Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_56.223596.12ON91914841e-64
SAKL0E00924g6.12ON97932584e-30
KLTH0C11484g6.12ON89892575e-30
Ecym_30156.12ON70712182e-24
ACR014C6.12ON70702141e-23
KLLA0D00880g6.12ON71721783e-18
Smik_5.286.12ON74731523e-14
Kpol_1032.36.12ON78821412e-12
YEL059C-A (SOM1)6.12ON74731392e-12
Suva_5.96.12ON73731393e-12
TDEL0G045906.12ON74751315e-11
Skud_5.306.12ON74731281e-10
NCAS0F002106.12ON79831194e-09
ZYRO0F00528g6.12ON77761151e-08
TPHA0M002206.12ON78801012e-06
KNAG0E009306.12ON10953952e-05
TBLA0G009906.12ON7881882e-04
KAFR0L003506.12ON7165680.11
CAGL0D00836g4.248ON61987631.8
Suva_16.906.233ON110423622.4
KLLA0B14190g1.525ON24931594.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_56.22359
         (91 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_56.22359 s56 (64674..64949) [276 bp, 91 aa] {ON} YEL059C-A ...   191   1e-64
SAKL0E00924g Chr5 (70494..70787) [294 bp, 97 aa] {ON} similar to...   103   4e-30
KLTH0C11484g Chr3 complement(944502..944771) [270 bp, 89 aa] {ON...   103   5e-30
Ecym_3015 Chr3 (30115..30327) [213 bp, 70 aa] {ON} similar to As...    89   2e-24
ACR014C Chr3 complement(382776..382988) [213 bp, 70 aa] {ON} Syn...    87   1e-23
KLLA0D00880g Chr4 (82211..82426) [216 bp, 71 aa] {ON} uniprot|P7...    73   3e-18
Smik_5.28 Chr5 complement(44691..44912) [222 bp, 74 aa] {ON} YEL...    63   3e-14
Kpol_1032.3 s1032 (3019..3255) [237 bp, 78 aa] {ON} (3019..3255)...    59   2e-12
YEL059C-A Chr5 complement(42400..42624) [225 bp, 74 aa] {ON}  SO...    58   2e-12
Suva_5.9 Chr5 complement(18353..18571) [219 bp, 73 aa] {ON} YEL0...    58   3e-12
TDEL0G04590 Chr7 complement(838052..838276) [225 bp, 74 aa] {ON}...    55   5e-11
Skud_5.30 Chr5 complement(41436..41657) [222 bp, 74 aa] {ON} YEL...    54   1e-10
NCAS0F00210 Chr6 (32317..32556) [240 bp, 79 aa] {ON} Anc_6.12 YE...    50   4e-09
ZYRO0F00528g Chr6 (51411..51644) [234 bp, 77 aa] {ON} similar to...    49   1e-08
TPHA0M00220 Chr13 (44225..44461) [237 bp, 78 aa] {ON} Anc_6.12 Y...    44   2e-06
KNAG0E00930 Chr5 complement(176364..176693) [330 bp, 109 aa] {ON...    41   2e-05
TBLA0G00990 Chr7 (251428..251664) [237 bp, 78 aa] {ON} Anc_6.12 ...    39   2e-04
KAFR0L00350 Chr12 (63897..64112) [216 bp, 71 aa] {ON} Anc_6.12 Y...    31   0.11 
CAGL0D00836g Chr4 complement(99696..101555) [1860 bp, 619 aa] {O...    29   1.8  
Suva_16.90 Chr16 (153235..156549) [3315 bp, 1104 aa] {ON} YPL216...    28   2.4  
KLLA0B14190g Chr2 complement(1245746..1246495) [750 bp, 249 aa] ...    27   4.7  

>Kwal_56.22359 s56 (64674..64949) [276 bp, 91 aa] {ON} YEL059C-A
          (SOM1) - involved in mitochondrial inner peptidase
          function [contig 186] FULL
          Length = 91

 Score =  191 bits (484), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 91/91 (100%), Positives = 91/91 (100%)

Query: 1  MAPPTVVFGKEELEPLLRNVMATCIFKSLTQSECNFDGHQYVCVPFKRVFKECKVDGKSI 60
          MAPPTVVFGKEELEPLLRNVMATCIFKSLTQSECNFDGHQYVCVPFKRVFKECKVDGKSI
Sbjct: 1  MAPPTVVFGKEELEPLLRNVMATCIFKSLTQSECNFDGHQYVCVPFKRVFKECKVDGKSI 60

Query: 61 RIEVTDRNTNKAKADEMVDSFWNSRKSFTRN 91
          RIEVTDRNTNKAKADEMVDSFWNSRKSFTRN
Sbjct: 61 RIEVTDRNTNKAKADEMVDSFWNSRKSFTRN 91

>SAKL0E00924g Chr5 (70494..70787) [294 bp, 97 aa] {ON} similar to
          uniprot|Q05676 Saccharomyces cerevisiae YEL059C-A SOM1
          Protein whose overexpression suppresses the imp1
          mutation may be required for the function of the Imp1p
          mitochondrial inner membrane peptidase and/or the
          protein sorting machinery
          Length = 97

 Score =  103 bits (258), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 50/93 (53%), Positives = 64/93 (68%), Gaps = 9/93 (9%)

Query: 1  MAPPTVVFGKEELEPLLRNVMATCIFKSLTQSECNFDGHQYVCVPFKRVFKECKVDGK-- 58
          MAPPT VFGK+ELE LL+ V   C  KSL Q+EC F+G +Y+CVPFKR+FKEC +D K  
Sbjct: 1  MAPPTPVFGKDELESLLKKVKPPCTLKSLIQNECTFNGEEYICVPFKRLFKECLLDSKTK 60

Query: 59 ------SIRIEVTDRNTNKA-KADEMVDSFWNS 84
                ++RIE+TDR+TN     D+MV  FW +
Sbjct: 61 DGRTSRTVRIEITDRHTNDGILEDQMVKRFWEA 93

>KLTH0C11484g Chr3 complement(944502..944771) [270 bp, 89 aa] {ON}
          similar to uniprot|Q05676 Saccharomyces cerevisiae
          YEL059C-A SOM1 Protein whose overexpression suppresses
          the imp1 mutation may be required for the function of
          the Imp1p mitochondrial inner membrane peptidase and/or
          the protein sorting machinery
          Length = 89

 Score =  103 bits (257), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 46/89 (51%), Positives = 59/89 (66%)

Query: 1  MAPPTVVFGKEELEPLLRNVMATCIFKSLTQSECNFDGHQYVCVPFKRVFKECKVDGKSI 60
          MAPPT+VFGKEEL+ +       C  K+L Q+EC F+GH+YVC PFKR+FKEC    + +
Sbjct: 1  MAPPTLVFGKEELKGIWEKAAEPCFLKALVQNECEFNGHEYVCTPFKRLFKECGAGKRIV 60

Query: 61 RIEVTDRNTNKAKADEMVDSFWNSRKSFT 89
          RIEVTD++TN    D  V  FW S +  T
Sbjct: 61 RIEVTDQDTNHLAFDATVTRFWESSRRCT 89

>Ecym_3015 Chr3 (30115..30327) [213 bp, 70 aa] {ON} similar to
          Ashbya gossypii ACR014C
          Length = 70

 Score = 88.6 bits (218), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 38/71 (53%), Positives = 54/71 (76%), Gaps = 1/71 (1%)

Query: 1  MAPPTVVFGKEELEPLLRNVMATCIFKSLTQSECNFDGHQYVCVPFKRVFKECKVDGKSI 60
          MAPPT +  ++E+EP+L      CI  SL Q+EC+FDGH YVC+PFKR+F+EC ++ + +
Sbjct: 1  MAPPTPIITRDEVEPILSRT-KDCILASLIQNECHFDGHNYVCIPFKRLFEECTLNKRRV 59

Query: 61 RIEVTDRNTNK 71
          RIEVTD +TN+
Sbjct: 60 RIEVTDISTNQ 70

>ACR014C Chr3 complement(382776..382988) [213 bp, 70 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YEL059C-A
          (SOM1)
          Length = 70

 Score = 87.0 bits (214), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 52/70 (74%), Gaps = 1/70 (1%)

Query: 1  MAPPTVVFGKEELEPLLRNVMATCIFKSLTQSECNFDGHQYVCVPFKRVFKECKVDGKSI 60
          MAPPT V  +EE+ P L      C+  SLTQ+EC+FDG  YVCVPF+R+F+EC ++ + +
Sbjct: 1  MAPPTPVLTREEVAPAL-ATSRDCVLASLTQNECHFDGRGYVCVPFQRLFRECTLNKRRV 59

Query: 61 RIEVTDRNTN 70
          RIE+T+RNTN
Sbjct: 60 RIEITERNTN 69

>KLLA0D00880g Chr4 (82211..82426) [216 bp, 71 aa] {ON}
          uniprot|P78699 Kluyveromyces lactis KLLA0D00880g SOM1
          Protein SOM1 mitochondrial precursor
          Length = 71

 Score = 73.2 bits (178), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 35/72 (48%), Positives = 50/72 (69%), Gaps = 2/72 (2%)

Query: 1  MAPPTVVFGKEELEPLLRNVMATCIFKSLTQSECNFDGHQYVCVPFKRVFKECKV-DGKS 59
          MAPPT + G +  + +L+     C  KSL Q+EC F+G+ YVC PFKR+F++C V DG+ 
Sbjct: 1  MAPPTKILGLDTQQRMLQR-GENCSLKSLVQNECAFNGNDYVCTPFKRLFEQCMVKDGRV 59

Query: 60 IRIEVTDRNTNK 71
          + IEVT+ NTN+
Sbjct: 60 LNIEVTNLNTNR 71

>Smik_5.28 Chr5 complement(44691..44912) [222 bp, 74 aa] {ON}
          YEL059C-A (REAL)
          Length = 74

 Score = 63.2 bits (152), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 34/73 (46%), Positives = 44/73 (60%), Gaps = 3/73 (4%)

Query: 1  MAPPTVVFGKEE-LEPLLR-NVMATCIFKSLTQSECNFDGHQYVCVPFKRVFKECKVDGK 58
          MAPPT +  +++ L PL+  +  A+C  K L Q EC F G  YVC PFKR+F+ C   GK
Sbjct: 1  MAPPTTIRSRDQALAPLMALDSQASCQLKELVQWECQFKGADYVCSPFKRLFEHCVEHGK 60

Query: 59 -SIRIEVTDRNTN 70
           +   EVTD  TN
Sbjct: 61 PATNYEVTDTYTN 73

>Kpol_1032.3 s1032 (3019..3255) [237 bp, 78 aa] {ON} (3019..3255)
          [237 nt, 79 aa]
          Length = 78

 Score = 58.9 bits (141), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 47/82 (57%), Gaps = 13/82 (15%)

Query: 1  MAPPTVVFGKEELE------PLLRNVMATCIFKSLTQSECNFDGH---QYVCVPFKRVFK 51
          MAPPT +  +EE+        ++ N    C   S+TQ +C F+     +Y+C+PFKR+F+
Sbjct: 1  MAPPTPIQSREEVLRGKKCLTMVDNKKGKCTLTSITQFQCRFENSYEGEYICLPFKRLFE 60

Query: 52 ECKVDGKSIRIEVTDRNTNKAK 73
          EC      IRIEVTDR TN  K
Sbjct: 61 EC----SGIRIEVTDRFTNNDK 78

>YEL059C-A Chr5 complement(42400..42624) [225 bp, 74 aa] {ON}
          SOM1Subunit of the mitochondrial inner membrane
          peptidase, which is required for maturation of
          mitochondrial proteins of the intermembrane space;
          Som1p facilitates cleavage of a subset of substrates;
          contains twin cysteine-x9-cysteine motifs
          Length = 74

 Score = 58.2 bits (139), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 41/73 (56%), Gaps = 3/73 (4%)

Query: 1  MAPPTVVFGKEE-LEPLLR-NVMATCIFKSLTQSECNFDGHQYVCVPFKRVFKECKVDGK 58
          MAPPT +  +++ L PL   +    C  K L Q EC F G +YVC PFKR+F+ C    K
Sbjct: 1  MAPPTTIRTRDQALAPLATLDSQTNCRLKELVQWECQFKGAEYVCSPFKRLFEHCIAPDK 60

Query: 59 S-IRIEVTDRNTN 70
          S    EVTD  TN
Sbjct: 61 SATNYEVTDTYTN 73

>Suva_5.9 Chr5 complement(18353..18571) [219 bp, 73 aa] {ON}
          YEL059C-A (REAL)
          Length = 73

 Score = 58.2 bits (139), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 41/73 (56%), Gaps = 3/73 (4%)

Query: 1  MAPPTVVFGKEE-LEPLLR-NVMATCIFKSLTQSECNFDGHQYVCVPFKRVFKECKVDGK 58
          MAPPT +  +++ L PL   +    C  K L Q EC F G  YVC PF+R+F+ C   G+
Sbjct: 1  MAPPTTIRARDQALAPLATLDSRTHCHLKELVQWECQFKGADYVCSPFRRLFEHCTAPGE 60

Query: 59 -SIRIEVTDRNTN 70
           +   EVTD  TN
Sbjct: 61 AATNYEVTDTYTN 73

>TDEL0G04590 Chr7 complement(838052..838276) [225 bp, 74 aa] {ON}
          Anc_6.12 YEL059C-A
          Length = 74

 Score = 55.1 bits (131), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 42/75 (56%), Gaps = 7/75 (9%)

Query: 1  MAPPTVVFGKEELEPLLRNVMATCIFKSLTQSECNF---DGHQYVCVPFKRVFKECKVDG 57
          MAPPT V  +EEL  + ++    C+ KSLTQ +C         Y CVPFKR+F+EC+   
Sbjct: 1  MAPPTPVLAREELPEIPQS--KNCVLKSLTQFQCQLRPAGSGLYECVPFKRLFQECRDPS 58

Query: 58 KSI--RIEVTDRNTN 70
               RIEVT   TN
Sbjct: 59 GRFKSRIEVTSPLTN 73

>Skud_5.30 Chr5 complement(41436..41657) [222 bp, 74 aa] {ON}
          YEL059C-A (REAL)
          Length = 74

 Score = 53.9 bits (128), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 39/73 (53%), Gaps = 3/73 (4%)

Query: 1  MAPPTVVFGKEE-LEPLLR-NVMATCIFKSLTQSECNFDGHQYVCVPFKRVFKECKVDGK 58
          MAPPT +  +++ L PL   +    C  K L Q EC F    YVC PFKR+F+ C    K
Sbjct: 1  MAPPTTIRSRDQALAPLAALDSHTRCQLKELVQWECQFREADYVCFPFKRLFERCIAPDK 60

Query: 59 SIR-IEVTDRNTN 70
          S    EVTD  TN
Sbjct: 61 SATDYEVTDTYTN 73

>NCAS0F00210 Chr6 (32317..32556) [240 bp, 79 aa] {ON} Anc_6.12
          YEL059C-A
          Length = 79

 Score = 50.4 bits (119), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 34/83 (40%), Positives = 46/83 (55%), Gaps = 18/83 (21%)

Query: 1  MAPPTVVFGKEEL--EPLLRN---------VMATCIFKSLTQSECNF--DGHQYVCVPFK 47
          MAPP VVFGK+++  +  L N             C    LTQ +C    DG QY+C PFK
Sbjct: 1  MAPPVVVFGKDDIRVKTALSNNRTGETDAETGDGCRQFQLTQFQCQLLEDG-QYICFPFK 59

Query: 48 RVFKECKVDGKSIRIEVTDRNTN 70
          RVF+EC    + +R EVT+ ++N
Sbjct: 60 RVFQEC----QGVRTEVTNVDSN 78

>ZYRO0F00528g Chr6 (51411..51644) [234 bp, 77 aa] {ON} similar to
          uniprot|Q05676 Saccharomyces cerevisiae YEL059C-A
          Length = 77

 Score = 48.9 bits (115), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 41/76 (53%), Gaps = 10/76 (13%)

Query: 1  MAPPTVVFGKEELEPLLRNVMAT-----CIFKSLTQSECNFDG-HQYVCVPFKRVFKECK 54
          MAPPT +   E++      V        C  KSLTQ  C+ +   +Y+CVPFKRVF++C 
Sbjct: 1  MAPPTPILTSEQVSRERERVQILKEKNKCELKSLTQHLCHAEAPGEYICVPFKRVFEKCL 60

Query: 55 VDGKSIRIEVTDRNTN 70
                 +EVTD +TN
Sbjct: 61 GHA----LEVTDADTN 72

>TPHA0M00220 Chr13 (44225..44461) [237 bp, 78 aa] {ON} Anc_6.12
          YEL059C-A
          Length = 78

 Score = 43.5 bits (101), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 42/80 (52%), Gaps = 13/80 (16%)

Query: 1  MAPPTVVFGKEELEPLL-----RNVMATCIFKSLTQSECNF---DGHQYVCVPFKRVFKE 52
          MAP T V  +E +   L     RN    C  K+LTQ EC F   + ++Y+C PFKR+F+ 
Sbjct: 1  MAPATPVVDREAVAATLQASKQRNRQ-ECELKALTQYECQFVDLESNRYICRPFKRLFEV 59

Query: 53 CKVDGKSIRIEVTDRNTNKA 72
          C   G S   E T + TN A
Sbjct: 60 CA--GTS--YETTAQPTNSA 75

>KNAG0E00930 Chr5 complement(176364..176693) [330 bp, 109 aa] {ON}
          Anc_6.12 YEL059C-A
          Length = 109

 Score = 41.2 bits (95), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 28/53 (52%), Gaps = 2/53 (3%)

Query: 1  MAPPTVVFGKEELEPLLRNVMATCIFKSLTQSECNFDGHQYVCVPFKRVFKEC 53
          MAP   V  + ++   L      C+ K L Q  C  DG Q+ C PF+R+F++C
Sbjct: 1  MAPNVRVLTRNDVP--LPQPQDGCVLKELVQFRCENDGTQWQCAPFRRLFEQC 51

>TBLA0G00990 Chr7 (251428..251664) [237 bp, 78 aa] {ON} Anc_6.12
          YEL059C-A
          Length = 78

 Score = 38.5 bits (88), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 38/81 (46%), Gaps = 15/81 (18%)

Query: 1  MAPPTVVFGKEELEPLLR----------NVMATCIFKSLTQSEC-NFDGHQYVCVPFKRV 49
          MAPP  +  KEEL+ L +             A     S+TQ EC + D  Q  C PFKR+
Sbjct: 1  MAPPVTIQTKEELDILEKVNRKNRKDDTKKSAKPKKYSITQYECFDNDKGQIECFPFKRI 60

Query: 50 FKECKVDGKSIRIEVTDRNTN 70
          F++        R E+TD  TN
Sbjct: 61 FQQV----GEYRREITDETTN 77

>KAFR0L00350 Chr12 (63897..64112) [216 bp, 71 aa] {ON} Anc_6.12
          YEL059C-A
          Length = 71

 Score = 30.8 bits (68), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 29/65 (44%), Gaps = 3/65 (4%)

Query: 1  MAPPTVVFGKEELEPLLRNVMATCIFKSLTQSECNFD-GHQYVCVPFKRVFKEC-KVDGK 58
          MAP   V   +  E  ++     C   SL Q  C +  G    C PFKR+F EC    GK
Sbjct: 1  MAPMIRVMDGDAAEREVKGAEG-CQLYSLVQYNCEYRVGGTLECFPFKRMFLECLDKSGK 59

Query: 59 SIRIE 63
            R+E
Sbjct: 60 LKRVE 64

>CAGL0D00836g Chr4 complement(99696..101555) [1860 bp, 619 aa] {ON}
           similar to uniprot|Q07395 Saccharomyces cerevisiae
           YDL063c
          Length = 619

 Score = 28.9 bits (63), Expect = 1.8,   Method: Composition-based stats.
 Identities = 24/87 (27%), Positives = 41/87 (47%), Gaps = 6/87 (6%)

Query: 7   VFGKEELEPLLRNVMATCIFKSLTQSECNFDGHQYVCVPFKRVFKECKVDGKSIRIEVTD 66
           +   +E +PLL   +   IF+  + S  ++D   +V   F +  KE  V     R +  D
Sbjct: 530 ILTSKESDPLLLVEVTNFIFEIYSDSAYDYDTEVFVKDSFLQTLKEKVVPNLKERFKFVD 589

Query: 67  RNTN---KAKADE---MVDSFWNSRKS 87
           RN +   K +A E   ++ SF N ++S
Sbjct: 590 RNKSPELKERATETFNILGSFINYKES 616

>Suva_16.90 Chr16 (153235..156549) [3315 bp, 1104 aa] {ON} YPL216W
          (REAL)
          Length = 1104

 Score = 28.5 bits (62), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 17/23 (73%)

Query: 51 KECKVDGKSIRIEVTDRNTNKAK 73
          KE ++DGK + I+ TDRNT + K
Sbjct: 7  KEVQLDGKELSIDTTDRNTWEIK 29

>KLLA0B14190g Chr2 complement(1245746..1246495) [750 bp, 249 aa]
          {ON} no similarity
          Length = 249

 Score = 27.3 bits (59), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 19/31 (61%), Gaps = 2/31 (6%)

Query: 63 EVTDRNTNKAKADEMVDSFWN--SRKSFTRN 91
          EV   +++  KA E +DS WN  SR  +TRN
Sbjct: 34 EVDHESSDTHKAQEELDSIWNGLSRMIYTRN 64

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.134    0.408 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 9,764,206
Number of extensions: 340935
Number of successful extensions: 819
Number of sequences better than 10.0: 22
Number of HSP's gapped: 808
Number of HSP's successfully gapped: 22
Length of query: 91
Length of database: 53,481,399
Length adjustment: 62
Effective length of query: 29
Effective length of database: 46,372,107
Effective search space: 1344791103
Effective search space used: 1344791103
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 59 (27.3 bits)