Re-run this search with the SEG filter switched on (default)

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_56.223626.13ON49349326230.0
KLTH0C11462g6.13ON49249224040.0
SAKL0E00946g6.13ON49349323440.0
Ecym_30166.13ON48947222650.0
KLLA0D00902g6.13ON49246122000.0
TDEL0G045806.13ON48447321960.0
Kpol_1032.46.13ON46746021560.0
ACR013C6.13ON48848321560.0
CAGL0A01045g6.13ON48347721240.0
Kpol_1045.766.13ON48546020730.0
Smik_6.4706.13ON48849220660.0
NCAS0D026206.13ON49348020590.0
YPL262W (FUM1)6.13ON48846520560.0
TPHA0J002706.13ON49646120550.0
ZYRO0C07964g6.13ON50547720530.0
Skud_16.166.13ON48849220510.0
Suva_16.436.13ON48849220340.0
KNAG0E027506.13ON49848220110.0
KAFR0B065206.13ON49546919890.0
TBLA0G010006.13ON46545919360.0
NDAI0I024706.13ON47546219320.0
TBLA0A071306.13ON50046219070.0
YLR359W (ADE13)4.197ON4821931268e-07
Smik_12.4464.197ON4821931261e-06
Suva_10.4594.197ON4821871251e-06
CAGL0B02794g4.197ON4821931232e-06
KLLA0A08404g1.354ON4612281213e-06
Skud_8.701.354ON4632241214e-06
Skud_12.4434.197ON4821931205e-06
Smik_8.831.354ON4632381196e-06
SAKL0D09746g1.354ON4642371196e-06
Suva_15.2011.354ON4632381187e-06
CAGL0I08987g1.354ON4612751171e-05
TPHA0B010404.197ON4821931171e-05
NDAI0J019504.197ON4821951162e-05
NDAI0G059401.354ON4622281142e-05
KNAG0I015601.354ON4622291142e-05
Kwal_47.180664.197ON4821901143e-05
YHR018C (ARG4)1.354ON4632381133e-05
TBLA0A083204.197ON4822141134e-05
NCAS0J012004.197ON4821931124e-05
KNAG0B058404.197ON4821931124e-05
Kpol_1042.164.197ON4821931125e-05
Ecym_24524.197ON4821951116e-05
TBLA0F034801.354ON4662151117e-05
ZYRO0G00748g1.354ON4622301107e-05
ZYRO0B07964g4.197ON4821871107e-05
KAFR0A062304.197ON4821931108e-05
NCAS0A090101.354ON4622241081e-04
TDEL0D022201.354ON4652301062e-04
KLLA0B13189g4.197ON4821871062e-04
Kpol_1018.1251.354ON4602381053e-04
AEL019W1.354ON4692191053e-04
Ecym_27491.354ON4702401053e-04
SAKL0B04972g4.197ON4821931053e-04
Kwal_27.127821.354ON4652711010.001
KLTH0G19338g1.354ON4652601000.001
TDEL0E017604.197ON482193990.002
KLTH0A03344g4.197ON482193980.002
ABL006C4.197ON482191970.003
TPHA0A021901.354ON463240920.011
Ecym_63581.256ON84891810.28
KNAG0D034804.117ON116275780.67
Suva_4.4946.148ON85092732.7
TDEL0G04710na 1ON40647713.8
Suva_4.2233.167ON61669696.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_56.22362
         (493 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_56.22362 s56 (65537..67018) [1482 bp, 493 aa] {ON} YPL262W ...  1014   0.0  
KLTH0C11462g Chr3 complement(942263..943741) [1479 bp, 492 aa] {...   930   0.0  
SAKL0E00946g Chr5 (72220..73701) [1482 bp, 493 aa] {ON} highly s...   907   0.0  
Ecym_3016 Chr3 (30897..32366) [1470 bp, 489 aa] {ON} similar to ...   877   0.0  
KLLA0D00902g Chr4 (83648..85126) [1479 bp, 492 aa] {ON} highly s...   852   0.0  
TDEL0G04580 Chr7 complement(836367..837821) [1455 bp, 484 aa] {O...   850   0.0  
Kpol_1032.4 s1032 (3761..5164) [1404 bp, 467 aa] {ON} (3761..516...   835   0.0  
ACR013C Chr3 complement(381119..382585) [1467 bp, 488 aa] {ON} S...   835   0.0  
CAGL0A01045g Chr1 complement(104865..106316) [1452 bp, 483 aa] {...   822   0.0  
Kpol_1045.76 s1045 complement(177447..178904) [1458 bp, 485 aa] ...   803   0.0  
Smik_6.470 Chr6 complement(772380..773846) [1467 bp, 488 aa] {ON...   800   0.0  
NCAS0D02620 Chr4 complement(504150..505631) [1482 bp, 493 aa] {O...   797   0.0  
YPL262W Chr16 (47336..48802) [1467 bp, 488 aa] {ON}  FUM1Fumaras...   796   0.0  
TPHA0J00270 Chr10 (61961..63451) [1491 bp, 496 aa] {ON} Anc_6.13...   796   0.0  
ZYRO0C07964g Chr3 complement(607609..609126) [1518 bp, 505 aa] {...   795   0.0  
Skud_16.16 Chr16 (26407..27873) [1467 bp, 488 aa] {ON} YPL262W (...   794   0.0  
Suva_16.43 Chr16 (62871..64337) [1467 bp, 488 aa] {ON} YPL262W (...   788   0.0  
KNAG0E02750 Chr5 (547746..549242) [1497 bp, 498 aa] {ON} Anc_6.1...   779   0.0  
KAFR0B06520 Chr2 (1352364..1353851) [1488 bp, 495 aa] {ON} Anc_6...   770   0.0  
TBLA0G01000 Chr7 (252070..253467) [1398 bp, 465 aa] {ON} Anc_6.1...   750   0.0  
NDAI0I02470 Chr9 complement(567782..569209) [1428 bp, 475 aa] {O...   748   0.0  
TBLA0A07130 Chr1 (1770536..1772038) [1503 bp, 500 aa] {ON} Anc_6...   739   0.0  
YLR359W Chr12 (844282..845730) [1449 bp, 482 aa] {ON}  ADE13Aden...    53   8e-07
Smik_12.446 Chr12 (783341..784789) [1449 bp, 482 aa] {ON} YLR359...    53   1e-06
Suva_10.459 Chr10 (803809..805257) [1449 bp, 482 aa] {ON} YLR359...    53   1e-06
CAGL0B02794g Chr2 complement(269303..270751) [1449 bp, 482 aa] {...    52   2e-06
KLLA0A08404g Chr1 complement(743192..744577) [1386 bp, 461 aa] {...    51   3e-06
Skud_8.70 Chr8 complement(121600..122991) [1392 bp, 463 aa] {ON}...    51   4e-06
Skud_12.443 Chr12 (784448..785896) [1449 bp, 482 aa] {ON} YLR359...    51   5e-06
Smik_8.83 Chr8 complement(120320..121711) [1392 bp, 463 aa] {ON}...    50   6e-06
SAKL0D09746g Chr4 complement(808721..810115) [1395 bp, 464 aa] {...    50   6e-06
Suva_15.201 Chr15 complement(348498..349889) [1392 bp, 463 aa] {...    50   7e-06
CAGL0I08987g Chr9 complement(871699..873084) [1386 bp, 461 aa] {...    50   1e-05
TPHA0B01040 Chr2 complement(235467..236915) [1449 bp, 482 aa] {O...    50   1e-05
NDAI0J01950 Chr10 (485753..487201) [1449 bp, 482 aa] {ON} Anc_4....    49   2e-05
NDAI0G05940 Chr7 (1470741..1472129) [1389 bp, 462 aa] {ON} Anc_1...    49   2e-05
KNAG0I01560 Chr9 (303704..305092) [1389 bp, 462 aa] {ON} Anc_1.3...    49   2e-05
Kwal_47.18066 s47 (668459..669907) [1449 bp, 482 aa] {ON} YLR359...    49   3e-05
YHR018C Chr8 complement(140011..141402) [1392 bp, 463 aa] {ON}  ...    48   3e-05
TBLA0A08320 Chr1 complement(2043721..2045169) [1449 bp, 482 aa] ...    48   4e-05
NCAS0J01200 Chr10 (209722..211170) [1449 bp, 482 aa] {ON} Anc_4....    48   4e-05
KNAG0B05840 Chr2 (1150025..1151473) [1449 bp, 482 aa] {ON} Anc_4...    48   4e-05
Kpol_1042.16 s1042 (40749..42197) [1449 bp, 482 aa] {ON} (40749....    48   5e-05
Ecym_2452 Chr2 (881643..883091) [1449 bp, 482 aa] {ON} similar t...    47   6e-05
TBLA0F03480 Chr6 (857021..858421) [1401 bp, 466 aa] {ON} Anc_1.3...    47   7e-05
ZYRO0G00748g Chr7 (57164..58552) [1389 bp, 462 aa] {ON} highly s...    47   7e-05
ZYRO0B07964g Chr2 complement(620761..622209) [1449 bp, 482 aa] {...    47   7e-05
KAFR0A06230 Chr1 complement(1257709..1259157) [1449 bp, 482 aa] ...    47   8e-05
NCAS0A09010 Chr1 complement(1783858..1785246) [1389 bp, 462 aa] ...    46   1e-04
TDEL0D02220 Chr4 (428430..429827) [1398 bp, 465 aa] {ON} Anc_1.3...    45   2e-04
KLLA0B13189g Chr2 complement(1153780..1155228) [1449 bp, 482 aa]...    45   2e-04
Kpol_1018.125 s1018 complement(330965..332347) [1383 bp, 460 aa]...    45   3e-04
AEL019W Chr5 (600410..601819) [1410 bp, 469 aa] {ON} Syntenic ho...    45   3e-04
Ecym_2749 Chr2 complement(1453019..1454431) [1413 bp, 470 aa] {O...    45   3e-04
SAKL0B04972g Chr2 (430349..431797) [1449 bp, 482 aa] {ON} highly...    45   3e-04
Kwal_27.12782 s27 complement(1373166..1374563) [1398 bp, 465 aa]...    44   0.001
KLTH0G19338g Chr7 complement(1665123..1666520) [1398 bp, 465 aa]...    43   0.001
TDEL0E01760 Chr5 complement(337315..338763) [1449 bp, 482 aa] {O...    43   0.002
KLTH0A03344g Chr1 (289188..290636) [1449 bp, 482 aa] {ON} highly...    42   0.002
ABL006C Chr2 complement(385134..386582) [1449 bp, 482 aa] {ON} S...    42   0.003
TPHA0A02190 Chr1 (452902..454293) [1392 bp, 463 aa] {ON} Anc_1.3...    40   0.011
Ecym_6358 Chr6 complement(694398..696944) [2547 bp, 848 aa] {ON}...    36   0.28 
KNAG0D03480 Chr4 complement(625236..628724) [3489 bp, 1162 aa] {...    35   0.67 
Suva_4.494 Chr4 (862220..864772) [2553 bp, 850 aa] {ON} YBR237W ...    33   2.7  
TDEL0G04710 Chr7 (860069..861289) [1221 bp, 406 aa] {ON}               32   3.8  
Suva_4.223 Chr4 complement(395869..397719) [1851 bp, 616 aa] {ON...    31   6.4  

>Kwal_56.22362 s56 (65537..67018) [1482 bp, 493 aa] {ON} YPL262W
           (FUM1) - mitochondrial and cytoplasmic fumarase
           (fumarate hydralase) [contig 186] FULL
          Length = 493

 Score = 1014 bits (2623), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 493/493 (100%), Positives = 493/493 (100%)

Query: 1   MFKVTTEAANKALISGSKARLISTSSSLGQKYRVETDAFGEIKVPTDKLWGAQTQRSLEN 60
           MFKVTTEAANKALISGSKARLISTSSSLGQKYRVETDAFGEIKVPTDKLWGAQTQRSLEN
Sbjct: 1   MFKVTTEAANKALISGSKARLISTSSSLGQKYRVETDAFGEIKVPTDKLWGAQTQRSLEN 60

Query: 61  FKIGGQRERMPEPIVKAFGILKKSAAIVNESLGTLDPKVSKPIQDAADEVISGKLIDHFP 120
           FKIGGQRERMPEPIVKAFGILKKSAAIVNESLGTLDPKVSKPIQDAADEVISGKLIDHFP
Sbjct: 61  FKIGGQRERMPEPIVKAFGILKKSAAIVNESLGTLDPKVSKPIQDAADEVISGKLIDHFP 120

Query: 121 LVVFQTGSGTQSNMNANEVISNRAIQLVGGEVGSKSIHPNNHCNQAQSSNDTFPSVMHIA 180
           LVVFQTGSGTQSNMNANEVISNRAIQLVGGEVGSKSIHPNNHCNQAQSSNDTFPSVMHIA
Sbjct: 121 LVVFQTGSGTQSNMNANEVISNRAIQLVGGEVGSKSIHPNNHCNQAQSSNDTFPSVMHIA 180

Query: 181 AVTEVTHLLLPELIALRDAFAKKAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNG 240
           AVTEVTHLLLPELIALRDAFAKKAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNG
Sbjct: 181 AVTEVTHLLLPELIALRDAFAKKAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNG 240

Query: 241 ISRVEHSLHNLKFLAQGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAH 300
           ISRVEHSLHNLKFLAQGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAH
Sbjct: 241 ISRVEHSLHNLKFLAQGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAH 300

Query: 301 DAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 360
           DAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE
Sbjct: 301 DAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 360

Query: 361 AMTQVCVQVMGNNAAITFAGASGQFELNVFKPVMISNLLSSIRLLGDACYSFRVHCVEGI 420
           AMTQVCVQVMGNNAAITFAGASGQFELNVFKPVMISNLLSSIRLLGDACYSFRVHCVEGI
Sbjct: 361 AMTQVCVQVMGNNAAITFAGASGQFELNVFKPVMISNLLSSIRLLGDACYSFRVHCVEGI 420

Query: 421 QANEDKIAKLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLSSAEFD 480
           QANEDKIAKLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLSSAEFD
Sbjct: 421 QANEDKIAKLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLSSAEFD 480

Query: 481 EWVVPENMVGPKP 493
           EWVVPENMVGPKP
Sbjct: 481 EWVVPENMVGPKP 493

>KLTH0C11462g Chr3 complement(942263..943741) [1479 bp, 492 aa] {ON}
           highly similar to uniprot|P08417 Saccharomyces
           cerevisiae YPL262W FUM1 Fumarase converts fumaric acid
           to L-malic acid in the TCA cycle cytosolic and
           mitochondrial localization determined by the N-terminal
           mitochondrial targeting sequence and protein
           conformation
          Length = 492

 Score =  930 bits (2404), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/492 (90%), Positives = 470/492 (95%)

Query: 1   MFKVTTEAANKALISGSKARLISTSSSLGQKYRVETDAFGEIKVPTDKLWGAQTQRSLEN 60
           MFK+T E ANK+L    K RLISTSS++ QK RVETDAFGEI VP DK WGAQTQRSLEN
Sbjct: 1   MFKLTAEVANKSLSGSPKTRLISTSSAISQKCRVETDAFGEINVPADKYWGAQTQRSLEN 60

Query: 61  FKIGGQRERMPEPIVKAFGILKKSAAIVNESLGTLDPKVSKPIQDAADEVISGKLIDHFP 120
           FKIGG RERMPEP+V+AFGILKKSAAIVNESLGTLDPK+SKPIQ AADEVISGKL+DHFP
Sbjct: 61  FKIGGARERMPEPVVRAFGILKKSAAIVNESLGTLDPKISKPIQQAADEVISGKLVDHFP 120

Query: 121 LVVFQTGSGTQSNMNANEVISNRAIQLVGGEVGSKSIHPNNHCNQAQSSNDTFPSVMHIA 180
           LVVFQTGSGTQSNMNANEVISNRAI++VGG++G+KSIHPNNHCNQAQSSNDTFPSVMHIA
Sbjct: 121 LVVFQTGSGTQSNMNANEVISNRAIEIVGGKMGTKSIHPNNHCNQAQSSNDTFPSVMHIA 180

Query: 181 AVTEVTHLLLPELIALRDAFAKKAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNG 240
           AVTE+TH LLPEL ALRD+FA K++EF+SIVKIGRTHLQDATPLTLGQEFSGYVQQLTNG
Sbjct: 181 AVTEITHSLLPELTALRDSFATKSKEFESIVKIGRTHLQDATPLTLGQEFSGYVQQLTNG 240

Query: 241 ISRVEHSLHNLKFLAQGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAH 300
           ISRVE SL +LKFLAQGGTAVGTGLNTKVGF EKIAEQVSKETGIDFKTAPNKFEALAAH
Sbjct: 241 ISRVEQSLIHLKFLAQGGTAVGTGLNTKVGFGEKIAEQVSKETGIDFKTAPNKFEALAAH 300

Query: 301 DAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 360
           DA+VECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE
Sbjct: 301 DAIVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 360

Query: 361 AMTQVCVQVMGNNAAITFAGASGQFELNVFKPVMISNLLSSIRLLGDACYSFRVHCVEGI 420
           AMTQVCVQVMGNNAAITFAGASGQFELNVFKPVMISNLLSS+RLLGDACYSFRVHCV+GI
Sbjct: 361 AMTQVCVQVMGNNAAITFAGASGQFELNVFKPVMISNLLSSVRLLGDACYSFRVHCVDGI 420

Query: 421 QANEDKIAKLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLSSAEFD 480
           +AN DKIAKLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALEL VL+SAEFD
Sbjct: 421 EANRDKIAKLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELKVLTSAEFD 480

Query: 481 EWVVPENMVGPK 492
           +WVVPENMVGPK
Sbjct: 481 QWVVPENMVGPK 492

>SAKL0E00946g Chr5 (72220..73701) [1482 bp, 493 aa] {ON} highly
           similar to uniprot|P08417 Saccharomyces cerevisiae
           YPL262W FUM1 Fumarase converts fumaric acid to L-malic
           acid in the TCA cycle cytosolic and mitochondrial
           localization determined by the N-terminal mitochondrial
           targeting sequence and protein conformation
          Length = 493

 Score =  907 bits (2344), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 432/493 (87%), Positives = 463/493 (93%), Gaps = 2/493 (0%)

Query: 1   MFKVTTEAANKALISGSKARLISTSSSLGQ-KYRVETDAFGEIKVPTDKLWGAQTQRSLE 59
           M ++T  AAN+ L+  S  R++STSSSL Q KYR+ETDAFGEIKVP DK WGAQTQRS E
Sbjct: 1   MLRITA-AANRNLLPSSSIRMLSTSSSLAQQKYRIETDAFGEIKVPADKYWGAQTQRSFE 59

Query: 60  NFKIGGQRERMPEPIVKAFGILKKSAAIVNESLGTLDPKVSKPIQDAADEVISGKLIDHF 119
           NFKIGG RERMPE +V+AFG+LKKSAAIVNESLGTLDP++SKPIQ AADEVI GKL+DHF
Sbjct: 60  NFKIGGARERMPEAVVRAFGVLKKSAAIVNESLGTLDPEISKPIQKAADEVIQGKLMDHF 119

Query: 120 PLVVFQTGSGTQSNMNANEVISNRAIQLVGGEVGSKSIHPNNHCNQAQSSNDTFPSVMHI 179
           PLVVFQTGSGTQSNMNANEVISNRAI+++GGE GSK +HPNNHCNQAQSSNDTFPSVMHI
Sbjct: 120 PLVVFQTGSGTQSNMNANEVISNRAIEIIGGEKGSKQVHPNNHCNQAQSSNDTFPSVMHI 179

Query: 180 AAVTEVTHLLLPELIALRDAFAKKAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTN 239
           AAVTE+TH LLPEL ALRD+F KK+ EF SIVKIGRTHLQDATPLTLGQEFSGYVQQLTN
Sbjct: 180 AAVTEITHSLLPELTALRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTN 239

Query: 240 GISRVEHSLHNLKFLAQGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAA 299
           GI+RVE SLH+LKFLAQGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAA
Sbjct: 240 GIARVEQSLHHLKFLAQGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAA 299

Query: 300 HDAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQN 359
           HDAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQN
Sbjct: 300 HDAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQN 359

Query: 360 EAMTQVCVQVMGNNAAITFAGASGQFELNVFKPVMISNLLSSIRLLGDACYSFRVHCVEG 419
           EAMTQVCVQVMGNNAAITFAGASGQFELNVFKPVMISNLLSS+RLL DA YSFRVHCV+G
Sbjct: 360 EAMTQVCVQVMGNNAAITFAGASGQFELNVFKPVMISNLLSSVRLLADASYSFRVHCVDG 419

Query: 420 IQANEDKIAKLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLSSAEF 479
           I+ANED+I+KLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESAL+LGVL+  EF
Sbjct: 420 IKANEDRISKLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALQLGVLNEKEF 479

Query: 480 DEWVVPENMVGPK 492
           DEWV+PE M+GPK
Sbjct: 480 DEWVIPEKMIGPK 492

>Ecym_3016 Chr3 (30897..32366) [1470 bp, 489 aa] {ON} similar to
           Ashbya gossypii ACR013C
          Length = 489

 Score =  877 bits (2265), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/472 (87%), Positives = 444/472 (94%)

Query: 20  RLISTSSSLGQKYRVETDAFGEIKVPTDKLWGAQTQRSLENFKIGGQRERMPEPIVKAFG 79
           R++ST++ L QK+R+ETDAFGEIKVP +K WGAQTQRSLENFKIGG RERMPEPI+KAFG
Sbjct: 16  RMMSTTAGLNQKFRIETDAFGEIKVPANKYWGAQTQRSLENFKIGGPRERMPEPIIKAFG 75

Query: 80  ILKKSAAIVNESLGTLDPKVSKPIQDAADEVISGKLIDHFPLVVFQTGSGTQSNMNANEV 139
           ILKKSAAIVNESLGTLDPK+SKPIQ AADEVI GKL+DHFPLVVFQTGSGTQSNMNANEV
Sbjct: 76  ILKKSAAIVNESLGTLDPKISKPIQQAADEVIEGKLLDHFPLVVFQTGSGTQSNMNANEV 135

Query: 140 ISNRAIQLVGGEVGSKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEVTHLLLPELIALRDA 199
           ISNRAI+L+GGE+G+K IHPNNHCNQAQSSNDTFPSVMHIAAVTE+T+ LLPEL ALRD+
Sbjct: 136 ISNRAIELIGGELGTKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNTLLPELTALRDS 195

Query: 200 FAKKAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHSLHNLKFLAQGGT 259
           F KK +EF  IVKIGRTHLQDATPLTLGQEF GY QQ+TNGI+RVE SLH+LKFLAQGGT
Sbjct: 196 FQKKTEEFSHIVKIGRTHLQDATPLTLGQEFGGYTQQITNGITRVEQSLHHLKFLAQGGT 255

Query: 260 AVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTLACSLFK 319
           AVGTGLNTKVGFAEKIAEQVSKET I+FKTAPNKFEALAAHDAVVECSGALNT+ACSLFK
Sbjct: 256 AVGTGLNTKVGFAEKIAEQVSKETNIEFKTAPNKFEALAAHDAVVECSGALNTVACSLFK 315

Query: 320 IANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFA 379
           IANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQ CVQVMGNN+ ITFA
Sbjct: 316 IANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQACVQVMGNNSTITFA 375

Query: 380 GASGQFELNVFKPVMISNLLSSIRLLGDACYSFRVHCVEGIQANEDKIAKLLHESLMLVT 439
           GASGQFELNVFKPVMISNLL+SIRLL DA YSFRVHCV+GI+ANEDKIAK+LHESLMLVT
Sbjct: 376 GASGQFELNVFKPVMISNLLNSIRLLADASYSFRVHCVDGIKANEDKIAKILHESLMLVT 435

Query: 440 ALNPKIGYDAASKVAKNAHKKGITLKESALELGVLSSAEFDEWVVPENMVGP 491
           ALNPKIGYD+A KVAKNAHKK ITLKESALELGVLS  EF EWVVPE M+GP
Sbjct: 436 ALNPKIGYDSACKVAKNAHKKNITLKESALELGVLSEEEFSEWVVPEKMIGP 487

>KLLA0D00902g Chr4 (83648..85126) [1479 bp, 492 aa] {ON} highly
           similar to uniprot|P08417 Saccharomyces cerevisiae
           YPL262W FUM1 Fumarase converts fumaric acid to L-malic
           acid in the TCA cycle cytosolic and mitochondrial
           localization determined by the N-terminal mitochondrial
           targeting sequence and protein conformation
          Length = 492

 Score =  852 bits (2200), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/461 (87%), Positives = 435/461 (94%)

Query: 32  YRVETDAFGEIKVPTDKLWGAQTQRSLENFKIGGQRERMPEPIVKAFGILKKSAAIVNES 91
           YRVETDAFGEI+VP+DK WGAQTQRSL+NFKIGG RERMPEPIVKAFG+LKKSAA+VNE 
Sbjct: 31  YRVETDAFGEIQVPSDKYWGAQTQRSLQNFKIGGPRERMPEPIVKAFGVLKKSAAVVNER 90

Query: 92  LGTLDPKVSKPIQDAADEVISGKLIDHFPLVVFQTGSGTQSNMNANEVISNRAIQLVGGE 151
           LGTLDP+++KPI+ AADEV  GKL++HFPLVVFQTGSGTQSNMNANEVISNRAI+L+GGE
Sbjct: 91  LGTLDPEIAKPIKQAADEVAQGKLMEHFPLVVFQTGSGTQSNMNANEVISNRAIELIGGE 150

Query: 152 VGSKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEVTHLLLPELIALRDAFAKKAQEFDSIV 211
           +GSK IHPNNHCNQAQSSNDTFPSVMHIAAVTE+TH LLPEL  L+ A  +K+ EF  IV
Sbjct: 151 LGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEITHHLLPELEGLKVALKQKSDEFQHIV 210

Query: 212 KIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHSLHNLKFLAQGGTAVGTGLNTKVGF 271
           KIGRTHLQDATPLTLGQEFSGYVQQ+ NGI+RV+ SL++LKFLAQGGTAVGTGLNTKVGF
Sbjct: 211 KIGRTHLQDATPLTLGQEFSGYVQQVENGIARVKQSLYHLKFLAQGGTAVGTGLNTKVGF 270

Query: 272 AEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTLACSLFKIANDIRYLGSGP 331
           AE IAEQVSKETGIDFKTAPNKFEALAAHDAVVE SGALNTLA SLFKIANDIRYLGSGP
Sbjct: 271 AEDIAEQVSKETGIDFKTAPNKFEALAAHDAVVEASGALNTLAVSLFKIANDIRYLGSGP 330

Query: 332 RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFK 391
           RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGN+AAITFAGASGQFELNVFK
Sbjct: 331 RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNHAAITFAGASGQFELNVFK 390

Query: 392 PVMISNLLSSIRLLGDACYSFRVHCVEGIQANEDKIAKLLHESLMLVTALNPKIGYDAAS 451
           PVMISNLLSSIRLLGDA  SFR+HCVEGI+ANED+IAKLLHESLMLVTALNPKIGYDAAS
Sbjct: 391 PVMISNLLSSIRLLGDASNSFRIHCVEGIKANEDRIAKLLHESLMLVTALNPKIGYDAAS 450

Query: 452 KVAKNAHKKGITLKESALELGVLSSAEFDEWVVPENMVGPK 492
           KVAKNAHKKGITLKESALEL VLSS EFD+WV+PE M+GPK
Sbjct: 451 KVAKNAHKKGITLKESALELKVLSSEEFDQWVIPEKMIGPK 491

>TDEL0G04580 Chr7 complement(836367..837821) [1455 bp, 484 aa] {ON}
           Anc_6.13 YPL262W
          Length = 484

 Score =  850 bits (2196), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/473 (85%), Positives = 438/473 (92%), Gaps = 1/473 (0%)

Query: 21  LISTSSSLGQKYRVETDAFGEIKVPTDKLWGAQTQRSLENFKIGGQRERMPEPIVKAFGI 80
           ++  S+  GQ +RVETDAFGEIKV  D+ WGAQTQRSLENF+IGG RERMPEPIV+AFG+
Sbjct: 13  VVKMSTKAGQ-FRVETDAFGEIKVAADRYWGAQTQRSLENFRIGGPRERMPEPIVRAFGV 71

Query: 81  LKKSAAIVNESLGTLDPKVSKPIQDAADEVISGKLIDHFPLVVFQTGSGTQSNMNANEVI 140
           LKKSAA+VNESLGTLDPKV++PI+ AADEV  GKL  HFPLVVFQTGSGTQSNMNANEVI
Sbjct: 72  LKKSAAVVNESLGTLDPKVAEPIKQAADEVAQGKLTAHFPLVVFQTGSGTQSNMNANEVI 131

Query: 141 SNRAIQLVGGEVGSKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEVTHLLLPELIALRDAF 200
           SNRAI+L+GGE+GSK IHPNNHCNQAQSSNDTFPSVMHIAAVTE+T  LLPEL  LRD+ 
Sbjct: 132 SNRAIELIGGELGSKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITRHLLPELAHLRDSL 191

Query: 201 AKKAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHSLHNLKFLAQGGTA 260
             K++EF  IVKIGRTHLQDATPLTLGQEFSGYVQQ++NGI RVE SLH LK+LAQGGTA
Sbjct: 192 DAKSKEFSDIVKIGRTHLQDATPLTLGQEFSGYVQQVSNGIDRVEGSLHRLKYLAQGGTA 251

Query: 261 VGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTLACSLFKI 320
           VGTGLNTK+GFAEKIAEQVSKETG+DFKTAPNKFEALAAHDAVVE SGALNT+ACSLFKI
Sbjct: 252 VGTGLNTKIGFAEKIAEQVSKETGLDFKTAPNKFEALAAHDAVVEASGALNTVACSLFKI 311

Query: 321 ANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAG 380
           A DIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEA+TQVCVQVMGNNAAITFAG
Sbjct: 312 AQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAG 371

Query: 381 ASGQFELNVFKPVMISNLLSSIRLLGDACYSFRVHCVEGIQANEDKIAKLLHESLMLVTA 440
           ASGQFELNVFKPVMISNLLSS+RLL DA YSFRVHCV+GI AN D+I KL+HESLMLVTA
Sbjct: 372 ASGQFELNVFKPVMISNLLSSVRLLADASYSFRVHCVDGIIANRDRIGKLMHESLMLVTA 431

Query: 441 LNPKIGYDAASKVAKNAHKKGITLKESALELGVLSSAEFDEWVVPENMVGPKP 493
           LNPKIGYDAASKVAKNAHKKGITLK+SAL+LGVL+ +EFDEWVVPENM+GPKP
Sbjct: 432 LNPKIGYDAASKVAKNAHKKGITLKQSALDLGVLTESEFDEWVVPENMIGPKP 484

>Kpol_1032.4 s1032 (3761..5164) [1404 bp, 467 aa] {ON} (3761..5164)
           [1404 nt, 468 aa]
          Length = 467

 Score =  835 bits (2156), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/460 (86%), Positives = 427/460 (92%)

Query: 32  YRVETDAFGEIKVPTDKLWGAQTQRSLENFKIGGQRERMPEPIVKAFGILKKSAAIVNES 91
           +R+ETD FGEIKVP DK WGAQTQRS ENFKIGG RERMPEP+VKAFG+LKKSAAIVNE 
Sbjct: 7   FRLETDGFGEIKVPADKYWGAQTQRSYENFKIGGPRERMPEPVVKAFGVLKKSAAIVNEE 66

Query: 92  LGTLDPKVSKPIQDAADEVISGKLIDHFPLVVFQTGSGTQSNMNANEVISNRAIQLVGGE 151
            G LD  +SK IQ AADEVI GKL +HFPLVVFQTGSGTQSNMNANEVISNRAI+L GG 
Sbjct: 67  FGILDAGISKLIQQAADEVIEGKLNEHFPLVVFQTGSGTQSNMNANEVISNRAIELKGGI 126

Query: 152 VGSKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEVTHLLLPELIALRDAFAKKAQEFDSIV 211
           +GSK IHPNNHCN AQSSNDTFP+VMHIAAVTE+TH L+P++  L+DA A K++EF+ IV
Sbjct: 127 MGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTEITHHLIPKMTELKDALANKSKEFEHIV 186

Query: 212 KIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHSLHNLKFLAQGGTAVGTGLNTKVGF 271
           KIGRTHLQDATPLTLGQEFSGYVQQL NGI+R+EHSL NLKFLAQGGTAVGTGLNTK+GF
Sbjct: 187 KIGRTHLQDATPLTLGQEFSGYVQQLINGIARIEHSLINLKFLAQGGTAVGTGLNTKIGF 246

Query: 272 AEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTLACSLFKIANDIRYLGSGP 331
           AE+IAEQVSKETGI+FKTAPNKFEALAAHDA+VE SGALNT+ACSLFKIA DIRYLGSGP
Sbjct: 247 AERIAEQVSKETGIEFKTAPNKFEALAAHDAIVESSGALNTVACSLFKIAQDIRYLGSGP 306

Query: 332 RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFK 391
           RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFK
Sbjct: 307 RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFK 366

Query: 392 PVMISNLLSSIRLLGDACYSFRVHCVEGIQANEDKIAKLLHESLMLVTALNPKIGYDAAS 451
           PVMISNLLSSIRLLGDAC+SF +HCVEGIQANEDKI KLLHESLMLVTALNPKIGYD+A+
Sbjct: 367 PVMISNLLSSIRLLGDACHSFTIHCVEGIQANEDKINKLLHESLMLVTALNPKIGYDSAT 426

Query: 452 KVAKNAHKKGITLKESALELGVLSSAEFDEWVVPENMVGP 491
           KVAKNAHKKGITLKESALELGVL+  EFDEWVVPE M+GP
Sbjct: 427 KVAKNAHKKGITLKESALELGVLTEDEFDEWVVPEKMLGP 466

>ACR013C Chr3 complement(381119..382585) [1467 bp, 488 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL262W
           (FUM1)
          Length = 488

 Score =  835 bits (2156), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/483 (80%), Positives = 438/483 (90%)

Query: 10  NKALISGSKARLISTSSSLGQKYRVETDAFGEIKVPTDKLWGAQTQRSLENFKIGGQRER 69
           ++  +  S AR + +++   Q++RVETDAFGEI+VP DK WGAQTQRSLENF+IGG RER
Sbjct: 5   SRGCVGSSAARRLMSTAGAPQQFRVETDAFGEIRVPADKYWGAQTQRSLENFRIGGARER 64

Query: 70  MPEPIVKAFGILKKSAAIVNESLGTLDPKVSKPIQDAADEVISGKLIDHFPLVVFQTGSG 129
           MPEP+V+AFG+LKKSAA+VNE LGTL+P ++K IQ AADEV  G+L++HFPLVVFQTGSG
Sbjct: 65  MPEPVVRAFGVLKKSAAVVNEQLGTLEPGIAKAIQQAADEVAQGQLMEHFPLVVFQTGSG 124

Query: 130 TQSNMNANEVISNRAIQLVGGEVGSKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEVTHLL 189
           TQSNMNANEVISNRAI+L+GGE+GSK +HPNNHCNQAQSSNDTFPSVMHIAAVTE+T  L
Sbjct: 125 TQSNMNANEVISNRAIELLGGELGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITRSL 184

Query: 190 LPELIALRDAFAKKAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHSLH 249
           LPEL ALR +F +K  EF  IVKIGRTHLQDATPLTLGQEFSGY QQ+ NGI+RVEH+  
Sbjct: 185 LPELEALRVSFQRKTDEFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQE 244

Query: 250 NLKFLAQGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGA 309
           +L+FLAQGGTAVGTGLNT+ GFAE+IA QVS+ETG++F+TAPNKFEALAAHDAVVE SGA
Sbjct: 245 SLRFLAQGGTAVGTGLNTRRGFAEQIAAQVSRETGLEFRTAPNKFEALAAHDAVVEASGA 304

Query: 310 LNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQV 369
           LNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEA+TQ CVQV
Sbjct: 305 LNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQACVQV 364

Query: 370 MGNNAAITFAGASGQFELNVFKPVMISNLLSSIRLLGDACYSFRVHCVEGIQANEDKIAK 429
           MGNNAAITFAGASGQFELNVFKPVMI+NLLSS+RLL DA  SFRVHCV+GIQ NED+IAK
Sbjct: 365 MGNNAAITFAGASGQFELNVFKPVMIANLLSSVRLLADAARSFRVHCVDGIQDNEDRIAK 424

Query: 430 LLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLSSAEFDEWVVPENMV 489
           LLHESLMLVTALNPKIGYDAAS VAKNAHKKGITL+ SALELGVL+ AEFDEWVVPE M+
Sbjct: 425 LLHESLMLVTALNPKIGYDAASAVAKNAHKKGITLRASALELGVLTDAEFDEWVVPEKMI 484

Query: 490 GPK 492
           GP+
Sbjct: 485 GPR 487

>CAGL0A01045g Chr1 complement(104865..106316) [1452 bp, 483 aa] {ON}
           highly similar to uniprot|P08417 Saccharomyces
           cerevisiae YPL262w FUM1 fumarate hydratase
          Length = 483

 Score =  822 bits (2124), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/477 (82%), Positives = 429/477 (89%), Gaps = 1/477 (0%)

Query: 15  SGSKARLISTSSSLGQKYRVETDAFGEIKVPTDKLWGAQTQRSLENFKIGGQRERMPEPI 74
           S +K  LI  S+ +   YRVETD FGEIKVP DK WGAQTQRS +NFKIGG RERMPEPI
Sbjct: 6   SRAKTSLIGYSARM-MHYRVETDTFGEIKVPADKYWGAQTQRSFQNFKIGGARERMPEPI 64

Query: 75  VKAFGILKKSAAIVNESLGTLDPKVSKPIQDAADEVISGKLIDHFPLVVFQTGSGTQSNM 134
           V+AFG+LKKSAAIVNE LGTLD +++ PIQ AADEV  GKL DHFPLVVFQTGSGTQSNM
Sbjct: 65  VRAFGVLKKSAAIVNEKLGTLDSEIAGPIQQAADEVAKGKLNDHFPLVVFQTGSGTQSNM 124

Query: 135 NANEVISNRAIQLVGGEVGSKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEVTHLLLPELI 194
           NANEVISNRAI+L+GGE+GSK IHPNNHCNQAQSSNDTFPSVMHIAAVTE+T+ LLPE+ 
Sbjct: 125 NANEVISNRAIELIGGELGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNSLLPEIT 184

Query: 195 ALRDAFAKKAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHSLHNLKFL 254
            L+DA  KKA+EF  IVKIGRTHLQDATPLTLGQEFSGYVQQL NGI+R+E++L +LK+L
Sbjct: 185 QLKDALHKKAEEFQDIVKIGRTHLQDATPLTLGQEFSGYVQQLVNGIARIENTLPHLKYL 244

Query: 255 AQGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTLA 314
           AQGGTAVGTGLNTK GF + IAEQ+SKETGIDFKTAPNKFEALAAHDA+VE SGALNT+A
Sbjct: 245 AQGGTAVGTGLNTKEGFDKLIAEQISKETGIDFKTAPNKFEALAAHDAIVEASGALNTVA 304

Query: 315 CSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNA 374
           CSLFKIA DIRYLGSGPRCGYGEL LPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNA
Sbjct: 305 CSLFKIAQDIRYLGSGPRCGYGELHLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNA 364

Query: 375 AITFAGASGQFELNVFKPVMISNLLSSIRLLGDACYSFRVHCVEGIQANEDKIAKLLHES 434
           A+TFAGA+GQFELNVFKPVMISNLLSSIRLL DAC+SFRVHCVEGI+AN +KI   LH S
Sbjct: 365 AVTFAGANGQFELNVFKPVMISNLLSSIRLLADACHSFRVHCVEGIEANREKINHNLHNS 424

Query: 435 LMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLSSAEFDEWVVPENMVGP 491
           LMLVTALNPKIGYDAASK+AKNA KK ITLKESALEL  L+S EFDEWV+PENMVGP
Sbjct: 425 LMLVTALNPKIGYDAASKIAKNAFKKNITLKESALELKYLTSEEFDEWVIPENMVGP 481

>Kpol_1045.76 s1045 complement(177447..178904) [1458 bp, 485 aa]
           {ON} complement(177449..178906) [1458 nt, 486 aa]
          Length = 485

 Score =  803 bits (2073), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/460 (82%), Positives = 416/460 (90%)

Query: 32  YRVETDAFGEIKVPTDKLWGAQTQRSLENFKIGGQRERMPEPIVKAFGILKKSAAIVNES 91
           +RVETD FGEIKVP +K WGAQT+RS ENFKIGG RERMPE +V+AFG+LKK AAIVN  
Sbjct: 24  FRVETDGFGEIKVPANKYWGAQTERSFENFKIGGSRERMPEAVVRAFGVLKKCAAIVNTE 83

Query: 92  LGTLDPKVSKPIQDAADEVISGKLIDHFPLVVFQTGSGTQSNMNANEVISNRAIQLVGGE 151
           LG LDP  SK IQ AADEV +GKL DHFPLVVFQTGSGTQSNMNANEVISNRAI+L GG 
Sbjct: 84  LGGLDPATSKLIQQAADEVATGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIELKGGV 143

Query: 152 VGSKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEVTHLLLPELIALRDAFAKKAQEFDSIV 211
           +GSK IHPNNHCN AQSSNDTFP+VMHIAAVT+++  LLPEL  LRDA A K+ EF+ IV
Sbjct: 144 LGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTQISQHLLPELTHLRDALAAKSAEFEHIV 203

Query: 212 KIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHSLHNLKFLAQGGTAVGTGLNTKVGF 271
           KIGRTHLQDATPLTLGQEFSGYVQQLTNGI R+E +  NL+FLAQGGTAVGTGLNTK G+
Sbjct: 204 KIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQQNLRFLAQGGTAVGTGLNTKNGW 263

Query: 272 AEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTLACSLFKIANDIRYLGSGP 331
           AE+IA ++SKETG+ FKTAPNKFEALAAHDA+VE SGALNT+ACSLFKIA DIRYLGSGP
Sbjct: 264 AERIAAEISKETGLAFKTAPNKFEALAAHDAIVEASGALNTVACSLFKIAQDIRYLGSGP 323

Query: 332 RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFK 391
           RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAA+TFAGASGQFELNVFK
Sbjct: 324 RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAVTFAGASGQFELNVFK 383

Query: 392 PVMISNLLSSIRLLGDACYSFRVHCVEGIQANEDKIAKLLHESLMLVTALNPKIGYDAAS 451
           PV+ISNLLSS++LLGDA  SFRVHCVEGI+ANE KI++LLH SLMLVTALNPKIGYDAA+
Sbjct: 384 PVLISNLLSSVQLLGDASRSFRVHCVEGIKANEAKISELLHRSLMLVTALNPKIGYDAAT 443

Query: 452 KVAKNAHKKGITLKESALELGVLSSAEFDEWVVPENMVGP 491
           KVAKNAHKKGITLKESALELGVL+  EFDEWVVPE M+GP
Sbjct: 444 KVAKNAHKKGITLKESALELGVLTEKEFDEWVVPEKMLGP 483

>Smik_6.470 Chr6 complement(772380..773846) [1467 bp, 488 aa] {ON}
           YPL262W (REAL)
          Length = 488

 Score =  800 bits (2066), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/492 (78%), Positives = 429/492 (87%), Gaps = 4/492 (0%)

Query: 1   MFKVTTEAANKALISGSKARLISTSSSLGQKYRVETDAFGEIKVPTDKLWGAQTQRSLEN 60
           M ++T  +    + S  K  +   +S+    +R ETDAFGEI VP DK WGAQTQRS +N
Sbjct: 1   MLRLTNSSCKAFVQSSYKFNIRRMNST----FRTETDAFGEINVPADKYWGAQTQRSFQN 56

Query: 61  FKIGGQRERMPEPIVKAFGILKKSAAIVNESLGTLDPKVSKPIQDAADEVISGKLIDHFP 120
           FKIGG RERMP P+V AFG+LKKSAAIVNESLG LDPK+SK IQ+AADEV SGKL DHFP
Sbjct: 57  FKIGGARERMPLPLVHAFGVLKKSAAIVNESLGGLDPKISKAIQEAADEVASGKLDDHFP 116

Query: 121 LVVFQTGSGTQSNMNANEVISNRAIQLVGGEVGSKSIHPNNHCNQAQSSNDTFPSVMHIA 180
           LVVFQTGSGTQSNMNANEVISNRAI+++GG++GSK +HPNNHCNQ+QSSNDTFP+VMHIA
Sbjct: 117 LVVFQTGSGTQSNMNANEVISNRAIEILGGKIGSKEVHPNNHCNQSQSSNDTFPTVMHIA 176

Query: 181 AVTEVTHLLLPELIALRDAFAKKAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNG 240
           A  ++ + L+PEL  L++A   K++EFD IVKIGRTHLQDATPLTLGQEFSGYVQQ+ NG
Sbjct: 177 ASLQIQNELIPELANLKNALEAKSKEFDHIVKIGRTHLQDATPLTLGQEFSGYVQQVENG 236

Query: 241 ISRVEHSLHNLKFLAQGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAH 300
           I RV HSL  L FLAQGGTAVGTGLNTK GF  KIAEQ+SKETG+ F+TAPNKFEALAAH
Sbjct: 237 IQRVAHSLKTLSFLAQGGTAVGTGLNTKPGFDVKIAEQISKETGLKFQTAPNKFEALAAH 296

Query: 301 DAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 360
           DA+VECSGALNTLACSLFKIA DIRYLGSGPRCGY EL LPENEPGSSIMPGKVNPTQNE
Sbjct: 297 DAIVECSGALNTLACSLFKIAQDIRYLGSGPRCGYHELMLPENEPGSSIMPGKVNPTQNE 356

Query: 361 AMTQVCVQVMGNNAAITFAGASGQFELNVFKPVMISNLLSSIRLLGDACYSFRVHCVEGI 420
           A+TQVCVQVMGNNAAITFAG+ GQFELNVFKPVMI+NLL+SIRL+ DA YSFRVHCVEGI
Sbjct: 357 ALTQVCVQVMGNNAAITFAGSQGQFELNVFKPVMIANLLNSIRLITDAAYSFRVHCVEGI 416

Query: 421 QANEDKIAKLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLSSAEFD 480
           +ANE +I +LL +SLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVL+  EFD
Sbjct: 417 KANEPRIHELLTKSLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLTEKEFD 476

Query: 481 EWVVPENMVGPK 492
           EWVVPENM+GPK
Sbjct: 477 EWVVPENMLGPK 488

>NCAS0D02620 Chr4 complement(504150..505631) [1482 bp, 493 aa] {ON}
           Anc_6.13 YPL262W
          Length = 493

 Score =  797 bits (2059), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/480 (77%), Positives = 429/480 (89%)

Query: 14  ISGSKARLISTSSSLGQKYRVETDAFGEIKVPTDKLWGAQTQRSLENFKIGGQRERMPEP 73
           +  S+  L +T+++  Q+YR+ETD+FGEIKVP DK WGAQTQRS +NFKIGG RER+P+P
Sbjct: 14  LQASRMSLSTTTAASQQQYRIETDSFGEIKVPADKYWGAQTQRSFQNFKIGGSRERIPDP 73

Query: 74  IVKAFGILKKSAAIVNESLGTLDPKVSKPIQDAADEVISGKLIDHFPLVVFQTGSGTQSN 133
           I+ AFGILKKSAAIVNESLGTLDPKV+ PI+ AADEV+ GKL DHFPLVVFQTGSGTQ+N
Sbjct: 74  IITAFGILKKSAAIVNESLGTLDPKVADPIKKAADEVVQGKLKDHFPLVVFQTGSGTQTN 133

Query: 134 MNANEVISNRAIQLVGGEVGSKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEVTHLLLPEL 193
           MN NEVISNRAI+LVGG++GSK IHPNNHCNQ+QSSNDTFPSVMHIAAV E+T+ L+PEL
Sbjct: 134 MNVNEVISNRAIELVGGKLGSKQIHPNNHCNQSQSSNDTFPSVMHIAAVLEITNSLIPEL 193

Query: 194 IALRDAFAKKAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHSLHNLKF 253
             L+DA   KA+EF  IVKIGRTHLQDATPLTLGQEFSGYVQQL NGI R+E SL++LKF
Sbjct: 194 TKLKDALDVKAKEFADIVKIGRTHLQDATPLTLGQEFSGYVQQLENGIYRIESSLYHLKF 253

Query: 254 LAQGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTL 313
           LAQGGTAVGTGLNTK+GF + IAE+VSKETGI+FKTAPNKFEALAAHDA+V  SGALNT+
Sbjct: 254 LAQGGTAVGTGLNTKIGFDKLIAEEVSKETGIEFKTAPNKFEALAAHDAIVFASGALNTV 313

Query: 314 ACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNN 373
           A SLFKIA DIRYLGSGPRCGYGEL LPENEPGSSIMPGKVNPTQNEAMTQVCVQ+MGNN
Sbjct: 314 AGSLFKIAQDIRYLGSGPRCGYGELQLPENEPGSSIMPGKVNPTQNEAMTQVCVQIMGNN 373

Query: 374 AAITFAGASGQFELNVFKPVMISNLLSSIRLLGDACYSFRVHCVEGIQANEDKIAKLLHE 433
             I+ AG+ GQFELNV+KP+MI+NLL+SIRL+ DAC SFR+HC++ ++AN+DKI + L++
Sbjct: 374 QTISIAGSQGQFELNVYKPLMIANLLNSIRLMTDACKSFRIHCIDDLKANKDKINENLNK 433

Query: 434 SLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLSSAEFDEWVVPENMVGPKP 493
           SLMLVTALNPKIGYDAASK+AKNAH K ITLKESALEL  L++ EFDEWVVPENM+GPKP
Sbjct: 434 SLMLVTALNPKIGYDAASKIAKNAHLKNITLKESALELKYLTAEEFDEWVVPENMIGPKP 493

>YPL262W Chr16 (47336..48802) [1467 bp, 488 aa] {ON}  FUM1Fumarase,
           converts fumaric acid to L-malic acid in the TCA cycle;
           cytosolic and mitochondrial distribution determined by
           the N-terminal targeting sequence, protein conformation,
           and status of glyoxylate shunt; phosphorylated in
           mitochondria
          Length = 488

 Score =  796 bits (2056), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/465 (81%), Positives = 417/465 (89%)

Query: 28  LGQKYRVETDAFGEIKVPTDKLWGAQTQRSLENFKIGGQRERMPEPIVKAFGILKKSAAI 87
           +   +R ETDAFGEI VP DK WGAQTQRS +NFKIGG RERMP P+V AFG+LKKSAAI
Sbjct: 24  MNSSFRTETDAFGEIHVPADKYWGAQTQRSFQNFKIGGARERMPLPLVHAFGVLKKSAAI 83

Query: 88  VNESLGTLDPKVSKPIQDAADEVISGKLIDHFPLVVFQTGSGTQSNMNANEVISNRAIQL 147
           VNESLG LDPK+SK IQ AADEV SGKL DHFPLVVFQTGSGTQSNMNANEVISNRAI++
Sbjct: 84  VNESLGGLDPKISKAIQQAADEVASGKLDDHFPLVVFQTGSGTQSNMNANEVISNRAIEI 143

Query: 148 VGGEVGSKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEVTHLLLPELIALRDAFAKKAQEF 207
           +GG++GSK +HPNNHCNQ+QSSNDTFP+VMHIAA  ++ + L+PEL  L++A   K++EF
Sbjct: 144 LGGKIGSKQVHPNNHCNQSQSSNDTFPTVMHIAASLQIQNELIPELTNLKNALEAKSKEF 203

Query: 208 DSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHSLHNLKFLAQGGTAVGTGLNT 267
           D IVKIGRTHLQDATPLTLGQEFSGYVQQ+ NGI RV HSL  L FLAQGGTAVGTGLNT
Sbjct: 204 DHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSLKTLSFLAQGGTAVGTGLNT 263

Query: 268 KVGFAEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTLACSLFKIANDIRYL 327
           K GF  KIAEQ+SKETG+ F+TAPNKFEALAAHDA+VECSGALNTLACSLFKIA DIRYL
Sbjct: 264 KPGFDVKIAEQISKETGLKFQTAPNKFEALAAHDAIVECSGALNTLACSLFKIAQDIRYL 323

Query: 328 GSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFEL 387
           GSGPRCGY EL LPENEPGSSIMPGKVNPTQNEA+TQVCVQVMGNNAAITFAG+ GQFEL
Sbjct: 324 GSGPRCGYHELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAGSQGQFEL 383

Query: 388 NVFKPVMISNLLSSIRLLGDACYSFRVHCVEGIQANEDKIAKLLHESLMLVTALNPKIGY 447
           NVFKPVMI+NLL+SIRL+ DA YSFRVHCVEGI+ANE +I +LL +SLMLVTALNPKIGY
Sbjct: 384 NVFKPVMIANLLNSIRLITDAAYSFRVHCVEGIKANEPRIHELLTKSLMLVTALNPKIGY 443

Query: 448 DAASKVAKNAHKKGITLKESALELGVLSSAEFDEWVVPENMVGPK 492
           DAASKVAKNAHKKGITLKESALELGVL+  EFDEWVVPE+M+GPK
Sbjct: 444 DAASKVAKNAHKKGITLKESALELGVLTEKEFDEWVVPEHMLGPK 488

>TPHA0J00270 Chr10 (61961..63451) [1491 bp, 496 aa] {ON} Anc_6.13
           YPL262W
          Length = 496

 Score =  796 bits (2055), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/461 (80%), Positives = 418/461 (90%)

Query: 32  YRVETDAFGEIKVPTDKLWGAQTQRSLENFKIGGQRERMPEPIVKAFGILKKSAAIVNES 91
           +R+ETD FGEIKVP +K WGAQT+RS ENF+IGG RERMP+P+VKAFG+LKKSAAIVNE 
Sbjct: 36  FRIETDGFGEIKVPANKYWGAQTERSFENFRIGGPRERMPDPVVKAFGVLKKSAAIVNEG 95

Query: 92  LGTLDPKVSKPIQDAADEVISGKLIDHFPLVVFQTGSGTQSNMNANEVISNRAIQLVGGE 151
            GTLDP++SK IQ+AADEVI GKL DHFPLVVFQTGSGTQSNMNANEVISNRAI+L+GG 
Sbjct: 96  YGTLDPQISKVIQEAADEVIQGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGT 155

Query: 152 VGSKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEVTHLLLPELIALRDAFAKKAQEFDSIV 211
           +GSK +HPNNH NQAQSSND+FP+VMHIAAVTE+T  L+PE+  LRDA   K+++F  IV
Sbjct: 156 LGSKQVHPNNHVNQAQSSNDSFPTVMHIAAVTEITDHLIPEVANLRDALESKSKDFAHIV 215

Query: 212 KIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHSLHNLKFLAQGGTAVGTGLNTKVGF 271
           KIGRTHLQDATPLTLGQEFSGYVQQLTNGI R+EHSL NLKFLAQGGTAVGTGLNT++GF
Sbjct: 216 KIGRTHLQDATPLTLGQEFSGYVQQLTNGIGRIEHSLINLKFLAQGGTAVGTGLNTRIGF 275

Query: 272 AEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTLACSLFKIANDIRYLGSGP 331
           AEKIAEQ+SKETG+ FKTAPNKFEALAAHDA+VE SGA+ T+A SLFKIA DIRYLGSGP
Sbjct: 276 AEKIAEQISKETGVAFKTAPNKFEALAAHDAIVEASGAITTVATSLFKIAQDIRYLGSGP 335

Query: 332 RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFK 391
           RCGYGELSLPENEPGSSIMPGK+NPTQNEA+TQVC Q++GNN  I FAG  GQFELNVFK
Sbjct: 336 RCGYGELSLPENEPGSSIMPGKINPTQNEAVTQVCAQIIGNNQTIIFAGTQGQFELNVFK 395

Query: 392 PVMISNLLSSIRLLGDACYSFRVHCVEGIQANEDKIAKLLHESLMLVTALNPKIGYDAAS 451
           PVMISNLLSSIRLLGD   SFR+HCVEGI+ANE++IA L+++SLMLVTALNPKIGYD A+
Sbjct: 396 PVMISNLLSSIRLLGDVSKSFRIHCVEGIKANEERIADLMNKSLMLVTALNPKIGYDEAT 455

Query: 452 KVAKNAHKKGITLKESALELGVLSSAEFDEWVVPENMVGPK 492
           KVAKNAHKKGITLKESA++LG L+ +EFDEWVVPE M+GPK
Sbjct: 456 KVAKNAHKKGITLKESAMQLGSLTESEFDEWVVPEKMIGPK 496

>ZYRO0C07964g Chr3 complement(607609..609126) [1518 bp, 505 aa] {ON}
           highly similar to uniprot|P08417 Saccharomyces
           cerevisiae YPL262W FUM1 Fumarase converts fumaric acid
           to L-malic acid in the TCA cycle cytosolic and
           mitochondrial localization determined by the N-terminal
           mitochondrial targeting sequence and protein
           conformation
          Length = 505

 Score =  795 bits (2053), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/477 (79%), Positives = 424/477 (88%)

Query: 17  SKARLISTSSSLGQKYRVETDAFGEIKVPTDKLWGAQTQRSLENFKIGGQRERMPEPIVK 76
           S+   + T++   Q++RVETDAFGEIKVP DK WGAQTQRS ENF+IGGQRERMPE +V 
Sbjct: 29  SQISQLHTTTPWLQEHRVETDAFGEIKVPADKYWGAQTQRSFENFRIGGQRERMPEAVVH 88

Query: 77  AFGILKKSAAIVNESLGTLDPKVSKPIQDAADEVISGKLIDHFPLVVFQTGSGTQSNMNA 136
           AFGILKK+ A VNE+ G LDPK++  I+ AADEV SGKL DHFPLVVFQTGSGTQSNMNA
Sbjct: 89  AFGILKKATATVNEANGQLDPKLAVAIKQAADEVASGKLKDHFPLVVFQTGSGTQSNMNA 148

Query: 137 NEVISNRAIQLVGGEVGSKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEVTHLLLPELIAL 196
           NEVISNRAI+L+GG++GSKS+HPNNH N +QSSNDTFP+VMHIAAV  +T  LLP L AL
Sbjct: 149 NEVISNRAIELLGGKLGSKSVHPNNHINMSQSSNDTFPTVMHIAAVLAITKDLLPNLTAL 208

Query: 197 RDAFAKKAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHSLHNLKFLAQ 256
           +D+  KK++EF  IVKIGRTHLQDATPLTLGQEFSGYVQQ+ NGI RVE +L +LK LAQ
Sbjct: 209 KDSLQKKSEEFADIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTLDSLKLLAQ 268

Query: 257 GGTAVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTLACS 316
           GGTAVGTGLNTK+G+AE +A +V+KETGIDF+TAPNKFEALAAHDAVVE SGALNTLA S
Sbjct: 269 GGTAVGTGLNTKIGWAENVAAEVAKETGIDFQTAPNKFEALAAHDAVVEASGALNTLAVS 328

Query: 317 LFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAI 376
           LFKIA DIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEA+TQVCVQV GN++AI
Sbjct: 329 LFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVFGNHSAI 388

Query: 377 TFAGASGQFELNVFKPVMISNLLSSIRLLGDACYSFRVHCVEGIQANEDKIAKLLHESLM 436
           TFAGASGQFELNVFKPVMISNLLSSI LL DA YSFRVHCV+GIQAN + IAKLLHESLM
Sbjct: 389 TFAGASGQFELNVFKPVMISNLLSSINLLSDASYSFRVHCVDGIQANRENIAKLLHESLM 448

Query: 437 LVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLSSAEFDEWVVPENMVGPKP 493
           LVTALNPKIGYDAASKVAKNAHK GITLKESAL+L +L++ EFD WVVPE+M+GPKP
Sbjct: 449 LVTALNPKIGYDAASKVAKNAHKNGITLKESALQLNILTAEEFDHWVVPEHMIGPKP 505

>Skud_16.16 Chr16 (26407..27873) [1467 bp, 488 aa] {ON} YPL262W
           (REAL)
          Length = 488

 Score =  794 bits (2051), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/492 (77%), Positives = 426/492 (86%), Gaps = 4/492 (0%)

Query: 1   MFKVTTEAANKALISGSKARLISTSSSLGQKYRVETDAFGEIKVPTDKLWGAQTQRSLEN 60
           M + +       L S  K  L   +S+    +R+ETDAFGEI VP DK WGAQTQRS +N
Sbjct: 1   MLRFSNFNCKAVLQSSYKVNLRRMNST----FRIETDAFGEINVPADKYWGAQTQRSFQN 56

Query: 61  FKIGGQRERMPEPIVKAFGILKKSAAIVNESLGTLDPKVSKPIQDAADEVISGKLIDHFP 120
           FKIGG RERMP P+V AFG+LKKSAA+VNESLG LDPK+SK IQ AADEV SGKL DHFP
Sbjct: 57  FKIGGARERMPLPLVHAFGVLKKSAAVVNESLGGLDPKISKAIQQAADEVTSGKLDDHFP 116

Query: 121 LVVFQTGSGTQSNMNANEVISNRAIQLVGGEVGSKSIHPNNHCNQAQSSNDTFPSVMHIA 180
           LVVFQTGSGTQSNMNANEVISNRAI+++GG++GSK +HPNNHCNQ+QSSNDTFP+VMHIA
Sbjct: 117 LVVFQTGSGTQSNMNANEVISNRAIEILGGKIGSKEVHPNNHCNQSQSSNDTFPTVMHIA 176

Query: 181 AVTEVTHLLLPELIALRDAFAKKAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNG 240
           A  ++ + L+PEL  L++A   K++EF+ IVKIGRTHLQDATPLTLGQEFSGYVQQ+ NG
Sbjct: 177 ASLQIQNELIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENG 236

Query: 241 ISRVEHSLHNLKFLAQGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAH 300
           I RV HSL  L FLAQGGTAVGTGLNTK GF  KIAEQ+S ETG+ F+TAPNKFEALAAH
Sbjct: 237 IQRVAHSLKTLSFLAQGGTAVGTGLNTKPGFDIKIAEQISSETGLKFQTAPNKFEALAAH 296

Query: 301 DAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 360
           DA+VECSGALNTLACSLFKIA DIRYLGSGPRCGY EL LPENEPGSSIMPGKVNPTQNE
Sbjct: 297 DAIVECSGALNTLACSLFKIAQDIRYLGSGPRCGYHELMLPENEPGSSIMPGKVNPTQNE 356

Query: 361 AMTQVCVQVMGNNAAITFAGASGQFELNVFKPVMISNLLSSIRLLGDACYSFRVHCVEGI 420
           A+TQVCVQVMGNNAAITFAG+ GQFELNVFKPVMI+NLL+SIRL+ D+ YSFRVHCVEGI
Sbjct: 357 ALTQVCVQVMGNNAAITFAGSQGQFELNVFKPVMIANLLNSIRLITDSAYSFRVHCVEGI 416

Query: 421 QANEDKIAKLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLSSAEFD 480
           +ANE +I +LL +SLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVL+  EFD
Sbjct: 417 KANEPRIHELLTKSLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLTEKEFD 476

Query: 481 EWVVPENMVGPK 492
           EWVVPENM+GPK
Sbjct: 477 EWVVPENMLGPK 488

>Suva_16.43 Chr16 (62871..64337) [1467 bp, 488 aa] {ON} YPL262W
           (REAL)
          Length = 488

 Score =  788 bits (2034), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/492 (76%), Positives = 423/492 (85%), Gaps = 4/492 (0%)

Query: 1   MFKVTTEAANKALISGSKARLISTSSSLGQKYRVETDAFGEIKVPTDKLWGAQTQRSLEN 60
           M + +  +    L S  K  +   +S+    +R ETDAFGEI VP DK WGAQTQRS +N
Sbjct: 1   MLRFSNSSCKAILQSSYKVNIRRMNST----FRTETDAFGEINVPADKYWGAQTQRSFQN 56

Query: 61  FKIGGQRERMPEPIVKAFGILKKSAAIVNESLGTLDPKVSKPIQDAADEVISGKLIDHFP 120
           FKIGG RERMP P+V AFG+LKKSAAIVNESLG LDPKVSK IQ AADEV +GKL DHFP
Sbjct: 57  FKIGGARERMPLPLVHAFGVLKKSAAIVNESLGGLDPKVSKAIQQAADEVAAGKLDDHFP 116

Query: 121 LVVFQTGSGTQSNMNANEVISNRAIQLVGGEVGSKSIHPNNHCNQAQSSNDTFPSVMHIA 180
           LVVFQTGSGTQSNMNANEVISNRAI+++GG++GSK +HPNN CNQ+QSSNDTFP+VMHIA
Sbjct: 117 LVVFQTGSGTQSNMNANEVISNRAIEILGGKIGSKQVHPNNDCNQSQSSNDTFPTVMHIA 176

Query: 181 AVTEVTHLLLPELIALRDAFAKKAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNG 240
           A  ++   L+PEL  L++A   K++EF+ IVKIGRTHLQDATPLTLGQEFSGYVQQ+ NG
Sbjct: 177 ASLQIEKELIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENG 236

Query: 241 ISRVEHSLHNLKFLAQGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAH 300
           I RV H+L  L FLAQGGTAVGTGLNTK GF  KIAEQ+SKETG+ F+TAPNKFEALAAH
Sbjct: 237 IQRVAHTLKTLSFLAQGGTAVGTGLNTKPGFDVKIAEQISKETGLKFQTAPNKFEALAAH 296

Query: 301 DAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 360
           DA+VECSGALNTLACSLFKIA DIRYLGSGPRCGY EL LPENEPGSSIMPGKVNPTQNE
Sbjct: 297 DAIVECSGALNTLACSLFKIAQDIRYLGSGPRCGYNELMLPENEPGSSIMPGKVNPTQNE 356

Query: 361 AMTQVCVQVMGNNAAITFAGASGQFELNVFKPVMISNLLSSIRLLGDACYSFRVHCVEGI 420
           A+TQVCVQVMGNNAAITF G+ GQFELNVFKPVMI+NLL+SIRL+ DA  SFR+HCVEGI
Sbjct: 357 ALTQVCVQVMGNNAAITFGGSQGQFELNVFKPVMIANLLNSIRLIADASRSFRIHCVEGI 416

Query: 421 QANEDKIAKLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLSSAEFD 480
           +ANE +I +LL +SLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVL+  EFD
Sbjct: 417 KANEPRIHELLTKSLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLTEKEFD 476

Query: 481 EWVVPENMVGPK 492
           EWVVPENM+GPK
Sbjct: 477 EWVVPENMLGPK 488

>KNAG0E02750 Chr5 (547746..549242) [1497 bp, 498 aa] {ON} Anc_6.13
           YPL262W
          Length = 498

 Score =  779 bits (2011), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/482 (76%), Positives = 422/482 (87%)

Query: 12  ALISGSKARLISTSSSLGQKYRVETDAFGEIKVPTDKLWGAQTQRSLENFKIGGQRERMP 71
           AL+  +  R +S S+   Q++RVETD+FGEI VP D+ WGAQTQRS +NFKIGG RE++P
Sbjct: 17  ALLRNNLRRNMSASAITNQEFRVETDSFGEINVPADRYWGAQTQRSFQNFKIGGDREKIP 76

Query: 72  EPIVKAFGILKKSAAIVNESLGTLDPKVSKPIQDAADEVISGKLIDHFPLVVFQTGSGTQ 131
           EP+V+AFGILKKSAA VNE+LGTLD  ++  I+ AADEV  GKL DHFPLVVFQTGSGTQ
Sbjct: 77  EPVVRAFGILKKSAATVNENLGTLDKSIAAKIKLAADEVAEGKLSDHFPLVVFQTGSGTQ 136

Query: 132 SNMNANEVISNRAIQLVGGEVGSKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEVTHLLLP 191
           SNMNANEVISNRAI+L+GGE+GSK +HPNNH NQ+QSSNDTFP+VMHIAA TE+ + L+P
Sbjct: 137 SNMNANEVISNRAIELLGGELGSKQVHPNNHVNQSQSSNDTFPTVMHIAATTEIANKLIP 196

Query: 192 ELIALRDAFAKKAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHSLHNL 251
           EL  L+DA   K +EF SIVKIGRTHLQDATPLTLGQEFSGYVQQ+ NGI RV+ SL++L
Sbjct: 197 ELQNLKDALQHKVEEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVQSSLYHL 256

Query: 252 KFLAQGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALN 311
            FLAQGGTAVGTGLNTKVGF + +AE+VSKETG+ F+TAPNKFEALAAHDA+VE SGALN
Sbjct: 257 HFLAQGGTAVGTGLNTKVGFDKLVAEEVSKETGLHFETAPNKFEALAAHDAIVEASGALN 316

Query: 312 TLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMG 371
           TLACSLFKIA DIRYLGSGPRCGYGEL LP NEPGSSIMPGKVNPTQNEAMTQVCVQVMG
Sbjct: 317 TLACSLFKIAQDIRYLGSGPRCGYGELILPANEPGSSIMPGKVNPTQNEAMTQVCVQVMG 376

Query: 372 NNAAITFAGASGQFELNVFKPVMISNLLSSIRLLGDACYSFRVHCVEGIQANEDKIAKLL 431
           NN+ ITFAG+ GQFELNV+KP+MISNLLSSIRLL DA  SFR+HC+  ++AN+DKI + L
Sbjct: 377 NNSTITFAGSQGQFELNVYKPLMISNLLSSIRLLTDASKSFRIHCLNDLKANKDKIDENL 436

Query: 432 HESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLSSAEFDEWVVPENMVGP 491
           ++SLMLVTALNPKIGYDAA+KVAKNAH K ITLKESALELGVL+  EFDEWV+PENM+ P
Sbjct: 437 NKSLMLVTALNPKIGYDAAAKVAKNAHHKNITLKESALELGVLTEKEFDEWVIPENMISP 496

Query: 492 KP 493
           KP
Sbjct: 497 KP 498

>KAFR0B06520 Chr2 (1352364..1353851) [1488 bp, 495 aa] {ON} Anc_6.13
           YPL262W
          Length = 495

 Score =  770 bits (1989), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/469 (76%), Positives = 420/469 (89%)

Query: 24  TSSSLGQKYRVETDAFGEIKVPTDKLWGAQTQRSLENFKIGGQRERMPEPIVKAFGILKK 83
           T SS+   +R ETD+FGEI VP DK WGAQTQRSL+NFKIGG+RE++P PI++AFGILKK
Sbjct: 26  TMSSIKSSFRAETDSFGEINVPNDKYWGAQTQRSLQNFKIGGEREKIPIPIIEAFGILKK 85

Query: 84  SAAIVNESLGTLDPKVSKPIQDAADEVISGKLIDHFPLVVFQTGSGTQSNMNANEVISNR 143
           SAAIVNE LGTLD +++K I  AADEV  GKL DHFPLVVFQTGSGTQSNMNANEVISNR
Sbjct: 86  SAAIVNERLGTLDSELAKNIIIAADEVSQGKLNDHFPLVVFQTGSGTQSNMNANEVISNR 145

Query: 144 AIQLVGGEVGSKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEVTHLLLPELIALRDAFAKK 203
           AI+L+GG++GSK++HPNNH NQ+QSSNDTFP+VMHIAA+ E+T  LLPEL +L+++  KK
Sbjct: 146 AIELMGGKLGSKTVHPNNHVNQSQSSNDTFPTVMHIAAMLEITRKLLPELNSLKNSLDKK 205

Query: 204 AQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHSLHNLKFLAQGGTAVGT 263
           + EF+ IVKIGRTHLQDATPLTLGQEFSGYVQQ+TNGI R+E +L++LKFLAQGGTAVGT
Sbjct: 206 SNEFNDIVKIGRTHLQDATPLTLGQEFSGYVQQMTNGIRRIETALYHLKFLAQGGTAVGT 265

Query: 264 GLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTLACSLFKIAND 323
           GLNTK GF + IAEQ+S+ETGI+F+TAPNKFEALAAHDA+VE SGALNTLACSLFKIA D
Sbjct: 266 GLNTKAGFDKLIAEQISEETGINFETAPNKFEALAAHDAIVEVSGALNTLACSLFKIAQD 325

Query: 324 IRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASG 383
           IRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVC+QVMGN++ ITFAG+ G
Sbjct: 326 IRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCIQVMGNHSTITFAGSQG 385

Query: 384 QFELNVFKPVMISNLLSSIRLLGDACYSFRVHCVEGIQANEDKIAKLLHESLMLVTALNP 443
           QFELNV+KP++ISNLLSSIRLL DA YSFRVHC++G++AN + I + L++SLMLVTALNP
Sbjct: 386 QFELNVYKPLLISNLLSSIRLLTDASYSFRVHCIDGLKANRENITENLNKSLMLVTALNP 445

Query: 444 KIGYDAASKVAKNAHKKGITLKESALELGVLSSAEFDEWVVPENMVGPK 492
            IGYD ASK+AKNAH K ITLKESALELG+L+  +F EWV+PE M+GPK
Sbjct: 446 YIGYDNASKIAKNAHHKNITLKESALELGLLTEEQFSEWVIPEKMIGPK 494

>TBLA0G01000 Chr7 (252070..253467) [1398 bp, 465 aa] {ON} Anc_6.13
           YPL262W
          Length = 465

 Score =  750 bits (1936), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/459 (75%), Positives = 410/459 (89%)

Query: 33  RVETDAFGEIKVPTDKLWGAQTQRSLENFKIGGQRERMPEPIVKAFGILKKSAAIVNESL 92
           R+E D FGE++VP +K WGAQTQR+L NF IGG+RERMPEP++ A+GILKKS AIVNESL
Sbjct: 5   RIEVDGFGELEVPANKYWGAQTQRALNNFHIGGERERMPEPLILAYGILKKSVAIVNESL 64

Query: 93  GTLDPKVSKPIQDAADEVISGKLIDHFPLVVFQTGSGTQSNMNANEVISNRAIQLVGGEV 152
           GTLDPK+SK IQ+AADEV  G L +HFPLVVFQTGSGTQ+NMN NEVISNRAI+++GG++
Sbjct: 65  GTLDPKISKAIQEAADEVAKGSLNEHFPLVVFQTGSGTQTNMNVNEVISNRAIEILGGQL 124

Query: 153 GSKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEVTHLLLPELIALRDAFAKKAQEFDSIVK 212
           GSK++HPNNH NQ+QS+ND+FP+ MHI+AV EV   LLPEL  LRDA   K+ EF+ IVK
Sbjct: 125 GSKTVHPNNHVNQSQSTNDSFPTAMHISAVREVVFKLLPELEKLRDALKDKSIEFNKIVK 184

Query: 213 IGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHSLHNLKFLAQGGTAVGTGLNTKVGFA 272
           IGRTHLQDATPLTLGQEFSGYVQQ+ NGI+RV++SL NLKF+AQGGTAVGTG+NTK  F 
Sbjct: 185 IGRTHLQDATPLTLGQEFSGYVQQVENGITRVQNSLTNLKFIAQGGTAVGTGINTKKDFD 244

Query: 273 EKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTLACSLFKIANDIRYLGSGPR 332
             +A+Q+S ETGI+FKTAPNKFEALA+HDA+VECSGALNTLACSLFKI+ DIR+LGSGPR
Sbjct: 245 ILVAKQISLETGIEFKTAPNKFEALASHDAIVECSGALNTLACSLFKISQDIRFLGSGPR 304

Query: 333 CGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFKP 392
           CGYGELSLPENEPGSSIMPGKVNPTQNEAM Q C+QVMGNN+AITFAGASGQFELN +KP
Sbjct: 305 CGYGELSLPENEPGSSIMPGKVNPTQNEAMCQACIQVMGNNSAITFAGASGQFELNTYKP 364

Query: 393 VMISNLLSSIRLLGDACYSFRVHCVEGIQANEDKIAKLLHESLMLVTALNPKIGYDAASK 452
           +MISNLL+SIRLL D+C SFR+HC+ GI+ANEDKI KLL+ESLMLVTALNPKIGYDAA+ 
Sbjct: 365 LMISNLLNSIRLLTDSCNSFRIHCIVGIRANEDKINKLLNESLMLVTALNPKIGYDAATA 424

Query: 453 VAKNAHKKGITLKESALELGVLSSAEFDEWVVPENMVGP 491
           +AK+AHK G+TLKE+AL+  +L++ +FDEW+VPE+MV P
Sbjct: 425 IAKDAHKNGLTLKEAALKSKLLTAEQFDEWIVPESMVHP 463

>NDAI0I02470 Chr9 complement(567782..569209) [1428 bp, 475 aa] {ON}
           Anc_6.13 YPL262W
          Length = 475

 Score =  748 bits (1932), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/462 (76%), Positives = 415/462 (89%)

Query: 32  YRVETDAFGEIKVPTDKLWGAQTQRSLENFKIGGQRERMPEPIVKAFGILKKSAAIVNES 91
           +RVETD+FGEIKVP++K WGAQTQRS +NFKIGG+RE++P PI+KAFGILKKSAAIVN+S
Sbjct: 14  FRVETDSFGEIKVPSNKYWGAQTQRSFQNFKIGGEREKIPLPIIKAFGILKKSAAIVNQS 73

Query: 92  LGTLDPKVSKPIQDAADEVISGKLIDHFPLVVFQTGSGTQSNMNANEVISNRAIQLVGGE 151
           LGTLDP ++ PI  A+DEVI GKL DHFPLVVFQTGSGTQ+NMNANEVISNRA +L+G E
Sbjct: 74  LGTLDPSIATPIIKASDEVIQGKLNDHFPLVVFQTGSGTQTNMNANEVISNRANELIGAE 133

Query: 152 VGSKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEVTHLLLPELIALRDAFAKKAQEFDSIV 211
           +GSK IHPNNH NQ+QSSNDTFPSVMHIAAV E+ + L+P+L  L+++   KA+E+ +IV
Sbjct: 134 LGSKKIHPNNHVNQSQSSNDTFPSVMHIAAVLELNNNLIPQLTELKNSLDNKAKEYANIV 193

Query: 212 KIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHSLHNLKFLAQGGTAVGTGLNTKVGF 271
           KIGRTHLQDATPLTLGQEFSGYVQQLTNGI R++ SL++LKFLAQGGTAVGTGLNTKVGF
Sbjct: 194 KIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIQASLYHLKFLAQGGTAVGTGLNTKVGF 253

Query: 272 AEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTLACSLFKIANDIRYLGSGP 331
            + IA++VSKETGIDF+TAPNKFEALAAHDA+V  S A+ T+A SLFKIA DIRYLGSGP
Sbjct: 254 DKMIAQEVSKETGIDFETAPNKFEALAAHDAIVFASSAITTVAGSLFKIAQDIRYLGSGP 313

Query: 332 RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFK 391
           RCGYGEL LPENEPGSSIMPGKVNPTQNEAMTQV +Q+MGNN  I  AG+ GQFELNV+K
Sbjct: 314 RCGYGELQLPENEPGSSIMPGKVNPTQNEAMTQVALQIMGNNQTIVMAGSQGQFELNVYK 373

Query: 392 PVMISNLLSSIRLLGDACYSFRVHCVEGIQANEDKIAKLLHESLMLVTALNPKIGYDAAS 451
           P+MI+NLL+SIRL+ DAC+SF++HCV+G++AN DKI + LH+SLMLVTALNPKIGYDAAS
Sbjct: 374 PLMIANLLNSIRLMSDACHSFKIHCVDGLKANTDKINENLHKSLMLVTALNPKIGYDAAS 433

Query: 452 KVAKNAHKKGITLKESALELGVLSSAEFDEWVVPENMVGPKP 493
           K+AKNAH K ITLKESALELG+L+  EFD+WV+PENM+GPKP
Sbjct: 434 KLAKNAHAKNITLKESALELGLLTEEEFDQWVIPENMIGPKP 475

>TBLA0A07130 Chr1 (1770536..1772038) [1503 bp, 500 aa] {ON} Anc_6.13
           YPL262W
          Length = 500

 Score =  739 bits (1907), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/462 (74%), Positives = 397/462 (85%)

Query: 30  QKYRVETDAFGEIKVPTDKLWGAQTQRSLENFKIGGQRERMPEPIVKAFGILKKSAAIVN 89
           Q  R ETD+FGEI+VP +K WGAQTQRS  NFKIGG+RERMPEPI++AFG  KK+AAIVN
Sbjct: 38  QGTRTETDSFGEIQVPANKYWGAQTQRSFMNFKIGGERERMPEPIIRAFGQQKKAAAIVN 97

Query: 90  ESLGTLDPKVSKPIQDAADEVISGKLIDHFPLVVFQTGSGTQSNMNANEVISNRAIQLVG 149
            SLGTLD  +   I  AA+EV  G L +HFPLVVFQTGSGTQSNMNANEVISNRAI+L+G
Sbjct: 98  NSLGTLDDTLKDAIVQAAEEVSQGLLNEHFPLVVFQTGSGTQSNMNANEVISNRAIELLG 157

Query: 150 GEVGSKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEVTHLLLPELIALRDAFAKKAQEFDS 209
           G +GSK +HPNNH NQ+QSSNDTFP+VMHIAA+TE+T+ LLP LI LR+    KA+EF+ 
Sbjct: 158 GTLGSKQVHPNNHVNQSQSSNDTFPTVMHIAALTEITNTLLPNLIVLRETLDSKAKEFEK 217

Query: 210 IVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHSLHNLKFLAQGGTAVGTGLNTKV 269
           I+KIGRTHLQDATPLTLGQEFSGY QQLTN I R+E +L  L+++AQGGTAVGTGLNTK+
Sbjct: 218 IIKIGRTHLQDATPLTLGQEFSGYTQQLTNAIKRIEKNLPELQYIAQGGTAVGTGLNTKI 277

Query: 270 GFAEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTLACSLFKIANDIRYLGS 329
           GFAE+ A Q+S +T + F T+PNKFE+LAAHDA+V    +LNTLACSLFKI+ DIRYL S
Sbjct: 278 GFAEQFARQLSNQTNLSFLTSPNKFESLAAHDAIVNVHASLNTLACSLFKISQDIRYLAS 337

Query: 330 GPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNV 389
           GPRCGYGELS+PENEPGSSIMPGKVNPTQNEAM Q CVQVMGNN+ I+FAGASGQFELN 
Sbjct: 338 GPRCGYGELSIPENEPGSSIMPGKVNPTQNEAMCQACVQVMGNNSTISFAGASGQFELNT 397

Query: 390 FKPVMISNLLSSIRLLGDACYSFRVHCVEGIQANEDKIAKLLHESLMLVTALNPKIGYDA 449
           +KP+MI+NLLSS RLL DA +SF +HC  GIQAN+DKI +LLHESLMLVT+LNPKIGYDA
Sbjct: 398 YKPLMIANLLSSTRLLSDAIFSFNLHCATGIQANKDKIDRLLHESLMLVTSLNPKIGYDA 457

Query: 450 ASKVAKNAHKKGITLKESALELGVLSSAEFDEWVVPENMVGP 491
           ASKVAKNAH KGITLK+SALEL +LSS +FDEWV PENM+GP
Sbjct: 458 ASKVAKNAHHKGITLKQSALELDILSSKQFDEWVRPENMLGP 499

>YLR359W Chr12 (844282..845730) [1449 bp, 482 aa] {ON}
           ADE13Adenylosuccinate lyase, catalyzes two steps in the
           'de novo' purine nucleotide biosynthetic pathway;
           expression is repressed by adenine and activated by
           Bas1p and Pho2p; mutations in human ortholog ADSL cause
           adenylosuccinase deficiency
          Length = 482

 Score = 53.1 bits (126), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 49/193 (25%), Positives = 91/193 (47%), Gaps = 19/193 (9%)

Query: 182 VTEVTHLLLPELIALRDAFAKKAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGI 241
           + +   +++P+L+ + +  AK A E+  +  +G TH Q A   TLG+  + ++Q+L   +
Sbjct: 121 IRDAYDIIIPKLVNVINRLAKFAMEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDL 180

Query: 242 SRVEHSLHNLKFLAQGGT--------AVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNK 293
              E + +++      GT        A+  G + KV   E + E+V++  G D K  P  
Sbjct: 181 RNFERARNDIGLRGVKGTTGTQASFLALFHGNHDKV---EALDERVTELLGFD-KVYPVT 236

Query: 294 FEALAAHDAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGK 353
            +   +    ++    L++ A +  K+A DIR L +       E    +++ GSS M  K
Sbjct: 237 GQTY-SRKIDIDVLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYK 292

Query: 354 VNPTQNEAMTQVC 366
            NP + E   +VC
Sbjct: 293 RNPMRCE---RVC 302

>Smik_12.446 Chr12 (783341..784789) [1449 bp, 482 aa] {ON} YLR359W
           (REAL)
          Length = 482

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 49/193 (25%), Positives = 90/193 (46%), Gaps = 19/193 (9%)

Query: 182 VTEVTHLLLPELIALRDAFAKKAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGI 241
           + +   +++P+L+ + +  AK A E+  +  +G TH Q A   TLG+  + ++Q+L   +
Sbjct: 121 IRDAYDIIIPKLVNVINRLAKFAMEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDL 180

Query: 242 SRVEHSLHNLKFLAQGGT--------AVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNK 293
              E + +++      GT        A+  G + KV   E + E+V++  G D K  P  
Sbjct: 181 RNFERARNDIGLRGVKGTTGTQASFLALFHGNHDKV---EALDERVTELLGFD-KVYPVT 236

Query: 294 FEALAAHDAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGK 353
            +   +    ++    L++ A +  K+A DIR L +       E    + + GSS M  K
Sbjct: 237 GQTY-SRKIDIDVLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKTQIGSSAMAYK 292

Query: 354 VNPTQNEAMTQVC 366
            NP + E   +VC
Sbjct: 293 RNPMRCE---RVC 302

>Suva_10.459 Chr10 (803809..805257) [1449 bp, 482 aa] {ON} YLR359W
           (REAL)
          Length = 482

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 49/187 (26%), Positives = 89/187 (47%), Gaps = 19/187 (10%)

Query: 188 LLLPELIALRDAFAKKAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHS 247
           +++P+L+ + +  AK A E+  +  +G TH Q A   TLG+  + ++Q+L   +   E +
Sbjct: 127 IIIPKLVNVINRLAKFAMEYKDLPVLGWTHFQPAQLTTLGKRTTLWIQELLWDLRNFERA 186

Query: 248 LHNLKFLAQGGT--------AVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAA 299
            +++      GT        A+  G + KV   E + E+V++  G D K  P   +   +
Sbjct: 187 RNDIGLRGVKGTTGTQASFLALFHGNHDKV---EALDERVTELLGFD-KVYPVTGQTY-S 241

Query: 300 HDAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQN 359
               ++    L++ A +  K+A DIR L +       E    +++ GSS M  K NP + 
Sbjct: 242 RKIDIDVLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPMRC 298

Query: 360 EAMTQVC 366
           E   +VC
Sbjct: 299 E---RVC 302

>CAGL0B02794g Chr2 complement(269303..270751) [1449 bp, 482 aa] {ON}
           highly similar to uniprot|Q05911 Saccharomyces
           cerevisiae YLR359w ADE13
          Length = 482

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 50/193 (25%), Positives = 90/193 (46%), Gaps = 31/193 (16%)

Query: 188 LLLPELIALRDAFAKKAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHS 247
           +++P+L+ + +  AK A E+  +  +G TH Q A   TLG+  + ++Q+L   +   E +
Sbjct: 127 IVIPKLVNVINRLAKFALEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERA 186

Query: 248 LHNLKFLAQGGT--------AVGTGLNTKVGFAEKIAEQVSKETGIDF------KTAPNK 293
            +++      GT        A+  G + KV   E++ E+V++  G D       +T   K
Sbjct: 187 RNDIGLRGVKGTTGTQASFLALFHGNHDKV---EELDERVTELLGFDTVYPVTGQTYSRK 243

Query: 294 FEALAAHDAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGK 353
            +        ++    L++ A S  K+A DIR L +       E    +++ GSS M  K
Sbjct: 244 ID--------IDVLAPLSSFAASAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYK 292

Query: 354 VNPTQNEAMTQVC 366
            NP + E   +VC
Sbjct: 293 RNPMRCE---RVC 302

>KLLA0A08404g Chr1 complement(743192..744577) [1386 bp, 461 aa] {ON}
           highly similar to uniprot|P04076 Saccharomyces
           cerevisiae YHR018C ARG4 Argininosuccinate lyase
           catalyzes the final step in the arginine biosynthesis
           pathway
          Length = 461

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 58/228 (25%), Positives = 89/228 (39%), Gaps = 13/228 (5%)

Query: 150 GEVGSKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEVTHLLLPELIALRDAFAKKAQEFDS 209
           GE+  + I    H    +S ND   + M I     +   +LP L +L     ++A+E   
Sbjct: 96  GEIIGRGIAGKVHT--GRSRNDQVATDMRIYCRDILNGTVLPALSSLIKVILQRAEEEID 153

Query: 210 IVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHSLHNLKFLAQGGTAVGTGLNTKV 269
           ++  G THLQ A P+      S Y    T    R++  +  L     G  A+        
Sbjct: 154 VLMPGYTHLQRAQPIRWAHWLSCYATYFTEDYKRLQQIVERLNVSPLGAGALA------- 206

Query: 270 GFAEKIAEQVSKETGIDFK-TAPNKFEALAAHDAVVECSGALNTLACSLFKIANDIRYLG 328
           G    I  +     G++F     N   A+A  D VVE     +     + + A D+  + 
Sbjct: 207 GHPYGIDREFLA-AGLNFNGVIGNSLTAVADRDFVVEIMFWGSLFMNHISRFAEDL-IIY 264

Query: 329 SGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAI 376
           S    G+ +LS      GSS+MP K NP   E +     +V G  A  
Sbjct: 265 STAEFGFIQLS-DAYSTGSSLMPQKKNPDSLELLRGKSGRVFGQLAGF 311

>Skud_8.70 Chr8 complement(121600..122991) [1392 bp, 463 aa] {ON}
           YHR018C (REAL)
          Length = 463

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 58/224 (25%), Positives = 87/224 (38%), Gaps = 13/224 (5%)

Query: 150 GEVGSKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEVTHLLLPELIALRDAFAKKAQEFDS 209
           GE+  + I    H    +S ND   + + I     V   L P L  L D   K+A+   +
Sbjct: 97  GEIIGRDIAGKVHT--GRSRNDQVVTDLRIYCRDVVNDNLFPALKGLVDVLIKRAKGEIN 154

Query: 210 IVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHSLHNLKFLAQGGTAVGTGLNTKV 269
           I+  G THLQ A P+      S Y    T    R++  LH L     G  A+        
Sbjct: 155 ILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLDQILHRLNQSPLGAGALA------- 207

Query: 270 GFAEKIAEQVSKETGIDFKTA-PNKFEALAAHDAVVECSGALNTLACSLFKIANDIRYLG 328
           G    I  +   E G+ F +   N   A++  D +VE           + + A D+  + 
Sbjct: 208 GHPYGIDREFLAE-GLGFNSVIGNSMVAVSDRDFIVELMFWGTLFMNHISRFAEDL-IIY 265

Query: 329 SGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGN 372
                G+ +LS      GSS+MP K N    E +     +V G+
Sbjct: 266 CTAEFGFIQLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>Skud_12.443 Chr12 (784448..785896) [1449 bp, 482 aa] {ON} YLR359W
           (REAL)
          Length = 482

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 48/193 (24%), Positives = 90/193 (46%), Gaps = 19/193 (9%)

Query: 182 VTEVTHLLLPELIALRDAFAKKAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGI 241
           + +   +++P+L+ + +  AK A E+  +  +G TH Q A   TLG+  + ++Q+L   +
Sbjct: 121 IRDAYDIIIPKLVNVINRLAKFAMEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDL 180

Query: 242 SRVEHSLHNLKFLAQGGT--------AVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNK 293
              E + +++      GT        A+  G + KV   E +  +V++  G D K  P  
Sbjct: 181 RNFERARNDIGLRGVKGTTGTQASFLALFHGNHDKV---EALDARVTELLGFD-KVYPVT 236

Query: 294 FEALAAHDAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGK 353
            +   +    ++    L++ A +  K+A DIR L +       E    +++ GSS M  K
Sbjct: 237 GQTY-SRKIDIDVLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYK 292

Query: 354 VNPTQNEAMTQVC 366
            NP + E   +VC
Sbjct: 293 RNPMRCE---RVC 302

>Smik_8.83 Chr8 complement(120320..121711) [1392 bp, 463 aa] {ON}
           YHR018C (REAL)
          Length = 463

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 61/238 (25%), Positives = 91/238 (38%), Gaps = 21/238 (8%)

Query: 136 ANEVISNRAIQLVGGEVGSKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEVTHLLLPELIA 195
           ANE    R  +L+G ++  K        +  +S ND   + + I     V   L P L  
Sbjct: 91  ANE---RRLGELIGRDIAGK-------VHTGRSRNDQVVTDLRIYCRDVVNGTLFPALKG 140

Query: 196 LRDAFAKKAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHSLHNLKFLA 255
           L D   K+A+    I+  G THLQ A P+      S Y    T    R+   LH L    
Sbjct: 141 LVDVLIKRAEGEIDILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLGQILHRLNQSP 200

Query: 256 QGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFKTA-PNKFEALAAHDAVVECSGALNTLA 314
            G  A+        G    I  +   E G+ F +   N   A++  D +VE         
Sbjct: 201 LGAGALA-------GHPYGIDREFLAE-GLGFNSVIGNSLVAVSDRDFIVELMFWGTLFM 252

Query: 315 CSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGN 372
             + + A D+  +      G+ +LS      GSS+MP K N    E +     +V G+
Sbjct: 253 NHISRFAEDL-IIYCTAEFGFIQLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>SAKL0D09746g Chr4 complement(808721..810115) [1395 bp, 464 aa] {ON}
           highly similar to uniprot|P04076 Saccharomyces
           cerevisiae YHR018C ARG4 Argininosuccinate lyase
           catalyzes the final step in the arginine biosynthesis
           pathway
          Length = 464

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 59/237 (24%), Positives = 93/237 (39%), Gaps = 21/237 (8%)

Query: 136 ANEVISNRAIQLVGGEVGSKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEVTHLLLPELIA 195
           ANE    R  +++G E+  K        +  +S ND   + M I     +  +LLP L A
Sbjct: 92  ANE---RRLGEIIGREISGK-------VHTGRSRNDQVATDMRIYCRDILNEVLLPALQA 141

Query: 196 LRDAFAKKAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHSLHNLKFLA 255
                  +A+E   ++  G THLQ A P+      S Y    T   +R++  +  L    
Sbjct: 142 FIKVLTTRAKEEIDVLMPGYTHLQRAQPIRWSHWLSSYATYFTEDYNRLKQIVERLNKSP 201

Query: 256 QGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFK-TAPNKFEALAAHDAVVECSGALNTLA 314
            G  A+        G    I  +     G+ F+    N   A++  D VVE         
Sbjct: 202 LGAGALA-------GHPYGIDREFLAR-GLGFQGVIGNSLTAVSDRDFVVEIMFWGTLFM 253

Query: 315 CSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMG 371
             + + + D+  + S    G+ +LS      GSS+MP K NP   E +     +V G
Sbjct: 254 NHISRFSEDL-IIYSTAEFGFIKLS-DAYSTGSSLMPQKKNPDSLELLRGKAGRVFG 308

>Suva_15.201 Chr15 complement(348498..349889) [1392 bp, 463 aa] {ON}
           YHR018C (REAL)
          Length = 463

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 60/238 (25%), Positives = 91/238 (38%), Gaps = 21/238 (8%)

Query: 136 ANEVISNRAIQLVGGEVGSKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEVTHLLLPELIA 195
           ANE    R  +L+G ++  K        +  +S ND   + + I     V   L P +  
Sbjct: 91  ANE---RRLGELIGRDIAGK-------VHTGRSRNDQVVTDLRIYCRDVVNDSLFPAMKG 140

Query: 196 LRDAFAKKAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHSLHNLKFLA 255
           L D   K+A+    I+  G THLQ A P+      S Y    T    R+   LH L    
Sbjct: 141 LVDVLVKRAEGEMDILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLVQILHRLNQSP 200

Query: 256 QGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFKTA-PNKFEALAAHDAVVECSGALNTLA 314
            G  A+        G    I  +   E G+ F +   N   A++  D +VE         
Sbjct: 201 LGAGALA-------GHPYGIDREFLAE-GLGFNSVIGNSLVAVSDRDFIVELMFWGTLFM 252

Query: 315 CSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGN 372
             + + A D+  +      G+ +LS      GSS+MP K N    E +     +V G+
Sbjct: 253 NHISRFAEDL-IIYCTAEFGFIQLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>CAGL0I08987g Chr9 complement(871699..873084) [1386 bp, 461 aa] {ON}
           highly similar to uniprot|P04076 Saccharomyces
           cerevisiae YHR018c ARLY
          Length = 461

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 62/275 (22%), Positives = 106/275 (38%), Gaps = 30/275 (10%)

Query: 98  KVSKPIQDAADEVISGKLIDHFPLVVFQTGSGTQSNMNANEVISNRAIQLVGGEVGSKSI 157
           K+   ++D  +E   GK + H            +S+ + +     R  +L+G ++  K  
Sbjct: 63  KIHSGLKDIENEWDEGKFVRH------------ESDEDIHTANERRLGELIGRDIAGK-- 108

Query: 158 HPNNHCNQAQSSNDTFPSVMHIAAVTEVTHLLLPELIALRDAFAKKAQEFDSIVKIGRTH 217
                 +  +S ND   + M I     +   + P + +L +    +A++   I+  G TH
Sbjct: 109 -----VHTGRSRNDQVVTDMRIYCREILNEKIFPAMKSLINVLVNRAEKEIDILMPGYTH 163

Query: 218 LQDATPLTLGQEFSGYVQQLTNGISRVEHSLHNLKFLAQGGTAVGTGLNTKVGFAEKIAE 277
           LQ A P+      S Y    T  + R+E     L       + +G+G     G    I  
Sbjct: 164 LQRAQPIRWAHWLSSYATYFTEDLKRLEQIAERL-----NKSPLGSG--ALAGHPYGIDR 216

Query: 278 QVSKETGIDFK-TAPNKFEALAAHDAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYG 336
           Q   E G+ F     N   A++  D VVE           + + + D+  + S    G+ 
Sbjct: 217 QFLAE-GLGFNGVIGNSLVAVSDRDFVVELMFWATLFMNHVSRFSEDL-IIYSTAEFGFI 274

Query: 337 ELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMG 371
           +LS      GSS+MP K N    E +     +V G
Sbjct: 275 KLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFG 308

>TPHA0B01040 Chr2 complement(235467..236915) [1449 bp, 482 aa] {ON}
           Anc_4.197 YLR359W
          Length = 482

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 49/193 (25%), Positives = 88/193 (45%), Gaps = 31/193 (16%)

Query: 188 LLLPELIALRDAFAKKAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHS 247
           +++P+L+ + D  +K A E+  +  +G TH Q A   TLG+  + ++Q+L   +     +
Sbjct: 127 VIIPKLVNVIDRLSKFAMEYKDLPVLGWTHFQPAQLTTLGKRSTLWIQELLWDLRNFVRA 186

Query: 248 LHNLKFLAQGGT--------AVGTGLNTKVGFAEKIAEQVSKETGIDF------KTAPNK 293
            ++L      GT        A+  G + KV   E++ E+V++  G D       +T   K
Sbjct: 187 RNDLGLRGVKGTTGTQASFLALFHGNHDKV---EELDERVTELLGFDTVYPVTGQTYSRK 243

Query: 294 FEALAAHDAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGK 353
            +        ++    L + A +  K+A DIR L +       E    +++ GSS M  K
Sbjct: 244 ID--------IDVLAPLASFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYK 292

Query: 354 VNPTQNEAMTQVC 366
            NP + E   +VC
Sbjct: 293 RNPMRCE---RVC 302

>NDAI0J01950 Chr10 (485753..487201) [1449 bp, 482 aa] {ON} Anc_4.197
           YLR359W
          Length = 482

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 50/195 (25%), Positives = 90/195 (46%), Gaps = 35/195 (17%)

Query: 188 LLLPELIALRDAFAKKAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHS 247
           L++P+L+ + D  +K A E+  +  +G TH Q A   TLG+  + ++Q+L   +     +
Sbjct: 127 LVIPKLVNVIDRLSKFAMEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFVRA 186

Query: 248 LHNLKFLAQGGT--------AVGTGLNTKVGFAEKIAEQVSKETGIDF------KTAPNK 293
            +++      GT        A+  G + KV   E + ++V++  G D       +T   K
Sbjct: 187 RNDIGLRGVKGTTGTQASFLALFHGDHDKV---EALDKRVTELLGFDTVYPVTGQTYSRK 243

Query: 294 FEALAAHDAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLP--ENEPGSSIMP 351
            +        ++    L++ A +  K+A DIR L +       EL  P  +++ GSS M 
Sbjct: 244 ID--------IDVLAPLSSFAATAHKMATDIRLLAN-----LKELEEPFEKSQIGSSAMA 290

Query: 352 GKVNPTQNEAMTQVC 366
            K NP + E   +VC
Sbjct: 291 YKRNPMRCE---RVC 302

>NDAI0G05940 Chr7 (1470741..1472129) [1389 bp, 462 aa] {ON}
           Anc_1.354 YHR018C
          Length = 462

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 57/228 (25%), Positives = 88/228 (38%), Gaps = 13/228 (5%)

Query: 150 GEVGSKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEVTHLLLPELIALRDAFAKKAQEFDS 209
           GE+  + I    H    +S ND   + + I     +   L P + +L +   K+A+E   
Sbjct: 97  GEIIGRDIAGKVHT--GRSRNDQCVTDLRIYCRDVLNEKLFPGMTSLIEVLIKRAEEEID 154

Query: 210 IVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHSLHNLKFLAQGGTAVGTGLNTKV 269
           I+  G THLQ A P+      S Y    T  + R++  L        G  A+        
Sbjct: 155 ILMPGYTHLQRAQPIRWSHWLSSYATYFTEDLKRLKQILERFNKSPLGAGALA------- 207

Query: 270 GFAEKIAEQVSKETGIDFK-TAPNKFEALAAHDAVVECSGALNTLACSLFKIANDIRYLG 328
           G    I  +   E G+ F     N   A++  D VVE           + + A D+  + 
Sbjct: 208 GHPYGIDREFLAE-GLGFDGVIGNSLVAVSDRDFVVELMFWGTLFMNHISRFAEDL-VIY 265

Query: 329 SGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAI 376
           S    G+ +LS      GSS+MP K N    E +     +V G+ A  
Sbjct: 266 STAEFGFIKLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGDLAGF 312

>KNAG0I01560 Chr9 (303704..305092) [1389 bp, 462 aa] {ON} Anc_1.354
           YHR018C
          Length = 462

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 60/229 (26%), Positives = 90/229 (39%), Gaps = 15/229 (6%)

Query: 150 GEVGSKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEVTHLLLPELIALRDAFAKKAQ-EFD 208
           GE+  + I    H    +S ND   + M I     +   LLP +  L     K+A+ E D
Sbjct: 97  GEIIGRHIAGKVHT--GRSRNDQVVTDMRIYCRDILNEKLLPFMADLIKVLVKRAENEID 154

Query: 209 SIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHSLHNLKFLAQGGTAVGTGLNTK 268
           +++  G THLQ A P+      S Y    T    R++  L  L     G  A+       
Sbjct: 155 TLMP-GYTHLQRAQPIRWAHWLSSYATYFTEDYKRLKQILERLNVSPLGAGALA------ 207

Query: 269 VGFAEKIAEQVSKETGIDF-KTAPNKFEALAAHDAVVECSGALNTLACSLFKIANDIRYL 327
            G    I  +   E G++F     N   A++  D VVE           + + A D+  +
Sbjct: 208 -GHPYGIDREFLAE-GLNFGGVIGNSLVAVSDRDFVVELMFWGTLFMNHISRFAEDL-II 264

Query: 328 GSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAI 376
            S    G+ +LS      GSS+MP K N    E +     +V G+ A  
Sbjct: 265 YSTAEFGFVKLS-DSYSTGSSLMPQKKNADSLELLRGKSGRVFGDLAGF 312

>Kwal_47.18066 s47 (668459..669907) [1449 bp, 482 aa] {ON} YLR359W
           (ADE13) - Adenylosuccinate Lyase [contig 198] FULL
          Length = 482

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 45/190 (23%), Positives = 85/190 (44%), Gaps = 25/190 (13%)

Query: 188 LLLPELIALRDAFAKKAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHS 247
           +L+P+L+ + D  +K A E+  +  +G TH Q A   TLG+  + ++Q+L   +     +
Sbjct: 127 ILIPKLVNVIDRLSKFAMEWKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRA 186

Query: 248 LHNLKFLAQGGTAVGTG-----LNTKVGFAEKIAEQVSKETGIDF------KTAPNKFEA 296
            +++      GT    G      ++     E + ++V++  G D       +T   K + 
Sbjct: 187 RNDIGLRGVKGTTGTQGSFLALFHSDHDKVEALDKRVTELLGFDTVYPVTGQTYSRKID- 245

Query: 297 LAAHDAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNP 356
                  ++    L++ A +  K+A DIR L +       E    +++ GSS M  K NP
Sbjct: 246 -------IDVLAPLSSFAATAHKMATDIRLLANLKEI---EEPFEKSQIGSSAMAYKRNP 295

Query: 357 TQNEAMTQVC 366
            + E   +VC
Sbjct: 296 MRCE---RVC 302

>YHR018C Chr8 complement(140011..141402) [1392 bp, 463 aa] {ON}
           ARG4Argininosuccinate lyase, catalyzes the final step in
           the arginine biosynthesis pathway
          Length = 463

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 59/238 (24%), Positives = 91/238 (38%), Gaps = 21/238 (8%)

Query: 136 ANEVISNRAIQLVGGEVGSKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEVTHLLLPELIA 195
           ANE    R  +L+G ++  K        +  +S ND   + + I     V   L P L  
Sbjct: 91  ANE---RRLGELIGRDIAGK-------VHTGRSRNDQVVTDLRIYCRDIVNDTLFPALKG 140

Query: 196 LRDAFAKKAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHSLHNLKFLA 255
           L +   K+A+    ++  G THLQ A P+      S Y    T    R+   LH L    
Sbjct: 141 LVEVLIKRAEGEIDVLMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLGQILHRLNQSP 200

Query: 256 QGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFKTA-PNKFEALAAHDAVVECSGALNTLA 314
            G  A+        G    I  +   E G+ F +   N   A++  D +VE         
Sbjct: 201 LGAGALA-------GHPYGIDREFLAE-GLGFNSVIGNSLVAVSDRDFIVELMFWGTLFM 252

Query: 315 CSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGN 372
             + + A D+  +      G+ +LS      GSS+MP K N    E +     +V G+
Sbjct: 253 NHISRFAEDL-IIYCTAEFGFIQLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>TBLA0A08320 Chr1 complement(2043721..2045169) [1449 bp, 482 aa]
           {ON} Anc_4.197 YLR359W
          Length = 482

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 54/214 (25%), Positives = 97/214 (45%), Gaps = 33/214 (15%)

Query: 188 LLLPELIALRDAFAKKAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHS 247
           L++P+L+ + +  A  A E+  +  +G TH Q A   TLG+  + ++Q+L   +   E +
Sbjct: 127 LVIPKLVNVINRLANFALEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERA 186

Query: 248 LHNLKFLAQGGT--------AVGTGLNTKVGFAEKIAEQVSKETGIDF------KTAPNK 293
            +++      GT        A+  G + KV   E++ E+V +  G D       +T   K
Sbjct: 187 RNDIGLRGVKGTTGTQASFLALFHGNHDKV---EELDERVVELLGFDTVYPVTGQTYSRK 243

Query: 294 FEALAAHDAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGK 353
            +        ++    L + A +  K+A DIR L +       E    +++ GSS M  K
Sbjct: 244 ID--------IDVVSPLVSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYK 292

Query: 354 VNPTQNEAMTQVC--VQVMGNNAAITFAGASGQF 385
            NP + E   +VC   + +G+  + T   AS Q+
Sbjct: 293 RNPMRCE---RVCSLARHLGSLLSDTVQTASVQW 323

>NCAS0J01200 Chr10 (209722..211170) [1449 bp, 482 aa] {ON} Anc_4.197
           YLR359W
          Length = 482

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 47/193 (24%), Positives = 87/193 (45%), Gaps = 31/193 (16%)

Query: 188 LLLPELIALRDAFAKKAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHS 247
           +++P+L+ + D  +K A E+  +  +G TH Q A   TLG+  + ++Q+L   +     +
Sbjct: 127 IIIPKLVNVIDRLSKFAMEYKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRA 186

Query: 248 LHNLKFLAQGGT--------AVGTGLNTKVGFAEKIAEQVSKETGIDF------KTAPNK 293
            +++      GT        A+  G + KV   E + ++V++  G D       +T   K
Sbjct: 187 RNDIGLRGVKGTTGTQASFLALFHGDHDKV---EALDKRVTELLGFDTVYPVTGQTYSRK 243

Query: 294 FEALAAHDAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGK 353
            +        ++    L + A +  K+A DIR L +       E    +++ GSS M  K
Sbjct: 244 ID--------IDVLAPLASFAATAHKMATDIRLLANLKEI---EEPFEKSQIGSSAMAYK 292

Query: 354 VNPTQNEAMTQVC 366
            NP + E   +VC
Sbjct: 293 RNPMRCE---RVC 302

>KNAG0B05840 Chr2 (1150025..1151473) [1449 bp, 482 aa] {ON}
           Anc_4.197 YLR359W
          Length = 482

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 48/193 (24%), Positives = 88/193 (45%), Gaps = 31/193 (16%)

Query: 188 LLLPELIALRDAFAKKAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHS 247
           L++P+L+ + D  +K A ++  +  +G TH Q A   TLG+  + ++Q+L   +     +
Sbjct: 127 LVIPKLVNVIDRLSKFALQYKDLPVLGWTHFQPAQLTTLGKRTTLWIQELLWDLRNFVRA 186

Query: 248 LHNLKFLAQGGT--------AVGTGLNTKVGFAEKIAEQVSKETGIDF------KTAPNK 293
            +++      GT        A+  G + KV   E + ++V++  G D       +T   K
Sbjct: 187 RNDIGLRGVKGTTGTQASFLALFHGDHDKV---EALDKRVTELLGFDTVYPVTGQTYSRK 243

Query: 294 FEALAAHDAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGK 353
            +        ++    L++ A S  K+A DIR L +       E    +++ GSS M  K
Sbjct: 244 ID--------IDVLAPLSSFAASAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYK 292

Query: 354 VNPTQNEAMTQVC 366
            NP + E   +VC
Sbjct: 293 RNPMRCE---RVC 302

>Kpol_1042.16 s1042 (40749..42197) [1449 bp, 482 aa] {ON}
           (40749..42197) [1449 nt, 483 aa]
          Length = 482

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 47/193 (24%), Positives = 87/193 (45%), Gaps = 31/193 (16%)

Query: 188 LLLPELIALRDAFAKKAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHS 247
           +++P+L+ + D  AK A E+  +  +G TH Q A   T+G+  + ++Q+L   +     +
Sbjct: 127 IIIPKLVNVIDRLAKFASEYKDLPVLGWTHFQPAQLTTMGKRATLWIQELLWDLRNFVRA 186

Query: 248 LHNLKFLAQGGT--------AVGTGLNTKVGFAEKIAEQVSKETGIDF------KTAPNK 293
            +++      GT        A+  G + KV   E + ++V +  G D       +T   K
Sbjct: 187 RNDIGLRGVKGTTGTQASFLALFHGDDDKV---EALDKRVVELLGFDTVYPVTGQTYSRK 243

Query: 294 FEALAAHDAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGK 353
            +        ++    L++ A +  K+A DIR L +       E    +++ GSS M  K
Sbjct: 244 ID--------IDVLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYK 292

Query: 354 VNPTQNEAMTQVC 366
            NP + E   +VC
Sbjct: 293 RNPMRCE---RVC 302

>Ecym_2452 Chr2 (881643..883091) [1449 bp, 482 aa] {ON} similar to
           Ashbya gossypii ABL006C
          Length = 482

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 49/195 (25%), Positives = 91/195 (46%), Gaps = 35/195 (17%)

Query: 188 LLLPELIALRDAFAKKAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHS 247
           +L+P+L+ + +  +  A ++  +  +G TH Q A   TLG+  + ++Q+L   +     +
Sbjct: 127 ILIPKLVNVINRLSTFAIKYKDLPVLGWTHYQPAQLTTLGKRVTLWIQELLWDLRNFVRA 186

Query: 248 LHNLKFLAQGGT--------AVGTGLNTKVGFAEKIAEQVSKETGIDF------KTAPNK 293
            +++ F    GT        A+  G + KV   E + ++V++ +G D       +T   K
Sbjct: 187 RNDIGFRGVKGTTGTQASFLALFHGDHDKV---EALDKRVAELSGFDIIYPVTGQTYSRK 243

Query: 294 FEALAAHDAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLP--ENEPGSSIMP 351
            +        ++  G L++ A +  K+A DIR L +       EL  P   ++ GSS M 
Sbjct: 244 VD--------IDVLGPLSSFAATSHKLATDIRLLAN-----LKELEEPFEASQIGSSAMA 290

Query: 352 GKVNPTQNEAMTQVC 366
            K NP + E   +VC
Sbjct: 291 YKRNPMRCE---RVC 302

>TBLA0F03480 Chr6 (857021..858421) [1401 bp, 466 aa] {ON} Anc_1.354
           YHR018C
          Length = 466

 Score = 47.4 bits (111), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 53/215 (24%), Positives = 82/215 (38%), Gaps = 11/215 (5%)

Query: 158 HPNNHCNQAQSSNDTFPSVMHIAAVTEVTHLLLPELIALRDAFAKKAQEFDSIVKIGRTH 217
           H     +  +S ND   + + I     +   LLP +I L     K+A+    I+  G TH
Sbjct: 103 HIAGKVHTGRSRNDQCVTDLRIYCRDILVEKLLPFMIDLVQVITKRAENEIDILMPGYTH 162

Query: 218 LQDATPLTLGQEFSGYVQQLTNGISRVEHSLHNLKFLAQGGTAVGTGLNTKVGFAEKIAE 277
           LQ A P+      S Y    T    R++  L  L     G  A+        G    I  
Sbjct: 163 LQRAQPIRWSHWLSSYATYFTEDYKRLKQVLERLNKCPLGAGAIA-------GHPYGIDR 215

Query: 278 Q-VSKETGIDFKTAPNKFEALAAHDAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYG 336
           Q +S E G +     N   A++  D +V+           + + + D+  + S    G+ 
Sbjct: 216 QYLSDELGFN-SIIGNSLVAVSDRDFIVDIMFWSTLFMNHISRFSEDL-IIYSTAEFGFI 273

Query: 337 ELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMG 371
           +LS      GSS+MP K N    E +     +V G
Sbjct: 274 KLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFG 307

>ZYRO0G00748g Chr7 (57164..58552) [1389 bp, 462 aa] {ON} highly
           similar to uniprot|P04076 Saccharomyces cerevisiae
           YHR018C ARG4 Argininosuccinate lyase catalyzes the final
           step in the arginine biosynthesis pathway
          Length = 462

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 58/230 (25%), Positives = 89/230 (38%), Gaps = 17/230 (7%)

Query: 150 GEVGSKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEVTHLLLPELIALRDAFAKKAQEFDS 209
           GE+  + I    H    +S ND   + M I     V   LLP L  L     K+A++   
Sbjct: 97  GEIIGRDIAGKVHT--GRSRNDQVVTDMRIFCRDTVNEKLLPGLKELVSVMVKRAEKEIG 154

Query: 210 IVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHSLHNLKFLAQGGTAVG---TGLN 266
            +  G THLQ A P+      S Y    T  + R+   L        G  A+     G++
Sbjct: 155 YLMPGYTHLQRAQPIRWSHWLSSYATYFTEDLKRLRQLLERFNQSPLGAGALAGHPYGID 214

Query: 267 TKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTLACSLFKIANDIRY 326
                 E +AE++  +  I      N   A++  D VVE           + + A D+  
Sbjct: 215 R-----EFLAEELGFQGVI-----GNSLVAVSDRDFVVELMFWGTLFMNHISRFAEDL-I 263

Query: 327 LGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAI 376
           + S    G+ +L+      GSS+MP K N    E +     +V G+ A  
Sbjct: 264 IYSTAEFGFIKLN-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGDLAGF 312

>ZYRO0B07964g Chr2 complement(620761..622209) [1449 bp, 482 aa] {ON}
           highly similar to uniprot|Q05911 Saccharomyces
           cerevisiae YLR359W ADE13 Adenylosuccinate lyase
           catalyzes two steps in the 'de novo' purine nucleotide
           biosynthetic pathway
          Length = 482

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 46/187 (24%), Positives = 85/187 (45%), Gaps = 19/187 (10%)

Query: 188 LLLPELIALRDAFAKKAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHS 247
           +++P+LI + D  +K A  +  +  +G TH Q A   TLG+  + ++Q L   +   + +
Sbjct: 127 VIIPKLINVIDRLSKFALNYKDVPVLGWTHFQPAQLTTLGKRVTLWIQDLLWDLRNFDRA 186

Query: 248 LHNLKFLAQGGT--------AVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAA 299
            +++      GT        A+  G + KV   E++ ++V++  G  F+T         +
Sbjct: 187 RNDIGLRGVKGTTGTQASFLALFHGNHDKV---EELDQRVTELLG--FETVYPVTGQTYS 241

Query: 300 HDAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQN 359
               ++    L + A +  K+A DIR L +       E    + + GSS M  K NP + 
Sbjct: 242 RKIDIDVLAPLASFAATAHKMATDIRLLANLKEV---EEPFEKTQIGSSAMAYKRNPMRC 298

Query: 360 EAMTQVC 366
           E   +VC
Sbjct: 299 E---RVC 302

>KAFR0A06230 Chr1 complement(1257709..1259157) [1449 bp, 482 aa]
           {ON} Anc_4.197 YLR359W
          Length = 482

 Score = 47.0 bits (110), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 49/193 (25%), Positives = 86/193 (44%), Gaps = 31/193 (16%)

Query: 188 LLLPELIALRDAFAKKAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHS 247
           +L+P+L+ + +   K A     +  +G TH Q A   TLG+  + ++Q+L   +   E +
Sbjct: 127 ILIPKLVNVINRLCKFAMANKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERA 186

Query: 248 LHNLKFLAQGGT--------AVGTGLNTKVGFAEKIAEQVSKETGIDF------KTAPNK 293
            +++      GT        A+  G + KV   EK+ E+V +  G D       +T   K
Sbjct: 187 RNDIGLRGVKGTTGTQASFLALFHGDHNKV---EKLDERVVELLGFDTVYPVTGQTYSRK 243

Query: 294 FEALAAHDAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGK 353
            +        ++    L++ A +  K+A DIR L +       E    +++ GSS M  K
Sbjct: 244 ID--------IDAFAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYK 292

Query: 354 VNPTQNEAMTQVC 366
            NP + E   +VC
Sbjct: 293 RNPMRCE---RVC 302

>NCAS0A09010 Chr1 complement(1783858..1785246) [1389 bp, 462 aa]
           {ON} Anc_1.354 YHR018C
          Length = 462

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 56/224 (25%), Positives = 91/224 (40%), Gaps = 13/224 (5%)

Query: 150 GEVGSKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEVTHLLLPELIALRDAFAKKAQEFDS 209
           GE+  + I    H    +S ND   + + I     +   L P L +L     K+ +E   
Sbjct: 97  GEIIGRDIAGKVHT--GRSRNDQCVTDLRIYCRDVLNEKLFPALTSLIQVLIKRGEEEID 154

Query: 210 IVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHSLHNLKFLAQGGTAVGTGLNTKV 269
           I+  G THLQ A P+      S Y    T  ++R++  L  ++F     + +G G     
Sbjct: 155 ILMPGYTHLQRAQPIRWSHWLSSYATYFTEDLNRLKQIL--VRF---NKSPLGAG--ALA 207

Query: 270 GFAEKIAEQVSKETGIDFK-TAPNKFEALAAHDAVVECSGALNTLACSLFKIANDIRYLG 328
           G    I  +   E G++F     N   A++  D VVE           + + A D+  + 
Sbjct: 208 GHPYGIDREFLAE-GLEFNGVIGNSLVAVSDRDFVVELMFWSTLFMNHISRFAEDL-IIY 265

Query: 329 SGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGN 372
           S    G+ +L+      GSS+MP K N    E +     +V G+
Sbjct: 266 STAEFGFIKLN-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>TDEL0D02220 Chr4 (428430..429827) [1398 bp, 465 aa] {ON} Anc_1.354
           YHR018C
          Length = 465

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 54/230 (23%), Positives = 89/230 (38%), Gaps = 17/230 (7%)

Query: 150 GEVGSKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEVTHLLLPELIALRDAFAKKAQEFDS 209
           GE+  ++I    H    +S ND   + + I     +   L P+L AL D   K+ +E   
Sbjct: 97  GEIIGRNIAGKVHT--GRSRNDQCVTDLRIYCRDLLNDKLFPDLQALVDVMIKRGKEEID 154

Query: 210 IVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHSLHNLKFLAQGGTAVG---TGLN 266
           ++  G THLQ A P+      S Y    T    R+   +  +     G  A+     G++
Sbjct: 155 VLMPGYTHLQRAQPIRWSHWLSSYATYFTEDFKRLRQIMDRINQSPLGAGALAGHPYGID 214

Query: 267 TKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTLACSLFKIANDIRY 326
                     E ++   G D     N   A++  D +VE           + + A D+  
Sbjct: 215 R---------EFLAAGLGFD-GVIGNSLVAVSDRDFIVELMFWGTLFMNHISRFAEDL-I 263

Query: 327 LGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAI 376
           + S    G+ +L+      GSS+MP K N    E +     +V G+ A  
Sbjct: 264 IYSTAEFGFIKLN-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGDLAGF 312

>KLLA0B13189g Chr2 complement(1153780..1155228) [1449 bp, 482 aa]
           {ON} highly similar to uniprot|Q05911 Saccharomyces
           cerevisiae YLR359W ADE13 Adenylosuccinate lyase
           catalyzes two steps in the 'de novo' purine nucleotide
           biosynthetic pathway
          Length = 482

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 47/187 (25%), Positives = 86/187 (45%), Gaps = 19/187 (10%)

Query: 188 LLLPELIALRDAFAKKAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHS 247
           +L+P+L+ + +  +K A E+  +  +G TH Q A   TLG+  + ++Q+L   +     +
Sbjct: 127 ILIPKLVNVINRLSKFALEYKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRA 186

Query: 248 LHNLKFLAQGGTAVGTGLNTKVGF------AEKIAEQVSKETGIDFKTAPNKFEALAAHD 301
            +++      GT  GT  +    F       E + ++V++  G  F T         +  
Sbjct: 187 RNDIGLRGVKGTT-GTQASFLTLFHGDHDKVEALDKRVAELLG--FSTVYPVTGQTYSRK 243

Query: 302 AVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLP--ENEPGSSIMPGKVNPTQN 359
             ++    L++ A +  K+A DIR L +       EL  P  +++ GSS M  K NP + 
Sbjct: 244 IDIDVLAPLSSFAATAHKMATDIRLLAN-----LKELEEPFEKSQIGSSAMAYKRNPMRC 298

Query: 360 EAMTQVC 366
           E   +VC
Sbjct: 299 E---RVC 302

>Kpol_1018.125 s1018 complement(330965..332347) [1383 bp, 460 aa]
           {ON} complement(330965..332347) [1383 nt, 461 aa]
          Length = 460

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 60/238 (25%), Positives = 89/238 (37%), Gaps = 21/238 (8%)

Query: 136 ANEVISNRAIQLVGGEVGSKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEVTHLLLPELIA 195
           ANE    R  +L+G ++  K        +  +S ND   + + I     +   LLP L +
Sbjct: 89  ANE---RRLGELIGTDISGK-------VHTGRSRNDQCVTDLRIYCRDIIQDKLLPSLKS 138

Query: 196 LRDAFAKKAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHSLHNLKFLA 255
           L     K+ +    I+  G THLQ A P+      S Y    T    R++  L  L    
Sbjct: 139 LIQVLVKRGEGEIGILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLKQLLDRLNVSP 198

Query: 256 QGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFK-TAPNKFEALAAHDAVVECSGALNTLA 314
            G  A+        G    I  +     G+ F     N   A++  D VVE         
Sbjct: 199 LGAGALA-------GHPYGIDREFLA-NGLGFNGVIGNSLVAVSDRDFVVELLFWGTLFM 250

Query: 315 CSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGN 372
             + + A D+  + S    G+  LS      GSS+MP K N    E +     +V GN
Sbjct: 251 NHISRFAEDL-IIYSTAEFGFITLS-DAYSTGSSLMPQKKNSDSLELLRGKSGRVFGN 306

>AEL019W Chr5 (600410..601819) [1410 bp, 469 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR018C (ARG4)
          Length = 469

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 51/219 (23%), Positives = 82/219 (37%), Gaps = 9/219 (4%)

Query: 158 HPNNHCNQAQSSNDTFPSVMHIAAVTEVTHLLLPELIALRDAFAKKAQEFDSIVKIGRTH 217
           H +   +  +S ND   + M +     +   + P L  L      +A+E   ++  G TH
Sbjct: 103 HISGKVHTGRSRNDQVATDMRLYCREMLQDKVEPALFELIKVLLHRAREEIDVLMPGYTH 162

Query: 218 LQDATPLTLGQEFSGYVQQLTNGISRVEHSLHNLKFLAQGGTAVGTGLNTKVGFAEKIAE 277
           LQ A P+      S Y         R++  +  L    Q     G       G      E
Sbjct: 163 LQRAQPIRWSHWLSCYATYFVEDFKRLKEVIARLN---QSPLGAGALAGHPYGIDR---E 216

Query: 278 QVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGE 337
            ++ E G D     N   A++  D VVE     +     + ++A D+  + S    G+ +
Sbjct: 217 YLACELGFD-GVIGNSMTAVSDRDFVVEIMSWGSLFMNHISRLAEDL-IIYSTAEFGFVK 274

Query: 338 LSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAI 376
           L+      GSS+MP K NP   E +     +V G  A  
Sbjct: 275 LA-DAYSTGSSLMPQKRNPDSLELLRGKSGRVFGQLAGF 312

>Ecym_2749 Chr2 complement(1453019..1454431) [1413 bp, 470 aa] {ON}
           similar to Ashbya gossypii AEL019W
          Length = 470

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 58/240 (24%), Positives = 95/240 (39%), Gaps = 27/240 (11%)

Query: 136 ANEVISNRAIQLVGGEVGSKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEVTHLLLPELIA 195
           ANE    R  +L+G  V  K        +  +S ND   + M I     +   +LP + +
Sbjct: 91  ANE---RRLGELIGTAVAGK-------VHTGRSRNDQVATDMRIYCREILNEKILPAVSS 140

Query: 196 LRDAFAKKAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHSLHNLKFLA 255
                  +A+E   ++  G THLQ A P+      S Y    T   +R+   +  L    
Sbjct: 141 FIRVLINRAREEVDVLMPGYTHLQRAQPIRWSHWLSCYATYFTEDYNRLRQVVERLNQSP 200

Query: 256 QGGTAVG---TGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNT 312
            G  A+     G++ K      +AEQ+    GI      N   A++  D V+E     + 
Sbjct: 201 LGAGALAGHPYGIDRKY-----LAEQLGF-NGI----IGNSLVAVSDRDFVIEIMFWGSL 250

Query: 313 LACSLFKIANDIRYLGSGPRCGYGELSLPE-NEPGSSIMPGKVNPTQNEAMTQVCVQVMG 371
               + + A D+    +     +G ++L +    GSS+MP K NP   E +     +V G
Sbjct: 251 FMNHISRFAEDLIIYSTAE---FGFINLADAYSTGSSLMPQKKNPDSLELLRGKSGRVFG 307

>SAKL0B04972g Chr2 (430349..431797) [1449 bp, 482 aa] {ON} highly
           similar to uniprot|Q05911 Saccharomyces cerevisiae
           YLR359W ADE13 Adenylosuccinate lyase catalyzes two steps
           in the 'de novo' purine nucleotide biosynthetic pathway
          Length = 482

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 46/193 (23%), Positives = 88/193 (45%), Gaps = 31/193 (16%)

Query: 188 LLLPELIALRDAFAKKAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHS 247
           +L+P+L+ + +  ++ A E+  +  +G TH Q A   TLG+  + ++Q+L   +     +
Sbjct: 127 ILIPKLVNVINRLSQFALEYKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRA 186

Query: 248 LHNLKFLAQGGT--------AVGTGLNTKVGFAEKIAEQVSKETGIDF------KTAPNK 293
            +++      GT        A+  G + KV   E + ++V++  G D       +T   K
Sbjct: 187 RNDIGLRGVKGTTGTQASFLALFHGDHDKV---EALDKRVTELLGFDTVYPVTGQTYSRK 243

Query: 294 FEALAAHDAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGK 353
            +        ++    L++ A +  K+A DIR L +       E    +++ GSS M  K
Sbjct: 244 ID--------IDVLAPLSSFAATAHKMATDIRLLANLKEM---EEPFEKSQIGSSAMAYK 292

Query: 354 VNPTQNEAMTQVC 366
            NP + E   +VC
Sbjct: 293 RNPMRCE---RVC 302

>Kwal_27.12782 s27 complement(1373166..1374563) [1398 bp, 465 aa]
           {ON} YHR018C (ARG4) - argininosuccinate lyase [contig
           260] FULL
          Length = 465

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 63/271 (23%), Positives = 102/271 (37%), Gaps = 50/271 (18%)

Query: 124 FQTGSGTQSNMNANEVISNRAIQLVGGEVGSKSIHPNNHCNQAQSSNDTFPSVMHIAAVT 183
           F    G +    ANE    R  +++G  +  K        +  +S ND   + M I    
Sbjct: 81  FVEKDGDEDIHTANE---RRLGEIIGRHIAGK-------VHTGRSRNDQVATDMRIYCRE 130

Query: 184 EVTHL--LLPELIALRDAFAKKAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGI 241
            + +L  +L +LI       +  QE D+++  G THLQ A P+      + Y    T   
Sbjct: 131 ALDNLAKILEDLIGA--ILQRSEQEIDALMP-GYTHLQRAQPIRWSHWLNLYATYFTEDF 187

Query: 242 SRVEHSLHNLKFLAQGGTAVG--------TGLNTKVGFAEKIAEQVSKETGIDFKTAPNK 293
            R++     L     G  A+           L  ++GF++ I                N 
Sbjct: 188 KRLKQIRERLNVSPLGCGALAGHPYGIDREFLAERLGFSDVIG---------------NS 232

Query: 294 FEALAAHDAVVECSGALNTLACSLF-----KIANDIRYLGSGPRCGYGELSLPENEPGSS 348
            +A++  D VVE         CSLF     + + D+  + S     + +LS      GSS
Sbjct: 233 LQAVSDRDFVVEI-----MFWCSLFMNHISRFSEDL-IIYSTAEFNFVKLS-DAYSTGSS 285

Query: 349 IMPGKVNPTQNEAMTQVCVQVMGNNAAITFA 379
           +MP K NP   E +     +V G+ A    +
Sbjct: 286 LMPQKKNPDSLELLRGKSGRVFGSLAGFMMS 316

>KLTH0G19338g Chr7 complement(1665123..1666520) [1398 bp, 465 aa]
           {ON} highly similar to uniprot|P04076 Saccharomyces
           cerevisiae YHR018C ARG4 Argininosuccinate lyase
           catalyzes the final step in the arginine biosynthesis
           pathway
          Length = 465

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 65/260 (25%), Positives = 106/260 (40%), Gaps = 42/260 (16%)

Query: 124 FQTGSGTQSNMNANEVISNRAIQLVGGEVGSKSIHPNNHCNQAQSSNDTFPSVMHIAAVT 183
           F    G +    ANE    R  +++G  +  K        +  +S ND   + M I    
Sbjct: 81  FVEKDGDEDIHTANE---RRLGEIIGRHIAGK-------VHTGRSRNDQVATDMRIYCRE 130

Query: 184 EVTHL--LLPELIALRDAFAKKA-QEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNG 240
            + ++  +L +L+    A  ++A QE D+++  G THLQ A P+      + Y    T  
Sbjct: 131 ALDNMAKILKDLVG---AILQRAEQEIDALMP-GYTHLQRAQPIRWSHWLNLYATYFTED 186

Query: 241 ISRVEHSLHNLKFLAQGGTAVG---TGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEAL 297
             R++     L     G  A+     G++      E IAE++    G D     N  +A+
Sbjct: 187 FKRLKQIRERLNVSPLGCGALAGHPYGIDR-----EHIAERL----GFD-GVIGNSLQAV 236

Query: 298 AAHDAVVECSGALNTLACSLF-----KIANDIRYLGSGPRCGYGELSLPENEPGSSIMPG 352
           +  D VVE         CSLF     + + D+  + S     + +LS      GSS+MP 
Sbjct: 237 SDRDFVVEI-----LFWCSLFMNHISRFSEDL-IIYSTAEFNFVKLS-DAYSTGSSLMPQ 289

Query: 353 KVNPTQNEAMTQVCVQVMGN 372
           K NP   E +     +V G+
Sbjct: 290 KKNPDSLELLRGKSGRVFGS 309

>TDEL0E01760 Chr5 complement(337315..338763) [1449 bp, 482 aa] {ON}
           Anc_4.197 YLR359W
          Length = 482

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 45/193 (23%), Positives = 87/193 (45%), Gaps = 31/193 (16%)

Query: 188 LLLPELIALRDAFAKKAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHS 247
           L++P+L+ + +  +  A ++  +  +G TH Q A   TLG+  + ++Q+L   +     +
Sbjct: 127 LIIPKLVNVINRLSDFALKYKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRA 186

Query: 248 LHNLKFLAQGGT--------AVGTGLNTKVGFAEKIAEQVSKETGIDF------KTAPNK 293
            +++      GT        A+  G + KV   E + ++V++  G D       +T   K
Sbjct: 187 RNDIGLRGVKGTTGTQASFLALFHGDHDKV---EALDKRVTELLGFDTVYPVTGQTYSRK 243

Query: 294 FEALAAHDAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGK 353
            +        ++    L++ A +  K+A DIR L +       E    +++ GSS M  K
Sbjct: 244 ID--------IDVLSPLSSFAATAHKMATDIRLLANLKEM---EEPFEKSQIGSSAMAYK 292

Query: 354 VNPTQNEAMTQVC 366
            NP + E   +VC
Sbjct: 293 RNPMRCE---RVC 302

>KLTH0A03344g Chr1 (289188..290636) [1449 bp, 482 aa] {ON} highly
           similar to uniprot|Q05911 Saccharomyces cerevisiae
           YLR359W ADE13 Adenylosuccinate lyase catalyzes two steps
           in the 'de novo' purine nucleotide biosynthetic pathway
          Length = 482

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 45/193 (23%), Positives = 87/193 (45%), Gaps = 31/193 (16%)

Query: 188 LLLPELIALRDAFAKKAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHS 247
           +L+P+L+ + +  ++ A ++  +  +G TH Q A   TLG+  + ++Q+L   +     +
Sbjct: 127 ILIPKLVNVINRLSQFALQWKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRA 186

Query: 248 LHNLKFLAQGGT--------AVGTGLNTKVGFAEKIAEQVSKETGIDF------KTAPNK 293
            +++      GT        A+  G + KV   E + ++V++  G D       +T   K
Sbjct: 187 RNDIGLRGVKGTTGTQASFLALFHGDHDKV---EALDKRVTELLGFDTVYPVTGQTYSRK 243

Query: 294 FEALAAHDAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGK 353
            +        ++    L + A +  K+A DIR L +       E    +++ GSS M  K
Sbjct: 244 ID--------IDVLAPLCSFAATAHKMATDIRLLANLKEI---EEPFEKSQIGSSAMAYK 292

Query: 354 VNPTQNEAMTQVC 366
            NP + E   +VC
Sbjct: 293 RNPMRCE---RVC 302

>ABL006C Chr2 complement(385134..386582) [1449 bp, 482 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR359W
           (ADE13)
          Length = 482

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 44/191 (23%), Positives = 85/191 (44%), Gaps = 27/191 (14%)

Query: 188 LLLPELIALRDAFAKKAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHS 247
           +++P+L+ + +  +K A E+  +  +G TH Q A   TLG+  + ++Q+L   +     +
Sbjct: 127 IIIPKLVNVINRLSKFACEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFVRA 186

Query: 248 LHNLKFLAQGGTAVGTGLNTKVGF------AEKIAEQVSKETGIDF------KTAPNKFE 295
            +++      GT  GT  +    F       E + ++V++  G D       +T   K +
Sbjct: 187 RNDIGLRGVKGT-TGTQASFLALFHGDHDRVEALDKRVTELLGFDIVYPVTGQTYSRKID 245

Query: 296 ALAAHDAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVN 355
                   ++  G+ ++   +  K+A DIR L +       E    + + GSS M  K N
Sbjct: 246 --------IDILGSGSSFEATAHKMATDIRLLANLKEV---EEPFEKTQIGSSAMAYKRN 294

Query: 356 PTQNEAMTQVC 366
           P + E   +VC
Sbjct: 295 PMRCE---RVC 302

>TPHA0A02190 Chr1 (452902..454293) [1392 bp, 463 aa] {ON} Anc_1.354
           YHR018C
          Length = 463

 Score = 40.0 bits (92), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 57/240 (23%), Positives = 93/240 (38%), Gaps = 25/240 (10%)

Query: 136 ANEVISNRAIQLVGGEVGSKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEVTHLLLPELIA 195
           ANE    R  +++G ++  K        +  +S ND   + + I     ++  LL  L  
Sbjct: 91  ANE---RRLGEIIGTKISGK-------VHTGRSRNDQCVTDLRIYCREYLSDKLLKNLET 140

Query: 196 LRDAFAKKAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHSLHNLKFLA 255
           L +    +A+E    +  G THLQ A P+      S Y         R+      L    
Sbjct: 141 LINVLINRAEEEIEFIMPGYTHLQRAQPIRWSHWLSSYATYFLEDYKRLVQLKERLNKSP 200

Query: 256 QGGTAVG---TGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNT 312
            G  A+     G++      E +AE++  ++ I      N   A++  D VVE       
Sbjct: 201 LGAGALAGHPYGID-----REYLAEKLGFDSVI-----GNSLVAVSDRDFVVEILFWSTL 250

Query: 313 LACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGN 372
               + + A D+  + S    G+ +LS      GSS+MP K N    E +     +V GN
Sbjct: 251 FMNHISRFAEDL-IIYSTAEFGFIKLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGN 308

>Ecym_6358 Chr6 complement(694398..696944) [2547 bp, 848 aa] {ON}
           similar to Ashbya gossypii AFR077W
          Length = 848

 Score = 35.8 bits (81), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 22/91 (24%), Positives = 43/91 (47%), Gaps = 6/91 (6%)

Query: 236 QLTNGISRVEHSLHNLKFLAQGGTAVGTGLNTKVGFAEKIAEQVSK---ETGIDFKTAPN 292
           + +NG  + +HS +N+KF+ +    +  G    + +   +   + K    T +D    P+
Sbjct: 489 KTSNGTQQQQHSNNNVKFVLRAIRDIEKGEELHINWDWDLRHPICKVIDGTPVDSIPEPD 548

Query: 293 KFEALAAHDAVV---ECSGALNTLACSLFKI 320
           KF  + + D V+   +C+   N   C LFK+
Sbjct: 549 KFLLIHSVDTVLSMGDCACGANNKDCHLFKV 579

>KNAG0D03480 Chr4 complement(625236..628724) [3489 bp, 1162 aa] {ON}
           Anc_4.117 YGL006W
          Length = 1162

 Score = 34.7 bits (78), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 40/75 (53%), Gaps = 14/75 (18%)

Query: 31  KYRVETDAFGEIKVPTDKLWGAQTQRSLENFKIGGQRERMPEPIVKAFG----------- 79
           KY ++TD    IKVP ++  G Q  RS + ++  G   R+PE + K+FG           
Sbjct: 50  KY-LKTDLETGIKVPLNETEGTQNHRSTDRYRKYGDN-RIPERLPKSFGKLIWEAFNDKT 107

Query: 80  -ILKKSAAIVNESLG 93
            +L  +AAIV+ +LG
Sbjct: 108 MLLLTAAAIVSFALG 122

>Suva_4.494 Chr4 (862220..864772) [2553 bp, 850 aa] {ON} YBR237W
           (REAL)
          Length = 850

 Score = 32.7 bits (73), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 45/92 (48%), Gaps = 6/92 (6%)

Query: 84  SAAIVNESLGTLDPKVSKPIQDAADEVISGKLIDHFPLVVFQTGSGTQSNMNANEVISNR 143
           S A+ ++ L   DP  +K + + +D+  SG     F L     G G ++  +  E   N+
Sbjct: 641 SKAMRDDELKASDPLQTKELHEMSDKFESGMKKGKFRLSKGFGGKGLENIKSKREEAQNK 700

Query: 144 AIQLVGG-----EVGSKSIH-PNNHCNQAQSS 169
            ++   G     ++ +KS H PN H N+A+SS
Sbjct: 701 ELEHKKGQKNNDQLENKSDHSPNEHANEAESS 732

>TDEL0G04710 Chr7 (860069..861289) [1221 bp, 406 aa] {ON} 
          Length = 406

 Score = 32.0 bits (71), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 25/47 (53%), Gaps = 4/47 (8%)

Query: 64  GGQRERMP----EPIVKAFGILKKSAAIVNESLGTLDPKVSKPIQDA 106
           GG + R+P     P+V+   +LK+ A  VNES      ++ KP  DA
Sbjct: 281 GGVQRRLPTAHIHPLVRVHPVLKRKALFVNESFSRRIVELKKPESDA 327

>Suva_4.223 Chr4 complement(395869..397719) [1851 bp, 616 aa] {ON}
           YDL025C (REAL)
          Length = 616

 Score = 31.2 bits (69), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 31/69 (44%), Gaps = 10/69 (14%)

Query: 62  KIGGQRERMPEPIVKAFGILKKSAAIVNESL----------GTLDPKVSKPIQDAADEVI 111
           K+GG+R    +  V    +LK+S A+ N SL            +D   S+P+ D    V 
Sbjct: 69  KLGGRRSSTGKNSVGNSPLLKESHAVANPSLLASSPTSLKKAAIDAPTSRPLHDTHTPVR 128

Query: 112 SGKLIDHFP 120
           +G  + H P
Sbjct: 129 TGHNVPHLP 137

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.131    0.369 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 48,028,004
Number of extensions: 1961085
Number of successful extensions: 5327
Number of sequences better than 10.0: 68
Number of HSP's gapped: 5462
Number of HSP's successfully gapped: 68
Length of query: 493
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 379
Effective length of database: 40,409,475
Effective search space: 15315191025
Effective search space used: 15315191025
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.5 bits)
S2: 68 (30.8 bits)