 500

 Score =  704 bits (1816), Expect = 0.0
 Identities = 344/462 (74%), Positives = 397/462 (85%)
 Frame = +1

Query: 88   QKYRVETDAFGEIKVPTDKLWGAQTQRSLENFKIGGQRERMPEPIVKAFGILKKSAAIVN 267
            Q  R ETD+FGEI+VP +K WGAQTQRS  NFKIGG+RERMPEPI++AFG  KK+AAIVN
Sbjct: 38   QGTRTETDSFGEIQVPANKYWGAQTQRSFMNFKIGGERERMPEPIIRAFGQQKKAAAIVN 97

Query: 268  ESLGTLDPKVSKPIQDAADEVISGKLIDHFPLVVFQTGSGTQSNMNANEVISNRAIQLVG 447
             SLGTLD  +   I  AA+EV  G L +HFPLVVFQTGSGTQSNMNANEVISNRAI+L+G
Sbjct: 98   NSLGTLDDTLKDAIVQAAEEVSQGLLNEHFPLVVFQTGSGTQSNMNANEVISNRAIELLG 157

Query: 448  GEVGSKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEVTHLLLPELIALRDAFAKKAQEFDS 627
            G +GSK +HPNNH NQ+QSSNDTFP+VMHIAA+TE+T+ LLP LI LR+    KA+EF+ 
Sbjct: 158  GTLGSKQVHPNNHVNQSQSSNDTFPTVMHIAALTEITNTLLPNLIVLRETLDSKAKEFEK 217

Query: 628  IVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHSLHNLKFLAQGGTAVGTGLNTKV 807
            I+KIGRTHLQDATPLTLGQEFSGY QQLTN I R+E +L  L+++AQGGTAVGTGLNTK+
Sbjct: 218  IIKIGRTHLQDATPLTLGQEFSGYTQQLTNAIKRIEKNLPELQYIAQGGTAVGTGLNTKI 277

Query: 808  GFAEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTLACSLFKIANDIRYLGS 987
            GFAE+ A Q+S +T + F T+PNKFE+LAAHDA+V    +LNTLACSLFKI+ DIRYL S
Sbjct: 278  GFAEQFARQLSNQTNLSFLTSPNKFESLAAHDAIVNVHASLNTLACSLFKISQDIRYLAS 337

Query: 988  GPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNV 1167
            GPRCGYGELS+PENEPGSSIMPGKVNPTQNEAM Q CVQVMGNN+ I+FAGASGQFELN 
Sbjct: 338  GPRCGYGELSIPENEPGSSIMPGKVNPTQNEAMCQACVQVMGNNSTISFAGASGQFELNT 397

Query: 1168 FKPVMISNLLSSIRLLGDACYSFRVHCVEGIQANEDKIAKLLHESLMLVTALNPKIGYDA 1347
            +KP+MI+NLLSS RLL DA +SF +HC  GIQAN+DKI +LLHESLMLVT+LNPKIGYDA
Sbjct: 398  YKPLMIANLLSSTRLLSDAIFSFNLHCATGIQANKDKIDRLLHESLMLVTSLNPKIGYDA 457

Query: 1348 ASKVAKNAHKKGITLKESALELGVLSSAEFDEWVVPENMVGP 1473
            ASKVAKNAH KGITLK+SALEL +LSS +FDEWV PENM+GP
Sbjct: 458  ASKVAKNAHHKGITLKQSALELDILSSKQFDEWVRPENMLGP 499

>YLR359W Chr12 (844282..845730) [1449 bp, 482 aa] {ON}
            ADE13Adenylosuccinate lyase, catalyzes two steps in the
            'de novo' purine nucleotide biosynthetic pathway;
            expression is repressed by adenine and activated by Bas1p
            and Pho2p; mutations in human ortholog ADSL cause
            adenylosuccinase deficiency
          Length = 482

 Score = 50.1 bits (118), Expect = 9e-06
 Identities = 68/321 (21%), Positives = 136/321 (42%), Gaps = 17/321 (5%)
 Frame = +1

Query: 544  VTEVTHLLLPELIALRDAFAKKAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGI 723
            + +   +++P+L+ + +  AK A E+  +  +G TH Q A   TLG+  + ++Q+L   +
Sbjct: 121  IRDAYDIIIPKLVNVINRLAKFAMEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDL 180

Query: 724  SRVEHSLHNLKFLAQGGT--------AVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNK 879
               E + +++      GT        A+  G + KV   E + E+V++  G D K  P  
Sbjct: 181  RNFERARNDIGLRGVKGTTGTQASFLALFHGNHDKV---EALDERVTELLGFD-KVYPVT 236

Query: 880  FEALAAHDAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGK 1059
             +   +    ++    L++ A +  K+A DIR L +       E    +++ GSS M  K
Sbjct: 237  GQTY-SRKIDIDVLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYK 292

Query: 1060 VNPTQNEAMTQVCVQVMGNNAAITFAGASGQ-FELNVFKPVMISNLLSSIRLLGDACYSF 1236
             NP + E +  +  + +G+  +     AS Q FE  +    +    L S  L  D   S 
Sbjct: 293  RNPMRCERVCSL-ARHLGSLFSDAVQTASVQWFERTLDDSAIRRISLPSAFLTADILLST 351

Query: 1237 RVHCVEGIQANEDKIAK--------LLHESLMLVTALNPKIGYDAASKVAKNAHKKGITL 1392
             ++   G+      I +        +  E++++          +   ++   +H+    +
Sbjct: 352  LLNISSGLVVYPKVIERRIKGELPFMATENIIMAMVEKNASRQEVHERIRVLSHQAAAVV 411

Query: 1393 KESALELGVLSSAEFDEWVVP 1455
            KE   E  ++   + DE+  P
Sbjct: 412  KEEGGENDLIERVKRDEFFKP 432

>Smik_12.446 Chr12 (783341..784789) [1449 bp, 482 aa] {ON} YLR359W
            (REAL)
          Length = 482

 Score = 49.7 bits (117), Expect = 1e-05
 Identities = 68/321 (21%), Positives = 135/321 (42%), Gaps = 17/321 (5%)
 Frame = +1

Query: 544  VTEVTHLLLPELIALRDAFAKKAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGI 723
            + +   +++P+L+ + +  AK A E+  +  +G TH Q A   TLG+  + ++Q+L   +
Sbjct: 121  IRDAYDIIIPKLVNVINRLAKFAMEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDL 180

Query: 724  SRVEHSLHNLKFLAQGGT--------AVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNK 879
               E + +++      GT        A+  G + KV   E + E+V++  G D K  P  
Sbjct: 181  RNFERARNDIGLRGVKGTTGTQASFLALFHGNHDKV---EALDERVTELLGFD-KVYPVT 236

Query: 880  FEALAAHDAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGK 1059
             +   +    ++    L++ A +  K+A DIR L +       E    + + GSS M  K
Sbjct: 237  GQTY-SRKIDIDVLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKTQIGSSAMAYK 292

Query: 1060 VNPTQNEAMTQVCVQVMGNNAAITFAGASGQ-FELNVFKPVMISNLLSSIRLLGDACYSF 1236
             NP + E +  +  + +G+  +     AS Q FE  +    +    L S  L  D   S 
Sbjct: 293  RNPMRCERVCSL-ARHLGSLFSDAVQTASVQWFERTLDDSAIRRISLPSAFLTADILLST 351

Query: 1237 RVHCVEGIQANEDKIAK--------LLHESLMLVTALNPKIGYDAASKVAKNAHKKGITL 1392
             ++   G+      I +        +  E++++          +   ++   +H+    +
Sbjct: 352  LLNISSGLVVYPKVIERRIKGELPFMATENIIMAMVEKNASRQEVHERIRVLSHQAAAVV 411

Query: 1393 KESALELGVLSSAEFDEWVVP 1455
            KE   E  ++   + DE+  P
Sbjct: 412  KEEGGENDLIERVKNDEFFKP 432

>Suva_10.459 Chr10 (803809..805257) [1449 bp, 482 aa] {ON} YLR359W
            (REAL)
          Length = 482

 Score = 48.9 bits (115), Expect = 2e-05
 Identities = 47/181 (25%), Positives = 86/181 (47%), Gaps = 8/181 (4%)
 Frame = +1

Query: 562  LLLPELIALRDAFAKKAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHS 741
            +++P+L+ + +  AK A E+  +  +G TH Q A   TLG+  + ++Q+L   +   E +
Sbjct: 127  IIIPKLVNVINRLAKFAMEYKDLPVLGWTHFQPAQLTTLGKRTTLWIQELLWDLRNFERA 186

Query: 742  LHNLKFLAQGGT--------AVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAA 897
             +++      GT        A+  G + KV   E + E+V++  G D K  P   +   +
Sbjct: 187  RNDIGLRGVKGTTGTQASFLALFHGNHDKV---EALDERVTELLGFD-KVYPVTGQTY-S 241

Query: 898  HDAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQN 1077
                ++    L++ A +  K+A DIR L +       E    +++ GSS M  K NP + 
Sbjct: 242  RKIDIDVLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPMRC 298

Query: 1078 E 1080
            E
Sbjct: 299  E 299

>CAGL0B02794g Chr2 complement(269303..270751) [1449 bp, 482 aa] {ON}
            highly similar to uniprot|Q05911 Saccharomyces cerevisiae
            YLR359w ADE13
          Length = 482

 Score = 48.5 bits (114), Expect = 3e-05
 Identities = 47/181 (25%), Positives = 85/181 (46%), Gaps = 8/181 (4%)
 Frame = +1

Query: 562  LLLPELIALRDAFAKKAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHS 741
            +++P+L+ + +  AK A E+  +  +G TH Q A   TLG+  + ++Q+L   +   E +
Sbjct: 127  IVIPKLVNVINRLAKFALEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERA 186

Query: 742  LHNLKFLAQGGT--------AVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAA 897
             +++      GT        A+  G + KV   E++ E+V++  G D  T         +
Sbjct: 187  RNDIGLRGVKGTTGTQASFLALFHGNHDKV---EELDERVTELLGFD--TVYPVTGQTYS 241

Query: 898  HDAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQN 1077
                ++    L++ A S  K+A DIR L +       E    +++ GSS M  K NP + 
Sbjct: 242  RKIDIDVLAPLSSFAASAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPMRC 298

Query: 1078 E 1080
            E
Sbjct: 299  E 299

>KLLA0A08404g Chr1 complement(743192..744577) [1386 bp, 461 aa] {ON}
            highly similar to uniprot|P04076 Saccharomyces cerevisiae
            YHR018C ARG4 Argininosuccinate lyase catalyzes the final
            step in the arginine biosynthesis pathway
          Length = 461

 Score = 47.8 bits (112), Expect = 5e-05
 Identities = 58/226 (25%), Positives = 90/226 (39%), Gaps = 1/226 (0%)
 Frame = +1

Query: 448  GEVGSKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEVTHLLLPELIALRDAFAKKAQEFDS 627
            GE+  + I    H  +  S ND   + M I     +   +LP L +L     ++A+E   
Sbjct: 96   GEIIGRGIAGKVHTGR--SRNDQVATDMRIYCRDILNGTVLPALSSLIKVILQRAEEEID 153

Query: 628  IVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHSLHNLKFLAQGGTAVGTGLNTKV 807
            ++  G THLQ A P+      S Y    T    R++  +  L     G  A+        
Sbjct: 154  VLMPGYTHLQRAQPIRWAHWLSCYATYFTEDYKRLQQIVERLNVSPLGAGAL-------A 206

Query: 808  GFAEKIAEQVSKETGIDFK-TAPNKFEALAAHDAVVECSGALNTLACSLFKIANDIRYLG 984
            G    I ++     G++F     N   A+A  D VVE     +     + + A D+  + 
Sbjct: 207  GHPYGI-DREFLAAGLNFNGVIGNSLTAVADRDFVVEIMFWGSLFMNHISRFAEDL-IIY 264

Query: 985  SGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNA 1122
            S    G+ +LS      GSS+MP K NP   E +     +V G  A
Sbjct: 265  STAEFGFIQLS-DAYSTGSSLMPQKKNPDSLELLRGKSGRVFGQLA 309

>Skud_12.443 Chr12 (784448..785896) [1449 bp, 482 aa] {ON} YLR359W
            (REAL)
          Length = 482

 Score = 47.8 bits (112), Expect = 5e-05
 Identities = 67/321 (20%), Positives = 135/321 (42%), Gaps = 17/321 (5%)
 Frame = +1

Query: 544  VTEVTHLLLPELIALRDAFAKKAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGI 723
            + +   +++P+L+ + +  AK A E+  +  +G TH Q A   TLG+  + ++Q+L   +
Sbjct: 121  IRDAYDIIIPKLVNVINRLAKFAMEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDL 180

Query: 724  SRVEHSLHNLKFLAQGGT--------AVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNK 879
               E + +++      GT        A+  G + KV   E +  +V++  G D K  P  
Sbjct: 181  RNFERARNDIGLRGVKGTTGTQASFLALFHGNHDKV---EALDARVTELLGFD-KVYPVT 236

Query: 880  FEALAAHDAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGK 1059
             +   +    ++    L++ A +  K+A DIR L +       E    +++ GSS M  K
Sbjct: 237  GQTY-SRKIDIDVLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYK 292

Query: 1060 VNPTQNEAMTQVCVQVMGNNAAITFAGASGQ-FELNVFKPVMISNLLSSIRLLGDACYSF 1236
             NP + E +  +  + +G+  +     AS Q FE  +    +    L S  L  D   S 
Sbjct: 293  RNPMRCERVCSL-ARHLGSLFSDAVQTASVQWFERTLDDSAIRRISLPSAFLTADILLST 351

Query: 1237 RVHCVEGIQANEDKIAK--------LLHESLMLVTALNPKIGYDAASKVAKNAHKKGITL 1392
             ++   G+      I +        +  E++++          +   ++   +H+    +
Sbjct: 352  LLNISSGLVVYPKVIERRIKGELPFMATENIIMAMVEKNASRQEVHERIRVLSHQAAAVV 411

Query: 1393 KESALELGVLSSAEFDEWVVP 1455
            KE   E  ++   + DE+  P
Sbjct: 412  KEEGGENDLIERVKKDEFFKP 432

>Skud_8.70 Chr8 complement(121600..122991) [1392 bp, 463 aa] {ON}
            YHR018C (REAL)
          Length = 463

 Score = 47.4 bits (111), Expect = 6e-05
 Identities = 58/224 (25%), Positives = 87/224 (38%), Gaps = 1/224 (0%)
 Frame = +1

Query: 448  GEVGSKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEVTHLLLPELIALRDAFAKKAQEFDS 627
            GE+  + I    H  +  S ND   + + I     V   L P L  L D   K+A+   +
Sbjct: 97   GEIIGRDIAGKVHTGR--SRNDQVVTDLRIYCRDVVNDNLFPALKGLVDVLIKRAKGEIN 154

Query: 628  IVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHSLHNLKFLAQGGTAVGTGLNTKV 807
            I+  G THLQ A P+      S Y    T    R++  LH L     G  A+        
Sbjct: 155  ILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLDQILHRLNQSPLGAGAL-------A 207

Query: 808  GFAEKIAEQVSKETGIDFKTA-PNKFEALAAHDAVVECSGALNTLACSLFKIANDIRYLG 984
            G    I  +   E G+ F +   N   A++  D +VE           + + A D+  + 
Sbjct: 208  GHPYGIDREFLAE-GLGFNSVIGNSMVAVSDRDFIVELMFWGTLFMNHISRFAEDL-IIY 265

Query: 985  SGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGN 1116
                 G+ +LS      GSS+MP K N    E +     +V G+
Sbjct: 266  CTAEFGFIQLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>Smik_8.83 Chr8 complement(120320..121711) [1392 bp, 463 aa] {ON}
            YHR018C (REAL)
          Length = 463

 Score = 47.0 bits (110), Expect = 8e-05
 Identities = 61/238 (25%), Positives = 91/238 (38%), Gaps = 1/238 (0%)
 Frame = +1

Query: 406  ANEVISNRAIQLVGGEVGSKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEVTHLLLPELIA 585
            ANE    R  +L+G ++  K        +  +S ND   + + I     V   L P L  
Sbjct: 91   ANE---RRLGELIGRDIAGK-------VHTGRSRNDQVVTDLRIYCRDVVNGTLFPALKG 140

Query: 586  LRDAFAKKAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHSLHNLKFLA 765
            L D   K+A+    I+  G THLQ A P+      S Y    T    R+   LH L    
Sbjct: 141  LVDVLIKRAEGEIDILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLGQILHRLNQSP 200

Query: 766  QGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFKTA-PNKFEALAAHDAVVECSGALNTLA 942
             G  A+        G    I  +   E G+ F +   N   A++  D +VE         
Sbjct: 201  LGAGAL-------AGHPYGIDREFLAE-GLGFNSVIGNSLVAVSDRDFIVELMFWGTLFM 252

Query: 943  CSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGN 1116
              + + A D+  +      G+ +LS      GSS+MP K N    E +     +V G+
Sbjct: 253  NHISRFAEDL-IIYCTAEFGFIQLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>SAKL0D09746g Chr4 complement(808721..810115) [1395 bp, 464 aa] {ON}
            highly similar to uniprot|P04076 Saccharomyces cerevisiae
            YHR018C ARG4 Argininosuccinate lyase catalyzes the final
            step in the arginine biosynthesis pathway
          Length = 464

 Score = 47.0 bits (110), Expect = 8e-05
 Identities = 59/238 (24%), Positives = 92/238 (38%), Gaps = 2/238 (0%)
 Frame = +1

Query: 406  ANEVISNRAIQLVGGEVGSKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEVTHLLLPELIA 585
            ANE    R  +++G E+  K        +  +S ND   + M I     +  +LLP L A
Sbjct: 92   ANE---RRLGEIIGREISGK-------VHTGRSRNDQVATDMRIYCRDILNEVLLPALQA 141

Query: 586  LRDAFAKKAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHSLHNLKFLA 765
                   +A+E   ++  G THLQ A P+      S Y    T   +R++  +  L    
Sbjct: 142  FIKVLTTRAKEEIDVLMPGYTHLQRAQPIRWSHWLSSYATYFTEDYNRLKQIVERLNKSP 201

Query: 766  QG-GTAVGTGLNTKVGFAEKIAEQVSKETGIDFK-TAPNKFEALAAHDAVVECSGALNTL 939
             G G   G        F  +         G+ F+    N   A++  D VVE        
Sbjct: 202  LGAGALAGHPYGIDREFLAR---------GLGFQGVIGNSLTAVSDRDFVVEIMFWGTLF 252

Query: 940  ACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMG 1113
               + + + D+  + S    G+ +LS      GSS+MP K NP   E +     +V G
Sbjct: 253  MNHISRFSEDL-IIYSTAEFGFIKLS-DAYSTGSSLMPQKKNPDSLELLRGKAGRVFG 308

>Suva_15.201 Chr15 complement(348498..349889) [1392 bp, 463 aa] {ON}
            YHR018C (REAL)
          Length = 463

 Score = 46.6 bits (109), Expect = 1e-04
 Identities = 60/238 (25%), Positives = 91/238 (38%), Gaps = 1/238 (0%)
 Frame = +1

Query: 406  ANEVISNRAIQLVGGEVGSKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEVTHLLLPELIA 585
            ANE    R  +L+G ++  K        +  +S ND   + + I     V   L P +  
Sbjct: 91   ANE---RRLGELIGRDIAGK-------VHTGRSRNDQVVTDLRIYCRDVVNDSLFPAMKG 140

Query: 586  LRDAFAKKAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHSLHNLKFLA 765
            L D   K+A+    I+  G THLQ A P+      S Y    T    R+   LH L    
Sbjct: 141  LVDVLVKRAEGEMDILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLVQILHRLNQSP 200

Query: 766  QGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFKTA-PNKFEALAAHDAVVECSGALNTLA 942
             G  A+        G    I  +   E G+ F +   N   A++  D +VE         
Sbjct: 201  LGAGAL-------AGHPYGIDREFLAE-GLGFNSVIGNSLVAVSDRDFIVELMFWGTLFM 252

Query: 943  CSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGN 1116
              + + A D+  +      G+ +LS      GSS+MP K N    E +     +V G+
Sbjct: 253  NHISRFAEDL-IIYCTAEFGFIQLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>TPHA0B01040 Chr2 complement(235467..236915) [1449 bp, 482 aa] {ON}
            Anc_4.197 YLR359W
          Length = 482

 Score = 45.8 bits (107), Expect = 2e-04
 Identities = 46/181 (25%), Positives = 83/181 (45%), Gaps = 8/181 (4%)
 Frame = +1

Query: 562  LLLPELIALRDAFAKKAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHS 741
            +++P+L+ + D  +K A E+  +  +G TH Q A   TLG+  + ++Q+L   +     +
Sbjct: 127  VIIPKLVNVIDRLSKFAMEYKDLPVLGWTHFQPAQLTTLGKRSTLWIQELLWDLRNFVRA 186

Query: 742  LHNLKFLAQGGT--------AVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAA 897
             ++L      GT        A+  G + KV   E++ E+V++  G D  T         +
Sbjct: 187  RNDLGLRGVKGTTGTQASFLALFHGNHDKV---EELDERVTELLGFD--TVYPVTGQTYS 241

Query: 898  HDAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQN 1077
                ++    L + A +  K+A DIR L +       E    +++ GSS M  K NP + 
Sbjct: 242  RKIDIDVLAPLASFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPMRC 298

Query: 1078 E 1080
            E
Sbjct: 299  E 299

>NDAI0J01950 Chr10 (485753..487201) [1449 bp, 482 aa] {ON} Anc_4.197
            YLR359W
          Length = 482

 Score = 45.8 bits (107), Expect = 2e-04
 Identities = 66/315 (20%), Positives = 133/315 (42%), Gaps = 17/315 (5%)
 Frame = +1

Query: 562  LLLPELIALRDAFAKKAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHS 741
            L++P+L+ + D  +K A E+  +  +G TH Q A   TLG+  + ++Q+L   +     +
Sbjct: 127  LVIPKLVNVIDRLSKFAMEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFVRA 186

Query: 742  LHNLKFLAQGGTAVGTGLNTKVGF------AEKIAEQVSKETGIDFKTAPNKFEALAAHD 903
             +++      GT  GT  +    F       E + ++V++  G D  T         +  
Sbjct: 187  RNDIGLRGVKGT-TGTQASFLALFHGDHDKVEALDKRVTELLGFD--TVYPVTGQTYSRK 243

Query: 904  AVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLP--ENEPGSSIMPGKVNPTQN 1077
              ++    L++ A +  K+A DIR L +       EL  P  +++ GSS M  K NP + 
Sbjct: 244  IDIDVLAPLSSFAATAHKMATDIRLLAN-----LKELEEPFEKSQIGSSAMAYKRNPMRC 298

Query: 1078 EAMTQVCVQVMGNNAAITFAGASGQ-FELNVFKPVMISNLLSSIRLLGDACYSFRVHCVE 1254
            E +  +  + +G+  +     AS Q FE  +    +    L S  L  D   S  ++   
Sbjct: 299  ERVCSL-ARHLGSLFSDAVQTASVQWFERTLDDSAIRRISLPSAFLTTDILLSTLLNISS 357

Query: 1255 GI--------QANEDKIAKLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALE 1410
            G+        +  + ++  +  E++++          D   ++   +H+    +KE   +
Sbjct: 358  GLVVYPKVIERRIKSELPFMATENIIMAMVEKKASRQDVHERIRVLSHQAAAVVKEQGGD 417

Query: 1411 LGVLSSAEFDEWVVP 1455
              ++   + DE+  P
Sbjct: 418  NDLIERIQKDEYFKP 432

>YHR018C Chr8 complement(140011..141402) [1392 bp, 463 aa] {ON}
            ARG4Argininosuccinate lyase, catalyzes the final step in
            the arginine biosynthesis pathway
          Length = 463

 Score = 45.1 bits (105), Expect = 3e-04
 Identities = 59/238 (24%), Positives = 91/238 (38%), Gaps = 1/238 (0%)
 Frame = +1

Query: 406  ANEVISNRAIQLVGGEVGSKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEVTHLLLPELIA 585
            ANE    R  +L+G ++  K        +  +S ND   + + I     V   L P L  
Sbjct: 91   ANE---RRLGELIGRDIAGK-------VHTGRSRNDQVVTDLRIYCRDIVNDTLFPALKG 140

Query: 586  LRDAFAKKAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHSLHNLKFLA 765
            L +   K+A+    ++  G THLQ A P+      S Y    T    R+   LH L    
Sbjct: 141  LVEVLIKRAEGEIDVLMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLGQILHRLNQSP 200

Query: 766  QGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFKTA-PNKFEALAAHDAVVECSGALNTLA 942
             G  A+        G    I  +   E G+ F +   N   A++  D +VE         
Sbjct: 201  LGAGAL-------AGHPYGIDREFLAE-GLGFNSVIGNSLVAVSDRDFIVELMFWGTLFM 252

Query: 943  CSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGN 1116
              + + A D+  +      G+ +LS      GSS+MP K N    E +     +V G+
Sbjct: 253  NHISRFAEDL-IIYCTAEFGFIQLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>Kwal_47.18066 s47 (668459..669907) [1449 bp, 482 aa] {ON} YLR359W
            (ADE13) - Adenylosuccinate Lyase [contig 198] FULL
          Length = 482

 Score = 45.1 bits (105), Expect = 3e-04
 Identities = 65/312 (20%), Positives = 128/312 (41%), Gaps = 14/312 (4%)
 Frame = +1

Query: 562  LLLPELIALRDAFAKKAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHS 741
            +L+P+L+ + D  +K A E+  +  +G TH Q A   TLG+  + ++Q+L   +     +
Sbjct: 127  ILIPKLVNVIDRLSKFAMEWKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRA 186

Query: 742  LHNLKFLAQGGTAVGTG-----LNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAHDA 906
             +++      GT    G      ++     E + ++V++  G D  T         +   
Sbjct: 187  RNDIGLRGVKGTTGTQGSFLALFHSDHDKVEALDKRVTELLGFD--TVYPVTGQTYSRKI 244

Query: 907  VVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAM 1086
             ++    L++ A +  K+A DIR L +       E    +++ GSS M  K NP + E +
Sbjct: 245  DIDVLAPLSSFAATAHKMATDIRLLANLKEI---EEPFEKSQIGSSAMAYKRNPMRCERV 301

Query: 1087 TQVCVQVMGNNAAITFAGASGQ-FELNVFKPVMISNLLSSIRLLGDACYSFRVHCVEGIQ 1263
              +  + +G+  +     AS Q FE  +    +    L S  L  D   S  ++   G+ 
Sbjct: 302  CSL-ARHLGSLFSDAVQTASVQWFERTLDDSAIRRISLPSAFLTADILLSTLLNISSGLV 360

Query: 1264 ANEDKIAKLLHESLMLVTALN---PKIGYDAASKVAKNA-----HKKGITLKESALELGV 1419
                 I + +   L  +   N     +G  A+ +    A     H+    +KE   +  +
Sbjct: 361  VYPKVIERRIKSELPFMATENFIMAMVGKGASRQEVHEAIRVLSHQAAAVVKEEGGDNDL 420

Query: 1420 LSSAEFDEWVVP 1455
            +   + D++  P
Sbjct: 421  IERVKTDKFFEP 432

>TBLA0A08320 Chr1 complement(2043721..2045169) [1449 bp, 482 aa] {ON}
            Anc_4.197 YLR359W
          Length = 482

 Score = 45.1 bits (105), Expect = 3e-04
 Identities = 62/264 (23%), Positives = 113/264 (42%), Gaps = 9/264 (3%)
 Frame = +1

Query: 562  LLLPELIALRDAFAKKAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHS 741
            L++P+L+ + +  A  A E+  +  +G TH Q A   TLG+  + ++Q+L   +   E +
Sbjct: 127  LVIPKLVNVINRLANFALEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERA 186

Query: 742  LHNLKFLAQGGT--------AVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAA 897
             +++      GT        A+  G + KV   E++ E+V +  G D  T         +
Sbjct: 187  RNDIGLRGVKGTTGTQASFLALFHGNHDKV---EELDERVVELLGFD--TVYPVTGQTYS 241

Query: 898  HDAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQN 1077
                ++    L + A +  K+A DIR L +       E    +++ GSS M  K NP + 
Sbjct: 242  RKIDIDVVSPLVSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPMRC 298

Query: 1078 EAMTQVCVQVMGNNAAITFAGASGQ-FELNVFKPVMISNLLSSIRLLGDACYSFRVHCVE 1254
            E +  +  + +G+  + T   AS Q FE  +    +    L S  L  D   +  ++   
Sbjct: 299  ERVCSL-ARHLGSLLSDTVQTASVQWFERTLDDSAIRRISLPSAFLTTDILLTTLLNISS 357

Query: 1255 GIQANEDKIAKLLHESLMLVTALN 1326
            G+      IA+ +   L  +   N
Sbjct: 358  GLVVYPKVIARRIQSELPFMATEN 381

>NCAS0J01200 Chr10 (209722..211170) [1449 bp, 482 aa] {ON} Anc_4.197
            YLR359W
          Length = 482

 Score = 44.7 bits (104), Expect = 5e-04
 Identities = 65/313 (20%), Positives = 127/313 (40%), Gaps = 15/313 (4%)
 Frame = +1

Query: 562  LLLPELIALRDAFAKKAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHS 741
            +++P+L+ + D  +K A E+  +  +G TH Q A   TLG+  + ++Q+L   +     +
Sbjct: 127  IIIPKLVNVIDRLSKFAMEYKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRA 186

Query: 742  LHNLKFLAQGGTAVGTGLNTKVGF------AEKIAEQVSKETGIDFKTAPNKFEALAAHD 903
             +++      GT  GT  +    F       E + ++V++  G D  T         +  
Sbjct: 187  RNDIGLRGVKGT-TGTQASFLALFHGDHDKVEALDKRVTELLGFD--TVYPVTGQTYSRK 243

Query: 904  AVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEA 1083
              ++    L + A +  K+A DIR L +       E    +++ GSS M  K NP + E 
Sbjct: 244  IDIDVLAPLASFAATAHKMATDIRLLANLKEI---EEPFEKSQIGSSAMAYKRNPMRCER 300

Query: 1084 MTQVCVQVMGNNAAITFAGASGQ-FELNVFKPVMISNLLSSIRLLGDACYSFRVHCVEGI 1260
            +  +  + +G+  +     AS Q FE  +    +    L S  L  D   S  ++   G+
Sbjct: 301  VCSL-ARHLGSLFSDAVQTASVQWFERTLDDSAIRRISLPSAFLTADILLSTLLNISSGL 359

Query: 1261 QANEDKIAKLLHESLMLVTALNPKIG--------YDAASKVAKNAHKKGITLKESALELG 1416
                  I + +   L  +   N  +          D   ++   +H+    +KE   +  
Sbjct: 360  VVYPKVIERRIKSELPFMATENIIMAMVEKNASRQDVHEQIRVLSHQAAAVVKEQGGDND 419

Query: 1417 VLSSAEFDEWVVP 1455
            ++   + DE+  P
Sbjct: 420  LIQRIQADEFFKP 432

>ZYRO0G00748g Chr7 (57164..58552) [1389 bp, 462 aa] {ON} highly
            similar to uniprot|P04076 Saccharomyces cerevisiae
            YHR018C ARG4 Argininosuccinate lyase catalyzes the final
            step in the arginine biosynthesis pathway
          Length = 462

 Score = 44.3 bits (103), Expect = 6e-04
 Identities = 58/226 (25%), Positives = 86/226 (38%), Gaps = 1/226 (0%)
 Frame = +1

Query: 448  GEVGSKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEVTHLLLPELIALRDAFAKKAQEFDS 627
            GE+  + I    H  +  S ND   + M I     V   LLP L  L     K+A++   
Sbjct: 97   GEIIGRDIAGKVHTGR--SRNDQVVTDMRIFCRDTVNEKLLPGLKELVSVMVKRAEKEIG 154

Query: 628  IVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHSLHNLKFLAQGGTAVGTGLNTKV 807
             +  G THLQ A P+      S Y    T  + R+   L       Q     G       
Sbjct: 155  YLMPGYTHLQRAQPIRWSHWLSSYATYFTEDLKRLRQLLERFN---QSPLGAGALAGHPY 211

Query: 808  GF-AEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTLACSLFKIANDIRYLG 984
            G   E +AE++  +  I      N   A++  D VVE           + + A D+  + 
Sbjct: 212  GIDREFLAEELGFQGVIG-----NSLVAVSDRDFVVELMFWGTLFMNHISRFAEDL-IIY 265

Query: 985  SGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNA 1122
            S    G+ +L+      GSS+MP K N    E +     +V G+ A
Sbjct: 266  STAEFGFIKLN-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGDLA 310

>TBLA0F03480 Chr6 (857021..858421) [1401 bp, 466 aa] {ON} Anc_1.354
            YHR018C
          Length = 466

 Score = 43.9 bits (102), Expect = 8e-04
 Identities = 53/215 (24%), Positives = 82/215 (38%), Gaps = 1/215 (0%)
 Frame = +1

Query: 472  HPNNHCNQAQSSNDTFPSVMHIAAVTEVTHLLLPELIALRDAFAKKAQEFDSIVKIGRTH 651
            H     +  +S ND   + + I     +   LLP +I L     K+A+    I+  G TH
Sbjct: 103  HIAGKVHTGRSRNDQCVTDLRIYCRDILVEKLLPFMIDLVQVITKRAENEIDILMPGYTH 162

Query: 652  LQDATPLTLGQEFSGYVQQLTNGISRVEHSLHNLKFLAQGGTAVGTGLNTKVGFAEKIAE 831
            LQ A P+      S Y    T    R++  L  L     G  A+        G    I  
Sbjct: 163  LQRAQPIRWSHWLSSYATYFTEDYKRLKQVLERLNKCPLGAGAI-------AGHPYGIDR 215

Query: 832  Q-VSKETGIDFKTAPNKFEALAAHDAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYG 1008
            Q +S E G +     N   A++  D +V+           + + + D+  + S    G+ 
Sbjct: 216  QYLSDELGFN-SIIGNSLVAVSDRDFIVDIMFWSTLFMNHISRFSEDL-IIYSTAEFGFI 273

Query: 1009 ELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMG 1113
            +LS      GSS+MP K N    E +     +V G
Sbjct: 274  KLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFG 307

>KAFR0A06230 Chr1 complement(1257709..1259157) [1449 bp, 482 aa] {ON}
            Anc_4.197 YLR359W
          Length = 482

 Score = 43.9 bits (102), Expect = 8e-04
 Identities = 46/181 (25%), Positives = 81/181 (44%), Gaps = 8/181 (4%)
 Frame = +1

Query: 562  LLLPELIALRDAFAKKAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHS 741
            +L+P+L+ + +   K A     +  +G TH Q A   TLG+  + ++Q+L   +   E +
Sbjct: 127  ILIPKLVNVINRLCKFAMANKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERA 186

Query: 742  LHNLKFLAQGGT--------AVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAA 897
             +++      GT        A+  G + KV   EK+ E+V +  G D  T         +
Sbjct: 187  RNDIGLRGVKGTTGTQASFLALFHGDHNKV---EKLDERVVELLGFD--TVYPVTGQTYS 241

Query: 898  HDAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQN 1077
                ++    L++ A +  K+A DIR L +       E    +++ GSS M  K NP + 
Sbjct: 242  RKIDIDAFAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPMRC 298

Query: 1078 E 1080
            E
Sbjct: 299  E 299

>KNAG0I01560 Chr9 (303704..305092) [1389 bp, 462 aa] {ON} Anc_1.354
            YHR018C
          Length = 462

 Score = 43.5 bits (101), Expect = 0.001
 Identities = 58/226 (25%), Positives = 86/226 (38%), Gaps = 1/226 (0%)
 Frame = +1

Query: 448  GEVGSKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEVTHLLLPELIALRDAFAKKAQEFDS 627
            GE+  + I    H  +  S ND   + M I     +   LLP +  L     K+A+    
Sbjct: 97   GEIIGRHIAGKVHTGR--SRNDQVVTDMRIYCRDILNEKLLPFMADLIKVLVKRAENEID 154

Query: 628  IVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHSLHNLKFLAQGGTAVGTGLNTKV 807
             +  G THLQ A P+      S Y    T    R++  L  L     G  A+        
Sbjct: 155  TLMPGYTHLQRAQPIRWAHWLSSYATYFTEDYKRLKQILERLNVSPLGAGAL-------A 207

Query: 808  GFAEKIAEQVSKETGIDF-KTAPNKFEALAAHDAVVECSGALNTLACSLFKIANDIRYLG 984
            G    I  +   E G++F     N   A++  D VVE           + + A D+  + 
Sbjct: 208  GHPYGIDREFLAE-GLNFGGVIGNSLVAVSDRDFVVELMFWGTLFMNHISRFAEDL-IIY 265

Query: 985  SGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNA 1122
            S    G+ +LS      GSS+MP K N    E +     +V G+ A
Sbjct: 266  STAEFGFVKLS-DSYSTGSSLMPQKKNADSLELLRGKSGRVFGDLA 310

>KNAG0B05840 Chr2 (1150025..1151473) [1449 bp, 482 aa] {ON} Anc_4.197
            YLR359W
          Length = 482

 Score = 43.5 bits (101), Expect = 0.001
 Identities = 44/179 (24%), Positives = 81/179 (45%), Gaps = 6/179 (3%)
 Frame = +1

Query: 562  LLLPELIALRDAFAKKAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHS 741
            L++P+L+ + D  +K A ++  +  +G TH Q A   TLG+  + ++Q+L   +     +
Sbjct: 127  LVIPKLVNVIDRLSKFALQYKDLPVLGWTHFQPAQLTTLGKRTTLWIQELLWDLRNFVRA 186

Query: 742  LHNLKFLAQGGTAVGTGLNTKVGF------AEKIAEQVSKETGIDFKTAPNKFEALAAHD 903
             +++      GT  GT  +    F       E + ++V++  G D  T         +  
Sbjct: 187  RNDIGLRGVKGT-TGTQASFLALFHGDHDKVEALDKRVTELLGFD--TVYPVTGQTYSRK 243

Query: 904  AVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 1080
              ++    L++ A S  K+A DIR L +       E    +++ GSS M  K NP + E
Sbjct: 244  IDIDVLAPLSSFAASAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPMRCE 299

>Ecym_2749 Chr2 complement(1453019..1454431) [1413 bp, 470 aa] {ON}
            similar to Ashbya gossypii AEL019W
          Length = 470

 Score = 43.1 bits (100), Expect = 0.001
 Identities = 66/286 (23%), Positives = 107/286 (37%), Gaps = 6/286 (2%)
 Frame = +1

Query: 274  LGTLDPK----VSKPIQDAADEVISGKLIDHFPLVVFQTGSGTQSNMNANEVISNRAIQL 441
            +G LD +    + K + +   E  SGK  +H            +    ANE    R  +L
Sbjct: 52   IGLLDVEELSLIHKGLLEIESEWSSGKFEEH---------PDDEDIHTANE---RRLGEL 99

Query: 442  VGGEVGSKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEVTHLLLPELIALRDAFAKKAQEF 621
            +G  V  K        +  +S ND   + M I     +   +LP + +       +A+E 
Sbjct: 100  IGTAVAGK-------VHTGRSRNDQVATDMRIYCREILNEKILPAVSSFIRVLINRAREE 152

Query: 622  DSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHSLHNLKFLAQGGTAVGTGLNT 801
              ++  G THLQ A P+      S Y    T   +R+   +  L    Q     G     
Sbjct: 153  VDVLMPGYTHLQRAQPIRWSHWLSCYATYFTEDYNRLRQVVERLN---QSPLGAGALAGH 209

Query: 802  KVGFAEK-IAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTLACSLFKIANDIRY 978
              G   K +AEQ+     I      N   A++  D V+E     +     + + A D+  
Sbjct: 210  PYGIDRKYLAEQLGFNGIIG-----NSLVAVSDRDFVIEIMFWGSLFMNHISRFAEDLII 264

Query: 979  LGSGPRCGYGELSLPE-NEPGSSIMPGKVNPTQNEAMTQVCVQVMG 1113
              +     +G ++L +    GSS+MP K NP   E +     +V G
Sbjct: 265  YSTAE---FGFINLADAYSTGSSLMPQKKNPDSLELLRGKSGRVFG 307

>ZYRO0B07964g Chr2 complement(620761..622209) [1449 bp, 482 aa] {ON}
            highly similar to uniprot|Q05911 Saccharomyces cerevisiae
            YLR359W ADE13 Adenylosuccinate lyase catalyzes two steps
            in the 'de novo' purine nucleotide biosynthetic pathway
          Length = 482

 Score = 43.1 bits (100), Expect = 0.001
 Identities = 44/181 (24%), Positives = 82/181 (45%), Gaps = 8/181 (4%)
 Frame = +1

Query: 562  LLLPELIALRDAFAKKAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHS 741
            +++P+LI + D  +K A  +  +  +G TH Q A   TLG+  + ++Q L   +   + +
Sbjct: 127  VIIPKLINVIDRLSKFALNYKDVPVLGWTHFQPAQLTTLGKRVTLWIQDLLWDLRNFDRA 186

Query: 742  LHNLKFLAQGGT--------AVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAA 897
             +++      GT        A+  G + KV   E++ ++V++  G  F+T         +
Sbjct: 187  RNDIGLRGVKGTTGTQASFLALFHGNHDKV---EELDQRVTELLG--FETVYPVTGQTYS 241

Query: 898  HDAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQN 1077
                ++    L + A +  K+A DIR L +       E    + + GSS M  K NP + 
Sbjct: 242  RKIDIDVLAPLASFAATAHKMATDIRLLANLKEV---EEPFEKTQIGSSAMAYKRNPMRC 298

Query: 1078 E 1080
            E
Sbjct: 299  E 299

>Kpol_1042.16 s1042 (40749..42197) [1449 bp, 482 aa] {ON}
            (40749..42197) [1449 nt, 483 aa]
          Length = 482

 Score = 43.1 bits (100), Expect = 0.001
 Identities = 42/181 (23%), Positives = 80/181 (44%), Gaps = 8/181 (4%)
 Frame = +1

Query: 562  LLLPELIALRDAFAKKAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHS 741
            +++P+L+ + D  AK A E+  +  +G TH Q A   T+G+  + ++Q+L   +     +
Sbjct: 127  IIIPKLVNVIDRLAKFASEYKDLPVLGWTHFQPAQLTTMGKRATLWIQELLWDLRNFVRA 186

Query: 742  LHNLKFLAQGGT--------AVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAA 897
             +++      GT        A+  G + KV   +K   ++     + F T         +
Sbjct: 187  RNDIGLRGVKGTTGTQASFLALFHGDDDKVEALDKRVVEL-----LGFDTVYPVTGQTYS 241

Query: 898  HDAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQN 1077
                ++    L++ A +  K+A DIR L +       E    +++ GSS M  K NP + 
Sbjct: 242  RKIDIDVLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPMRC 298

Query: 1078 E 1080
            E
Sbjct: 299  E 299

>Kpol_1018.125 s1018 complement(330965..332347) [1383 bp, 460 aa] {ON}
            complement(330965..332347) [1383 nt, 461 aa]
          Length = 460

 Score = 42.7 bits (99), Expect = 0.002
 Identities = 60/238 (25%), Positives = 90/238 (37%), Gaps = 1/238 (0%)
 Frame = +1

Query: 406  ANEVISNRAIQLVGGEVGSKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEVTHLLLPELIA 585
            ANE    R  +L+G ++  K        +  +S ND   + + I     +   LLP L +
Sbjct: 89   ANE---RRLGELIGTDISGK-------VHTGRSRNDQCVTDLRIYCRDIIQDKLLPSLKS 138

Query: 586  LRDAFAKKAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHSLHNLKFLA 765
            L     K+ +    I+  G THLQ A P+      S Y    T    R++  L  L    
Sbjct: 139  LIQVLVKRGEGEIGILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLKQLLDRLNVSP 198

Query: 766  QGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFK-TAPNKFEALAAHDAVVECSGALNTLA 942
             G  A+        G    I ++     G+ F     N   A++  D VVE         
Sbjct: 199  LGAGAL-------AGHPYGI-DREFLANGLGFNGVIGNSLVAVSDRDFVVELLFWGTLFM 250

Query: 943  CSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGN 1116
              + + A D+  + S    G+  LS      GSS+MP K N    E +     +V GN
Sbjct: 251  NHISRFAEDL-IIYSTAEFGFITLS-DAYSTGSSLMPQKKNSDSLELLRGKSGRVFGN 306

>Ecym_2452 Chr2 (881643..883091) [1449 bp, 482 aa] {ON} similar to
            Ashbya gossypii ABL006C
          Length = 482

 Score = 42.7 bits (99), Expect = 0.002
 Identities = 46/187 (24%), Positives = 86/187 (45%), Gaps = 14/187 (7%)
 Frame = +1

Query: 562  LLLPELIALRDAFAKKAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHS 741
            +L+P+L+ + +  +  A ++  +  +G TH Q A   TLG+  + ++Q+L   +     +
Sbjct: 127  ILIPKLVNVINRLSTFAIKYKDLPVLGWTHYQPAQLTTLGKRVTLWIQELLWDLRNFVRA 186

Query: 742  LHNLKFLAQGGTAVGTGLNTKVGF------AEKIAEQVSKETGIDF------KTAPNKFE 885
             +++ F    GT  GT  +    F       E + ++V++ +G D       +T   K +
Sbjct: 187  RNDIGFRGVKGT-TGTQASFLALFHGDHDKVEALDKRVAELSGFDIIYPVTGQTYSRKVD 245

Query: 886  ALAAHDAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLP--ENEPGSSIMPGK 1059
                    ++  G L++ A +  K+A DIR L +       EL  P   ++ GSS M  K
Sbjct: 246  --------IDVLGPLSSFAATSHKLATDIRLLAN-----LKELEEPFEASQIGSSAMAYK 292

Query: 1060 VNPTQNE 1080
             NP + E
Sbjct: 293  RNPMRCE 299

>KLLA0B13189g Chr2 complement(1153780..1155228) [1449 bp, 482 aa] {ON}
            highly similar to uniprot|Q05911 Saccharomyces cerevisiae
            YLR359W ADE13 Adenylosuccinate lyase catalyzes two steps
            in the 'de novo' purine nucleotide biosynthetic pathway
          Length = 482

 Score = 42.7 bits (99), Expect = 0.002
 Identities = 45/181 (24%), Positives = 83/181 (45%), Gaps = 8/181 (4%)
 Frame = +1

Query: 562  LLLPELIALRDAFAKKAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHS 741
            +L+P+L+ + +  +K A E+  +  +G TH Q A   TLG+  + ++Q+L   +     +
Sbjct: 127  ILIPKLVNVINRLSKFALEYKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRA 186

Query: 742  LHNLKFLAQGGTAVGTGLNTKVGF------AEKIAEQVSKETGIDFKTAPNKFEALAAHD 903
             +++      GT  GT  +    F       E + ++V++  G  F T         +  
Sbjct: 187  RNDIGLRGVKGT-TGTQASFLTLFHGDHDKVEALDKRVAELLG--FSTVYPVTGQTYSRK 243

Query: 904  AVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLP--ENEPGSSIMPGKVNPTQN 1077
              ++    L++ A +  K+A DIR L +       EL  P  +++ GSS M  K NP + 
Sbjct: 244  IDIDVLAPLSSFAATAHKMATDIRLLAN-----LKELEEPFEKSQIGSSAMAYKRNPMRC 298

Query: 1078 E 1080
            E
Sbjct: 299  E 299

>TDEL0D02220 Chr4 (428430..429827) [1398 bp, 465 aa] {ON} Anc_1.354
            YHR018C
          Length = 465

 Score = 42.4 bits (98), Expect = 0.002
 Identities = 54/225 (24%), Positives = 86/225 (38%)
 Frame = +1

Query: 448  GEVGSKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEVTHLLLPELIALRDAFAKKAQEFDS 627
            GE+  ++I    H  +  S ND   + + I     +   L P+L AL D   K+ +E   
Sbjct: 97   GEIIGRNIAGKVHTGR--SRNDQCVTDLRIYCRDLLNDKLFPDLQALVDVMIKRGKEEID 154

Query: 628  IVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHSLHNLKFLAQGGTAVGTGLNTKV 807
            ++  G THLQ A P+      S Y    T    R+   +  +    Q     G       
Sbjct: 155  VLMPGYTHLQRAQPIRWSHWLSSYATYFTEDFKRLRQIMDRIN---QSPLGAGALAGHPY 211

Query: 808  GFAEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTLACSLFKIANDIRYLGS 987
            G      E ++   G D     N   A++  D +VE           + + A D+  + S
Sbjct: 212  GIDR---EFLAAGLGFD-GVIGNSLVAVSDRDFIVELMFWGTLFMNHISRFAEDL-IIYS 266

Query: 988  GPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNA 1122
                G+ +L+      GSS+MP K N    E +     +V G+ A
Sbjct: 267  TAEFGFIKLN-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGDLA 310

>AEL019W Chr5 (600410..601819) [1410 bp, 469 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YHR018C (ARG4)
          Length = 469

 Score = 42.0 bits (97), Expect = 0.003
 Identities = 51/217 (23%), Positives = 82/217 (37%)
 Frame = +1

Query: 472  HPNNHCNQAQSSNDTFPSVMHIAAVTEVTHLLLPELIALRDAFAKKAQEFDSIVKIGRTH 651
            H +   +  +S ND   + M +     +   + P L  L      +A+E   ++  G TH
Sbjct: 103  HISGKVHTGRSRNDQVATDMRLYCREMLQDKVEPALFELIKVLLHRAREEIDVLMPGYTH 162

Query: 652  LQDATPLTLGQEFSGYVQQLTNGISRVEHSLHNLKFLAQGGTAVGTGLNTKVGFAEKIAE 831
            LQ A P+      S Y         R++  +  L    Q     G       G      E
Sbjct: 163  LQRAQPIRWSHWLSCYATYFVEDFKRLKEVIARLN---QSPLGAGALAGHPYGIDR---E 216

Query: 832  QVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGE 1011
             ++ E G D     N   A++  D VVE     +     + ++A D+  + S    G+ +
Sbjct: 217  YLACELGFD-GVIGNSMTAVSDRDFVVEIMSWGSLFMNHISRLAEDL-IIYSTAEFGFVK 274

Query: 1012 LSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNA 1122
            L+      GSS+MP K NP   E +     +V G  A
Sbjct: 275  LA-DAYSTGSSLMPQKRNPDSLELLRGKSGRVFGQLA 310

>SAKL0B04972g Chr2 (430349..431797) [1449 bp, 482 aa] {ON} highly
            similar to uniprot|Q05911 Saccharomyces cerevisiae
            YLR359W ADE13 Adenylosuccinate lyase catalyzes two steps
            in the 'de novo' purine nucleotide biosynthetic pathway
          Length = 482

 Score = 40.8 bits (94), Expect = 0.007
 Identities = 42/179 (23%), Positives = 81/179 (45%), Gaps = 6/179 (3%)
 Frame = +1

Query: 562  LLLPELIALRDAFAKKAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHS 741
            +L+P+L+ + +  ++ A E+  +  +G TH Q A   TLG+  + ++Q+L   +     +
Sbjct: 127  ILIPKLVNVINRLSQFALEYKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRA 186

Query: 742  LHNLKFLAQGGTAVGTGLNTKVGF------AEKIAEQVSKETGIDFKTAPNKFEALAAHD 903
             +++      GT  GT  +    F       E + ++V++  G D  T         +  
Sbjct: 187  RNDIGLRGVKGT-TGTQASFLALFHGDHDKVEALDKRVTELLGFD--TVYPVTGQTYSRK 243

Query: 904  AVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 1080
              ++    L++ A +  K+A DIR L +       E    +++ GSS M  K NP + E
Sbjct: 244  IDIDVLAPLSSFAATAHKMATDIRLLANLKEM---EEPFEKSQIGSSAMAYKRNPMRCE 299

>TPHA0A02190 Chr1 (452902..454293) [1392 bp, 463 aa] {ON} Anc_1.354
            YHR018C
          Length = 463

 Score = 38.9 bits (89), Expect = 0.029
 Identities = 57/238 (23%), Positives = 90/238 (37%), Gaps = 1/238 (0%)
 Frame = +1

Query: 406  ANEVISNRAIQLVGGEVGSKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEVTHLLLPELIA 585
            ANE    R  +++G ++  K        +  +S ND   + + I     ++  LL  L  
Sbjct: 91   ANE---RRLGEIIGTKISGK-------VHTGRSRNDQCVTDLRIYCREYLSDKLLKNLET 140

Query: 586  LRDAFAKKAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHSLHNLKFLA 765
            L +    +A+E    +  G THLQ A P+      S Y         R+      L    
Sbjct: 141  LINVLINRAEEEIEFIMPGYTHLQRAQPIRWSHWLSSYATYFLEDYKRLVQLKERLNKSP 200

Query: 766  QGGTAVGTGLNTKVGFAEKI-AEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTLA 942
             G  A+        G    I  E ++++ G D     N   A++  D VVE         
Sbjct: 201  LGAGALA-------GHPYGIDREYLAEKLGFD-SVIGNSLVAVSDRDFVVEILFWSTLFM 252

Query: 943  CSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGN 1116
              + + A D+  + S    G+ +LS      GSS+MP K N    E +     +V GN
Sbjct: 253  NHISRFAEDL-IIYSTAEFGFIKLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGN 308

>ABL006C Chr2 complement(385134..386582) [1449 bp, 482 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YLR359W
            (ADE13)
          Length = 482

 Score = 38.9 bits (89), Expect = 0.030
 Identities = 42/185 (22%), Positives = 82/185 (44%), Gaps = 12/185 (6%)
 Frame = +1

Query: 562  LLLPELIALRDAFAKKAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHS 741
            +++P+L+ + +  +K A E+  +  +G TH Q A   TLG+  + ++Q+L   +     +
Sbjct: 127  IIIPKLVNVINRLSKFACEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFVRA 186

Query: 742  LHNLKFLAQGGTAVGTGLNTKVGF------AEKIAEQVSKETGIDF------KTAPNKFE 885
             +++      GT  GT  +    F       E + ++V++  G D       +T   K +
Sbjct: 187  RNDIGLRGVKGT-TGTQASFLALFHGDHDRVEALDKRVTELLGFDIVYPVTGQTYSRKID 245

Query: 886  ALAAHDAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVN 1065
                    ++  G+ ++   +  K+A DIR L +       E    + + GSS M  K N
Sbjct: 246  --------IDILGSGSSFEATAHKMATDIRLLANLKEV---EEPFEKTQIGSSAMAYKRN 294

Query: 1066 PTQNE 1080
            P + E
Sbjct: 295  PMRCE 299

>TDEL0E01760 Chr5 complement(337315..338763) [1449 bp, 482 aa] {ON}
            Anc_4.197 YLR359W
          Length = 482

 Score = 38.5 bits (88), Expect = 0.039
 Identities = 41/179 (22%), Positives = 80/179 (44%), Gaps = 6/179 (3%)
 Frame = +1

Query: 562  LLLPELIALRDAFAKKAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHS 741
            L++P+L+ + +  +  A ++  +  +G TH Q A   TLG+  + ++Q+L   +     +
Sbjct: 127  LIIPKLVNVINRLSDFALKYKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRA 186

Query: 742  LHNLKFLAQGGTAVGTGLNTKVGF------AEKIAEQVSKETGIDFKTAPNKFEALAAHD 903
             +++      GT  GT  +    F       E + ++V++  G D  T         +  
Sbjct: 187  RNDIGLRGVKGT-TGTQASFLALFHGDHDKVEALDKRVTELLGFD--TVYPVTGQTYSRK 243

Query: 904  AVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 1080
              ++    L++ A +  K+A DIR L +       E    +++ GSS M  K NP + E
Sbjct: 244  IDIDVLSPLSSFAATAHKMATDIRLLANLKEM---EEPFEKSQIGSSAMAYKRNPMRCE 299

>KLTH0A03344g Chr1 (289188..290636) [1449 bp, 482 aa] {ON} highly
            similar to uniprot|Q05911 Saccharomyces cerevisiae
            YLR359W ADE13 Adenylosuccinate lyase catalyzes two steps
            in the 'de novo' purine nucleotide biosynthetic pathway
          Length = 482

 Score = 37.4 bits (85), Expect = 0.090
 Identities = 41/179 (22%), Positives = 80/179 (44%), Gaps = 6/179 (3%)
 Frame = +1

Query: 562  LLLPELIALRDAFAKKAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHS 741
            +L+P+L+ + +  ++ A ++  +  +G TH Q A   TLG+  + ++Q+L   +     +
Sbjct: 127  ILIPKLVNVINRLSQFALQWKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRA 186

Query: 742  LHNLKFLAQGGTAVGTGLNTKVGF------AEKIAEQVSKETGIDFKTAPNKFEALAAHD 903
             +++      GT  GT  +    F       E + ++V++  G D  T         +  
Sbjct: 187  RNDIGLRGVKGT-TGTQASFLALFHGDHDKVEALDKRVTELLGFD--TVYPVTGQTYSRK 243

Query: 904  AVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 1080
              ++    L + A +  K+A DIR L +       E    +++ GSS M  K NP + E
Sbjct: 244  IDIDVLAPLCSFAATAHKMATDIRLLANLKEI---EEPFEKSQIGSSAMAYKRNPMRCE 299

>Kwal_27.12782 s27 complement(1373166..1374563) [1398 bp, 465 aa] {ON}
            YHR018C (ARG4) - argininosuccinate lyase [contig 260]
            FULL
          Length = 465

 Score = 36.2 bits (82), Expect = 0.20
 Identities = 59/261 (22%), Positives = 99/261 (37%), Gaps = 10/261 (3%)
 Frame = +1

Query: 370  FQTGSGTQSNMNANEVISNRAIQLVGGEVGSKSIHPNNHCNQAQSSNDTFPSVMHIAAVT 549
            F    G +    ANE    R  +++G  +  K        +  +S ND   + M I    
Sbjct: 81   FVEKDGDEDIHTANE---RRLGEIIGRHIAGK-------VHTGRSRNDQVATDMRIYCRE 130

Query: 550  EVTHL--LLPELIALRDAFAKKAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGI 723
             + +L  +L +LI       +  QE D+++  G THLQ A P+      + Y    T   
Sbjct: 131  ALDNLAKILEDLIGA--ILQRSEQEIDALMP-GYTHLQRAQPIRWSHWLNLYATYFTEDF 187

Query: 724  SRVEHSLHNLKFLAQGGTAVGTG--------LNTKVGFAEKIAEQVSKETGIDFKTAPNK 879
             R++     L     G  A+           L  ++GF++ I                N 
Sbjct: 188  KRLKQIRERLNVSPLGCGALAGHPYGIDREFLAERLGFSDVIG---------------NS 232

Query: 880  FEALAAHDAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGK 1059
             +A++  D VVE     +     + + + D+  + S     + +LS      GSS+MP K
Sbjct: 233  LQAVSDRDFVVEIMFWCSLFMNHISRFSEDL-IIYSTAEFNFVKLS-DAYSTGSSLMPQK 290

Query: 1060 VNPTQNEAMTQVCVQVMGNNA 1122
             NP   E +     +V G+ A
Sbjct: 291  KNPDSLELLRGKSGRVFGSLA 311

>KLTH0G19338g Chr7 complement(1665123..1666520) [1398 bp, 465 aa] {ON}
            highly similar to uniprot|P04076 Saccharomyces cerevisiae
            YHR018C ARG4 Argininosuccinate lyase catalyzes the final
            step in the arginine biosynthesis pathway
          Length = 465

 Score = 36.2 bits (82), Expect = 0.20
 Identities = 61/257 (23%), Positives = 100/257 (38%), Gaps = 8/257 (3%)
 Frame = +1

Query: 370  FQTGSGTQSNMNANEVISNRAIQLVGGEVGSKSIHPNNHCNQAQSSNDTFPSVMHIAAVT 549
            F    G +    ANE    R  +++G  +  K        +  +S ND   + M I    
Sbjct: 81   FVEKDGDEDIHTANE---RRLGEIIGRHIAGK-------VHTGRSRNDQVATDMRIYCRE 130

Query: 550  EVTHL--LLPELIALRDAFAKKAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGI 723
             + ++  +L +L+       +  QE D+++  G THLQ A P+      + Y    T   
Sbjct: 131  ALDNMAKILKDLVGA--ILQRAEQEIDALMP-GYTHLQRAQPIRWSHWLNLYATYFTEDF 187

Query: 724  SRVEHSLHNLKFLAQGGTAVGTGLNTKVGFAEKI-AEQVSKETGIDFKTAPNKFEALAAH 900
             R++     L     G  A+        G    I  E +++  G D     N  +A++  
Sbjct: 188  KRLKQIRERLNVSPLGCGALA-------GHPYGIDREHIAERLGFD-GVIGNSLQAVSDR 239

Query: 901  DAVVECSGALNTLACSLF-----KIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVN 1065
            D VVE         CSLF     + + D+  + S     + +LS      GSS+MP K N
Sbjct: 240  DFVVEI-----LFWCSLFMNHISRFSEDL-IIYSTAEFNFVKLS-DAYSTGSSLMPQKKN 292

Query: 1066 PTQNEAMTQVCVQVMGN 1116
            P   E +     +V G+
Sbjct: 293  PDSLELLRGKSGRVFGS 309

>Suva_4.494 Chr4 (862220..864772) [2553 bp, 850 aa] {ON} YBR237W
           (REAL)
          Length = 850

 Score = 35.4 bits (80), Expect = 0.41
 Identities = 26/92 (28%), Positives = 45/92 (48%), Gaps = 6/92 (6%)
 Frame = +1

Query: 250 SAAIVNESLGTLDPKVSKPIQDAADEVISGKLIDHFPLVVFQTGSGTQSNMNANEVISNR 429
           S A+ ++ L   DP  +K + + +D+  SG     F L     G G ++  +  E   N+
Sbjct: 641 SKAMRDDELKASDPLQTKELHEMSDKFESGMKKGKFRLSKGFGGKGLENIKSKREEAQNK 700

Query: 430 AIQLVGGE-----VGSKSIH-PNNHCNQAQSS 507
            ++   G+     + +KS H PN H N+A+SS
Sbjct: 701 ELEHKKGQKNNDQLENKSDHSPNEHANEAESS 732

>Ecym_6358 Chr6 complement(694398..696944) [2547 bp, 848 aa] {ON}
           similar to Ashbya gossypii AFR077W
          Length = 848

 Score = 33.9 bits (76), Expect = 1.2
 Identities = 22/89 (24%), Positives = 42/89 (47%), Gaps = 6/89 (6%)
 Frame = +1

Query: 712 TNGISRVEHSLHNLKFLAQGGTAVGTGLNTKVGFAEKIAEQVSK---ETGIDFKTAPNKF 882
           +NG  + +HS +N+KF+ +    +  G    + +   +   + K    T +D    P+KF
Sbjct: 491 SNGTQQQQHSNNNVKFVLRAIRDIEKGEELHINWDWDLRHPICKVIDGTPVDSIPEPDKF 550

Query: 883 EALAAHDAVV---ECSGALNTLACSLFKI 960
             + + D V+   +C+   N   C LFK+
Sbjct: 551 LLIHSVDTVLSMGDCACGANNKDCHLFKV 579

>KNAG0D03480 Chr4 complement(625236..628724) [3489 bp, 1162 aa] {ON}
           Anc_4.117 YGL006W
          Length = 1162

 Score = 33.9 bits (76), Expect = 1.3
 Identities = 24/72 (33%), Positives = 38/72 (52%), Gaps = 12/72 (16%)
 Frame = +1

Query: 100 VETDAFGEIKVPTDKLWGAQTQRSLENFKIGGQRERMPEPIVKAFG------------IL 243
           ++TD    IKVP ++  G Q  RS + ++  G   R+PE + K+FG            +L
Sbjct: 52  LKTDLETGIKVPLNETEGTQNHRSTDRYRKYGD-NRIPERLPKSFGKLIWEAFNDKTMLL 110

Query: 244 KKSAAIVNESLG 279
             +AAIV+ +LG
Sbjct: 111 LTAAAIVSFALG 122

>TDEL0G04710 Chr7 (860069..861289) [1221 bp, 406 aa] {ON} 
          Length = 406

 Score = 32.3 bits (72), Expect = 3.1
 Identities = 20/53 (37%), Positives = 28/53 (52%), Gaps = 5/53 (9%)
 Frame = +1

Query: 175 ENFK-IGGQRERMP----EPIVKAFGILKKSAAIVNESLGTLDPKVSKPIQDA 318
           EN K  GG + R+P     P+V+   +LK+ A  VNES      ++ KP  DA
Sbjct: 275 ENSKGAGGVQRRLPTAHIHPLVRVHPVLKRKALFVNESFSRRIVELKKPESDA 327

>Suva_4.223 Chr4 complement(395869..397719) [1851 bp, 616 aa] {ON}
           YDL025C (REAL)
          Length = 616

 Score = 32.0 bits (71), Expect = 4.6
 Identities = 20/69 (28%), Positives = 31/69 (44%), Gaps = 10/69 (14%)
 Frame = +1

Query: 184 KIGGQRERMPEPIVKAFGILKKSAAIVNESL----------GTLDPKVSKPIQDAADEVI 333
           K+GG+R    +  V    +LK+S A+ N SL            +D   S+P+ D    V 
Sbjct: 69  KLGGRRSSTGKNSVGNSPLLKESHAVANPSLLASSPTSLKKAAIDAPTSRPLHDTHTPVR 128

Query: 334 SGKLIDHFP 360
           +G  + H P
Sbjct: 129 TGHNVPHLP 137

>KLTH0E14586g Chr5 (1293773..1297870) [4098 bp, 1365 aa] {ON} weakly
            similar to uniprot|P38198 Saccharomyces cerevisiae
            YBL034C STU1 Component of the mitotic spindle that binds
            to interpolar microtubules via its association with
            beta-tubulin (Tub2p) required for interpolar microtubules
            to provide an outward force on the spindle poles
          Length = 1365

 Score = 31.6 bits (70), Expect = 6.7
 Identities = 56/219 (25%), Positives = 87/219 (39%), Gaps = 16/219 (7%)
 Frame = +1

Query: 283  LDPKVSKPIQDAAD--------EVISGKLIDHFPLVVFQTGSGT------QSNMNANEVI 420
            L+ K   P  D +D        +V S K  D+ P ++ QTG+        +S+ +   + 
Sbjct: 968  LENKSETPDVDLSDIFSEGRGKKVNSVKFHDN-PSIIQQTGTSCCGVKKLESSNDLETIS 1026

Query: 421  SNRAIQLVGGEVGSKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEVTHLLLPELIALRDAF 600
            SN +     G + +KS H N+  + A    +     MHIAA         PE  A+  A 
Sbjct: 1027 SNNSDLDTVGTIEAKSDHENSQSDPAGQEFEERAWSMHIAARNS------PEKGAIGSAA 1080

Query: 601  AKKAQEFDSIV--KIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHSLHNLKFLAQGG 774
             K   + + I   KI    L    PL L  E    +  L  GI     S+ ++    + G
Sbjct: 1081 VKTCSKKEDIPRRKIDFLALASKWPL-LKFELEAIIADL--GIPFRSESMASIINKIKSG 1137

Query: 775  TAVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEAL 891
            +     LN  +GF   I   V ++T  ++   PN F  L
Sbjct: 1138 SFTLKDLNLMIGF---ILVSVQQDTLENWFAQPNAFTEL 1173

>AGL217W Chr7 (290043..291287) [1245 bp, 414 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL054W (PSH1)
          Length = 414

 Score = 31.2 bits (69), Expect = 7.2
 Identities = 21/61 (34%), Positives = 32/61 (52%), Gaps = 5/61 (8%)
 Frame = +1

Query: 484 HCNQAQSSNDTFPSV-----MHIAAVTEVTHLLLPELIALRDAFAKKAQEFDSIVKIGRT 648
           +C Q +SS  + PS+      ++ A+ EV     PE+IAL DA AK  +E+   V   R 
Sbjct: 75  NCPQCRSSITSMPSLNVTLQQNLDALIEVLDKAEPEVIALLDANAKSLKEYKDDVAGNRL 134

Query: 649 H 651
           +
Sbjct: 135 Y 135

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.132    0.373 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 130,203,167
Number of extensions: 2826004
Number of successful extensions: 8784
Number of sequences better than 10.0: 65
Number of HSP's gapped: 8773
Number of HSP's successfully gapped: 65
Length of query: 494
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 380
Effective length of database: 40,409,475
Effective search space: 15355600500
Effective search space used: 15355600500
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 35 (18.1 bits)