Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_56.223556.11ON54154128850.0
KLTH0C11506g6.11ON54454021740.0
SAKL0E00902g6.11ON54454218750.0
Ecym_30146.11ON55153517130.0
ACR015W6.11ON55254115890.0
KLLA0D00858g6.11ON54153815600.0
Kpol_1032.26.11ON53953715260.0
TPHA0M002106.11ON54553915090.0
TDEL0G046006.11ON52853714760.0
ZYRO0F00506g6.11ON55055814760.0
TBLA0G009806.11ON55855714420.0
NCAS0F002006.11ON54955214330.0
CAGL0B03597g6.11ON54054414310.0
Suva_5.106.11ON55355014120.0
Smik_5.296.11ON55555413960.0
Skud_5.316.11ON55755313930.0
KAFR0L003406.11ON54054413860.0
NDAI0K028906.11ON56155113860.0
YEL058W (PCM1)6.11ON55754113840.0
KNAG0E009406.11ON53855113141e-177
CAGL0M02981g8.840ON61777900.022
TBLA0B032508.840ON64391900.026
TPHA0I002508.840ON62953880.049
TDEL0B005708.840ON63027870.055
Kpol_1068.88.840ON63227860.068
KLLA0D01573g8.840ON60722860.085
Kwal_27.102588.840ON62041860.085
NCAS0C004108.840ON62549850.10
KLTH0C03872g8.840ON62160830.19
Ecym_46118.840ON63044820.24
KNAG0J002708.840ON62520820.25
YMR278W (PGM3)8.840ON62220810.27
Suva_13.4668.840ON62220810.30
Skud_13.4508.840ON62220810.30
NDAI0K004108.840ON62625810.32
ZYRO0G14190g8.840ON61020810.33
KAFR0B039208.840ON62423810.33
Smik_13.4918.840ON62225800.40
ABL126W8.840ON62425780.63
SAKL0D01474g8.840ON62425770.86
CAGL0M05511g8.521ON43558741.7
ADR050W8.521ON41486732.7
Smik_2.324na 1ON55334732.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_56.22355
         (541 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_56.22355 s56 complement(62955..64580) [1626 bp, 541 aa] {ON...  1115   0.0  
KLTH0C11506g Chr3 (944869..946503) [1635 bp, 544 aa] {ON} simila...   842   0.0  
SAKL0E00902g Chr5 complement(68682..70316) [1635 bp, 544 aa] {ON...   726   0.0  
Ecym_3014 Chr3 complement(28261..29916) [1656 bp, 551 aa] {ON} s...   664   0.0  
ACR015W Chr3 (383130..384788) [1659 bp, 552 aa] {ON} Syntenic ho...   616   0.0  
KLLA0D00858g Chr4 complement(80327..81952) [1626 bp, 541 aa] {ON...   605   0.0  
Kpol_1032.2 s1032 complement(1049..2668) [1620 bp, 539 aa] {ON} ...   592   0.0  
TPHA0M00210 Chr13 complement(42336..43973) [1638 bp, 545 aa] {ON...   585   0.0  
TDEL0G04600 Chr7 (838381..839967) [1587 bp, 528 aa] {ON} Anc_6.1...   573   0.0  
ZYRO0F00506g Chr6 complement(49579..51231) [1653 bp, 550 aa] {ON...   573   0.0  
TBLA0G00980 Chr7 complement(248484..250160) [1677 bp, 558 aa] {O...   560   0.0  
NCAS0F00200 Chr6 complement(30474..32123) [1650 bp, 549 aa] {ON}...   556   0.0  
CAGL0B03597g Chr2 complement(359018..360640) [1623 bp, 540 aa] {...   555   0.0  
Suva_5.10 Chr5 (19280..20941) [1662 bp, 553 aa] {ON} YEL058W (REAL)   548   0.0  
Smik_5.29 Chr5 (45538..47205) [1668 bp, 555 aa] {ON} YEL058W (REAL)   542   0.0  
Skud_5.31 Chr5 (42262..43935) [1674 bp, 557 aa] {ON} YEL058W (REAL)   541   0.0  
KAFR0L00340 Chr12 complement(62157..63779) [1623 bp, 540 aa] {ON...   538   0.0  
NDAI0K02890 Chr11 (655311..656996) [1686 bp, 561 aa] {ON} Anc_6....   538   0.0  
YEL058W Chr5 (43252..44925) [1674 bp, 557 aa] {ON}  PCM1Essentia...   537   0.0  
KNAG0E00940 Chr5 (176887..178503) [1617 bp, 538 aa] {ON} Anc_6.1...   510   e-177
CAGL0M02981g Chr13 (335863..337716) [1854 bp, 617 aa] {ON} simil...    39   0.022
TBLA0B03250 Chr2 (757928..759859) [1932 bp, 643 aa] {ON} Anc_8.8...    39   0.026
TPHA0I00250 Chr9 (46554..48443) [1890 bp, 629 aa] {ON} Anc_8.840...    39   0.049
TDEL0B00570 Chr2 complement(109270..111162) [1893 bp, 630 aa] {O...    38   0.055
Kpol_1068.8 s1068 complement(13542..15440) [1899 bp, 632 aa] {ON...    38   0.068
KLLA0D01573g Chr4 complement(139183..141006) [1824 bp, 607 aa] {...    38   0.085
Kwal_27.10258 s27 complement(265612..267474) [1863 bp, 620 aa] {...    38   0.085
NCAS0C00410 Chr3 complement(62893..64770) [1878 bp, 625 aa] {ON}...    37   0.10 
KLTH0C03872g Chr3 complement(337765..339630) [1866 bp, 621 aa] {...    37   0.19 
Ecym_4611 Chr4 (1191367..1193259) [1893 bp, 630 aa] {ON} similar...    36   0.24 
KNAG0J00270 Chr10 complement(39750..41627) [1878 bp, 625 aa] {ON...    36   0.25 
YMR278W Chr13 (822763..824631) [1869 bp, 622 aa] {ON}  PGM3Phosp...    36   0.27 
Suva_13.466 Chr13 (805414..807282) [1869 bp, 622 aa] {ON} YMR278...    36   0.30 
Skud_13.450 Chr13 (796030..797898) [1869 bp, 622 aa] {ON} YMR278...    36   0.30 
NDAI0K00410 Chr11 complement(91807..93687) [1881 bp, 626 aa] {ON...    36   0.32 
ZYRO0G14190g Chr7 (1131206..1133038) [1833 bp, 610 aa] {ON} simi...    36   0.33 
KAFR0B03920 Chr2 (814394..816268) [1875 bp, 624 aa] {ON} Anc_8.8...    36   0.33 
Smik_13.491 Chr13 (805767..807635) [1869 bp, 622 aa] {ON} YMR278...    35   0.40 
ABL126W Chr2 (159207..161081) [1875 bp, 624 aa] {ON} Syntenic ho...    35   0.63 
SAKL0D01474g Chr4 complement(117178..119052) [1875 bp, 624 aa] {...    34   0.86 
CAGL0M05511g Chr13 (587202..588509) [1308 bp, 435 aa] {ON} simil...    33   1.7  
ADR050W Chr4 (794886..796130) [1245 bp, 414 aa] {ON} Syntenic ho...    33   2.7  
Smik_2.324 Chr2 (583653..585314) [1662 bp, 553 aa] {ON} YBR184W ...    33   2.8  

>Kwal_56.22355 s56 complement(62955..64580) [1626 bp, 541 aa] {ON}
           YEL058W (PCM1) - Phosphoacetylglucosamine Mutase [contig
           186] FULL
          Length = 541

 Score = 1115 bits (2885), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 541/541 (100%), Positives = 541/541 (100%)

Query: 1   MLDTKALKSLYEAHCSTGFHYAYGTAGFRYKADVLDTVMFTTGVVAGLRSIFLEGKTVGV 60
           MLDTKALKSLYEAHCSTGFHYAYGTAGFRYKADVLDTVMFTTGVVAGLRSIFLEGKTVGV
Sbjct: 1   MLDTKALKSLYEAHCSTGFHYAYGTAGFRYKADVLDTVMFTTGVVAGLRSIFLEGKTVGV 60

Query: 61  MITASHNPPEDNGVKIVDPKGEMLEQSWEVYATDLANSASQGFSEFVASVERLMTKLEVG 120
           MITASHNPPEDNGVKIVDPKGEMLEQSWEVYATDLANSASQGFSEFVASVERLMTKLEVG
Sbjct: 61  MITASHNPPEDNGVKIVDPKGEMLEQSWEVYATDLANSASQGFSEFVASVERLMTKLEVG 120

Query: 121 SNDHGSIVVARDSRESGPRLLGAFLSGVKVLANVKVTDHGLLTTPQLHFLTSKSNELPKG 180
           SNDHGSIVVARDSRESGPRLLGAFLSGVKVLANVKVTDHGLLTTPQLHFLTSKSNELPKG
Sbjct: 121 SNDHGSIVVARDSRESGPRLLGAFLSGVKVLANVKVTDHGLLTTPQLHFLTSKSNELPKG 180

Query: 181 TEIGKSLYYDNFLSAWVEIAELCKIDSLPYKLEIDAANGIGAPVVTEMLSQHKFFKGAFA 240
           TEIGKSLYYDNFLSAWVEIAELCKIDSLPYKLEIDAANGIGAPVVTEMLSQHKFFKGAFA
Sbjct: 181 TEIGKSLYYDNFLSAWVEIAELCKIDSLPYKLEIDAANGIGAPVVTEMLSQHKFFKGAFA 240

Query: 241 VVNDEWETPDSLNHLCGADFVKTNQKLPHGIAPGGERNRICCSFDGDADRIVFYYCGKNG 300
           VVNDEWETPDSLNHLCGADFVKTNQKLPHGIAPGGERNRICCSFDGDADRIVFYYCGKNG
Sbjct: 241 VVNDEWETPDSLNHLCGADFVKTNQKLPHGIAPGGERNRICCSFDGDADRIVFYYCGKNG 300

Query: 301 DFHLLDGDKMATLFAKFFQELLRDAGLQDELELGVVQTAYANGSSTAYIEQVLGISVTCT 360
           DFHLLDGDKMATLFAKFFQELLRDAGLQDELELGVVQTAYANGSSTAYIEQVLGISVTCT
Sbjct: 301 DFHLLDGDKMATLFAKFFQELLRDAGLQDELELGVVQTAYANGSSTAYIEQVLGISVTCT 360

Query: 361 PTGVKHLHHEAVKYDIGVYFEANGHGTVVFSSKFLDVIDRKLSEKLESDAAQKSLKVLHL 420
           PTGVKHLHHEAVKYDIGVYFEANGHGTVVFSSKFLDVIDRKLSEKLESDAAQKSLKVLHL
Sbjct: 361 PTGVKHLHHEAVKYDIGVYFEANGHGTVVFSSKFLDVIDRKLSEKLESDAAQKSLKVLHL 420

Query: 421 FAKLINQTVGDAISDMLAVLAVLSILKWSPEKWDEEYTDLPNKLIKVLVPDRTVFKTKNA 480
           FAKLINQTVGDAISDMLAVLAVLSILKWSPEKWDEEYTDLPNKLIKVLVPDRTVFKTKNA
Sbjct: 421 FAKLINQTVGDAISDMLAVLAVLSILKWSPEKWDEEYTDLPNKLIKVLVPDRTVFKTKNA 480

Query: 481 ERQLVSPAGVQEKIDALVATFSKGRSFVRASGTEDAVRVYAEAATPQETEALSQQVEKLL 540
           ERQLVSPAGVQEKIDALVATFSKGRSFVRASGTEDAVRVYAEAATPQETEALSQQVEKLL
Sbjct: 481 ERQLVSPAGVQEKIDALVATFSKGRSFVRASGTEDAVRVYAEAATPQETEALSQQVEKLL 540

Query: 541 A 541
           A
Sbjct: 541 A 541

>KLTH0C11506g Chr3 (944869..946503) [1635 bp, 544 aa] {ON} similar
           to uniprot|P38628 Saccharomyces cerevisiae YEL058W PCM1
           Essential N-acetylglucosamine- phosphate mutase a
           hexosephosphate mutase involved in the biosynthesis of
           chitin
          Length = 544

 Score =  842 bits (2174), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/540 (73%), Positives = 461/540 (85%)

Query: 1   MLDTKALKSLYEAHCSTGFHYAYGTAGFRYKADVLDTVMFTTGVVAGLRSIFLEGKTVGV 60
           MLDTK L++LYE HC +GF YAYGTAGFRYKADVLDTVMFTTGV+AGLRSI+LEG+TVGV
Sbjct: 1   MLDTKTLETLYETHCKSGFTYAYGTAGFRYKADVLDTVMFTTGVLAGLRSIYLEGRTVGV 60

Query: 61  MITASHNPPEDNGVKIVDPKGEMLEQSWEVYATDLANSASQGFSEFVASVERLMTKLEVG 120
           MITASHNPPEDNGVKIVDPKGEMLEQSWE YATDLANSA+Q F+ F+A ++ L+++L + 
Sbjct: 61  MITASHNPPEDNGVKIVDPKGEMLEQSWESYATDLANSATQSFTAFLAYLQNLVSELGLD 120

Query: 121 SNDHGSIVVARDSRESGPRLLGAFLSGVKVLANVKVTDHGLLTTPQLHFLTSKSNELPKG 180
           ++  GS+ VARDSRESGPRLL A L+G +VL N+++TD+GLLTTPQLHFLTSK NELP  
Sbjct: 121 TDALGSLAVARDSRESGPRLLHALLNGSRVLPNIRITDYGLLTTPQLHFLTSKRNELPND 180

Query: 181 TEIGKSLYYDNFLSAWVEIAELCKIDSLPYKLEIDAANGIGAPVVTEMLSQHKFFKGAFA 240
           T I +  YY  FLSAW +I  LC I SLPYKLEIDAANGIGAP V EMLS HKFF G F 
Sbjct: 181 TAIDRFFYYKEFLSAWDDITALCGIQSLPYKLEIDAANGIGAPRVKEMLSTHKFFDGVFR 240

Query: 241 VVNDEWETPDSLNHLCGADFVKTNQKLPHGIAPGGERNRICCSFDGDADRIVFYYCGKNG 300
           VVND+WETP SLNHLCGAD+VKTNQ+LP+GI    +  RICCSFDGDADRIVFY+C   G
Sbjct: 241 VVNDDWETPASLNHLCGADYVKTNQRLPYGIQANNDCQRICCSFDGDADRIVFYFCDSEG 300

Query: 301 DFHLLDGDKMATLFAKFFQELLRDAGLQDELELGVVQTAYANGSSTAYIEQVLGISVTCT 360
            F LLDGDKMATLFAKFFQ++L  A LQ+ L LGVVQTAYANGSST YIE+VLGI VTCT
Sbjct: 301 QFRLLDGDKMATLFAKFFQDILSSANLQERLSLGVVQTAYANGSSTHYIERVLGIPVTCT 360

Query: 361 PTGVKHLHHEAVKYDIGVYFEANGHGTVVFSSKFLDVIDRKLSEKLESDAAQKSLKVLHL 420
           PTGVKHLHHEA+ YDIGVYFEANGHGTVVFS KF +V++  LS K +SD++ +SL+VL  
Sbjct: 361 PTGVKHLHHEAINYDIGVYFEANGHGTVVFSKKFDEVVNSGLSNKHQSDSSLQSLEVLSK 420

Query: 421 FAKLINQTVGDAISDMLAVLAVLSILKWSPEKWDEEYTDLPNKLIKVLVPDRTVFKTKNA 480
           FA LINQTVGDAISDM+ VLAVLSILKW+P+KW++EYTDLPNKL+KVLVPDRTVFKT NA
Sbjct: 421 FANLINQTVGDAISDMMGVLAVLSILKWTPQKWNQEYTDLPNKLVKVLVPDRTVFKTTNA 480

Query: 481 ERQLVSPAGVQEKIDALVATFSKGRSFVRASGTEDAVRVYAEAATPQETEALSQQVEKLL 540
           ERQL+SP G+Q KI+ALVA + + RSFVRASGTEDAVRVYAEA+T +E ++L+ +V +++
Sbjct: 481 ERQLLSPLGLQPKINALVAEYHQARSFVRASGTEDAVRVYAEASTREEADSLASRVSQVV 540

>SAKL0E00902g Chr5 complement(68682..70316) [1635 bp, 544 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 544

 Score =  726 bits (1875), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/542 (63%), Positives = 430/542 (79%), Gaps = 3/542 (0%)

Query: 1   MLDTKALKSLYEAHCSTGFHYAYGTAGFRYKADVLDTVMFTTGVVAGLRSIFLEGKTVGV 60
           M++ + L+ LY+ HC TGF Y YGTAGFRYKADVLDTVMFTTG++A +RSI+L+G+ VGV
Sbjct: 1   MVNIQLLEELYDKHCKTGFTYTYGTAGFRYKADVLDTVMFTTGILAAIRSIYLKGQYVGV 60

Query: 61  MITASHNPPEDNGVKIVDPKGEMLEQSWEVYATDLANSASQGFSEFVASVERLMTKLEVG 120
           MITASHNPP+DNGVKIVDPKGEML+Q+WE +AT+LANSAS+G  E + ++++L+TKL + 
Sbjct: 61  MITASHNPPQDNGVKIVDPKGEMLDQAWEPFATELANSASKGKQELIKALDKLITKLGID 120

Query: 121 SNDHGSIVVARDSRESGPRLLGAFLSGVKVLANVKVTDHGLLTTPQLHFLTSKSNELPKG 180
             +   I ++RDSRESGPRLL A + G KVL NV+V D  LLTTPQLHFLT + N+    
Sbjct: 121 DTESAKITISRDSRESGPRLLQAVIDGTKVLKNVQVVDFNLLTTPQLHFLTYQYNQ-GSS 179

Query: 181 TEIGKSLYYDNFLSAWVEIAELCKIDSLPYKLEIDAANGIGAPVVTEMLSQHKFFKGAFA 240
           +++ +S YY  F SAW +I  L  I+SLPY++ IDAANGIG P V+EML ++KFF    +
Sbjct: 180 SKVEESTYYSAFSSAWTKICGLHDINSLPYRVIIDAANGIGGPKVSEMLLKNKFFSSTVS 239

Query: 241 VVNDEWETPDSLNHLCGADFVKTNQKLPHGIAPGGERNRICCSFDGDADRIVFYYCGKNG 300
           V+N++W++P+ LN  CGAD+VKTNQ  P G++   E   I CSFDGDADRIVFYY  +  
Sbjct: 240 VINNQWQSPELLNESCGADYVKTNQHFPKGVSGNSENECIYCSFDGDADRIVFYYHDEKS 299

Query: 301 DFHLLDGDKMATLFAKFFQELLRDAGLQDELELGVVQTAYANGSSTAYIEQVLGISVTCT 360
            F+LLDGDK++TLFAKFF+ELL  AG ++EL+LGVVQTAYANGSST Y+  +L + V+CT
Sbjct: 300 KFNLLDGDKISTLFAKFFKELLVAAGAENELKLGVVQTAYANGSSTEYLSSILEVPVSCT 359

Query: 361 PTGVKHLHHEAV-KYDIGVYFEANGHGTVVFSSKFLDVIDRKLSEKLESDAAQKSLKVLH 419
            TGVKHLHHEA+  YDIG+YFEANGHGTV+FS +F   ID+KL E  +   A K+LK L+
Sbjct: 360 ATGVKHLHHEAIHNYDIGIYFEANGHGTVIFSDEFHKTIDKKLKEPQDEKTA-KALKTLY 418

Query: 420 LFAKLINQTVGDAISDMLAVLAVLSILKWSPEKWDEEYTDLPNKLIKVLVPDRTVFKTKN 479
           LF  LINQTVGDAISDMLAVLAVL ILKWSP+KWD+EYTDLPNKL+KV+VPDR+VFKT N
Sbjct: 419 LFTNLINQTVGDAISDMLAVLAVLCILKWSPQKWDQEYTDLPNKLVKVIVPDRSVFKTSN 478

Query: 480 AERQLVSPAGVQEKIDALVATFSKGRSFVRASGTEDAVRVYAEAATPQETEALSQQVEKL 539
           AERQLVSP G+QEKID+ V  F  GRSFVRASGTEDAVRVYAEAAT ++ + L+  V  L
Sbjct: 479 AERQLVSPKGLQEKIDSTVQEFEHGRSFVRASGTEDAVRVYAEAATKEKADRLAASVSDL 538

Query: 540 LA 541
           ++
Sbjct: 539 VS 540

>Ecym_3014 Chr3 complement(28261..29916) [1656 bp, 551 aa] {ON}
           similar to Ashbya gossypii ACR015W
          Length = 551

 Score =  664 bits (1713), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/535 (58%), Positives = 405/535 (75%), Gaps = 4/535 (0%)

Query: 10  LYEAHCSTGFHYAYGTAGFRYKADVLDTVMFTTGVVAGLRSIFLEGKTVGVMITASHNPP 69
           LY+ HC + F Y YGTAGFRYKA++LDTV+FTTGV+A LRS+ L+G+ VG MITASHNPP
Sbjct: 10  LYDKHCCSRFKYIYGTAGFRYKAEILDTVLFTTGVLACLRSMHLKGQYVGAMITASHNPP 69

Query: 70  EDNGVKIVDPKGEMLEQSWEVYATDLANSASQGFSEFVASVERLMTKLEVGSNDHGSIVV 129
           +DNGVK+VDPKGEML+Q WEVYAT+LAN AS G  +F+  ++ LM +  + ++    IVV
Sbjct: 70  QDNGVKLVDPKGEMLKQEWEVYATELANCASDGKHQFLHRLQELMNQFGIKADSEARIVV 129

Query: 130 ARDSRESGPRLLGAFLSGVKVLANVKVTDHGLLTTPQLHFLTSKSN---ELPKGTEIGKS 186
           ARDSRESG RLL A + G  V  NV + D+ +LTTPQLHFLT   N   E  +  E+ ++
Sbjct: 130 ARDSRESGSRLLKALVDGTSVFTNVDIVDYDMLTTPQLHFLTYHLNRQMESERVIEVNEA 189

Query: 187 LYYDNFLSAWVEIAELCKIDSLPYKLEIDAANGIGAPVVTEMLSQHKFFKGAFAVVNDEW 246
            YY +FLSA  E+ EL  I  LPY L IDAANG+G     E+  ++ FFK +  ++N  W
Sbjct: 190 FYYSHFLSALKELTELFNIPGLPYPLVIDAANGVGGAKAEELFMKNTFFKDSTTIINGNW 249

Query: 247 ETPDSLNHLCGADFVKTNQKLPHGIAPGGERNRICCSFDGDADRIVFYYCGKNGDFHLLD 306
              D LN  CGAD+VKTNQ LP GI+   + N + CSFDGDADR++FYY   +G FHLLD
Sbjct: 250 SQHDLLNSFCGADYVKTNQCLPQGISAATDINSLHCSFDGDADRVIFYYRDVDGMFHLLD 309

Query: 307 GDKMATLFAKFFQELLRDAGLQDELELGVVQTAYANGSSTAYIEQVLGISVTCTPTGVKH 366
           GDK++TLFAKFFQ +L  AG+QD ++LGVVQTAYANGSST Y+ +VL + V+CTPTGVK+
Sbjct: 310 GDKISTLFAKFFQSMLPVAGIQDNVKLGVVQTAYANGSSTRYLSEVLIVPVSCTPTGVKY 369

Query: 367 LHHEAVK-YDIGVYFEANGHGTVVFSSKFLDVIDRKLSEKLESDAAQKSLKVLHLFAKLI 425
           LH +AV+ YD+G+YFEANGHGTV+FS  F + + ++L E   S  ++ +LK L  F+KLI
Sbjct: 370 LHRKAVENYDVGIYFEANGHGTVIFSENFNNTVSKRLKEGSLSAESKMALKTLQSFSKLI 429

Query: 426 NQTVGDAISDMLAVLAVLSILKWSPEKWDEEYTDLPNKLIKVLVPDRTVFKTKNAERQLV 485
           NQTVGDA+SDM+AVLAVL ILKW+P++WD EYTDLPN L+KV+VPDR++FKT NAERQLV
Sbjct: 430 NQTVGDAMSDMMAVLAVLCILKWTPQQWDGEYTDLPNTLMKVVVPDRSLFKTTNAERQLV 489

Query: 486 SPAGVQEKIDALVATFSKGRSFVRASGTEDAVRVYAEAATPQETEALSQQVEKLL 540
           SP G+Q +ID ++ ++   RSFVRASGTEDAVR+YAEAAT ++ + LS ++ +L+
Sbjct: 490 SPKGLQAQIDKVIKSYDNARSFVRASGTEDAVRIYAEAATKEQADDLSIKISQLV 544

>ACR015W Chr3 (383130..384788) [1659 bp, 552 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL058W (PCM1)
          Length = 552

 Score =  616 bits (1589), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/541 (55%), Positives = 387/541 (71%), Gaps = 1/541 (0%)

Query: 1   MLDTKALKSLYEAHCSTGFHYAYGTAGFRYKADVLDTVMFTTGVVAGLRSIFLEGKTVGV 60
           M   + +  LY+ H   G  YAYGTAGFR +A+VL  V+F TG++A LRS++L G  VGV
Sbjct: 1   MRTVQEMVKLYDRHRGCGRVYAYGTAGFRSRAEVLAPVVFATGLLACLRSLYLGGAYVGV 60

Query: 61  MITASHNPPEDNGVKIVDPKGEMLEQSWEVYATDLANSASQGFSEFVASVERLMTKLEVG 120
           M+TASHNPPEDNGVK+VDP GEML   WE +AT LAN ASQG  E + ++  L+ +L + 
Sbjct: 61  MLTASHNPPEDNGVKLVDPHGEMLAAEWEKHATALANCASQGQQELLDALHMLVDRLGLD 120

Query: 121 SNDHGSIVVARDSRESGPRLLGAFLSGVKVLANVKVTDHGLLTTPQLHFLTSKSNELPKG 180
                 +VVARDSR SGP+LL A L G ++L +V+V D G+LTTPQLHFLT   NE    
Sbjct: 121 LALRARVVVARDSRASGPQLLDALLDGTRMLEDVEVVDCGMLTTPQLHFLTCACNERGSA 180

Query: 181 TEIGKSLYYDNFLSAWVEIAELCKIDSLPYKLEIDAANGIGAPVVTEMLSQHKFFKGAFA 240
             + + LYY +F++A  E+A L  +++LP+ L +D ANG+GA    E+  +   FK   +
Sbjct: 181 AGVREDLYYAHFVAALEELAALHGLETLPFPLVVDTANGVGALKARELFRRSPLFKNRVS 240

Query: 241 VVNDEWETPDSLNHLCGADFVKTNQKLPHGIAPGGERNRICCSFDGDADRIVFYYCGKNG 300
           ++ND W   + LN  CGAD+VKT Q LP GI+    R  + CS+DGDADR++FYY     
Sbjct: 241 IINDNWSQHELLNSGCGADYVKTKQCLPQGISADLLRESLFCSYDGDADRVIFYYIDGQE 300

Query: 301 DFHLLDGDKMATLFAKFFQELLRDAGLQDELELGVVQTAYANGSSTAYIEQVLGISVTCT 360
            FHLLDGDK++TL AKF Q  L  AG+ D++ LGVVQTAYANGSST Y+ +VL + V+CT
Sbjct: 301 RFHLLDGDKISTLIAKFLQSALLTAGINDDVCLGVVQTAYANGSSTRYLSEVLEVPVSCT 360

Query: 361 PTGVKHLHHEAV-KYDIGVYFEANGHGTVVFSSKFLDVIDRKLSEKLESDAAQKSLKVLH 419
           PTGVKHLH EAV KYD+G+YFEANGHGTV+FS  F   ++R L     S  A+ SL+ L 
Sbjct: 361 PTGVKHLHREAVQKYDVGIYFEANGHGTVIFSEHFTLTVERALENPALSAKARLSLQTLK 420

Query: 420 LFAKLINQTVGDAISDMLAVLAVLSILKWSPEKWDEEYTDLPNKLIKVLVPDRTVFKTKN 479
            FA LINQT+GDAI+DMLAV+A+LSIL WSPE WD++YTDLPN L+KV+VPDR++FKT N
Sbjct: 421 TFANLINQTIGDAIADMLAVIAILSILHWSPEDWDKQYTDLPNNLVKVVVPDRSMFKTTN 480

Query: 480 AERQLVSPAGVQEKIDALVATFSKGRSFVRASGTEDAVRVYAEAATPQETEALSQQVEKL 539
           AE+QL SPAG+QE ID +V  +  GRSFVRASGTEDAVR+YAEAA+ Q+ + L+ +V  L
Sbjct: 481 AEQQLTSPAGLQELIDDIVMVYDSGRSFVRASGTEDAVRIYAEAASQQQADELATKVSTL 540

Query: 540 L 540
           +
Sbjct: 541 V 541

>KLLA0D00858g Chr4 complement(80327..81952) [1626 bp, 541 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 541

 Score =  605 bits (1560), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/538 (57%), Positives = 384/538 (71%), Gaps = 5/538 (0%)

Query: 6   ALKSLYEAHCSTGFHYAYGTAGFRYKADVLDTVMFTTGVVAGLRSIFLEGKTVGVMITAS 65
           + + LYE +C  G  Y YGTAGFR    VLDTVMFTTG+VA LRSI+L+ K VGVMITAS
Sbjct: 2   SFRDLYEQYCKQGHAYTYGTAGFRAHNSVLDTVMFTTGIVAVLRSIYLKSKFVGVMITAS 61

Query: 66  HNPPEDNGVKIVDPKGEMLEQSWEVYATDLANSASQGFSEFVASVERLMTKLEVGSNDHG 125
           HNPPEDNGVK+V+P GEML Q+WE  AT LAN+AS  F++  ++++ ++ +L + +    
Sbjct: 62  HNPPEDNGVKVVEPYGEMLVQNWEPIATKLANAASSSFTQLESTLQSIIAELNIDTTQLA 121

Query: 126 SIVVARDSRESGPRLLGAFLSGVKVLANVKVTDHGLLTTPQLHFLTSKSNELPKGTEIGK 185
           +I VARDSRESGPRLL A  +G+ V   VK+ D  LLTTPQLHFL    N   + +++  
Sbjct: 122 NITVARDSRESGPRLLAALKAGISVFPAVKIIDFELLTTPQLHFLVYSLNTSSQPSQVRD 181

Query: 186 SLYYDNFLSAWVEIAELCKIDSLPYKLEIDAANGIGAPVVTEMLSQH-KFFKGAFAVVND 244
           S YYD+F+S W ++ +L ++  LP+ L ID ANGIGA  V +++SQ     + +   VN 
Sbjct: 182 STYYDHFVSIWNQLTQLYEVTELPFHLTIDCANGIGADKVKQLISQAGHMLENSLTAVNG 241

Query: 245 EWETPDSLNHLCGADFVKTNQKLPHGIAPGGERNRICCSFDGDADRIVFYYC-GKNGDFH 303
           E +T   LN  CGADFVKTNQ  P    P  + +++ CSFDGDADR+VFYY  GK   FH
Sbjct: 242 ETKTFQLLNESCGADFVKTNQTFPANCNP--KPSQLYCSFDGDADRVVFYYVDGKENKFH 299

Query: 304 LLDGDKMATLFAKFFQELLRDAGLQDELELGVVQTAYANGSSTAYIEQVLGISVTCTPTG 363
           LLDGDK+ATL AK   +LLRD GL D L+LGVVQTAYANGSST YI   L I V+CT TG
Sbjct: 300 LLDGDKIATLLAKLIADLLRDCGLSDTLKLGVVQTAYANGSSTKYITDKLKIPVSCTKTG 359

Query: 364 VKHLHHEAV-KYDIGVYFEANGHGTVVFSSKFLDVIDRKLSEKLESDAAQKSLKVLHLFA 422
           VKHLHHEAV +YDIG+YFEANGHGTV+FS +FL+ +D +L E   ++   KSL  L L +
Sbjct: 360 VKHLHHEAVSRYDIGIYFEANGHGTVIFSREFLETVDSRLQETSGNEQQYKSLLSLKLLS 419

Query: 423 KLINQTVGDAISDMLAVLAVLSILKWSPEKWDEEYTDLPNKLIKVLVPDRTVFKTKNAER 482
           +LINQTVGDAISDMLAV+A LSI    PE WD  Y DLPN+L KV+VPDR+VF + NAER
Sbjct: 420 QLINQTVGDAISDMLAVIATLSIFNLKPEDWDGCYQDLPNRLTKVIVPDRSVFVSTNAER 479

Query: 483 QLVSPAGVQEKIDALVATFSKGRSFVRASGTEDAVRVYAEAATPQETEALSQQVEKLL 540
           QL+SP G+Q KID LV  F   RSFVRASGTEDAVRVYAEA T +    L+ +V +L+
Sbjct: 480 QLLSPEGLQAKIDLLVTQFPNSRSFVRASGTEDAVRVYAEAETTESAIELATKVGELV 537

>Kpol_1032.2 s1032 complement(1049..2668) [1620 bp, 539 aa] {ON}
           complement(1049..2668) [1620 nt, 540 aa]
          Length = 539

 Score =  592 bits (1526), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/537 (56%), Positives = 380/537 (70%), Gaps = 12/537 (2%)

Query: 10  LYEAHCSTGFH-YAYGTAGFRYKADVLDTVMFTTGVVAGLRSIFLEGKTVGVMITASHNP 68
           L+E +C+T  H Y YGTAGFR  A +L+TVMFTTG+VA LRSI L GK VGVMITASHNP
Sbjct: 5   LFEKYCTTKDHKYVYGTAGFRDNASILNTVMFTTGIVACLRSISLGGKAVGVMITASHNP 64

Query: 69  PEDNGVKIVDPKGEMLEQSWEVYATDLAN-SASQGFSEFVASVERLMTKL--EVGSNDHG 125
           PEDNGVKIV+P G ML+QSWE  AT+LAN +A+  F +  A VE  + K   E GS    
Sbjct: 65  PEDNGVKIVEPNGAMLDQSWEPMATELANIAANSTFDDLKAYVEEKVKKFSPESGSKVQP 124

Query: 126 SIVVARDSRESGPRLLGAFLSGVKVLANVKVTDHGLLTTPQLHFLTSKSNELPKGTEIGK 185
            +VV RDSRESG  LL   L+  +   N K+ ++GLLTTPQLHFLT++ N + K   + +
Sbjct: 125 VVVVGRDSRESGSYLLECLLASAENYMNAKIINYGLLTTPQLHFLTNEIN-VKKSYAVQE 183

Query: 186 SLYYDNFLSAWVEIAELCKIDSL-PYKLEIDAANGIGAPVVTEMLSQHKFFKGAFAVVND 244
           S YY+ F+ +W +I  L  I  L    L ID ANGIG P + E+L    F      +VN+
Sbjct: 184 SSYYNYFIESWNKITALHNITDLYCSSLTIDTANGIGGPKIQELLKSWPF-ASKVTLVNN 242

Query: 245 EWETPDSLNHLCGADFVKTNQKLPHGIAPGGERNRICCSFDGDADRIVFYYCGKNGDFHL 304
           EWE PD LN  CGADFVKTNQKLP+G++     N + CS+DGDADRIVFY+  ++  FHL
Sbjct: 243 EWEKPDLLNKNCGADFVKTNQKLPNGVSGNSTENDLYCSYDGDADRIVFYFQDQDKQFHL 302

Query: 305 LDGDKMATLFAKFFQELLRDAGLQDELELGVVQTAYANGSSTAYIEQVLGISVTCTPTGV 364
           LDGDK++TLFAK   +LL DA L  ++ LGVVQTAYANGSST Y++  L + V+C  TGV
Sbjct: 303 LDGDKISTLFAKLIAKLLNDANLNSKISLGVVQTAYANGSSTNYLQGTLNVPVSCAKTGV 362

Query: 365 KHLHHEAV-KYDIGVYFEANGHGTVVFSSKFLDVIDRKLSEKLESDAAQKSLKVLHLFAK 423
           KHLHHEAV  YDIGVYFEANGHGT++FS  F  V +++L    ES A    + + H    
Sbjct: 363 KHLHHEAVTNYDIGVYFEANGHGTIIFSDHFYQVCEKELKANSESIAVNTLVALSH---- 418

Query: 424 LINQTVGDAISDMLAVLAVLSILKWSPEKWDEEYTDLPNKLIKVLVPDRTVFKTKNAERQ 483
           LINQTVGDAISDML VL+VLSI+K S ++WD EYTDLPN L KV+VPDR+VF T + ER+
Sbjct: 419 LINQTVGDAISDMLGVLSVLSIMKLSSQQWDNEYTDLPNLLTKVIVPDRSVFITTDQERK 478

Query: 484 LVSPAGVQEKIDALVATFSKGRSFVRASGTEDAVRVYAEAATPQETEALSQQVEKLL 540
           L+SP G+Q KID  ++ FS GRSFVRASGTEDAVRVYAEA++ +E + L+  V KL+
Sbjct: 479 LLSPEGLQSKIDKAISEFSNGRSFVRASGTEDAVRVYAEASSQEEAKELNALVTKLV 535

>TPHA0M00210 Chr13 complement(42336..43973) [1638 bp, 545 aa] {ON}
           Anc_6.11 YEL058W
          Length = 545

 Score =  585 bits (1509), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/539 (56%), Positives = 379/539 (70%), Gaps = 12/539 (2%)

Query: 7   LKSLYEAHCSTGFH-YAYGTAGFRYKADVLDTVMFTTGVVAGLRSIFLEGKTVGVMITAS 65
           L+S++E+ C+T  H Y YGTAGFR  A VLDTVM TTG++A LRSI L+GK VGVMITAS
Sbjct: 6   LESVFESCCTTRNHRYVYGTAGFRDDATVLDTVMVTTGLLACLRSIALDGKAVGVMITAS 65

Query: 66  HNPPEDNGVKIVDPKGEMLEQSWEVYATDLANSAS--QGFSEFVASVERLMTKLEVGSND 123
           HN P DNGVKIV+P G ML+QSWE +AT+LAN AS      EF   ++    + +V S  
Sbjct: 66  HNQPCDNGVKIVEPDGSMLDQSWEPFATELANKASFCHSTQEFKLYLQEKFAQYKVDSGI 125

Query: 124 HGSIVVARDSRESGPRLLGAFLSGVKVLANVKVTDHGLLTTPQLHFLTSKSNELPKGTEI 183
              +VV RDSR+SGPRLL    S    L   K+ D+GLLTTPQLHFLT+  N       +
Sbjct: 126 TPVLVVGRDSRDSGPRLLQCLNSLAVPLMKPKIIDYGLLTTPQLHFLTNAINTTKSRAPV 185

Query: 184 GKSLYYDNFLSAWVEIAELCKIDSLPY-KLEIDAANGIGAPVVTEMLSQHKFFKGAFAVV 242
            +  YY  F+ AWV I  L  I  L   +L IDAANGIG P V+++        G F +V
Sbjct: 186 TEDDYYSFFMDAWVSITALHGIKVLQSPRLYIDAANGIGGPKVSKLFEVWPQ-AGQFTLV 244

Query: 243 NDEWETPDSLNHLCGADFVKTNQKLPHGIAPGGERN--RICCSFDGDADRIVFYYCGKNG 300
           N+ W+TP  LN+ CGAD+VKTNQ+LP  I P  + +   + CSFDGDADRIVFYY     
Sbjct: 245 NNHWQTPTLLNNDCGADYVKTNQRLPKNIDPAADSDPATLYCSFDGDADRIVFYYQDAQN 304

Query: 301 DFHLLDGDKMATLFAKFFQELLRDAGLQDELELGVVQTAYANGSSTAYIEQVLGISVTCT 360
            FHLLDGDK++TLFA F  + L+ AGL +++ +GVVQTAYANG+ST Y+E VL I V+C 
Sbjct: 305 SFHLLDGDKISTLFALFISKQLKKAGLTEKISMGVVQTAYANGNSTNYLENVLNIPVSCA 364

Query: 361 PTGVKHLHHEAV-KYDIGVYFEANGHGTVVFSSKFLDVIDRKLSEKLESDAAQKSLKVLH 419
            TGVKHLHHEA+  YD+G+YFEANGHGT++FS+KF +  +  L E  ES      +K L 
Sbjct: 365 KTGVKHLHHEAITNYDVGIYFEANGHGTIMFSNKFFETCESLLKENNES----LEVKTLL 420

Query: 420 LFAKLINQTVGDAISDMLAVLAVLSILKWSPEKWDEEYTDLPNKLIKVLVPDRTVFKTKN 479
            FA LINQTVGDAISDML VLAVLSI+K +P  WD+EYTDLPN L KV+VPDR++F T +
Sbjct: 421 SFAHLINQTVGDAISDMLGVLAVLSIMKLTPSAWDKEYTDLPNLLTKVVVPDRSLFTTTD 480

Query: 480 AERQLVSPAGVQEKIDALVATFSKGRSFVRASGTEDAVRVYAEAATPQETEALSQQVEK 538
            ER+L++P G Q KIDA+VA +  GRSFVRASGTEDAVRVYAEA+TPQ+  AL+++V K
Sbjct: 481 QERKLLTPEGAQTKIDAIVAKYKNGRSFVRASGTEDAVRVYAEASTPQDAAALNEEVSK 539

>TDEL0G04600 Chr7 (838381..839967) [1587 bp, 528 aa] {ON} Anc_6.11
           YEL058W
          Length = 528

 Score =  573 bits (1476), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/537 (56%), Positives = 381/537 (70%), Gaps = 20/537 (3%)

Query: 7   LKSLYEAHCST-GFHYAYGTAGFRYKADVLDTVMFTTGVVAGLRSIFLEGKTVGVMITAS 65
           L+SL E +C+T G+ Y YGTAGFR  ++ LDTVMF TG+VA LRS  L GK VGVMITAS
Sbjct: 5   LESLIEQYCTTRGYRYVYGTAGFRDDSEKLDTVMFATGIVACLRSQVLNGKPVGVMITAS 64

Query: 66  HNPPEDNGVKIVDPKGEMLEQSWEVYATDLANS-ASQGFSEFVASVERLMTKLEVGSNDH 124
           HNP  DNGVK+V+P G ML QSWE  AT+LAN  A++   +  A V +L +     S+  
Sbjct: 65  HNPSGDNGVKVVEPDGSMLIQSWESTATELANLLANRPLEDIKAKVGQLTSG---ESSVR 121

Query: 125 GSIVVARDSRESGPRLLGAFLSGVKVLANVKVTDHGLLTTPQLHFLTSKSNELPKGTEIG 184
             ++V RDSR SGP LL   ++    L + K+TD+GLLTTPQLHFLT+++  +  G  + 
Sbjct: 122 PQLIVGRDSRVSGPHLLSCLVASATSLFDAKITDYGLLTTPQLHFLTNET--MITGAHVD 179

Query: 185 KSLYYDNFLSAWVEIAELCKIDSLPYKLEIDAANGIGAPVVTEMLSQHKFFKGAFAVVND 244
           +  Y+ +FL AW +IA L  +  LP  + +D ANGIG P ++ +L+Q  F K   +V+ND
Sbjct: 180 EQAYFAHFLGAWDQIAALQPV-KLP-NVVVDCANGIGGPKMSALLTQWGFAKQC-SVIND 236

Query: 245 EWETPDSLNHLCGADFVKTNQKLPHGIAPGGERNRICCSFDGDADRIVFYYCGKNGDFHL 304
           + + P+ LNH CGADFVKT+Q+LP+G+ P    N + CSFDGDADR+VFYY  +N  FHL
Sbjct: 237 KCDEPELLNHGCGADFVKTSQRLPNGVKPNA--NDLYCSFDGDADRVVFYYLDQNLGFHL 294

Query: 305 LDGDKMATLFAKFFQELLRDAGLQDELELGVVQTAYANGSSTAYIEQVLGISVTCTPTGV 364
           LDGDK++TLFA F  +LL+   L   L +GVVQTAYANGSST Y++  L + V+CT TGV
Sbjct: 295 LDGDKISTLFAYFVAKLLKQCKLDSILSMGVVQTAYANGSSTKYLQDNLQVPVSCTKTGV 354

Query: 365 KHLHHEAVK-YDIGVYFEANGHGTVVFSSKFLDVIDRKLSEKLESDAAQKSLKVLHLFAK 423
           KHLHHEAV  YDIG+YFEANGHGTV+FS+KF + +     +  E       LK+L   AK
Sbjct: 355 KHLHHEAVNNYDIGIYFEANGHGTVMFSNKFHETVTNHADQTPE-------LKILKYLAK 407

Query: 424 LINQTVGDAISDMLAVLAVLSILKWSPEKWDEEYTDLPNKLIKVLVPDRTVFKTKNAERQ 483
           LINQTVGDAISDM+AVLAVLSIL+WSP +WD E+TDLPNKL KV+V DR+ F T + ER+
Sbjct: 408 LINQTVGDAISDMMAVLAVLSILQWSPSRWDREFTDLPNKLTKVVVSDRSAFTTTDQERR 467

Query: 484 LVSPAGVQEKIDALVATFSKGRSFVRASGTEDAVRVYAEAATPQETEALSQQVEKLL 540
           LVSPAG+Q+KID  VA    GRSFVRASGTEDAVRVYAEAAT  E + LS  V  L+
Sbjct: 468 LVSPAGLQDKIDEAVARIKSGRSFVRASGTEDAVRVYAEAATQSEKDQLSSIVGDLV 524

>ZYRO0F00506g Chr6 complement(49579..51231) [1653 bp, 550 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 550

 Score =  573 bits (1476), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/558 (54%), Positives = 389/558 (69%), Gaps = 32/558 (5%)

Query: 1   MLDTKALKSLYEAHCS-TGFHYAYGTAGFRYKADVLDTVMFTTGVVAGLRSIFLEGKTVG 59
           ML    L  L + +CS +  HY YGTAGFR  A  LDTV+F TG++A LRS+ L+G  +G
Sbjct: 1   MLAVDTLTKLIDQYCSNSDRHYVYGTAGFRGPAATLDTVLFATGILACLRSLALKGDVIG 60

Query: 60  VMITASHNPPEDNGVKIVDPKGEMLEQSWEVYATDLANS-ASQGFSEFVASV------ER 112
           VM+TASHNPP DNGVK+V+P G M+ +SWE  AT+LAN+ A +G S   A          
Sbjct: 61  VMVTASHNPPVDNGVKVVEPDGSMMPESWEPLATELANTLAIKGSSHERAQATHSWLQRE 120

Query: 113 LMTKLEVGSNDHG-----SIVVARDSRESGPRLLGAFLSGVKVLANVKVTDHGLLTTPQL 167
           L  +L+  +N +      ++VV RDSRESGP+LL   ++  K L + K+ D GLLTTPQL
Sbjct: 121 LKGQLQSANNSYNEGIVPTLVVGRDSRESGPKLLSCLVASAKELFHAKIHDQGLLTTPQL 180

Query: 168 HFLTSKSNELPKGT-EIGKSLYYDNFLSAWVEIAELCKI-DSLPY--KLEIDAANGIGAP 223
           HFLTS   E  KG   + +S YY++FL AW  +A+L  I +SLP    L IDAANGIGAP
Sbjct: 181 HFLTS---ETAKGVANVTESRYYEHFLQAWDYVAQLHGIGESLPTISSLTIDAANGIGAP 237

Query: 224 VVTEMLSQHKFFKGAFAVVNDEWETPDSLNHLCGADFVKTNQKLPHGIAPGGERNRICCS 283
            V E+LSQ    +G    +ND+W  P+ LNH CGADFVK+NQ+ P G     +   + CS
Sbjct: 238 KVQELLSQWAC-RGQVHFINDKWTNPELLNHECGADFVKSNQRCPLGF---NDSTGLGCS 293

Query: 284 FDGDADRIVFYYCGKNGDFHLLDGDKMATLFAKFFQELLRDAGLQDELELGVVQTAYANG 343
           +DGDADR+VFYY  +  +F LLDGD+++ LFA FF  +L+ AGLQ EL LGVVQTAYANG
Sbjct: 294 YDGDADRVVFYYINEANEFCLLDGDRISGLFAHFFAGILKQAGLQSELSLGVVQTAYANG 353

Query: 344 SSTAYIEQVLGISVTCTPTGVKHLHHEAV-KYDIGVYFEANGHGTVVFSSKFLDVIDRKL 402
           +ST Y+++ L + V+C  TGVKHLHHEAV KYDIG+YFEANGHGT++FS KF  VI    
Sbjct: 354 NSTEYLQKTLQVPVSCAKTGVKHLHHEAVTKYDIGIYFEANGHGTIIFSPKFYKVI---- 409

Query: 403 SEKLESDAAQKSLKVLHLFAKLINQTVGDAISDMLAVLAVLSILKWSPEKWDEEYTDLPN 462
            E+ E   A ++L+    F++LINQTVGDAISDML VLA LSI KW+PE W +E+TDLPN
Sbjct: 410 KEQKERSVAVETLEA---FSRLINQTVGDAISDMLGVLAALSISKWTPEHWGQEFTDLPN 466

Query: 463 KLIKVLVPDRTVFKTKNAERQLVSPAGVQEKIDALVATFSKGRSFVRASGTEDAVRVYAE 522
           +L KV+VPDR+VF T + ER+L  P G+Q+KID  V  F +GRSFVRASGTEDAVRVYAE
Sbjct: 467 RLAKVVVPDRSVFITTDQERRLTKPEGLQQKIDEAVKCFQQGRSFVRASGTEDAVRVYAE 526

Query: 523 AATPQETEALSQQVEKLL 540
           AA+ ++ E LS  V++L+
Sbjct: 527 AASLEDVEKLSNTVKELV 544

>TBLA0G00980 Chr7 complement(248484..250160) [1677 bp, 558 aa] {ON}
           Anc_6.11 YEL058W
          Length = 558

 Score =  560 bits (1442), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/557 (53%), Positives = 387/557 (69%), Gaps = 34/557 (6%)

Query: 2   LDTKALKSLYEAHCSTGFH-YAYGTAGFRYKADVLDTVMFTTGVVAGLRSIFLEGKTVGV 60
           LD      L+   C T  H Y YGTAGFR KA +LDTVMFTTG VA LRS+  +GK VGV
Sbjct: 5   LDLSKTTDLFHKICKTKNHVYTYGTAGFRDKAAILDTVMFTTGFVACLRSLSHDGKAVGV 64

Query: 61  MITASHNPPEDNGVKIVDPKGEMLEQSWEVYATDLANSASQG-FSEFVASVERLMTKLEV 119
           M+TASHNPP DNGVKIV+P G ML Q WE  ATDLAN ASQG   E V  V   +  +E+
Sbjct: 65  MVTASHNPPVDNGVKIVEPNGSMLSQDWEPIATDLANLASQGKIDELVQFVNAKL--IEL 122

Query: 120 GSNDHGSIVVARDSRESGPRLLGAFLSGVKVLANVKVTDHGLLTTPQLHFLTSKSN---E 176
            SN   +++V RDSRES   LL     G   L + K+ D+ LLTTPQLHFLT+  N   +
Sbjct: 123 NSNKVPTLIVGRDSRESSTSLLECLKEGSLKLFDAKIVDYELLTTPQLHFLTNAYNLEKD 182

Query: 177 LPKGTEIGKSLYYDNFLSAWVEIAELCK--IDSLPYKLE---IDAANGIGAPVVTEMLSQ 231
           LPK T+     YY +F +AW ++  +      S   K+E   ID+ANGIG P +  +L  
Sbjct: 183 LPKETD-----YYHHFNNAWDQLISINNDASSSTSNKIESLIIDSANGIGGPKMENLL-- 235

Query: 232 HKFFKGAFAV--VNDEWETPDSLNHLCGADFVKTNQKLPHGIAPG----GERNRICCSFD 285
            K++K  + V  +N+ W+ P+SLN+ CGAD+VKTNQKLP+GI         +N I CSFD
Sbjct: 236 -KYWKTNYKVRLINNNWKRPESLNNNCGADYVKTNQKLPNGITTDIINESSKNVIHCSFD 294

Query: 286 GDADRIVFYYCG-KNGDFHLLDGDKMATLFAKFFQELLRDAGL--QDELELGVVQTAYAN 342
           GDADR+VFYY   ++  F+LLDGDK++TLFA F    L+ AG+  ++E++LGVVQTAYAN
Sbjct: 295 GDADRVVFYYQDPQSNTFNLLDGDKISTLFANFISMQLKLAGIDYENEIKLGVVQTAYAN 354

Query: 343 GSSTAYIEQVLGISVTCTPTGVKHLHHEA-VKYDIGVYFEANGHGTVVFSSKFLDVIDRK 401
           GSST Y++Q L I V C  TGVKHLHHEA  +YDIGVYFEANGHGT++FS  F  +I++K
Sbjct: 355 GSSTNYLQQNLKIPVACAKTGVKHLHHEACTRYDIGVYFEANGHGTIIFSENFYKIINQK 414

Query: 402 LS--EKLESDAAQKSLKVLHLFAKLINQTVGDAISDMLAVLAVLSILKWSPEKWDEEYTD 459
           ++   ++E+    ++LK L + + LINQTVGDAISDM+ V+AVL+IL W+P+ W++EYTD
Sbjct: 415 INAESQIENTPKLRALKTLKVLSALINQTVGDAISDMMGVMAVLAILNWTPQIWNKEYTD 474

Query: 460 LPNKLIKVLVPDRTVFKTKNAERQLVSPAGVQEKIDALVATFSKGRSFVRASGTEDAVRV 519
           LPNKL K++VPDR+VF+T + ER+L SPAG+Q KI+ +VA +  GRSFVRASGTEDAVRV
Sbjct: 475 LPNKLAKLVVPDRSVFETTDQERKLTSPAGLQSKINKIVAKYENGRSFVRASGTEDAVRV 534

Query: 520 YAEAATPQETEALSQQV 536
           YAEA+   +   L Q+V
Sbjct: 535 YAEAS--DDVNKLCQEV 549

>NCAS0F00200 Chr6 complement(30474..32123) [1650 bp, 549 aa] {ON}
           Anc_6.11 YEL058W
          Length = 549

 Score =  556 bits (1433), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/552 (53%), Positives = 377/552 (68%), Gaps = 24/552 (4%)

Query: 2   LDTKALKSLYEAHCST-GFHYAYGTAGFRYKADVLDTVMFTTGVVAGLRSIFLEGKTVGV 60
           +D   L+ +Y + C+T  + Y YGTAGFR KA  LDTVMF TG++A  RS+ L G  VGV
Sbjct: 3   IDKSVLQQVYNSTCTTRDYKYTYGTAGFRDKASKLDTVMFATGIIACWRSMVLCGTPVGV 62

Query: 61  MITASHNPPEDNGVKIVDPKGEMLEQSWEVYATDLAN-SASQGFS---EFVASVERLMTK 116
           M+TASHNPP DNGVK+V+P G ML Q WE   T LAN +A++ F    +F+  V +   K
Sbjct: 63  MVTASHNPPLDNGVKVVEPTGAMLIQEWEPLTTKLANIAANESFEKVYDFILEVSK-DPK 121

Query: 117 LEVGSNDHGSIVVARDSRESGPRLLGAFLSGVKVLANVKVTDHGLLTTPQLHFLTSKSN- 175
                N   S+++  DSRES PRL    ++    + N  + ++GL+TTPQLHF+TS  N 
Sbjct: 122 FPFQEN-KPSLIIGHDSRESSPRLTKLLVNTAVEIYNADIHNYGLVTTPQLHFITSLWNA 180

Query: 176 ELPKGTE--IGKSLYYDNFLSAWVEIAELCKIDSLPY--KLEIDAANGIGAPVVTEMLSQ 231
           +  K T   I    YY+ F ++W +  EL   +S      L ID+ANGIG P VT+++S 
Sbjct: 181 KYNKNTNDVISVDNYYNYFNASWSKFQELYDFNSFKSFENLIIDSANGIGGPKVTDLIST 240

Query: 232 H-KFFKGAFAVVNDEWETPDSLNHLCGADFVKTNQKLPHGIAPGGERNRICCSFDGDADR 290
                +G  +++N+ WE P+ LN+ CGAD+VKTNQKLP GI      N + CSFDGDADR
Sbjct: 241 WPSTLRGNVSIINNSWENPNLLNNDCGADYVKTNQKLPKGIQNPSNLN-LHCSFDGDADR 299

Query: 291 IVFYYCGK-NGDFHLLDGDKMATLFAKFFQELLRDAGLQDELELGVVQTAYANGSSTAYI 349
           IVFYY  + +  FHLLDGDK+ATLFAKF   LL++  L D+L+LGVVQTAYANGSST Y+
Sbjct: 300 IVFYYISEVDQKFHLLDGDKIATLFAKFLSNLLKETNLTDKLKLGVVQTAYANGSSTNYL 359

Query: 350 EQVLGISVTCTPTGVKHLHHEA-VKYDIGVYFEANGHGTVVFSSKFLDVIDRKLSEKLES 408
             VL + V+CT TGVKHLHHEA  KYDIG+YFEANGHGTV+FS +F  V        L++
Sbjct: 360 TNVLKVPVSCTKTGVKHLHHEASTKYDIGIYFEANGHGTVLFSERFQQV--------LQN 411

Query: 409 DAAQKSLKVLHLFAKLINQTVGDAISDMLAVLAVLSILKWSPEKWDEEYTDLPNKLIKVL 468
           +    + + L LF K+INQTVGDA++DML V+ VLS+ K +P +WD+ Y DLPNKL KV+
Sbjct: 412 EPKTTATQTLLLFQKIINQTVGDAMADMLGVITVLSVSKITPSQWDQGYKDLPNKLAKVI 471

Query: 469 VPDRTVFKTKNAERQLVSPAGVQEKIDALVATFSKGRSFVRASGTEDAVRVYAEAATPQE 528
           VPDR+VF T N ERQL SP G+QEKID  V+  + GRSFVRASGTEDAVRVYAEAAT +E
Sbjct: 472 VPDRSVFITTNQERQLTSPVGLQEKIDVAVSKVTNGRSFVRASGTEDAVRVYAEAATQEE 531

Query: 529 TEALSQQVEKLL 540
           TE LSQ+V K +
Sbjct: 532 TEKLSQEVCKFV 543

>CAGL0B03597g Chr2 complement(359018..360640) [1623 bp, 540 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058w PCM1 phosphoacetylglucosamine mutase
          Length = 540

 Score =  555 bits (1431), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/544 (55%), Positives = 365/544 (67%), Gaps = 27/544 (4%)

Query: 10  LYEAHCST-GFHYAYGTAGFRYKADVLDTVMFTTGVVAGLRSIFLEGKTVGVMITASHNP 68
           LY  +C T   HY YGTAGFR  A +LD+VMFTTGV+A LRSI  +   VGVMITASHNP
Sbjct: 5   LYNKNCITRDQHYTYGTAGFRADARILDSVMFTTGVIAALRSISCQCAPVGVMITASHNP 64

Query: 69  PEDNGVKIVDPKGEMLEQSWEVYATDLANSASQGFSEFVASVERLMTKLEVGSNDHGSIV 128
           P DNGVKIV+  G ML Q WE  AT LANS +  +  F +++  +M +L +       IV
Sbjct: 65  PRDNGVKIVESDGSMLLQDWEPLATRLANSVAD-YHTFESTLNAIMQELNISPGHAPQIV 123

Query: 129 VARDSRESGPRLLGAFLSGVKVLA-NVKVTDHGLLTTPQLHFLTSKSNELPKGTEIGKSL 187
           V  DSRES PRLL   L G+K ++ + ++T+HGLLTTPQLHFLT+            +  
Sbjct: 124 VGHDSRESSPRLLANLLDGIKAVSPDARITNHGLLTTPQLHFLTANPAHF-------EDY 176

Query: 188 YYDNFLSAWVEIAELCKIDSLPY--KLEIDAANGIGAPVVTEMLSQ--------HKFFKG 237
           YY  FL AW ++ EL  I+      KL ID ANGIG P   +MLS          K    
Sbjct: 177 YYRYFLDAWNQLFELYGIEGFKSFDKLVIDTANGIGGPQFLKMLSYSQTDLPHLQKIRLH 236

Query: 238 AFAVVNDEWETPDSLNHLCGADFVKTNQKLPHGIAPGGERNRICCSFDGDADRIVFYYCG 297
              + N+ W  P  LN  CGADFVKTNQ+LP GI    +   + CSFDGDADR+VFYY  
Sbjct: 237 QIDITNNSWLNPSMLNSGCGADFVKTNQRLPEGI--NADPRNLYCSFDGDADRVVFYYVD 294

Query: 298 KNGDFHLLDGDKMATLFAKFFQELLRDAGLQDELELGVVQTAYANGSSTAYIEQVLGISV 357
            +  FHLLDGDK++TL A F   LL++AGL +EL+LGVVQTAYANGSST Y+ + L + V
Sbjct: 295 DSLTFHLLDGDKISTLLAYFINALLKEAGLAEELKLGVVQTAYANGSSTTYVTKKLQVPV 354

Query: 358 TCTPTGVKHLHHEAV-KYDIGVYFEANGHGTVVFSSKFLDVIDRKLSEKLESDAAQKSLK 416
           +   TGVKHLHHEAV  YDIGVYFEANGHGTV+FS  F +VI+    ++L  +A  KS  
Sbjct: 355 SIAKTGVKHLHHEAVTNYDIGVYFEANGHGTVIFSQHFYEVIE----DRLAKNAHDKSTL 410

Query: 417 VLHLFAKLINQTVGDAISDMLAVLAVLSILKWSPEKWDEEYTDLPNKLIKVLVPDRTVFK 476
            L L ++LINQT+GDAISDMLA++ VL IL WSP  WD EYTDLPNKL KV+VPDR++F 
Sbjct: 411 TLRLLSRLINQTIGDAISDMLAIITVLGILGWSPATWDHEYTDLPNKLTKVVVPDRSIFI 470

Query: 477 TKNAERQLVSPAGVQEKIDALVATFSKGRSFVRASGTEDAVRVYAEAATPQETEALSQQV 536
           T + ER+LVSPAG+Q+KID LVA    GRSF+RASGTEDAVRVYAEA T + TE LS +V
Sbjct: 471 TTDQERRLVSPAGLQDKIDMLVADAPCGRSFIRASGTEDAVRVYAEAQTVEATEKLSTEV 530

Query: 537 EKLL 540
              L
Sbjct: 531 TDAL 534

>Suva_5.10 Chr5 (19280..20941) [1662 bp, 553 aa] {ON} YEL058W (REAL)
          Length = 553

 Score =  548 bits (1412), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/550 (52%), Positives = 376/550 (68%), Gaps = 22/550 (4%)

Query: 2   LDTKALKSLYEAHCST-GFHYAYGTAGFRYKADVLDTVMFTTGVVAGLRSIFLEGKTVGV 60
           +D   L+ LYE  C T    Y+YGTAGFR  A  LDTVMFTTG++A LRS+ L+G+ VGV
Sbjct: 3   IDYDQLRKLYEETCCTKNLQYSYGTAGFRTLAKDLDTVMFTTGILAVLRSLKLQGQYVGV 62

Query: 61  MITASHNPPEDNGVKIVDPKGEMLEQSWEVYATDLANSAS--QGFSEFVASVERLMTKLE 118
           MITASHNP +DNGVKIV+P G ML  +WE YA  LAN+AS    F EF A + +L+   +
Sbjct: 63  MITASHNPYQDNGVKIVEPDGSMLLAAWEPYAMQLANAASFAATFDEFYAELVKLIEHEK 122

Query: 119 VGSNDHGSIVVARDSRESGPRLLGAFLSGVKVLANVKVTDHGLLTTPQLHFLTSKSNELP 178
           +  +    +VV RDSRES P LL    S +  + +  V D G +TTPQLH++T+ SN+  
Sbjct: 123 IDLDAAPHVVVGRDSRESSPFLLRCLTSTMASVFHAHVVDLGCVTTPQLHYVTNLSNK-- 180

Query: 179 KGTEIGKSL------YYDNFLSAWVEIAELCKID---SLPYKLEIDAANGIGAPVVTEML 229
           +  E G +       YY  F++A+ E+   C+I+   S+P KL +D ANGIG P + ++L
Sbjct: 181 RQREGGSAQVATEQDYYSFFINAFNELFTTCQIEKRLSVP-KLFVDTANGIGGPQLKKLL 239

Query: 230 SQHKFF--KGAFAVVNDEWETPDSLNHLCGADFVKTNQKLPHGIAPGGERNRICCSFDGD 287
           +   +        +VND+ + P  LN  CGAD+VKTNQ+LP G++P    + + CSFDGD
Sbjct: 240 ASKDWAVPSDEIEIVNDKSDVPKLLNFECGADYVKTNQRLPKGLSPSSP-DSLYCSFDGD 298

Query: 288 ADRIVFYYCGKNGDFHLLDGDKMATLFAKFFQELLRDAGLQDELELGVVQTAYANGSSTA 347
           ADR+VFYY      FHLLDGDK++TLFAKF  + L  A L D L++GVVQTAYANGSST+
Sbjct: 299 ADRVVFYYVDPESKFHLLDGDKISTLFAKFLSKQLELANLTDSLKIGVVQTAYANGSSTS 358

Query: 348 YIEQVLGISVTCTPTGVKHLHHEA-VKYDIGVYFEANGHGTVVFSSKFLDVIDRKLSEKL 406
           YI+  L   V+CT TGVKHLHHEA  +YDIG+YFEANGHGT++FS KF   I+ +LS   
Sbjct: 359 YIKDTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSKKFHQTIESELSR-- 416

Query: 407 ESDAAQKSLKVLHLFAKLINQTVGDAISDMLAVLAVLSILKWSPEKWDEEYTDLPNKLIK 466
            +  +  +L  L  FA LINQTVGDAISDMLAVLA LSIL  +P  WD+EYTDLPNKL+K
Sbjct: 417 -AQGSLLALNTLRCFANLINQTVGDAISDMLAVLATLSILHMAPTDWDKEYTDLPNKLVK 475

Query: 467 VLVPDRTVFKTKNAERQLVSPAGVQEKIDALVATFSKGRSFVRASGTEDAVRVYAEAATP 526
            +VPDR++F+T + ER+L +PAG+Q KID+++  ++ GRSFVRASGTEDAVRVYAE   P
Sbjct: 476 CIVPDRSIFQTTDQERKLQNPAGLQTKIDSVIGKYAMGRSFVRASGTEDAVRVYAECQDP 535

Query: 527 QETEALSQQV 536
            + +    +V
Sbjct: 536 TKLDQFCNEV 545

>Smik_5.29 Chr5 (45538..47205) [1668 bp, 555 aa] {ON} YEL058W (REAL)
          Length = 555

 Score =  542 bits (1396), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/554 (51%), Positives = 378/554 (68%), Gaps = 20/554 (3%)

Query: 2   LDTKALKSLYEAHCST-GFHYAYGTAGFRYKADVLDTVMFTTGVVAGLRSIFLEGKTVGV 60
           +D + L  LY+  C T    Y+YGTAGFR  A  LDTVMFTTG++A LRS+ L+G+ VGV
Sbjct: 3   IDYEQLSELYDKTCRTKNVQYSYGTAGFRTLAKNLDTVMFTTGILAILRSLKLQGQYVGV 62

Query: 61  MITASHNPPEDNGVKIVDPKGEMLEQSWEVYATDLANSAS--QGFSEFVASVERLMTKLE 118
           MITASHNP +DNGVKIV+P G ML  +WE YA  LAN+AS    F EF A + RL+   +
Sbjct: 63  MITASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANTASFASNFEEFRAELTRLIEHEK 122

Query: 119 VGSNDH--GSIVVARDSRESGPRLLGAFLSGVKVLANVKVTDHGLLTTPQLHFLTSKSNE 176
           +G +      IVV RDSRES P LL    S +  + + +V D G +TTPQLH++T  SN+
Sbjct: 123 IGLDTSIVPHIVVGRDSRESSPYLLRCLTSTMVSVFHAQVLDLGCVTTPQLHYITDLSNK 182

Query: 177 LPK---GTEIG-KSLYYDNFLSAWVEIAELCKID---SLPYKLEIDAANGIGAPVVTEML 229
             +     E+  +  YY  F+ A+ E+    +I+   S+P +L IDAANGIG P + ++L
Sbjct: 183 REREGGSAEVATEQDYYSFFIGAFNELFSTYEIEKRLSVP-RLFIDAANGIGGPQLKKLL 241

Query: 230 SQHKFF--KGAFAVVNDEWETPDSLNHLCGADFVKTNQKLPHGIAPGGERNRICCSFDGD 287
           +   +        V+ND+ + P+ LN  CGAD+VKTNQ+LP G++P    + + CSFDGD
Sbjct: 242 TSKDWVVPPDQIEVINDKSDVPELLNFECGADYVKTNQRLPKGLSPSS-HDSLYCSFDGD 300

Query: 288 ADRIVFYYCGKNGDFHLLDGDKMATLFAKFFQELLRDAGLQDELELGVVQTAYANGSSTA 347
           ADR+VFYY      FHLLDGDK++TLFAKF  + L  A L++ L +GVVQTAYANGSST 
Sbjct: 301 ADRVVFYYVDSESQFHLLDGDKISTLFAKFLSKQLELAHLENSLRIGVVQTAYANGSSTN 360

Query: 348 YIEQVLGISVTCTPTGVKHLHHEA-VKYDIGVYFEANGHGTVVFSSKFLDVIDRKLSEKL 406
           YIE  L   V+CT TGVKHLHHEA  +YDIG+YFEANGHGT++FS KF  VI  +LS   
Sbjct: 361 YIENTLRCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQVIKSELSR-- 418

Query: 407 ESDAAQKSLKVLHLFAKLINQTVGDAISDMLAVLAVLSILKWSPEKWDEEYTDLPNKLIK 466
            +     +LK L  F+KLINQTVGDA+SDMLAVLA L+I+K +P  WD+EYTDLPNKL+K
Sbjct: 419 -ARGDMLALKTLDCFSKLINQTVGDALSDMLAVLATLAIMKMAPMDWDKEYTDLPNKLVK 477

Query: 467 VLVPDRTVFKTKNAERQLVSPAGVQEKIDALVATFSKGRSFVRASGTEDAVRVYAEAATP 526
            +VPDR++F+T + ER+L +P G+Q KID ++A +  GRSFVRASGTEDAVR+YAE    
Sbjct: 478 CIVPDRSIFQTIDQERKLQNPVGLQAKIDLVIAKYPMGRSFVRASGTEDAVRIYAECQDS 537

Query: 527 QETEALSQQVEKLL 540
            + +    ++ +L+
Sbjct: 538 SQLDQFCNEIVELV 551

>Skud_5.31 Chr5 (42262..43935) [1674 bp, 557 aa] {ON} YEL058W (REAL)
          Length = 557

 Score =  541 bits (1393), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/553 (53%), Positives = 377/553 (68%), Gaps = 31/553 (5%)

Query: 2   LDTKALKSLYEAHCST-GFHYAYGTAGFRYKADVLDTVMFTTGVVAGLRSIFLEGKTVGV 60
           +D + L+ LY+  C T    Y+YGTAGFR  A  LDTVMFTTG++A LRS+ L+G+ VGV
Sbjct: 3   IDYEQLRKLYDETCRTKNVQYSYGTAGFRTLAKDLDTVMFTTGILAVLRSLKLQGQYVGV 62

Query: 61  MITASHNPPEDNGVKIVDPKGEMLEQSWEVYATDLANSAS--QGFSEFVASVERL--MTK 116
           MITASHNP +DNGVKIV+P G ML  SWE YA  LAN+AS    F EF A + +L  + K
Sbjct: 63  MITASHNPYQDNGVKIVEPDGSMLLASWEPYAMQLANAASFATHFEEFYAELVKLIELEK 122

Query: 117 LEVG-SNDHGSIVVARDSRESGPRLLGAFLSGVKVLANVKVTDHGLLTTPQLHFLTSKSN 175
           +++G SN    IVV RDSRES P LL    S +  + + +V D G +TTPQLH++T  SN
Sbjct: 123 IDLGASNVAPHIVVGRDSRESSPYLLRCLTSTMASVFHARVLDLGCVTTPQLHYITDLSN 182

Query: 176 E--------LPKGTEIGKSLYYDNFLSAWVEI---AELCKIDSLPYKLEIDAANGIGAPV 224
                    L   TE     YY  F+ A+ E+    ++ K  S+P KL ID ANGIG P 
Sbjct: 183 RREREGDSALAAATEQD---YYSFFIGAFNELFTTYDMEKRLSVP-KLFIDTANGIGGPQ 238

Query: 225 VTEMLSQHKFF--KGAFAVVNDEWETPDSLNHLCGADFVKTNQKLPHGIAPGGERNRICC 282
           + ++L+   +        ++ND+ + P  LN  CGAD+VKTNQ+LP G++P    + + C
Sbjct: 239 LKKLLASKDWVVPSDQIEIINDKSDVPKLLNSECGADYVKTNQRLPKGLSPSSFES-LYC 297

Query: 283 SFDGDADRIVFYYCGKNGDFHLLDGDKMATLFAKFFQELLRDAGLQDELELGVVQTAYAN 342
           SFDGDADR+VFYY      FHLLDGDK++TLFAKF  + L  A L+  L++GVVQTAYAN
Sbjct: 298 SFDGDADRVVFYYVDSELKFHLLDGDKISTLFAKFLSKQLEMANLERSLKIGVVQTAYAN 357

Query: 343 GSSTAYIEQVLGISVTCTPTGVKHLHHEA-VKYDIGVYFEANGHGTVVFSSKFLDVIDRK 401
           GSSTAYI+  L   V+CT TGVKHLHHEA  +YDIG+YFEANGHGT++FS KF   I+ +
Sbjct: 358 GSSTAYIKDTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQTIESE 417

Query: 402 LSEKLESDAAQKSLKVLHLFAKLINQTVGDAISDMLAVLAVLSILKWSPEKWDEEYTDLP 461
           LS+    +    +LK L  FAKLINQTVGDA+SDMLAVLA L+ILK +P  WDEEY DLP
Sbjct: 418 LSK---PNGHTLALKTLSCFAKLINQTVGDAMSDMLAVLATLAILKMAPMNWDEEYKDLP 474

Query: 462 NKLIKVLVPDRTVFKTKNAERQLVSPAGVQEKIDALVATFSKGRSFVRASGTEDAVRVYA 521
           NKL+K +VPDR++F+T + ER+L +P G+Q KID+++A +  GRSFVRASGTEDAVRVYA
Sbjct: 475 NKLVKCIVPDRSIFQTTDQERKLQNPVGLQSKIDSVIAKYPMGRSFVRASGTEDAVRVYA 534

Query: 522 EAATPQETEALSQ 534
           E    Q+   L Q
Sbjct: 535 EC---QDMSKLDQ 544

>KAFR0L00340 Chr12 complement(62157..63779) [1623 bp, 540 aa] {ON}
           Anc_6.11 YEL058W
          Length = 540

 Score =  538 bits (1386), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/544 (51%), Positives = 366/544 (67%), Gaps = 11/544 (2%)

Query: 1   MLDTKALKSLYEAHCSTGFH-YAYGTAGFRYKADVLDTVMFTTGVVAGLRSIFLEGKTVG 59
           M D   L+  +  +C+T  H Y YGTAGFR  A  LDTVMFTTG+VA LRS+ L+GK +G
Sbjct: 1   MFDITQLEPAFIKYCTTRNHSYTYGTAGFRANASTLDTVMFTTGIVAILRSLVLQGKYIG 60

Query: 60  VMITASHNPPEDNGVKIVDPKGEMLEQSWEVYATDLANSASQG-FSEFVASVERLMTKLE 118
           VMITASHNPP+DNGVKIV+P G ML +SWE  ATDLAN AS G F+ FV  + +++ KL 
Sbjct: 61  VMITASHNPPQDNGVKIVEPSGAMLIESWEQIATDLANIASHGNFTAFVMHLSQVIAKLN 120

Query: 119 VGSNDHGSIVVARDSRESGPRLLGAFLSGVKVLANVKVTDHGLLTTPQLHFLTSKSNELP 178
           +       ++V  DSRES P L+    +   V   + V +H L+TTPQLH+LT   N++ 
Sbjct: 121 IDETTTPRLIVGHDSRESSPYLMECLQAAAPVFDTI-VINHTLITTPQLHYLTMLQNDVV 179

Query: 179 KGTEIGKSLYYDNFLSAWVEIAELCKIDSLPYK-LEIDAANGIGAPVVTEMLSQHKFFKG 237
             TE+    YY  F ++W  +  L    +L +  L +D ANG+G+   ++ L        
Sbjct: 180 --TEVD---YYKFFSTSWNNLFSLYPDLNLTFNNLIVDGANGVGSVQFSKFLPYLPQLAT 234

Query: 238 AFAVVNDEWETPDSLNHLCGADFVKTNQKLPHGIAPGGERNRICCSFDGDADRIVFYYCG 297
              ++ND+   P  LN  CGADFVKTNQKLP+GI      + +  SFDGDADRIVFYY  
Sbjct: 235 LTTIINDKHNVPQMLNVDCGADFVKTNQKLPNGIVNPNPSD-LYASFDGDADRIVFYYVD 293

Query: 298 KNGDFHLLDGDKMATLFAKFFQELLRDAGLQDELELGVVQTAYANGSSTAYIEQVLGISV 357
            N  FHLLDGDK++T+  K    +LR++ L +++ LGVVQTAYANGSST YI + L + V
Sbjct: 294 NNKKFHLLDGDKISTILTKCLISMLRESELLNDINLGVVQTAYANGSSTKYITKSLKVPV 353

Query: 358 TCTPTGVKHLHHEA-VKYDIGVYFEANGHGTVVFSSKFLDVIDRKLSEKLESDAAQKSLK 416
            CT TGVKHLHH A  K+DIG+YFEANGHGTV+FS+KF +V+ + +     S+   K+  
Sbjct: 354 ECTKTGVKHLHHIAESKFDIGIYFEANGHGTVLFSNKFYEVLQKAIDNGSSSEKIHKARL 413

Query: 417 VLHLFAKLINQTVGDAISDMLAVLAVLSILKWSPEKWDEEYTDLPNKLIKVLVPDRTVFK 476
            L  F+KLINQTVGD+++D+LAV+A LSIL+ SP  WD EY DLPN L K  V +R VFK
Sbjct: 414 SLFYFSKLINQTVGDSMADLLAVIATLSILQLSPSDWDTEYQDLPNLLTKCTVLNRFVFK 473

Query: 477 TKNAERQLVSPAGVQEKIDALVATFSKGRSFVRASGTEDAVRVYAEAATPQETEALSQQV 536
           T + ER+L SP+G+QEKIDA V+ +  GRSFVRASGTEDAVR+YAEA T  E EALS++V
Sbjct: 474 TTDMERKLTSPSGLQEKIDAAVSKYDSGRSFVRASGTEDAVRIYAEAKTKAEVEALSKEV 533

Query: 537 EKLL 540
            +L+
Sbjct: 534 TQLV 537

>NDAI0K02890 Chr11 (655311..656996) [1686 bp, 561 aa] {ON} Anc_6.11
           YEL058W
          Length = 561

 Score =  538 bits (1386), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/551 (53%), Positives = 376/551 (68%), Gaps = 25/551 (4%)

Query: 7   LKSLYEAHCST-GFHYAYGTAGFRYKADVLDTVMFTTGVVAGLRSIFLEGKT----VGVM 61
           LKS +   C T  +HY YGTAGFR  A  LDTVMFTTG+VA LRS+ L+       +GVM
Sbjct: 12  LKSCFNEICQTKNYHYTYGTAGFRDNAKRLDTVMFTTGIVACLRSLTLQTSNKHSAIGVM 71

Query: 62  ITASHNPPEDNGVKIVDPKGEMLEQSWEVYATDLAN-SASQGFSEFVASVERLMTKLEVG 120
           +TASHNPPEDNGVKI++P G ML Q WE  AT  AN +A++ F EF   +   +  LE  
Sbjct: 72  VTASHNPPEDNGVKIIEPNGSMLLQEWEPKATQFANIAANESFDEFYQLLIDSIVTLEND 131

Query: 121 SN--DHGSIVVARDSRESGPRLLGAFLSGVKVLANVKVTDHGLLTTPQLHFLTSKSNELP 178
            N     ++++  DSR+S P L+   +    ++ N K+ ++  +TTPQLHFLT+ +N   
Sbjct: 132 LNIKQPPTLILGHDSRDSSPTLMNHIIKSATLIFNAKIINYNYVTTPQLHFLTNLTNTTG 191

Query: 179 KGTEIGKSLYYDNFLSAWVEIAELCKIDSLPY-KLEIDAANGIGAPVVTEML-SQHKF-- 234
              EI    YYD+F     ++  L    +LP+  L IDAANGIGAP V ++L +++KF  
Sbjct: 192 TAEEIN---YYDHFNKYLSQLQSLYPPFNLPFDNLIIDAANGIGAPQVEKLLFTKNKFPP 248

Query: 235 --FKGAFAVVNDEWETPDSLNHLCGADFVKTNQKLPHGIAPGGERNR-ICCSFDGDADRI 291
              K    ++N++ + P+ LN  CGAD+VKTNQKLP GI    + N  + CS+DGDADRI
Sbjct: 249 LNIKNPIKIINNDSKNPNLLNMNCGADYVKTNQKLPQGIPKDIDANSTLFCSYDGDADRI 308

Query: 292 VFYYCGK-NGDFHLLDGDKMATLFAKFFQELLRDAGLQDELELGVVQTAYANGSSTAYIE 350
           VFYY      +F+LLDGDK+ATLFAKFF  LL  A L   L+LGVVQTAYANGSST YI 
Sbjct: 309 VFYYIDPMTNNFNLLDGDKIATLFAKFFSNLLTIAKLNHILKLGVVQTAYANGSSTNYIS 368

Query: 351 QVLGISVTCTPTGVKHLHHEAV-KYDIGVYFEANGHGTVVFSSKFLDVIDRKLSEKLESD 409
             L + V+CT TGVKHLHHEA+ KYDIG+YFEANGHGTV+FS KF   +      KL+  
Sbjct: 369 SKLKVPVSCTKTGVKHLHHEAITKYDIGIYFEANGHGTVIFSDKFHSEL-----TKLKES 423

Query: 410 AAQKSLKVLHLFAKLINQTVGDAISDMLAVLAVLSILKWSPEKWDEEYTDLPNKLIKVLV 469
            + + +K L LF++LINQTVGDA+SDMLAV+AVLSIL+ SP  WD+EY DLPNKL KV+V
Sbjct: 424 GSSREIKTLLLFSELINQTVGDAMSDMLAVIAVLSILQLSPNSWDKEYKDLPNKLAKVIV 483

Query: 470 PDRTVFKTKNAERQLVSPAGVQEKIDALVATFSKGRSFVRASGTEDAVRVYAEAATPQET 529
           PDR+ F T + ER+LV P G+Q  ++  VA+ S GRSFVRASGTEDAVRVYAEA T +ET
Sbjct: 484 PDRSKFITTDQERKLVEPKGLQPLLEEAVASVSLGRSFVRASGTEDAVRVYAEAKTQEET 543

Query: 530 EALSQQVEKLL 540
           E LS++V +L+
Sbjct: 544 EWLSKKVCQLV 554

>YEL058W Chr5 (43252..44925) [1674 bp, 557 aa] {ON}  PCM1Essential
           N-acetylglucosamine-phosphate mutase; converts
           GlcNAc-6-P to GlcNAc-1-P, which is a precursor for the
           biosynthesis of chitin and for the formation of
           N-glycosylated mannoproteins and
           glycosylphosphatidylinositol anchors
          Length = 557

 Score =  537 bits (1384), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/541 (53%), Positives = 373/541 (68%), Gaps = 26/541 (4%)

Query: 2   LDTKALKSLYEAHCST-GFHYAYGTAGFRYKADVLDTVMFTTGVVAGLRSIFLEGKTVGV 60
           +D + L  LY+  C T    ++YGTAGFR  A  LDTVMF+TG++A LRS+ L+G+ VGV
Sbjct: 3   VDYEQLCKLYDDTCRTKNVQFSYGTAGFRTLAKNLDTVMFSTGILAVLRSLKLQGQYVGV 62

Query: 61  MITASHNPPEDNGVKIVDPKGEMLEQSWEVYATDLANSAS--QGFSEFVASVERLMT--K 116
           MITASHNP +DNGVKIV+P G ML  +WE YA  LAN+AS    F EF   + +L+   K
Sbjct: 63  MITASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANAASFATNFEEFRVELAKLIEHEK 122

Query: 117 LEVGSNDHGSIVVARDSRESGPRLLGAFLSGVKVLANVKVTDHGLLTTPQLHFLTSKSNE 176
           +++ +     IVV RDSRES P LL    S +  + + +V D G +TTPQLH++T  SN 
Sbjct: 123 IDLNTTVVPHIVVGRDSRESSPYLLRCLTSSMASVFHAQVLDLGCVTTPQLHYITDLSNR 182

Query: 177 -------LPKGTEIGKSLYYDNFLSAWVEI---AELCKIDSLPYKLEIDAANGIGAPVVT 226
                   P  TE     YY  F+ A+ E+    +L K  S+P KL ID ANGIG P + 
Sbjct: 183 RKLEGDTAPVATEQD---YYSFFIGAFNELFATYQLEKRLSVP-KLFIDTANGIGGPQLK 238

Query: 227 EMLSQHKFFKGA--FAVVNDEWETPDSLNHLCGADFVKTNQKLPHGIAPGGERNRICCSF 284
           ++L+   +   A    V+ND  + P+ LN  CGAD+VKTNQ+LP G++P    + + CSF
Sbjct: 239 KLLASEDWDVPAEQVEVINDRSDVPELLNFECGADYVKTNQRLPKGLSPSS-FDSLYCSF 297

Query: 285 DGDADRIVFYYCGKNGDFHLLDGDKMATLFAKFFQELLRDAGLQDELELGVVQTAYANGS 344
           DGDADR+VFYY      FHLLDGDK++TLFAKF  + L  A L+  L++GVVQTAYANGS
Sbjct: 298 DGDADRVVFYYVDSGSKFHLLDGDKISTLFAKFLSKQLELAHLEHSLKIGVVQTAYANGS 357

Query: 345 STAYIEQVLGISVTCTPTGVKHLHHEA-VKYDIGVYFEANGHGTVVFSSKFLDVIDRKLS 403
           STAYI+  L   V+CT TGVKHLHHEA  +YDIG+YFEANGHGT++FS KF   I  +LS
Sbjct: 358 STAYIKNTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHRTIKSELS 417

Query: 404 E-KLESDAAQKSLKVLHLFAKLINQTVGDAISDMLAVLAVLSILKWSPEKWDEEYTDLPN 462
           + KL  D    +L+ L  F++LINQTVGDAISDMLAVLA L+ILK SP  WDEEYTDLPN
Sbjct: 418 KSKLNGDTL--ALRTLKCFSELINQTVGDAISDMLAVLATLAILKMSPMDWDEEYTDLPN 475

Query: 463 KLIKVLVPDRTVFKTKNAERQLVSPAGVQEKIDALVATFSKGRSFVRASGTEDAVRVYAE 522
           KL+K +VPDR++F+T + ER+L++P G+Q+KID +VA +  GRSFVRASGTEDAVRVYAE
Sbjct: 476 KLVKCIVPDRSIFQTTDQERKLLNPVGLQDKIDLVVAKYPMGRSFVRASGTEDAVRVYAE 535

Query: 523 A 523
            
Sbjct: 536 C 536

>KNAG0E00940 Chr5 (176887..178503) [1617 bp, 538 aa] {ON} Anc_6.11
           YEL058W
          Length = 538

 Score =  510 bits (1314), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 286/551 (51%), Positives = 366/551 (66%), Gaps = 37/551 (6%)

Query: 2   LDTKALKSLYEAHCST-GFHYAYGTAGFRYKADVLDTVMFTTGVVAGLRSIFLEGKTVGV 60
           +  +A++++++A C+T G+ Y YGTAGFR KA VLDTVMF TG VA LRS  L G  VGV
Sbjct: 1   MSREAVRAVFDAVCTTKGYTYTYGTAGFRDKAAVLDTVMFATGCVAVLRSWRLNGAQVGV 60

Query: 61  MITASHNPPEDNGVKIVDPKGEMLEQSWEVYATDLANSASQGFSEFVASVERLMTKLEVG 120
           M+TASHNPPEDNGVK+VDP+G ML + WE  AT LAN A+ G   F    E   + +E G
Sbjct: 61  MVTASHNPPEDNGVKVVDPEGGMLPEQWEPLATRLANLAANG--TFDQWWEYWTSLVEEG 118

Query: 121 SNDHGS-IVVARDSRESGPRLLGAFLSGVKVLA--NVKVTDHGLLTTPQLHFLTSKSNEL 177
           +   G+ + V  D+RES PRLL   +     ++  ++ ++   +   PQLH+LTS    L
Sbjct: 119 NYTGGARLCVGHDTRESSPRLLKNLMDAALAVSGGSITISKPWITNHPQLHYLTS----L 174

Query: 178 PKGTEIGKSLYYDNFLSAWVEIAELCKIDSLPY-KLEIDAANGIGAPVVTEMLSQHKFFK 236
            +      + Y D+F   W ++     + + P+ +L ID ANG+GA      +   +FFK
Sbjct: 175 QRDGVTDAAAYNDHFQGCWQKLFPDGVV-AWPFDRLFIDTANGVGA------VQLQQFFK 227

Query: 237 G------AFAVVNDEWETPDSLNHLCGADFVKTNQKLPHGI----APGGERNRICCSFDG 286
           G       F ++N ++ TP++LN  CGADFVKTN +LP  +       G    + CSFDG
Sbjct: 228 GWAVDQNKFRLLNTDYGTPENLNVKCGADFVKTNHRLPSEVPDQRGTSGALPDLYCSFDG 287

Query: 287 DADRIVFYYCGKNGDFHLLDGDKMATLFAKFFQELLRDAGLQDELELGVVQTAYANGSST 346
           DADRIVFY+  KN  FHLLDGDK++TLFAKF  +L   AG  D+L +GVVQTAYANG+ST
Sbjct: 288 DADRIVFYFV-KNKQFHLLDGDKISTLFAKFIGQLTARAGADDKLTVGVVQTAYANGNST 346

Query: 347 AYIEQVLGISVTCTPTGVKHLHHEA-VKYDIGVYFEANGHGTVVFSSKFLDVIDRKLSEK 405
            YI   LGI   CT TGVKHLHH A  +YDIG+YFEANGHGTVVFS KF +V+    S  
Sbjct: 347 RYIASELGIPSACTKTGVKHLHHVAKTQYDIGIYFEANGHGTVVFSDKFNEVVAGVAST- 405

Query: 406 LESDAAQKSLKVLHLFAKLINQTVGDAISDMLAVLAVLSILKWSPEKWDEEYTDLPNKLI 465
             +DAA      L+ F+KLINQTVGDAI+DML VLAVL  L+W+PE W  EYTDLPN L 
Sbjct: 406 --NDAA----STLYHFSKLINQTVGDAIADMLGVLAVLIKLQWTPEVWGAEYTDLPNLLT 459

Query: 466 KVLVPDRTVFKTKNAERQLVSPAGVQEKIDALVATFSKGRSFVRASGTEDAVRVYAEAAT 525
           KV+VPDR++F+T + ER+LVSP G+QEKIDA V  F + RSFVRASGTE+AVR+Y EA  
Sbjct: 460 KVVVPDRSIFETTDQERRLVSPEGLQEKIDACVGRFKRARSFVRASGTENAVRIYCEAED 519

Query: 526 PQETEALSQQV 536
           PQE + LS+QV
Sbjct: 520 PQEVQELSKQV 530

>CAGL0M02981g Chr13 (335863..337716) [1854 bp, 617 aa] {ON} similar
           to uniprot|Q03262 Saccharomyces cerevisiae YMR278w
          Length = 617

 Score = 39.3 bits (90), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 40/77 (51%), Gaps = 20/77 (25%)

Query: 57  TVGVMITASHNPPEDNGVKIVDPKG------------EMLEQSWEVYATD------LANS 98
           +VGVMITASHNP  DNG K+    G            E +  + E ++TD      L+N+
Sbjct: 147 SVGVMITASHNPKMDNGYKVYYTNGCQIIPPHDHGIAETINNNLEPWSTDWNFTKILSNA 206

Query: 99  ASQGFSEFVASVERLMT 115
            + G  E+V   +R++T
Sbjct: 207 ETDGKIEYVR--KRMLT 221

>TBLA0B03250 Chr2 (757928..759859) [1932 bp, 643 aa] {ON} Anc_8.840
           YMR278W
          Length = 643

 Score = 39.3 bits (90), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 41/91 (45%), Gaps = 29/91 (31%)

Query: 57  TVGVMITASHNPPEDNGVKI-------------------VDPKGEMLEQSWEVYATDLAN 97
           +VGVM+TASHNP  DNG K+                   +D   E  E SW  Y   +AN
Sbjct: 165 SVGVMVTASHNPKMDNGYKVYYSNGCQIIPPHDSGISQCIDANLEPWENSWN-YKEIMAN 223

Query: 98  SASQG---------FSEFVASVERLMTKLEV 119
           + S+G          ++++  +E  +T  ++
Sbjct: 224 AESKGDLIYHRDVMLNDYITQLEEKLTSKDI 254

>TPHA0I00250 Chr9 (46554..48443) [1890 bp, 629 aa] {ON} Anc_8.840
           YMR278W
          Length = 629

 Score = 38.5 bits (88), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 30/53 (56%), Gaps = 4/53 (7%)

Query: 25  TAGFR-YKADVLDTVMFTTGVVAGLRSIFLEGKTVGVMITASHNPPEDNGVKI 76
            AGF+ Y  +  D  + T  V  G+    L   ++GVMITASHNP  DNG K+
Sbjct: 126 NAGFKVYYLNPNDEFVHTPMVPFGIN---LYSASIGVMITASHNPEMDNGYKV 175

>TDEL0B00570 Chr2 complement(109270..111162) [1893 bp, 630 aa] {ON}
           Anc_8.840 YMR278W
          Length = 630

 Score = 38.1 bits (87), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 17/27 (62%), Positives = 19/27 (70%)

Query: 55  GKTVGVMITASHNPPEDNGVKIVDPKG 81
           G +VGVMITASHNP  DNG K+    G
Sbjct: 156 GASVGVMITASHNPKMDNGYKVYYSNG 182

>Kpol_1068.8 s1068 complement(13542..15440) [1899 bp, 632 aa] {ON}
           complement(13542..15440) [1899 nt, 633 aa]
          Length = 632

 Score = 37.7 bits (86), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 17/27 (62%), Positives = 19/27 (70%)

Query: 55  GKTVGVMITASHNPPEDNGVKIVDPKG 81
           G +VGVMITASHNP  DNG K+    G
Sbjct: 154 GASVGVMITASHNPKMDNGYKVYYSNG 180

>KLLA0D01573g Chr4 complement(139183..141006) [1824 bp, 607 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 607

 Score = 37.7 bits (86), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 15/22 (68%), Positives = 18/22 (81%)

Query: 55  GKTVGVMITASHNPPEDNGVKI 76
           G +VG+MITASHNP  DNG K+
Sbjct: 151 GASVGIMITASHNPKMDNGYKV 172

>Kwal_27.10258 s27 complement(265612..267474) [1863 bp, 620 aa] {ON}
           YMR278W - Hypothetical ORF [contig 37] FULL
          Length = 620

 Score = 37.7 bits (86), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 23/41 (56%), Gaps = 8/41 (19%)

Query: 55  GKTVGVMITASHNPPEDNGVK--------IVDPKGEMLEQS 87
           G + GVMITASHNP  DNG K        I+ P   ++ QS
Sbjct: 152 GASAGVMITASHNPKMDNGYKVYYSNGCQIIPPHDRLIAQS 192

>NCAS0C00410 Chr3 complement(62893..64770) [1878 bp, 625 aa] {ON}
           Anc_8.840 YMR278W
          Length = 625

 Score = 37.4 bits (85), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 29/49 (59%), Gaps = 12/49 (24%)

Query: 57  TVGVMITASHNPPEDNGVK--------IVDPK----GEMLEQSWEVYAT 93
           +VGVMITASHNP  DNG K        I+ P      EM++++ E ++T
Sbjct: 152 SVGVMITASHNPKMDNGYKVYYDNACQIIPPHDKNIAEMIQKNLEPWST 200

>KLTH0C03872g Chr3 complement(337765..339630) [1866 bp, 621 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 621

 Score = 36.6 bits (83), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 30/60 (50%), Gaps = 11/60 (18%)

Query: 36  DTVMFTTGVVAGLRSIFLEGKTVGVMITASHNPPEDNGVK--------IVDPKGEMLEQS 87
           D V+ T  V  G+  +   G   G+MITASHNP  DNG K        I+ P  + + QS
Sbjct: 137 DVVVHTPMVPFGIDHLRASG---GIMITASHNPKMDNGYKVYYSNGCQIIPPHDQRISQS 193

>Ecym_4611 Chr4 (1191367..1193259) [1893 bp, 630 aa] {ON} similar to
           Ashbya gossypii ABL126W
          Length = 630

 Score = 36.2 bits (82), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 23/44 (52%), Gaps = 7/44 (15%)

Query: 38  VMFTTGVVAGLRSIFLEGKTVGVMITASHNPPEDNGVKIVDPKG 81
           V FT   + G       G + G+MITASHNP  DNG K+    G
Sbjct: 150 VPFTVSNIEG-------GASCGIMITASHNPKMDNGYKVYYSNG 186

>KNAG0J00270 Chr10 complement(39750..41627) [1878 bp, 625 aa] {ON}
           Anc_8.840 YMR278W
          Length = 625

 Score = 36.2 bits (82), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 15/20 (75%), Positives = 17/20 (85%)

Query: 57  TVGVMITASHNPPEDNGVKI 76
           +VGVMITASHNP  DNG K+
Sbjct: 153 SVGVMITASHNPKMDNGYKV 172

>YMR278W Chr13 (822763..824631) [1869 bp, 622 aa] {ON}
           PGM3Phosphoglucomutase, catalyzes interconversion of
           glucose-1-phosphate and glucose-6-phospate;
           transcription induced in response to stress; green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm and nucleus; non-essential
          Length = 622

 Score = 35.8 bits (81), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 15/20 (75%), Positives = 17/20 (85%)

Query: 57  TVGVMITASHNPPEDNGVKI 76
           +VGVMITASHNP  DNG K+
Sbjct: 150 SVGVMITASHNPKMDNGYKV 169

>Suva_13.466 Chr13 (805414..807282) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score = 35.8 bits (81), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 15/20 (75%), Positives = 17/20 (85%)

Query: 57  TVGVMITASHNPPEDNGVKI 76
           +VGVMITASHNP  DNG K+
Sbjct: 150 SVGVMITASHNPKMDNGYKV 169

>Skud_13.450 Chr13 (796030..797898) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score = 35.8 bits (81), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 15/20 (75%), Positives = 17/20 (85%)

Query: 57  TVGVMITASHNPPEDNGVKI 76
           +VGVMITASHNP  DNG K+
Sbjct: 150 SVGVMITASHNPKMDNGYKV 169

>NDAI0K00410 Chr11 complement(91807..93687) [1881 bp, 626 aa] {ON}
           Anc_8.840 YMR278W
          Length = 626

 Score = 35.8 bits (81), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 18/25 (72%)

Query: 57  TVGVMITASHNPPEDNGVKIVDPKG 81
           ++GVMITASHNP  DNG K+    G
Sbjct: 153 SIGVMITASHNPKMDNGYKVYYSNG 177

>ZYRO0G14190g Chr7 (1131206..1133038) [1833 bp, 610 aa] {ON} similar
           to uniprot|Q03262 Saccharomyces cerevisiae YMR278W
           Hypothetical ORF
          Length = 610

 Score = 35.8 bits (81), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 15/20 (75%), Positives = 17/20 (85%)

Query: 57  TVGVMITASHNPPEDNGVKI 76
           +VGVMITASHNP  DNG K+
Sbjct: 146 SVGVMITASHNPKLDNGYKV 165

>KAFR0B03920 Chr2 (814394..816268) [1875 bp, 624 aa] {ON} Anc_8.840
           YMR278W
          Length = 624

 Score = 35.8 bits (81), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 17/23 (73%)

Query: 59  GVMITASHNPPEDNGVKIVDPKG 81
           GVMITASHNP +DNG K+    G
Sbjct: 158 GVMITASHNPKDDNGYKVYYSNG 180

>Smik_13.491 Chr13 (805767..807635) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score = 35.4 bits (80), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 18/25 (72%)

Query: 57  TVGVMITASHNPPEDNGVKIVDPKG 81
           +VGVM+TASHNP  DNG K+    G
Sbjct: 150 SVGVMVTASHNPKMDNGYKVYYSNG 174

>ABL126W Chr2 (159207..161081) [1875 bp, 624 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR278W
          Length = 624

 Score = 34.7 bits (78), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 17/25 (68%)

Query: 57  TVGVMITASHNPPEDNGVKIVDPKG 81
           + GVMITASHNP  DNG K+    G
Sbjct: 158 SCGVMITASHNPKMDNGYKVYYANG 182

>SAKL0D01474g Chr4 complement(117178..119052) [1875 bp, 624 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 624

 Score = 34.3 bits (77), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%)

Query: 57  TVGVMITASHNPPEDNGVKIVDPKG 81
           + G+MITASHNP  DNG K+    G
Sbjct: 154 SAGIMITASHNPKMDNGYKVYYSNG 178

>CAGL0M05511g Chr13 (587202..588509) [1308 bp, 435 aa] {ON} similar
           to uniprot|P38310 Saccharomyces cerevisiae YBR207w FTH1
          Length = 435

 Score = 33.1 bits (74), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 27/58 (46%)

Query: 242 VNDEWETPDSLNHLCGADFVKTNQKLPHGIAPGGERNRICCSFDGDADRIVFYYCGKN 299
           +  E   P +   L  AD +K  +KL   I  GG    I C+F G A   VFY+ G +
Sbjct: 81  IEGESMVPSTDESLSYADNLKLYKKLKIQIVSGGALGLIICAFIGGAFIAVFYHIGTD 138

>ADR050W Chr4 (794886..796130) [1245 bp, 414 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR207W (FTH1)
          Length = 414

 Score = 32.7 bits (73), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 37/86 (43%), Gaps = 6/86 (6%)

Query: 265 QKLPHGIAPGGERNRICCSFDGDADRIVFYYCGKN---GDFHLLDG--DKMATLFAKFFQ 319
           ++L   I  GG    +CC   G    ++FYY GK+      H  +G    +A++   F  
Sbjct: 81  RRLKVQILSGGALGLLCCMLVGGLFIVLFYYVGKDLWAASEHYYEGVLSIVASVIISFMG 140

Query: 320 E-LLRDAGLQDELELGVVQTAYANGS 344
              LR   L+D+  + +    YA  S
Sbjct: 141 LFFLRMGRLRDKFRIKLASMLYAQSS 166

>Smik_2.324 Chr2 (583653..585314) [1662 bp, 553 aa] {ON} YBR184W
           (REAL)
          Length = 553

 Score = 32.7 bits (73), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 20/34 (58%)

Query: 169 FLTSKSNELPKGTEIGKSLYYDNFLSAWVEIAEL 202
           FL    N   K T++ K L+YD+F   WV++ EL
Sbjct: 517 FLKFYCNGCSKKTDLSKILFYDDFTEKWVKMGEL 550

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.387 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 56,143,236
Number of extensions: 2432263
Number of successful extensions: 6190
Number of sequences better than 10.0: 56
Number of HSP's gapped: 6237
Number of HSP's successfully gapped: 57
Length of query: 541
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 427
Effective length of database: 40,409,475
Effective search space: 17254845825
Effective search space used: 17254845825
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)