Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_56.223506.10ON65865827460.0
KLTH0C11528g6.10ON64258921270.0
SAKL0E00880g6.10ON63654820890.0
TBLA0G011106.10ON63859119880.0
Kpol_1045.776.10ON65056119640.0
TPHA0M002006.10ON63454619540.0
ZYRO0F00484g6.10ON64359219330.0
ACR016W6.10ON64056519280.0
TDEL0G046106.10ON63359719060.0
KLLA0D00836g6.10ON64055118790.0
NCAS0D021906.10ON64555518530.0
CAGL0A01067g6.10ON64155417830.0
KAFR0B065006.10ON63656216620.0
NDAI0I027506.10ON66357215810.0
KNAG0E027806.10ON65056514340.0
Suva_16.426.10ON65456813221e-174
YPL263C (KEL3)6.10ON65156513211e-174
Skud_16.146.10ON65256713181e-174
Smik_6.4716.10ON65156412921e-170
Kpol_1050.695.88ON10842541852e-13
NCAS0F005205.88ON10862981638e-11
ZYRO0B08228g5.88ON12932591602e-10
KAFR0B043205.88ON9862731602e-10
KNAG0K005605.88ON11042651565e-10
KLLA0E15511g5.88ON9052741541e-09
Skud_8.2225.88ON11692621541e-09
Suva_15.3575.88ON11722621541e-09
SAKL0H02618g5.88ON10852091493e-09
YHR158C (KEL1)5.88ON11642621485e-09
Smik_8.2425.88ON11682621476e-09
TDEL0G011205.88ON10092091451e-08
Kwal_14.10195.88ON9782661441e-08
KLTH0C01474g5.88ON10562561413e-08
NDAI0D026005.88ON11672541405e-08
CAGL0I02090g5.88ON11362611396e-08
CAGL0F07997g5.88ON9362501378e-08
TPHA0A051705.88ON10162491361e-07
TBLA0C065305.88ON11721931361e-07
Kpol_1010.625.88ON9731881352e-07
YGR238C (KEL2)5.88ON8822731342e-07
Suva_7.5305.88ON8942641271e-06
Ecym_20615.88ON13622091262e-06
TPHA0H010805.88ON8282551235e-06
ADL149W5.88ON12112121217e-06
Smik_16.685.88ON8942761182e-05
Skud_7.5725.88ON8832021154e-05
ZYRO0C00550g7.9ON848104820.30
ZYRO0C03344g3.15ON658122810.36
TBLA0A043207.9ON83891800.52
KNAG0D021008.157ON1687229790.66
Kpol_538.457.9ON848188761.7
KAFR0C049107.9ON87876752.4
CAGL0K02101g8.157ON163396742.7
Smik_7.758.157ON1483142743.1
Kpol_1014.253.15ON629145724.5
NCAS0B054408.157ON1550119724.8
ADR414C7.9ON78469716.7
TDEL0H044207.9ON83470716.7
AGL293C7.413ON98496708.4
Suva_10.4184.139ON259111688.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_56.22350
         (658 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_56.22350 s56 complement(60828..62804) [1977 bp, 658 aa] {ON...  1062   0.0  
KLTH0C11528g Chr3 (946632..948560) [1929 bp, 642 aa] {ON} simila...   823   0.0  
SAKL0E00880g Chr5 complement(66646..68556) [1911 bp, 636 aa] {ON...   809   0.0  
TBLA0G01110 Chr7 complement(283630..285546) [1917 bp, 638 aa] {O...   770   0.0  
Kpol_1045.77 s1045 (180708..182660) [1953 bp, 650 aa] {ON} (1807...   761   0.0  
TPHA0M00200 Chr13 complement(40103..42007) [1905 bp, 634 aa] {ON...   757   0.0  
ZYRO0F00484g Chr6 complement(47424..49355) [1932 bp, 643 aa] {ON...   749   0.0  
ACR016W Chr3 (384967..386889) [1923 bp, 640 aa] {ON} Syntenic ho...   747   0.0  
TDEL0G04610 Chr7 (840098..841999) [1902 bp, 633 aa] {ON} Anc_6.1...   738   0.0  
KLLA0D00836g Chr4 complement(78202..80124) [1923 bp, 640 aa] {ON...   728   0.0  
NCAS0D02190 Chr4 complement(408069..410006) [1938 bp, 645 aa] {O...   718   0.0  
CAGL0A01067g Chr1 (106866..108791) [1926 bp, 641 aa] {ON} simila...   691   0.0  
KAFR0B06500 Chr2 (1347509..1349419) [1911 bp, 636 aa] {ON} Anc_6...   644   0.0  
NDAI0I02750 Chr9 complement(644137..646128) [1992 bp, 663 aa] {O...   613   0.0  
KNAG0E02780 Chr5 complement(559180..561132) [1953 bp, 650 aa] {O...   556   0.0  
Suva_16.42 Chr16 complement(60142..62106) [1965 bp, 654 aa] {ON}...   513   e-174
YPL263C Chr16 complement(44551..46506) [1956 bp, 651 aa] {ON}  K...   513   e-174
Skud_16.14 Chr16 complement(23637..25595) [1959 bp, 652 aa] {ON}...   512   e-174
Smik_6.471 Chr6 (774663..776618) [1956 bp, 651 aa] {ON} YPL263C ...   502   e-170
Kpol_1050.69 s1050 complement(150301..153555) [3255 bp, 1084 aa]...    76   2e-13
NCAS0F00520 Chr6 (100048..103308) [3261 bp, 1086 aa] {ON} Anc_5....    67   8e-11
ZYRO0B08228g Chr2 (641988..645869) [3882 bp, 1293 aa] {ON} simil...    66   2e-10
KAFR0B04320 Chr2 complement(893930..896890) [2961 bp, 986 aa] {O...    66   2e-10
KNAG0K00560 Chr11 complement(96678..99992) [3315 bp, 1104 aa] {O...    65   5e-10
KLLA0E15511g Chr5 (1388626..1391343) [2718 bp, 905 aa] {ON} simi...    64   1e-09
Skud_8.222 Chr8 complement(385114..388623) [3510 bp, 1169 aa] {O...    64   1e-09
Suva_15.357 Chr15 complement(617637..618952,619001..621203) [351...    64   1e-09
SAKL0H02618g Chr8 (259684..262941) [3258 bp, 1085 aa] {ON} simil...    62   3e-09
YHR158C Chr8 complement(413685..417179) [3495 bp, 1164 aa] {ON} ...    62   5e-09
Smik_8.242 Chr8 complement(390631..394137) [3507 bp, 1168 aa] {O...    61   6e-09
TDEL0G01120 Chr7 (229805..232834) [3030 bp, 1009 aa] {ON} Anc_5....    60   1e-08
Kwal_14.1019 s14 (159934..162870) [2937 bp, 978 aa] {ON} YHR158C...    60   1e-08
KLTH0C01474g Chr3 (131243..134413) [3171 bp, 1056 aa] {ON} simil...    59   3e-08
NDAI0D02600 Chr4 complement(600880..604383) [3504 bp, 1167 aa] {...    59   5e-08
CAGL0I02090g Chr9 complement(177324..180734) [3411 bp, 1136 aa] ...    58   6e-08
CAGL0F07997g Chr6 complement(785803..788613) [2811 bp, 936 aa] {...    57   8e-08
TPHA0A05170 Chr1 complement(1161610..1164660) [3051 bp, 1016 aa]...    57   1e-07
TBLA0C06530 Chr3 complement(1577728..1581246) [3519 bp, 1172 aa]...    57   1e-07
Kpol_1010.62 s1010 complement(151895..154816) [2922 bp, 973 aa] ...    57   2e-07
YGR238C Chr7 complement(966039..968687) [2649 bp, 882 aa] {ON}  ...    56   2e-07
Suva_7.530 Chr7 complement(920446..923130) [2685 bp, 894 aa] {ON...    54   1e-06
Ecym_2061 Chr2 (99788..103876) [4089 bp, 1362 aa] {ON} similar t...    53   2e-06
TPHA0H01080 Chr8 complement(232804..235290) [2487 bp, 828 aa] {O...    52   5e-06
ADL149W Chr4 (427096..430731) [3636 bp, 1211 aa] {ON} Syntenic h...    51   7e-06
Smik_16.68 Chr16 (128068..130752) [2685 bp, 894 aa] {ON} YGR238C...    50   2e-05
Skud_7.572 Chr7 complement(940820..943471) [2652 bp, 883 aa] {ON...    49   4e-05
ZYRO0C00550g Chr3 (39312..41858) [2547 bp, 848 aa] {ON} similar ...    36   0.30 
ZYRO0C03344g Chr3 complement(259809..261785) [1977 bp, 658 aa] {...    36   0.36 
TBLA0A04320 Chr1 (1068199..1070715) [2517 bp, 838 aa] {ON} Anc_7...    35   0.52 
KNAG0D02100 Chr4 (351677..356740) [5064 bp, 1687 aa] {ON} Anc_8....    35   0.66 
Kpol_538.45 s538 complement(101351..103897) [2547 bp, 848 aa] {O...    34   1.7  
KAFR0C04910 Chr3 (975629..978265) [2637 bp, 878 aa] {ON} Anc_7.9...    33   2.4  
CAGL0K02101g Chr11 (182946..187847) [4902 bp, 1633 aa] {ON} simi...    33   2.7  
Smik_7.75 Chr7 (119160..123611) [4452 bp, 1483 aa] {ON} YGL197W ...    33   3.1  
Kpol_1014.25 s1014 complement(42216..44105) [1890 bp, 629 aa] {O...    32   4.5  
NCAS0B05440 Chr2 (1017388..1022040) [4653 bp, 1550 aa] {ON}            32   4.8  
ADR414C Chr4 complement(1450330..1452684) [2355 bp, 784 aa] {ON}...    32   6.7  
TDEL0H04420 Chr8 complement(760921..763425) [2505 bp, 834 aa] {O...    32   6.7  
AGL293C Chr7 complement(156902..159856) [2955 bp, 984 aa] {ON} S...    32   8.4  
Suva_10.418 Chr10 complement(739402..740181) [780 bp, 259 aa] {O...    31   8.6  

>Kwal_56.22350 s56 complement(60828..62804) [1977 bp, 658 aa] {ON}
           YPL263C (KEL3) - Kelch-repeat protein, similar to Kel1
           and Kel2 [contig 186] FULL
          Length = 658

 Score = 1062 bits (2746), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 530/658 (80%), Positives = 530/658 (80%)

Query: 1   MDKRLLKSSSYLPWHRQENSGREFYLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 60
           MDKRLLKSSSYLPWHRQENSGREFYL                                  
Sbjct: 1   MDKRLLKSSSYLPWHRQENSGREFYLAMAKKKKDKEAKKARAEQKNKKNLEKSENKDKKR 60

Query: 61  XXXLGSEXXXXXXXXEVLANFKKEQELFQEVLVTPVERPSQRINSCMVANPIHGKRELLI 120
              LGSE        EVLANFKKEQELFQEVLVTPVERPSQRINSCMVANPIHGKRELLI
Sbjct: 61  SKKLGSEDDDDLDIDEVLANFKKEQELFQEVLVTPVERPSQRINSCMVANPIHGKRELLI 120

Query: 121 FGGEHTNSTNSLTAFYNELFTYSLDSDQWRKITSRNSPMPRXXXXXXXXXXGVALIHGGE 180
           FGGEHTNSTNSLTAFYNELFTYSLDSDQWRKITSRNSPMPR          GVALIHGGE
Sbjct: 121 FGGEHTNSTNSLTAFYNELFTYSLDSDQWRKITSRNSPMPRSSAAAAAHSSGVALIHGGE 180

Query: 181 FSSPKQNTFYHYSDTWLLDCTTKEWTKMEQKNGPSARSGHRMTIWKNFFILHGGFRDLGT 240
           FSSPKQNTFYHYSDTWLLDCTTKEWTKMEQKNGPSARSGHRMTIWKNFFILHGGFRDLGT
Sbjct: 181 FSSPKQNTFYHYSDTWLLDCTTKEWTKMEQKNGPSARSGHRMTIWKNFFILHGGFRDLGT 240

Query: 241 STTYLNDLWIFDITTYKWKQVEFPPNHPIPDARSGHSIIPTQDGAVLWGGYCKVKAGKGL 300
           STTYLNDLWIFDITTYKWKQVEFPPNHPIPDARSGHSIIPTQDGAVLWGGYCKVKAGKGL
Sbjct: 241 STTYLNDLWIFDITTYKWKQVEFPPNHPIPDARSGHSIIPTQDGAVLWGGYCKVKAGKGL 300

Query: 301 QKGKTLTDCWYLKMKSDVSAIRWERRKKQGFQPSPRVGCSMVHHKGRGMLFGGVYDFEET 360
           QKGKTLTDCWYLKMKSDVSAIRWERRKKQGFQPSPRVGCSMVHHKGRGMLFGGVYDFEET
Sbjct: 301 QKGKTLTDCWYLKMKSDVSAIRWERRKKQGFQPSPRVGCSMVHHKGRGMLFGGVYDFEET 360

Query: 361 EEGLASEFFNDLFSYQVEANRWYSVKMRPQKKKTVAISRNNRNKDEELENILNDILQQAN 420
           EEGLASEFFNDLFSYQVEANRWYSVKMRPQKKKTVAISRNNRNKDEELENILNDILQQAN
Sbjct: 361 EEGLASEFFNDLFSYQVEANRWYSVKMRPQKKKTVAISRNNRNKDEELENILNDILQQAN 420

Query: 421 LAXXXXXXXNEIKRELQRIDEEEALENSRKQYEVVGQLPHPRFNATTAVVDDFLFIFGGV 480
           LA       NEIKRELQRIDEEEALENSRKQYEVVGQLPHPRFNATTAVVDDFLFIFGGV
Sbjct: 421 LADDTDDDDNEIKRELQRIDEEEALENSRKQYEVVGQLPHPRFNATTAVVDDFLFIFGGV 480

Query: 481 WEFGERDFSIDSFYSIDLNKLDGVKVYWENLSELEKAKALGXXXXXXXXXXXXXXXXXXX 540
           WEFGERDFSIDSFYSIDLNKLDGVKVYWENLSELEKAKALG                   
Sbjct: 481 WEFGERDFSIDSFYSIDLNKLDGVKVYWENLSELEKAKALGEDDEEEFDDDEDDDDDDEE 540

Query: 541 XXTADQKLVAXXXXXXXXXXXXXXXXXIPDLRPWLPHPKPFETLRAFYIRTGAEFLKWAI 600
             TADQKLVA                 IPDLRPWLPHPKPFETLRAFYIRTGAEFLKWAI
Sbjct: 541 EETADQKLVAEDEEEEEEEEEEEDEPEIPDLRPWLPHPKPFETLRAFYIRTGAEFLKWAI 600

Query: 601 SNNRDAKGKHLKKQSFDLCXXXXXXXXXXXXXXXXKXXXXXXXXXXXXRDPAQTMKRR 658
           SNNRDAKGKHLKKQSFDLC                K            RDPAQTMKRR
Sbjct: 601 SNNRDAKGKHLKKQSFDLCQDRWWERREQIRIEEDKLEELGGVENVVERDPAQTMKRR 658

>KLTH0C11528g Chr3 (946632..948560) [1929 bp, 642 aa] {ON} similar
           to uniprot|Q08979 Saccharomyces cerevisiae YPL263C KEL3
           Cytoplasmic protein of unknown function
          Length = 642

 Score =  823 bits (2127), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/589 (67%), Positives = 453/589 (76%), Gaps = 10/589 (1%)

Query: 80  NFKKEQELFQEVLVTPVERPSQRINSCMVANPIHGKRELLIFGGEHTNSTNSLTAFYNEL 139
           NF+KEQELFQEV+VTPV+RPS R N CMV NP HGKRELLIFGGE+TN T+S T FYNEL
Sbjct: 54  NFRKEQELFQEVVVTPVKRPSPRSNVCMVPNPSHGKRELLIFGGEYTNQTSSTTTFYNEL 113

Query: 140 FTYSLDSDQWRKITSRNSPMPRXXXXXXXXXXGVALIHGGEFSSPKQNTFYHYSDTWLLD 199
           FTYSLD+DQW+KITSRN+PMPR          GV LIHGGEFSSPKQNTFYHYSD+WLLD
Sbjct: 114 FTYSLDTDQWKKITSRNAPMPRSSAAAAGHPSGVVLIHGGEFSSPKQNTFYHYSDSWLLD 173

Query: 200 CTTKEWTKMEQKNGPSARSGHRMTIWKNFFILHGGFRDLGTSTTYLNDLWIFDITTYKWK 259
           C++KEWTK++QKNGPSARSGHRMT+WKNFF++HGGFRDLGTSTTYLND W+FDITTYKWK
Sbjct: 174 CSSKEWTKIDQKNGPSARSGHRMTVWKNFFVMHGGFRDLGTSTTYLNDCWLFDITTYKWK 233

Query: 260 QVEFPPNHPIPDARSGHSIIPTQDGAVLWGGYCKVKAGKGLQKGKTLTDCWYLKMKSDVS 319
           QVEFPPNHP+PDARSGHS+IPTQ+GA++WGGYCK+KA KGLQKGK LTDCWYL+MKSD++
Sbjct: 234 QVEFPPNHPVPDARSGHSLIPTQEGAIVWGGYCKIKAKKGLQKGKILTDCWYLRMKSDIT 293

Query: 320 AIRWERRKKQGFQPSPRVGCSMVHHKGRGMLFGGVYDFEETEEGLASEFFNDLFSYQVEA 379
            IRWERRKKQGFQPSPRVGCSM HHKGRG+LFGGVYD+EETEEGL+SEFFNDL SYQVEA
Sbjct: 294 GIRWERRKKQGFQPSPRVGCSMAHHKGRGILFGGVYDYEETEEGLSSEFFNDLLSYQVEA 353

Query: 380 NRWYSVKMRPQKKKTVAISRNNRNKDEELENILNDILQQANLA---XXXXXXXNEIKREL 436
           NRWYS+KMRPQKKK VA S++ ++KD+EL  ILNDILQ+ANLA          +EI++EL
Sbjct: 354 NRWYSIKMRPQKKKIVAASKSAKSKDDELVGILNDILQKANLADEENEENESDSEIEKEL 413

Query: 437 QRIDEEEALENSRKQYEVVGQLPHPRFNATTAVVDDFLFIFGGVWEFGERDFSIDSFYSI 496
            R+DEEE L + +KQY VV QLPH RFNA T VVDD LFIFGG WE+GERDFSIDSFYSI
Sbjct: 414 HRLDEEELLGHQQKQYPVVAQLPHSRFNAATTVVDDTLFIFGGSWEYGERDFSIDSFYSI 473

Query: 497 DLNKLDGVKVYWENLSELEKAKALGXXXXXXXXXXXXXXXXXXXXXTADQKLVAXXXXXX 556
           DLN+ DGV+V+WE+L E+EKAK  G                     T D++L+A      
Sbjct: 474 DLNRTDGVRVFWEDLEEIEKAKDQGLEEDEEEEEEEDDDDEDDEEETLDEELIAEMEDDK 533

Query: 557 XXXXXXXXXX-------XIPDLRPWLPHPKPFETLRAFYIRTGAEFLKWAISNNRDAKGK 609
                             IPD RPWLPHPK FETLRAFYIRTGAEFL+WAISNNR AKGK
Sbjct: 534 QEEEEQEEEEEEEEAGPEIPDPRPWLPHPKAFETLRAFYIRTGAEFLQWAISNNRSAKGK 593

Query: 610 HLKKQSFDLCXXXXXXXXXXXXXXXXKXXXXXXXXXXXXRDPAQTMKRR 658
           HLKKQSFDL                 K            RD + + KRR
Sbjct: 594 HLKKQSFDLSQDRWWERREQVRIEEDKLEEMGGVENIIERDSSHSTKRR 642

>SAKL0E00880g Chr5 complement(66646..68556) [1911 bp, 636 aa] {ON}
           similar to uniprot|Q08979 Saccharomyces cerevisiae
           YPL263C KEL3 Cytoplasmic protein of unknown function
          Length = 636

 Score =  809 bits (2089), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/548 (69%), Positives = 442/548 (80%), Gaps = 8/548 (1%)

Query: 78  LANFKKEQELFQEVLVTPVERPSQRINSCMVANPIHGKRELLIFGGEHTNSTNSLTAFYN 137
           LANFK+EQE F+EV+V+ V+RP++RINS MVANP+HGKRELL+FGGE+TNSTNS TAFYN
Sbjct: 52  LANFKREQEKFEEVVVSTVDRPTRRINSSMVANPLHGKRELLLFGGENTNSTNSTTAFYN 111

Query: 138 ELFTYSLDSDQWRKITSRNSPMPRXXXXXXXXXXGVALIHGGEFSSPKQNTFYHYSDTWL 197
           +LFTYSLD DQWRKI+S+NSPMPR          GV LIHGGEFSSPKQNTFYHYSDTWL
Sbjct: 112 DLFTYSLDGDQWRKISSQNSPMPRSSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWL 171

Query: 198 LDCTTKEWTKMEQKNGPSARSGHRMTIWKNFFILHGGFRDLGTSTTYLNDLWIFDITTYK 257
           LDC TKEWTK+EQKNGP+ARSGHR+T+WKN+FILHGGFRDLGT TTYL+D W+FDITTYK
Sbjct: 172 LDCNTKEWTKIEQKNGPTARSGHRLTVWKNYFILHGGFRDLGTMTTYLSDCWLFDITTYK 231

Query: 258 WKQVEFPPNHPIPDARSGHSIIPTQDGAVLWGGYCKVKAGKGLQKGKTLTDCWYLKMKSD 317
           WKQV+FPPNHPIPDARSGHS++PT DGAVLWGGYCKVKAGKGLQKGK LTDCWYLKMKSD
Sbjct: 232 WKQVDFPPNHPIPDARSGHSLVPTPDGAVLWGGYCKVKAGKGLQKGKILTDCWYLKMKSD 291

Query: 318 VSAIRWERRKKQGFQPSPRVGCSMVHHKGRGMLFGGVYDFEETEEGLASEFFNDLFSYQV 377
           + AIRWERRKKQGFQPSPRVGCSMVHHKGRG+LFGGV+DFEETEE L S F+NDLF++Q+
Sbjct: 292 IGAIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFEETEESLESMFYNDLFTFQI 351

Query: 378 EANRWYSVKMRPQKKKTVAISRNNRNKDEELENILNDILQQANLAXXXXXXXNEIKRELQ 437
           E NRWYS  +RPQ+K   A S+NNRNKD+ELE+ILN IL++ANL          I   L+
Sbjct: 352 ETNRWYSASLRPQRKAAKATSKNNRNKDKELEDILNQILEKANLNDDENEKET-IGDVLK 410

Query: 438 RIDEE-----EALENSRKQYEVVGQLPHPRFNATTAVVDDFLFIFGGVWEFGERDFSIDS 492
            +DEE     E L + +K+Y +  QLPHPRFNA+TAVVDD LFIFGGVWE GE+D+SIDS
Sbjct: 411 ELDEEDSDSAEELNSEKKEYPIRIQLPHPRFNASTAVVDDTLFIFGGVWEIGEKDYSIDS 470

Query: 493 FYSIDLNKLDGVKVYWENLSELEKAKALG-XXXXXXXXXXXXXXXXXXXXXTADQKLVAX 551
           FY+IDLN+LDG+K+YWE+L ++E AK LG                        DQKLVA 
Sbjct: 471 FYAIDLNRLDGIKIYWEDLRDIEMAKELGDEEEDFEDNEEDDEEDDDDEEEITDQKLVA- 529

Query: 552 XXXXXXXXXXXXXXXXIPDLRPWLPHPKPFETLRAFYIRTGAEFLKWAISNNRDAKGKHL 611
                           IPD RPWLPHPKPFETLR FY+RTGA+FL+WAIS+NRDA+GKHL
Sbjct: 530 EDDDEEEEEEDEYEPEIPDPRPWLPHPKPFETLRGFYVRTGADFLEWAISSNRDARGKHL 589

Query: 612 KKQSFDLC 619
           KK+SFDLC
Sbjct: 590 KKKSFDLC 597

>TBLA0G01110 Chr7 complement(283630..285546) [1917 bp, 638 aa] {ON}
           Anc_6.10 YPL263C
          Length = 638

 Score =  770 bits (1988), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/591 (62%), Positives = 438/591 (74%), Gaps = 11/591 (1%)

Query: 76  EVLANFKKEQELFQEVLVTPVERPSQRINSCMVANPIHGKRELLIFGGEHTNSTNSLTAF 135
           ++L NFKK+QE F+++ +  V +P++RINSCM++NPIHGK EL++FGGE+T++T   T F
Sbjct: 51  DILENFKKQQEQFEKINIETVSKPTKRINSCMISNPIHGKNELILFGGENTSTT---TTF 107

Query: 136 YNELFTYSLDSDQWRKITSRNSPMPRXXXXXXXXXXGVALIHGGEFSSPKQNTFYHYSDT 195
           YN+LFTY+ ++DQW+K TS+NSPMPR          G+AL+HGGEFSSPKQNTFYHYSDT
Sbjct: 108 YNDLFTYNPENDQWKKYTSQNSPMPRSSSAMISHPTGIALLHGGEFSSPKQNTFYHYSDT 167

Query: 196 WLLDCTTKEWTKMEQKNGPSARSGHRMTIWKNFFILHGGFRDLGTSTTYLNDLWIFDITT 255
           WLLDC TKEW+K+E KNGPSARSGHRMT+WKNF ILHGGFRDLGTSTTYL DLW+FD+T 
Sbjct: 168 WLLDCATKEWSKVENKNGPSARSGHRMTVWKNFIILHGGFRDLGTSTTYLKDLWLFDVTK 227

Query: 256 YKWKQVEFPPNHPIPDARSGHSIIPTQDGAVLWGGYCKVKAGKGLQKGKTLTDCWYLKMK 315
           YKW QVEFPPNH IPDARSGHS+IPTQDGA+LWGGYCKVKAGKGLQKGK L+DCWYLKMK
Sbjct: 228 YKWTQVEFPPNHAIPDARSGHSLIPTQDGALLWGGYCKVKAGKGLQKGKILSDCWYLKMK 287

Query: 316 SDVSAIRWERRKKQGFQPSPRVGCSMVHHKGRGMLFGGVYDFEETEEGLASEFFNDLFSY 375
           SDVS IRWERRKKQGFQPSPRVGCSMVHHKGRG+LFGGV+DFEETEE L S F+NDLF+Y
Sbjct: 288 SDVSGIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFEETEESLDSLFYNDLFTY 347

Query: 376 QVEANRWYSVKMRPQKKKTVAIS-RNNRNKDEELENILNDILQQANLAXXXXXXXNEIKR 434
           Q+E NRW+S+ MR Q+KKT+ I  +  ++K++EL++ILN IL++ NL        N I+ 
Sbjct: 348 QIEINRWFSLSMRSQRKKTIKIGPKTTKDKEKELQDILNSILKKNNLTDDDSEDPNAIEE 407

Query: 435 ELQRIDEEEALENSR------KQYEVVGQLPHPRFNATTAVVDDFLFIFGGVWEFGERDF 488
           EL+  D+E   E+        KQYEV+ QLPH RFNATTAVV+D L+IFGG WE GE+D+
Sbjct: 408 ELKINDDESNSEDESKDGQVTKQYEVMNQLPHVRFNATTAVVNDTLYIFGGSWELGEKDY 467

Query: 489 SIDSFYSIDLNKLDGVKVYWENLSELEKAKALGXX-XXXXXXXXXXXXXXXXXXXTADQK 547
           SIDSFYSIDLNKLDGV VYWE++ E+E AK LG                        DQK
Sbjct: 468 SIDSFYSIDLNKLDGVTVYWEDMEEIEAAKELGEQFSDEEDEDDEEEDEDDGEEEIVDQK 527

Query: 548 LVAXXXXXXXXXXXXXXXXXIPDLRPWLPHPKPFETLRAFYIRTGAEFLKWAISNNRDAK 607
           LVA                 IPD RPWLPHPKPFETLRAFY+RTGA FL+WAISNNRD+K
Sbjct: 528 LVAEEDEEEEEIEADEDEMEIPDPRPWLPHPKPFETLRAFYVRTGATFLEWAISNNRDSK 587

Query: 608 GKHLKKQSFDLCXXXXXXXXXXXXXXXXKXXXXXXXXXXXXRDPAQTMKRR 658
           GKHLKK+SF+L                 K            RD  Q  KRR
Sbjct: 588 GKHLKKKSFELTEDRWWERRDQVRIEEDKMEELGGIENIVERDTTQVNKRR 638

>Kpol_1045.77 s1045 (180708..182660) [1953 bp, 650 aa] {ON}
           (180710..182662) [1953 nt, 651 aa]
          Length = 650

 Score =  761 bits (1964), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/561 (64%), Positives = 434/561 (77%), Gaps = 18/561 (3%)

Query: 77  VLANFKKEQELFQEVLVTPVERPSQRINSCMVANPIHGKRELLIFGGEHTNSTNSLTAFY 136
           VLANFKKEQELF+++ +  VERPS+RIN CM+ NP HGK EL++FGGE TN   S T F+
Sbjct: 51  VLANFKKEQELFEQINIESVERPSRRINPCMIENPNHGKSELILFGGESTNKDTSTTQFF 110

Query: 137 NELFTYSLDSDQWRKITSRNSPMPRXXXXXXXXXXGVALIHGGEFSSPKQNTFYHYSDTW 196
           N+L++Y+ ++DQWR+ TS+NSPMPR          GVALIHGGEFSSPKQNTFYHYSDTW
Sbjct: 111 NDLYSYTPENDQWRRYTSKNSPMPRSSAAMAAHPSGVALIHGGEFSSPKQNTFYHYSDTW 170

Query: 197 LLDCTTKEWTKMEQKNGPSARSGHRMTIWKNFFILHGGFRDLGTSTTYLNDLWIFDITTY 256
           LLDC+TKEWTK+EQKNGPSARSGHR++IWKN+F+LHGGFRDLGTSTTYLND W+FDIT Y
Sbjct: 171 LLDCSTKEWTKVEQKNGPSARSGHRISIWKNYFMLHGGFRDLGTSTTYLNDCWLFDITNY 230

Query: 257 KWKQVEFPPNHPIPDARSGHSIIPTQDGAVLWGGYCKVKAGKGLQKGKTLTDCWYLKMKS 316
           KWKQ+EFPPNHPIPDARSGHS IPTQ+GAVLWGGYCKVKAGKGLQKGK LTDCWYLKMK+
Sbjct: 231 KWKQIEFPPNHPIPDARSGHSFIPTQEGAVLWGGYCKVKAGKGLQKGKILTDCWYLKMKA 290

Query: 317 DVSAIRWERRKKQGFQPSPRVGCSMVHHKGRGMLFGGVYDFEETEEGLASEFFNDLFSYQ 376
           D +AIRWERRKKQGFQPSPRVGCSMVHHKGRG+LFGGVYDFEETEE L S F+NDLFSYQ
Sbjct: 291 DPTAIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVYDFEETEESLDSMFYNDLFSYQ 350

Query: 377 VEANRWYSVKMRPQKKKTVAI-SRNNRNKDEELENILNDILQQANL-----AXXXXXXXN 430
           +E NRW+++++RPQ+KK V + ++++++K++EL+++LN IL++ANL              
Sbjct: 351 IEINRWFALQLRPQRKKVVRLNNKSSKDKEKELQDLLNQILEKANLNDKDDKDQEDEDAK 410

Query: 431 EIKRELQRIDEEEALENS--------RKQYEVVGQLPHPRFNATTAVVDDFLFIFGGVWE 482
            I+ EL R D + +  ++        +K+Y+V+ QLPHPRFNAT  VV+D LFI+GGVWE
Sbjct: 411 AIETELDRADHDTSDSDADDVEDAKEKKEYKVLTQLPHPRFNATMTVVNDTLFIYGGVWE 470

Query: 483 FGERDFSIDSFYSIDLNKLDGVKVYWENLSELEKAKALG--XXXXXXXXXXXXXXXXXXX 540
            GE+D++IDSFYSIDLN+ DGV V WE+LSE+E AK  G                     
Sbjct: 471 LGEKDYTIDSFYSIDLNRTDGVTVLWEDLSEIEAAKEAGIVDSDEEDDEFGDSDDEDDGE 530

Query: 541 XXTADQKLVA--XXXXXXXXXXXXXXXXXIPDLRPWLPHPKPFETLRAFYIRTGAEFLKW 598
               DQKLVA                   IPD  PWLPHPKPFE+LR FY+RTGA FL+W
Sbjct: 531 EEIMDQKLVAEEEEEEEEEEEEEQVDEMEIPDPCPWLPHPKPFESLRVFYVRTGATFLEW 590

Query: 599 AISNNRDAKGKHLKKQSFDLC 619
           AISNNRDA+GKHLKK+SFDLC
Sbjct: 591 AISNNRDARGKHLKKKSFDLC 611

>TPHA0M00200 Chr13 complement(40103..42007) [1905 bp, 634 aa] {ON}
           Anc_6.10 YPL263C
          Length = 634

 Score =  757 bits (1954), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/546 (65%), Positives = 435/546 (79%), Gaps = 5/546 (0%)

Query: 77  VLANFKKEQELFQEVLVTPVERPSQRINSCMVANPIHGKRELLIFGGEHTNSTNSLTAFY 136
           VLANFKKEQE F+++ V  V++P++RINSCM+ANP HGK+ELL+FGGE+T+    +T FY
Sbjct: 52  VLANFKKEQEQFEQINVESVDKPTRRINSCMIANPNHGKKELLLFGGENTSQEQGVTHFY 111

Query: 137 NELFTYSLDSDQWRKITSRNSPMPRXXXXXXXXXXGVALIHGGEFSSPKQNTFYHYSDTW 196
           N+L+T++ D+D W+KITS+NSPMPR          G+AL+HGGEFSSPKQNTFYHYSDTW
Sbjct: 112 NDLYTFTPDNDLWKKITSQNSPMPRSSAAMAAHPSGIALLHGGEFSSPKQNTFYHYSDTW 171

Query: 197 LLDCTTKEWTKMEQKNGPSARSGHRMTIWKNFFILHGGFRDLGTSTTYLNDLWIFDITTY 256
           LLDCTT+EWTK+EQKNGPSARSGHR+T+WKN+FILHGGFRDLG++T+YLND W+FDIT+Y
Sbjct: 172 LLDCTTREWTKVEQKNGPSARSGHRITVWKNYFILHGGFRDLGSTTSYLNDSWLFDITSY 231

Query: 257 KWKQVEFPPNHPIPDARSGHSIIPTQDGAVLWGGYCKVKAGKGLQKGKTLTDCWYLKMKS 316
           KW+Q+EFPPNHP+PDARSGHS+IPTQ+GAVLWGGYCKVKAGKGLQKGK L DCWYLKMK+
Sbjct: 232 KWRQIEFPPNHPVPDARSGHSLIPTQEGAVLWGGYCKVKAGKGLQKGKILGDCWYLKMKA 291

Query: 317 DVSAIRWERRKKQGFQPSPRVGCSMVHHKGRGMLFGGVYDFEETEEGLASEFFNDLFSYQ 376
           D SA+RWERRKKQGFQPSPRVGCSMVHHKGRG+LFGGVYDFEETEE L S F+NDLFSYQ
Sbjct: 292 DPSAVRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVYDFEETEESLDSIFYNDLFSYQ 351

Query: 377 VEANRWYSVKMRPQKKKTVAI-SRNNRNKDEELENILNDILQQANLAXXXXXXXNEIKRE 435
           +E+NRWY++++R Q+KK V + +++++ K+ EL+NILN+IL++ANL        NE+   
Sbjct: 352 IESNRWYALQLRSQRKKVVRLNNKSSKEKELELQNILNEILEKANLK-DDDEDANELSNG 410

Query: 436 L--QRIDEEEALENSRKQYEVVGQLPHPRFNATTAVVDDFLFIFGGVWEFGERDFSIDSF 493
           L      ++E+ + S+K+Y V  QLPH RFNA+T VVDD LFI+GGVWE GE+D+SIDS 
Sbjct: 411 LGSDSDSDDESEKVSKKEYIVRNQLPHHRFNASTTVVDDTLFIYGGVWELGEKDYSIDSM 470

Query: 494 YSIDLNKLDGVKVYWENLSELEKAKALGXXXXXXXXXXXXXXXXXXXXXTADQKLVAXXX 553
           YSIDLNKLDGV VYWENL ++EKAK LG                     T DQKLVA   
Sbjct: 471 YSIDLNKLDGVTVYWENLHDIEKAKELGAINSDEEDEEDEDDEDDDEEETVDQKLVA-EE 529

Query: 554 XXXXXXXXXXXXXXIPDLRPWLPHPKPFETLRAFYIRTGAEFLKWAISNNRDAKGKHLKK 613
                         IPD RPWLPHPK FE+LR FY+RTGA FL+WAISNN+  +GKHLK 
Sbjct: 530 EEEEEEIEDADDMEIPDPRPWLPHPKAFESLRNFYVRTGASFLEWAISNNKHTRGKHLKT 589

Query: 614 QSFDLC 619
           +SF+LC
Sbjct: 590 KSFELC 595

>ZYRO0F00484g Chr6 complement(47424..49355) [1932 bp, 643 aa] {ON}
           similar to uniprot|Q08979 Saccharomyces cerevisiae
           YPL263C KEL3 Cytoplasmic protein of unknown function
          Length = 643

 Score =  749 bits (1933), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/592 (61%), Positives = 440/592 (74%), Gaps = 11/592 (1%)

Query: 77  VLANFKKEQELFQEVLVTPVERPSQRINSCMVANPIHGKRELLIFGGEHTNSTNSLTAFY 136
           VLA+FKKEQE F++V+V  V++PS RIN C+V+NP HGK+EL++FGGE+TN +NS T FY
Sbjct: 53  VLASFKKEQEQFEKVVVESVDKPSARINPCLVSNPAHGKKELILFGGEYTNQSNSTTHFY 112

Query: 137 NELFTYSLDSDQWRKITSRNSPMPRXXXXXXXXXXGVALIHGGEFSSPKQNTFYHYSDTW 196
           NELFT++ D+DQWRKI+S+N+PMPR          G+AL+HGGEFSSPKQNTFYHYSDTW
Sbjct: 113 NELFTFTPDNDQWRKISSQNAPMPRSSAAMAAHPSGIALLHGGEFSSPKQNTFYHYSDTW 172

Query: 197 LLDCTTKEWTKMEQKNGPSARSGHRMTIWKNFFILHGGFRDLGTSTTYLNDLWIFDITTY 256
           LLDCTTKEWTK++QKNGP++RSGHRMT+WKNFFI++GGFRDLGTSTTYLND W+FDITT+
Sbjct: 173 LLDCTTKEWTKLDQKNGPASRSGHRMTVWKNFFIMYGGFRDLGTSTTYLNDCWLFDITTH 232

Query: 257 KWKQVEFPPNHPIPDARSGHSIIPTQDGAVLWGGYCKVKAGKGLQKGKTLTDCWYLKMKS 316
           KW QVEFP NH IPDARSGHS IP Q+GA+LWGGYCKVKAGKGLQKGK LTDCWYLKM S
Sbjct: 233 KWTQVEFPRNHLIPDARSGHSFIPDQEGAILWGGYCKVKAGKGLQKGKILTDCWYLKMNS 292

Query: 317 DVSAIRWERRKKQGFQPSPRVGCSMVHHKGRGMLFGGVYDFEETEEGLASEFFNDLFSYQ 376
             SAIRWERRKKQGFQPSPRVGCSMV HKGRG+LFGGVYDFEETEE L S F+NDLF++Q
Sbjct: 293 TPSAIRWERRKKQGFQPSPRVGCSMVPHKGRGVLFGGVYDFEETEESLDSNFYNDLFTFQ 352

Query: 377 VEANRWYSVKMRPQKKKTVAISRNN-RNKDEELENILNDILQQANL------AXXXXXXX 429
           ++ NRWYS+ +RPQ+KK V IS+++ +++++EL++ LN ILQQA L              
Sbjct: 353 IKTNRWYSLSLRPQRKKQVKISKSSTKDQEKELQDHLNRILQQAQLYDQDEDKEDDKAIR 412

Query: 430 NEIKRELQRIDEEEALENSRKQYEVVGQLPHPRFNATTAVVDDFLFIFGGVWEFGERDFS 489
            + + E Q  DE+E  E+++KQ+ +  QLPHPRFN + AVV+D LFI+GG+WE G++D++
Sbjct: 413 EQFEDENQSGDEDEE-ESTKKQHTISTQLPHPRFNTSLAVVNDTLFIYGGLWELGDKDYN 471

Query: 490 IDSFYSIDLNKLDGVKVYWENLSELEKAKAL---GXXXXXXXXXXXXXXXXXXXXXTADQ 546
           IDSFY IDLNK+DGV VYWENL+E+EKAK L   G                       DQ
Sbjct: 472 IDSFYGIDLNKVDGVTVYWENLAEIEKAKKLAEQGSDEDEDDEDEEDEDEDDDEEEVRDQ 531

Query: 547 KLVAXXXXXXXXXXXXXXXXXIPDLRPWLPHPKPFETLRAFYIRTGAEFLKWAISNNRDA 606
            LVA                 IPD RPWLPHPK FE+LRAFY+R G +FL+WAISNNRDA
Sbjct: 532 VLVAEEEDAEEDEEVEEEEMEIPDPRPWLPHPKAFESLRAFYVRAGPQFLEWAISNNRDA 591

Query: 607 KGKHLKKQSFDLCXXXXXXXXXXXXXXXXKXXXXXXXXXXXXRDPAQTMKRR 658
           +GKHLK++SFDLC                K            R+PAQ  KRR
Sbjct: 592 RGKHLKQKSFDLCQDRWWERRDQVRIEEDKMEELGGVGDIVERNPAQKTKRR 643

>ACR016W Chr3 (384967..386889) [1923 bp, 640 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL263C (KEL3)
          Length = 640

 Score =  747 bits (1928), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/565 (63%), Positives = 430/565 (76%), Gaps = 10/565 (1%)

Query: 64  LGSEXXXXXXXXEVLANFKKEQELFQEVLVTPVERPSQRINSCMVANPIHGKRELLIFGG 123
           LG++        EVLANFK++Q  F+ V V  VERP QR +S +VANP+H KREL++FGG
Sbjct: 38  LGADDDDDMDIEEVLANFKRQQAEFEAVNVETVERPHQRSSSSLVANPLHNKRELILFGG 97

Query: 124 EHTNSTNSLTAFYNELFTYSLDSDQWRKITSRNSPMPRXXXXXXXXXXGVALIHGGEFSS 183
           E+TN +  +T FYN+LF YSLD+DQW+K TS+NSPMPR          GV LIHGGEFSS
Sbjct: 98  EYTNQSTGMTHFYNDLFIYSLDTDQWKKYTSQNSPMPRSSAAIAAHPSGVVLIHGGEFSS 157

Query: 184 PKQNTFYHYSDTWLLDCTTKEWTKMEQKNGPSARSGHRMTIWKNFFILHGGFRDLGTSTT 243
           PKQNTFYHYSDTWL DC T EWTK+EQKNGPS+RSGHRMT+WKN+ ILHGGFRDLGTSTT
Sbjct: 158 PKQNTFYHYSDTWLFDCATHEWTKIEQKNGPSSRSGHRMTVWKNYIILHGGFRDLGTSTT 217

Query: 244 YLNDLWIFDITTYKWKQVEFPPNHPIPDARSGHSIIPTQDGAVLWGGYCKVKAGKGLQKG 303
           YLND W+FDITTYKW+Q++FP NHPIPDARSGHS++PT +GA+LWGGYCKVKAGKGLQKG
Sbjct: 218 YLNDCWLFDITTYKWQQLQFPANHPIPDARSGHSLLPTPEGAILWGGYCKVKAGKGLQKG 277

Query: 304 KTLTDCWYLKMKSDVSAIRWERRKKQGFQPSPRVGCSMVHHKGRGMLFGGVYDFEETEEG 363
           K LTDCWYLKMKSDV+AIRWERRKKQGFQPS R GCSMVHHKGRG+LFGGVYD+EETEEG
Sbjct: 278 KILTDCWYLKMKSDVTAIRWERRKKQGFQPSSRAGCSMVHHKGRGILFGGVYDYEETEEG 337

Query: 364 LASEFFNDLFSYQVEANRWYSVKMRPQKKKTV-AISRNNRNKDEELENILNDILQQANLA 422
           L S F+NDLF+Y +E NRWYSV +R Q+   V +  ++NR+KD+ELE++LN IL++ANL 
Sbjct: 338 LDSLFYNDLFTYHIETNRWYSVSLRAQRHSKVKSAPKSNRDKDKELEDMLNAILKKANLD 397

Query: 423 XXXXXXXNE-IKRELQRIDEE--EALENSRKQYEVVGQLPHPRFNATTAVVDDFLFIFGG 479
                   + I+ EL +++ +     E ++K Y +V +LPHPRFNA+TA+VDD LFIFGG
Sbjct: 398 DDDGDEDGKTIEEELNKLENDGITETEETKKSYPIVMKLPHPRFNASTAIVDDTLFIFGG 457

Query: 480 VWEFGERDFSIDSFYSIDLNKLDGVKVYWENLSELEKAKALGXXXXXXXXXXXXXXXXXX 539
           VWE GE+D+ IDSFYSID+NK+DGVKVYWE+++ +E+AK LG                  
Sbjct: 458 VWEQGEKDYMIDSFYSIDMNKVDGVKVYWEDMAAVERAKELGEEDEDDAEDDEDDDSEDD 517

Query: 540 XXXT-ADQKLVAXXXXXXXXXXXXXXXXXIPDLRPWLPHPKPFETLRAFYIRTGAEFLKW 598
                +D+KLVA                 IPD RPWLPHPK FE+LRAFY+RTGA FL+W
Sbjct: 518 DEEEHSDRKLVA-EEEEEEEEEDNEILPEIPDPRPWLPHPKAFESLRAFYVRTGASFLEW 576

Query: 599 AISNNR----DAKGKHLKKQSFDLC 619
           AI+N      DAKGKHLKK SFDLC
Sbjct: 577 AITNKHNTRSDAKGKHLKKHSFDLC 601

>TDEL0G04610 Chr7 (840098..841999) [1902 bp, 633 aa] {ON} Anc_6.10
           YPL263C
          Length = 633

 Score =  738 bits (1906), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/597 (59%), Positives = 432/597 (72%), Gaps = 4/597 (0%)

Query: 64  LGSEXXXXXXXXEVLANFKKEQELFQEVLVTPVERPSQRINSCMVANPIHGKRELLIFGG 123
           LG+E        +VLANFKKEQE F++V+V  +ERPS+RIN  M+ANPIHGK EL++FGG
Sbjct: 39  LGAEEDDDLDIEQVLANFKKEQEQFEKVVVENIERPSRRINPSMIANPIHGKSELIMFGG 98

Query: 124 EHTNSTNSLTAFYNELFTYSLDSDQWRKITSRNSPMPRXXXXXXXXXXGVALIHGGEFSS 183
           EHT  + S T F+N+L  +S D++QW++I+S+NSPMPR          GVAL+HGGEFSS
Sbjct: 99  EHTIQSTSTTHFFNDLVVFSPDNEQWKRISSQNSPMPRSSAAMVGHPSGVALLHGGEFSS 158

Query: 184 PKQNTFYHYSDTWLLDCTTKEWTKMEQKNGPSARSGHRMTIWKNFFILHGGFRDLGTSTT 243
           PKQNTFYHYSDTWLLDC TKEWTK+EQKNGPSARSGHRM +WKNF ILHGGFRDLGTSTT
Sbjct: 159 PKQNTFYHYSDTWLLDCATKEWTKIEQKNGPSARSGHRMAVWKNFIILHGGFRDLGTSTT 218

Query: 244 YLNDLWIFDITTYKWKQVEFPPNHPIPDARSGHSIIPTQDGAVLWGGYCKVKAGKGLQKG 303
           YLND W+FDITTYKWKQVEFP NHP+PDARSGHS+I  Q+GA+LWGGYCKVKAGKGLQKG
Sbjct: 219 YLNDCWLFDITTYKWKQVEFPQNHPVPDARSGHSLIADQEGAILWGGYCKVKAGKGLQKG 278

Query: 304 KTLTDCWYLKMKSDVSAIRWERRKKQGFQPSPRVGCSMVHHKGRGMLFGGVYDFEETEEG 363
           K LTDCWYLKM S+ SAIRW+R+K+QGFQPSPRVGCSMV HKGRG+LFGGVYDFEETEE 
Sbjct: 279 KILTDCWYLKMSSNTSAIRWDRKKRQGFQPSPRVGCSMVPHKGRGVLFGGVYDFEETEES 338

Query: 364 LASEFFNDLFSYQVEANRWYSVKMRPQKKKTVAI-SRNNRNKDEELENILNDILQQANLA 422
           L S F+ND+F+YQ+  NRWYS+ +RPQ+KK V + +R+ +++++ELE++LN IL+ A L 
Sbjct: 339 LESNFYNDVFTYQINMNRWYSLSLRPQRKKQVKLNNRSTKDQEKELEDLLNKILRNAQLD 398

Query: 423 XXXXXXXNEIKRELQRIDEE-EALENSRKQYEVVGQLPHPRFNATTAVVDDFLFIFGGVW 481
                   +   E   ++E+ +  E+  K++ ++ +LPHPRFNA TAVVDD LFIFGGVW
Sbjct: 399 DQGEEEEIDAAEESTAVEEDSDESESLDKEHVIMNELPHPRFNAATAVVDDTLFIFGGVW 458

Query: 482 EFGERDFSIDSFYSIDLNKLDGVKVYWENLSELEKAKALGXXXXXXXXXXXXXXXXXXXX 541
           EFGE+D+SIDSFY IDLNK DGV VYWE+L+ LE AK                       
Sbjct: 459 EFGEKDYSIDSFYGIDLNKADGVTVYWEDLTALENAKDE-DDSDEDEGEEDDDDEEDSEE 517

Query: 542 XTADQKLVAXXXXXXXXXXXXXXXXXIPDLRPWLPHPKPFETLRAFYIRTGAEFLKWAIS 601
              DQKLVA                 IPD RPWLPHPK FE+LR+FY+RTGA FL+WAIS
Sbjct: 518 EQVDQKLVA-EDEDEEEEEFEEEEMEIPDPRPWLPHPKAFESLRSFYVRTGATFLEWAIS 576

Query: 602 NNRDAKGKHLKKQSFDLCXXXXXXXXXXXXXXXXKXXXXXXXXXXXXRDPAQTMKRR 658
           NNR  KGKHLK +SF++C                K            RD  +T KRR
Sbjct: 577 NNRHVKGKHLKTKSFEICESRWWERRDQVRLEEDKLEELGGVGEIIERDTTKTKKRR 633

>KLLA0D00836g Chr4 complement(78202..80124) [1923 bp, 640 aa] {ON}
           similar to uniprot|Q08979 Saccharomyces cerevisiae
           YPL263C KEL3 Cytoplasmic protein of unknown function
          Length = 640

 Score =  728 bits (1879), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/551 (64%), Positives = 412/551 (74%), Gaps = 9/551 (1%)

Query: 78  LANFKKEQELFQEVLVTPVERPSQRINSCMVANPIHGKRELLIFGGEHTNSTNSLTAFYN 137
           LANFK+EQE F+++ V  V+RP QRIN CM  NP HGKREL++FGGE T      T FYN
Sbjct: 51  LANFKREQENFEKINVENVDRPDQRINPCMFVNPAHGKRELMMFGGESTTQETGTTHFYN 110

Query: 138 ELFTYSLDSDQWRKITSRNSPMPRXXXXXXXXXXGVALIHGGEFSSPKQNTFYHYSDTWL 197
           +LF YSLD+D W++ TS+NSPMPR          GVALIHGGEFSSPKQNTFYHYSD+WL
Sbjct: 111 DLFVYSLDTDTWKRYTSQNSPMPRSSAAVASHPTGVALIHGGEFSSPKQNTFYHYSDSWL 170

Query: 198 LDCTTKEWTKMEQKNGPSARSGHRMTIWKNFFILHGGFRDLGTSTTYLNDLWIFDITTYK 257
            DC++KEWTK+EQKNGPSARSGHRM IWKNF ILHGGFRDLGTSTTYLNDLW+FDIT YK
Sbjct: 171 FDCSSKEWTKVEQKNGPSARSGHRMAIWKNFIILHGGFRDLGTSTTYLNDLWVFDITNYK 230

Query: 258 WKQVEFPPNHPIPDARSGHSIIPTQDGAVLWGGYCKVKAGKGLQKGKTLTDCWYLKMKSD 317
           WKQVE P NHPIPDARSGHS+I T +GAVL+GGY KVKAGKGLQKGK L+DCWYLKMKSD
Sbjct: 231 WKQVELPANHPIPDARSGHSLISTAEGAVLYGGYTKVKAGKGLQKGKILSDCWYLKMKSD 290

Query: 318 VSAIRWERRKKQGFQPSPRVGCSMVHHKGRGMLFGGVYDFEETEEGLASEFFNDLFSYQV 377
           + +IRWERRKKQG QPSPRVGCSMVHHKGRG+LFGGVYDFEETEE L S F+N+L++YQ+
Sbjct: 291 LGSIRWERRKKQGSQPSPRVGCSMVHHKGRGVLFGGVYDFEETEESLRSIFYNELYTYQI 350

Query: 378 EANRWYSVKMRPQ-KKKTVAISRNNRNKDEELENILNDILQQANLAXXXXXXXNEIKRE- 435
           E NRWY++ +RPQ KKK    S++NRNKD+ELE+ILN IL +ANL        +++  E 
Sbjct: 351 ENNRWYAMSLRPQRKKKNFVQSKSNRNKDKELEDILNQILDKANLRDAEDDDESKVIEEQ 410

Query: 436 ------LQRIDEEEALENSRKQYEVVGQLPHPRFNATTAVVDDFLFIFGGVWEFGERDFS 489
                 +   D++E+ + S K YE +  LPH RFNA TAVVDD LFIFGG  E GE+D+ 
Sbjct: 411 LNQLDLIDFDDDDESDKKSAKSYETMSTLPHARFNAATAVVDDTLFIFGGTVEIGEKDYP 470

Query: 490 IDSFYSIDLNKLDGVKVYWENLSELEKAKALGXX-XXXXXXXXXXXXXXXXXXXTADQKL 548
           IDSFYSID+NKLDGVKVYWE L E+E+A+ LG                        D KL
Sbjct: 471 IDSFYSIDMNKLDGVKVYWEELKEVERAEKLGEQDSDDEFGDEDDDDEDDGEEEIVDSKL 530

Query: 549 VAXXXXXXXXXXXXXXXXXIPDLRPWLPHPKPFETLRAFYIRTGAEFLKWAISNNRDAKG 608
            A                 IPDLRPWLPHPK FETLRAFY+RTG  FL+ AIS+NRD+KG
Sbjct: 531 EAEDEEEEEEEEEVEEEYEIPDLRPWLPHPKAFETLRAFYVRTGPTFLELAISSNRDSKG 590

Query: 609 KHLKKQSFDLC 619
           KHLK +SF+LC
Sbjct: 591 KHLKTKSFELC 601

>NCAS0D02190 Chr4 complement(408069..410006) [1938 bp, 645 aa] {ON}
           Anc_6.10
          Length = 645

 Score =  718 bits (1853), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/555 (62%), Positives = 408/555 (73%), Gaps = 11/555 (1%)

Query: 76  EVLANFKKEQELFQEVLVTPVERPSQRINSCMVANPIHGKRELLIFGGEHTNSTNSLTAF 135
           +VLANFK +QE F+ V V  + +P+QR+NSCM+  P H K+ELLIFGGE TN   S+T F
Sbjct: 51  QVLANFKLQQEQFEHVNVESISKPAQRLNSCMITTPNHSKKELLIFGGEFTNPETSMTHF 110

Query: 136 YNELFTYSLDSDQWRKITSRNSPMPRXXXXXXXXXXGVALIHGGEFSSPKQNTFYHYSDT 195
           YNEL TYS D+ QWRKITS+NSPMPR          G+AL+HGGEFSSPKQNTFYHYSDT
Sbjct: 111 YNELITYSPDNGQWRKITSQNSPMPRSSAAMCAHPSGIALLHGGEFSSPKQNTFYHYSDT 170

Query: 196 WLLDCTTKEWTKMEQKNGPSARSGHRMTIWKNFFILHGGFRDLGTSTTYLNDLWIFDITT 255
           WLLD  TKEWTKM+   GP  RSGHR+TIWKN+FIL GGF+DLG ST+Y ND W FDITT
Sbjct: 171 WLLDTHTKEWTKMDSAKGPPGRSGHRITIWKNYFILSGGFKDLGHSTSYFNDCWCFDITT 230

Query: 256 YKWKQVEFPPNHPIPDARSGHSIIPTQDGAVLWGGYCKVKAGKGLQKGKTLTDCWYLKMK 315
           YKWKQ+EFPPNHPIPDARSGHS IPT++G +LWGGYCKVKAGKGLQKGK L DCWYLKMK
Sbjct: 231 YKWKQIEFPPNHPIPDARSGHSWIPTEEGCILWGGYCKVKAGKGLQKGKILNDCWYLKMK 290

Query: 316 SDVSAIRWERRKKQGFQPSPRVGCSMVHHKGRGMLFGGVYDFEETEEGLASEFFNDLFSY 375
           SD+S +RWERRKKQGFQPSPRVGCSM +HKGRG+LFGGVYDFEETEE L S F+NDLFSY
Sbjct: 291 SDLSQVRWERRKKQGFQPSPRVGCSMAYHKGRGILFGGVYDFEETEESLESIFYNDLFSY 350

Query: 376 QVEANRWYSVKMR-PQKKKTVAISRNNRN---KDEELENILNDILQQANL-----AXXXX 426
            VE+NRW+S+ +R  QK K VA S NN++   K++EL+++LN IL++ NL          
Sbjct: 351 NVESNRWFSLSLRKAQKFKKVAKSSNNKSSKEKEKELQDLLNQILEKNNLKDDDDDDEIS 410

Query: 427 XXXNEIKRELQRIDEEEALENSRK-QYEVVGQLPHPRFNATTAVVDDFLFIFGGVWEFGE 485
                        D+E+  E+S+  Q  V+ QLPHPRFNA T VVDD LFI+GG+WE GE
Sbjct: 411 TGTETETETAANSDDEDNKEHSKSAQVTVMSQLPHPRFNAATTVVDDSLFIYGGIWEMGE 470

Query: 486 RDFSIDSFYSIDLNKLDGVKVYWENLSELEKAKALGXXXXXXXXXXXXXXXXXXXXXTAD 545
           +D++IDS YSIDLNKLDGV  YWE+L E+EKAK +G                       D
Sbjct: 471 KDYAIDSLYSIDLNKLDGVSCYWEDLQEIEKAKEIGEQDSDEDEEEEDDEEDDDEEEIED 530

Query: 546 QKLVA-XXXXXXXXXXXXXXXXXIPDLRPWLPHPKPFETLRAFYIRTGAEFLKWAISNNR 604
           +KLVA                  IPDLRPWLPHPKPFE+LRAFYIR GA FL+WAISNN+
Sbjct: 531 KKLVAEEDDEEEEEEEEEFEEMEIPDLRPWLPHPKPFESLRAFYIREGAAFLEWAISNNK 590

Query: 605 DAKGKHLKKQSFDLC 619
             +GKHLKK+SFDLC
Sbjct: 591 HVRGKHLKKKSFDLC 605

>CAGL0A01067g Chr1 (106866..108791) [1926 bp, 641 aa] {ON} similar
           to uniprot|Q08979 Saccharomyces cerevisiae YPL263c KEL3
          Length = 641

 Score =  691 bits (1783), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/554 (60%), Positives = 409/554 (73%), Gaps = 11/554 (1%)

Query: 77  VLANFKKEQELFQEVLVTPVERPSQRINSCMVANPI--HGKRELLIFGGEHTNSTNSLTA 134
           VLANFKKEQE F++V V  V++ ++R+N CMV NP     K+EL++FGGE TN   S T 
Sbjct: 49  VLANFKKEQEQFEKVAVDSVDKVNKRLNPCMVGNPSASSSKKELIVFGGEFTNPQTSTTT 108

Query: 135 FYNELFTYSLDSDQWRKITSRNSPMPRXXXXXXXXXXGVALIHGGEFSSPKQNTFYHYSD 194
           FYN+L T++ +++QW++ TS+N+PMPR          G+AL+HGGEFSSPKQNTFYHYSD
Sbjct: 109 FYNDLHTFTPENNQWKRYTSQNAPMPRSSAAMAAHPSGIALLHGGEFSSPKQNTFYHYSD 168

Query: 195 TWLLDCTTKEWTKMEQKNGPSARSGHRMTIWKNFFILHGGFRDLGTSTTYLNDLWIFDIT 254
           TW+LDC TKEW K++ K GPSARSGHR+T+WKNFFILHGGFRDLGTSTTYL+D W+FDIT
Sbjct: 169 TWILDCNTKEWAKVDAKVGPSARSGHRITVWKNFFILHGGFRDLGTSTTYLSDCWLFDIT 228

Query: 255 TYKWKQVEFPPNHPIPDARSGHSIIPTQDGAVLWGGYCKVKAG-KGLQKGKTLTDCWYLK 313
           TYKWKQVEFP NH +PDARSGHS IPT +GA+LWGGYCKVKA  KG QKGK L+DCWYLK
Sbjct: 229 TYKWKQVEFPSNHQVPDARSGHSFIPTAEGAILWGGYCKVKANKKGYQKGKILSDCWYLK 288

Query: 314 MKSDVSAIRWERRKKQGFQPSPRVGCSMVHHKGRGMLFGGVYDFEETEEGLASEFFNDLF 373
           MKSD+S IRWERR+KQGFQPSPRVGCSM +HKGRG+LFGGVYDFEETEE L S FFNDLF
Sbjct: 289 MKSDISGIRWERRRKQGFQPSPRVGCSMAYHKGRGILFGGVYDFEETEESLESNFFNDLF 348

Query: 374 SYQVEANRWYSVKMRPQKKKTVAIS----RNNRNKDEELENILNDILQQANLAXXX--XX 427
           SY +E+NRWYS+ +R +K    A++    +N++ +++EL+ +L+ IL++ANL        
Sbjct: 349 SYHIESNRWYSLSIRSRKSNNNAVAKKSGKNSKEQEKELKMLLDSILEKANLQDKSDDDE 408

Query: 428 XXNEIKRELQRID-EEEALENSRKQYEVVGQLPHPRFNATTAVVDDFLFIFGGVWEFGER 486
              EI   L ++D E+E  E    Q+ ++ QLPHPRFNATT V+DD LFIFGG+WE G++
Sbjct: 409 DDEEINTALAKVDLEDEEEEQLAVQHTILTQLPHPRFNATTTVIDDTLFIFGGIWELGDK 468

Query: 487 DFSIDSFYSIDLNKLDGVKVYWENLSELEKAKALGX-XXXXXXXXXXXXXXXXXXXXTAD 545
           +F IDS YSIDLNKLDGV +YWE+L E+E+AK LG                        +
Sbjct: 469 EFMIDSLYSIDLNKLDGVTMYWEDLKEIERAKELGVEDSDFEDDDEDDDDEDDDEEDDNE 528

Query: 546 QKLVAXXXXXXXXXXXXXXXXXIPDLRPWLPHPKPFETLRAFYIRTGAEFLKWAISNNRD 605
           +                      PD RPWLPHPKPFETLRAFYIR GA FL+WAISNN++
Sbjct: 529 KDEGDDEESEEEEEEEIEEELEYPDPRPWLPHPKPFETLRAFYIREGAAFLEWAISNNKN 588

Query: 606 AKGKHLKKQSFDLC 619
           AKGKHLKK SFDLC
Sbjct: 589 AKGKHLKKHSFDLC 602

>KAFR0B06500 Chr2 (1347509..1349419) [1911 bp, 636 aa] {ON} Anc_6.10
           YPL263C
          Length = 636

 Score =  644 bits (1662), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/562 (56%), Positives = 401/562 (71%), Gaps = 9/562 (1%)

Query: 64  LGSEXXXXXXXXEVLANFKKEQELFQEVLVTPVERPSQRINSCMVANPIHGKRELLIFGG 123
           L S+        E+L NFKKEQE ++++ +  VE+PS R N  ++++    K+ELL+FGG
Sbjct: 38  LDSDDEDDGNIEEILENFKKEQENYEKINIESVEKPSIRNNGSIISSTT--KKELLLFGG 95

Query: 124 EHTNSTNSLTAFYNELFTYSLDSDQWRKITSRNSPMPRXXXXXXXXXXGVALIHGGEFSS 183
           EHT+     T FYN+L+T+S D++QW++ITS+NSPMPR          G+AL++GGEFSS
Sbjct: 96  EHTSKELQTTKFYNDLYTFSPDNNQWKRITSQNSPMPRSSAAMAAHPSGIALLNGGEFSS 155

Query: 184 PKQNTFYHYSDTWLLDCTTKEWTKMEQKNGPSARSGHRMTIWKNFFILHGGFRDLGTSTT 243
           PKQ+TFYHYSDTW+LD TTKEWTK+E K  P  RSGHR+T WKN+FIL GGF+DLG STT
Sbjct: 156 PKQSTFYHYSDTWILDLTTKEWTKIEGKVKPVGRSGHRITTWKNYFILFGGFKDLGHSTT 215

Query: 244 YLNDLWIFDITTYKWKQVEFPPNHPIPDARSGHSIIPTQDGAVLWGGYCKVKAGKGLQKG 303
           Y ND+W+FDITTYKWKQVEFP NH +PDARSGHS+IPT +G +++GGYCK+KA KGLQKG
Sbjct: 216 YYNDVWLFDITTYKWKQVEFPKNHTLPDARSGHSLIPTSEGCIVYGGYCKIKAKKGLQKG 275

Query: 304 KTLTDCWYLKMKSDVSAIRWERRKKQGFQPSPRVGCSMVHHKGRGMLFGGVYDFEETEEG 363
           K L+ CW LKMK+DV AIRWERR+KQGFQPSPRVGCSM +HKGRG+LFGGVYDF+ETEE 
Sbjct: 276 KLLSGCWNLKMKADVEAIRWERRRKQGFQPSPRVGCSMAYHKGRGILFGGVYDFDETEES 335

Query: 364 LASEFFNDLFSYQVEANRWYSV--KMRPQKKKTVAISRN--NRNKDEELENILNDILQQA 419
           L S F+NDLF+Y +E+NRW++V  K R    KT++ ++N  ++ K+ EL+++LN IL++ 
Sbjct: 336 LESIFYNDLFTYNIESNRWFNVTLKKRSNATKTISSTKNKSSKEKERELQDLLNQILEKN 395

Query: 420 NLAXXXXXXXNEIKRELQRIDEEEALENSRKQYEVVGQLPHPRFNATTAVVDDFLFIFGG 479
           NL                  DE++  + ++   + V QLPHPRFNATT V+DD L+I+GG
Sbjct: 396 NLKPDDEEEEESSDI-FGSDDEDDEEQKNKIDIKTVTQLPHPRFNATTTVIDDMLYIYGG 454

Query: 480 VWEFGERDFSIDSFYSIDLNKLDGVKVYWENLSELEKAKALGXX-XXXXXXXXXXXXXXX 538
            WEFGE D+SIDSFYSIDLNKLDGV VYWE+L+E+E AK LG                  
Sbjct: 455 AWEFGEIDYSIDSFYSIDLNKLDGVNVYWEDLNEIETAKELGEQGSEDEDEDDFEEDEED 514

Query: 539 XXXXTADQKLVA-XXXXXXXXXXXXXXXXXIPDLRPWLPHPKPFETLRAFYIRTGAEFLK 597
                 D KL+A                  IPD RPWLPHPK FE+LRAFY+R G  FL+
Sbjct: 515 GEEEVEDTKLIAEDVEDEKEEEEEEYPEMEIPDPRPWLPHPKAFESLRAFYLREGPAFLE 574

Query: 598 WAISNNRDAKGKHLKKQSFDLC 619
           WAISNNR  +GK LK++SF+LC
Sbjct: 575 WAISNNRHTRGKLLKQKSFELC 596

>NDAI0I02750 Chr9 complement(644137..646128) [1992 bp, 663 aa] {ON}
           Anc_6.10 YPL263C
          Length = 663

 Score =  613 bits (1581), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/572 (54%), Positives = 387/572 (67%), Gaps = 30/572 (5%)

Query: 77  VLANFKKEQELFQEVLVTPVERP-----SQRINSCMV-ANPIHGKR--ELLIFGGEHTNS 128
           VLANFK EQE F+++ V  + +      S R NS M+ A   H K+  ELL+FGGE+T+ 
Sbjct: 53  VLANFKMEQEKFEKINVELLPQGQHNHISPRSNSSMITAASAHNKKGKELLMFGGEYTSP 112

Query: 129 TNSLTAFYNELFTYSLDSDQWRKITSRNSPMPRXXXXXXXXXXGVALIHGGEFSSPKQNT 188
              +T FYN+L +Y+ D+ QWRKITS+NSPMPR          G+A++HGGEFSSPKQNT
Sbjct: 113 ETGMTHFYNDLLSYTPDTQQWRKITSQNSPMPRSSAAMCYHPSGIAILHGGEFSSPKQNT 172

Query: 189 FYHYSDTWLLDCTTKEWTKMEQKNGPSARSGHRMTIWKNFFILHGGFRDLGTS-TTYLND 247
           FYHYSDTW+LD +TKEWTK++ K  P ARSGHR+  WKN+F+L GGF+D+G + T Y ND
Sbjct: 173 FYHYSDTWILDTSTKEWTKVDIKKSPVARSGHRIVHWKNYFVLFGGFKDIGNNQTNYFND 232

Query: 248 LWIFDITTYKWKQVEFPPNHPIPDARSGHSIIPTQDGAVLWGGYCKVKA--GKGLQKGKT 305
           +W FDI  YKW QVEFP NHP+PD RSGHS IP ++G +LWGGY KVK+    G QKGK 
Sbjct: 233 VWCFDILNYKWTQVEFPKNHPLPDPRSGHSWIPVEEGCILWGGYTKVKSKLKSGQQKGKI 292

Query: 306 LTDCWYLKMKSDVSAIRWERRKKQGFQPSPRVGCSMVHHKGRGMLFGGVYDFEETEEGLA 365
           L DCWYLKMKSD+S+IRWERRKK GFQPSPRVGCSM +HKGRG+LFGGVYDF+ETEE L 
Sbjct: 293 LNDCWYLKMKSDLSSIRWERRKKLGFQPSPRVGCSMAYHKGRGILFGGVYDFDETEESLE 352

Query: 366 SEFFNDLFSYQVEANRWYSVKMRPQKKKTVAISR-NNRN---KDEELENILNDILQQANL 421
           S F+NDLFSY VE NRW+++ +R  +K   ++ R NN+N   K++EL+++LN IL++ NL
Sbjct: 353 SLFYNDLFSYNVETNRWFALNLRKNQKGNKSLKRSNNKNSKEKEKELQDLLNQILEKNNL 412

Query: 422 --------AXXXXXXXNEIKRELQRIDEEEALENSRKQYE---VVGQLPHPRFNATTAVV 470
                                      ++E  E + ++ E   ++ QLPHPR+N    VV
Sbjct: 413 KDEDDEDDEEVNENEDGSTTASTAATSDDEDTERTTQEAEGVTIMNQLPHPRYNVAMTVV 472

Query: 471 DDFLFIFGGVWEFGERDFSIDSFYSIDLNKLDGVKVYWENLSELEKAKALGXXXX---XX 527
           DD LFI+GG WE GE+D+ I+SFYSIDLN++DGV  YWE+L E+EKAK LG         
Sbjct: 473 DDLLFIYGGSWELGEKDYFINSFYSIDLNRIDGVTCYWEDLKEIEKAKELGEQDSDEEDD 532

Query: 528 XXXXXXXXXXXXXXXTADQKLVAXXXXXXXXXXXXXXXXXIPDLRPWLPHPKPFETLRAF 587
                            DQKLVA                 IPDLRPWLPHPKPFE+LRAF
Sbjct: 533 EDDEEDDDEDDDEEEIKDQKLVA-DDEDEEEEEEDVQEMEIPDLRPWLPHPKPFESLRAF 591

Query: 588 YIRTGAEFLKWAISNNRDAKGKHLKKQSFDLC 619
           YIR G  FL+WAISNN+  +GKHLKK+SF+LC
Sbjct: 592 YIREGPAFLEWAISNNKHVRGKHLKKKSFELC 623

>KNAG0E02780 Chr5 complement(559180..561132) [1953 bp, 650 aa] {ON}
           Anc_6.10 YPL263C
          Length = 650

 Score =  556 bits (1434), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/565 (50%), Positives = 370/565 (65%), Gaps = 30/565 (5%)

Query: 77  VLANFKKEQELFQEVLVTPVERPSQRINSCMVANPIHGKRELLIFGGEHTNSTNSLTAFY 136
           +L NFK EQE F++V+V  V  P+ R N+C+V N    K ELL+FGGE TN+  ++T FY
Sbjct: 53  ILQNFKLEQEQFEKVVVELVPHPTPRNNACLVTNA--SKPELLLFGGERTNNETNMTKFY 110

Query: 137 NELFTYSLDSDQWRKITSRNSPMPRXXXXXXXXXXGVALIHGGEFSSPKQNTFYHYSDTW 196
           N+L  Y+  ++QW+K TS+NSPMPR          GV ++ GGEFSSPKQNTFYHY+DTW
Sbjct: 111 NDLHVYNPQNNQWKKFTSQNSPMPRSSAAMCSHQSGVTILFGGEFSSPKQNTFYHYNDTW 170

Query: 197 LLDCTTKEWTKMEQKNGPSARSGHRMTIWKNFFILHGGFRDLGTSTTYLNDLWIFDITTY 256
           LLD TT+EW+K++ KNGPSARSGHR+T WKN+FIL GGF+DL   T+Y ND+W+F++  +
Sbjct: 171 LLDNTTREWSKLDFKNGPSARSGHRITTWKNYFILFGGFKDLNQGTSYFNDVWLFNVVDF 230

Query: 257 KWKQVEFPPNHPIPDARSGHSIIPTQDGAVLWGGYCKVKA--GKGLQKGKTLTDCWYLKM 314
           KW + E   N   PD RSGHS I + +G +++GGYCKVKA   K L KGKTLTDCW LKM
Sbjct: 231 KWTKWE-TTNKNQPDPRSGHSWIGSNEGPIVYGGYCKVKAKNNKSLHKGKTLTDCWILKM 289

Query: 315 KSDVSAIRWERRKKQGFQPSPRVGCSM-VHHKGRGMLFGGVYDFEETEEGLASEFFNDLF 373
             +V+ I+WERR K+G QPSPRVGCSM +H   RG+LFGGVYD EETEE L+S ++NDL+
Sbjct: 290 SQNVNEIKWERRAKKGQQPSPRVGCSMALHRNNRGILFGGVYDLEETEEDLSSIYYNDLY 349

Query: 374 SYQVEANRWYSVKMRPQKKKTVAISRNNRNK----------DEELENILNDILQQANLAX 423
           SY +E+NRWY +K+R    K    S  NRNK          ++EL+++LN IL+Q +L  
Sbjct: 350 SYNIESNRWYPLKLR----KVTQNSNANRNKSSNNTVSKEQEKELQDLLNKILEQNDLKD 405

Query: 424 XXXXXXN-------EIKRELQRIDEEEALENSRKQYEVVGQLPHPRFNATTAVVDDFLFI 476
                 +       E   + ++ D EE  E  R     + QLPH RFNA T V++D  +I
Sbjct: 406 EETNSYSGSNTPHEETTTDREQDDNEEE-EKMRTNLPKLNQLPHERFNACTTVLNDTFYI 464

Query: 477 FGGVWEFGERDFSIDSFYSIDLNKLDGVKVYWENLSELEKAKALGXXXXXXXXXXXXXXX 536
           +GG+WEF + D++IDSFYSIDLNKLDG+  Y+ENL E+E+ K LG               
Sbjct: 465 YGGMWEFKDNDYTIDSFYSIDLNKLDGITQYYENLQEIEEVKRLGDVQSEDDFEYEDDDD 524

Query: 537 XXXXXX--TADQKLVAXXXXXXXXXXXXXXXXXIPDLRPWLPHPKPFETLRAFYIRTGAE 594
                   T ++                     IPD RPWLPHPK FE+LR FYIR G +
Sbjct: 525 EDDGEAEPTNERLEAEDDDEEENEEDEGIDEMEIPDPRPWLPHPKAFESLREFYIREGPK 584

Query: 595 FLKWAISNNRDAKGKHLKKQSFDLC 619
           FL+WAISNN+ AKGKHLK++SF+LC
Sbjct: 585 FLEWAISNNKHAKGKHLKQKSFELC 609

>Suva_16.42 Chr16 complement(60142..62106) [1965 bp, 654 aa] {ON}
           YPL263C (REAL)
          Length = 654

 Score =  513 bits (1322), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 269/568 (47%), Positives = 355/568 (62%), Gaps = 27/568 (4%)

Query: 76  EVLANFKKEQELFQEVLVTPVERPSQRINSCMVANPIHGKRELLIFGGEHTNSTNSLTAF 135
           E+L++F K+Q   + V +T VERPS R++  M ANP H K EL IFGGE T+    LT F
Sbjct: 53  EILSSFTKKQTELEHVDITAVERPSCRVHPLMFANPQHNKHELFIFGGEFTDPETKLTHF 112

Query: 136 YNELFTYSLDSDQWRKITSRNSPMPRXXXXXXXXXXGVALIHGGEFSSPKQNTFYHYSDT 195
           YN+L++YS+ ++ W+K  S+N+P+PR          G+AL+HGGEFSSPKQ+ FYHYSDT
Sbjct: 113 YNDLYSYSIKNNSWKKYVSQNAPLPRSSGAVAVHSSGIALLHGGEFSSPKQSKFYHYSDT 172

Query: 196 WLLDCTTKEWTKME---QKNGPSARSGHRMTIWKNFFILHGGFRDLGTS-TTYLNDLWIF 251
           WL DC  K++TK+E   + + PSARSGHR+  WKN+FIL GGFRDLG+  T+YLNDLW F
Sbjct: 173 WLFDCHEKKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGSGQTSYLNDLWCF 232

Query: 252 DITTYKWKQVEFPPNHPIPDARSGHSIIPTQDGAVLWGGYCK--VKAGKGLQKGKTLTDC 309
           DI+ YKW ++E    +  PDARSGH  +PT + A+L GGYCK   K  K L KGK L D 
Sbjct: 233 DISNYKWTKLE---TNTKPDARSGHCFVPTDNSAILMGGYCKTIAKNNKNLMKGKILNDS 289

Query: 310 WYLKMKSDVSAIRWERRKKQGFQPSPRVGCSM-VHHKGRGMLFGGVYDFEETEEGLASEF 368
           W L +  D    +WE+ K    QPSPRVG S  +  + + + FGGVYD +ETEE L S F
Sbjct: 290 WKLTLTPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLDSIF 349

Query: 369 FNDLFSYQVEANRWYSVKMRPQK----KKTVAISRNNRNKDE--ELENILNDILQQANL- 421
           +NDL+ + +E N+W  ++++PQ+    +   A S+   NKD+  EL+++LN IL ++NL 
Sbjct: 350 YNDLYMFHLELNKWSKLRIKPQRHTNNRNAPATSKRKSNKDQEKELQDLLNSILAKSNLN 409

Query: 422 ------AXXXXXXXNEIKRELQRIDEEEALENSRKQYEVVGQLPHPRFNATTAVVDDFLF 475
                                +  DE+++   +++   +  QLPHPRFNA T VVDD LF
Sbjct: 410 DEEDDNDDSTATTTGANSSNDEGDDEDDSDFENQENITISNQLPHPRFNAATCVVDDSLF 469

Query: 476 IFGGVWEFGERDFSIDSFYSIDLNKLDGVKVYWENLSELEKAKALGXXXXXXXXXXXXXX 535
           I+ GVWE GE+D+ I+SFYSIDLNKLDGVKVYWE+LS +E+AK LG              
Sbjct: 470 IYSGVWELGEKDYPINSFYSIDLNKLDGVKVYWEDLSTVEEAKRLGDRDSDEEEFEYEDE 529

Query: 536 XXXXXXXTADQK----LVAXXXXXXXXXXXXXXXXXIPDLRPWLPHPKPFETLRAFYIRT 591
                    + +    L                   IPD R WLPHPKPFETLRAFY+R 
Sbjct: 530 DDDEDDDEEEPQDTRLLEDDDDEESEEEDDGQAQMEIPDERSWLPHPKPFETLRAFYLRE 589

Query: 592 GAEFLKWAISNNRDAKGKHLKKQSFDLC 619
           GA FL W+ISNNR+ KGK LK +SF+LC
Sbjct: 590 GANFLTWSISNNRNLKGKQLKTKSFELC 617

>YPL263C Chr16 complement(44551..46506) [1956 bp, 651 aa] {ON}
           KEL3Cytoplasmic protein of unknown function
          Length = 651

 Score =  513 bits (1321), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 270/565 (47%), Positives = 357/565 (63%), Gaps = 24/565 (4%)

Query: 76  EVLANFKKEQELFQEVLVTPVERPSQRINSCMVANPIHGKRELLIFGGEHTNSTNSLTAF 135
           E+L++F K+Q   + V +T VE+PS R +  M ANP H K EL IFGGE T+    LT F
Sbjct: 53  EILSSFSKKQIELEHVDITSVEKPSCRTHPLMFANPQHNKHELFIFGGEFTDPETKLTHF 112

Query: 136 YNELFTYSLDSDQWRKITSRNSPMPRXXXXXXXXXXGVALIHGGEFSSPKQNTFYHYSDT 195
           YN+L++YS+ ++ W+K  S+N+P+PR          G+AL+HGGEFSSPKQ+ FYHYSDT
Sbjct: 113 YNDLYSYSIKNNSWKKYVSQNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDT 172

Query: 196 WLLDCTTKEWTKME---QKNGPSARSGHRMTIWKNFFILHGGFRDLGTS-TTYLNDLWIF 251
           WL DC  +++TK+E   + + PSARSGHR+  WKN+FIL GGFRDLG   T+YLNDLW F
Sbjct: 173 WLFDCVERKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCF 232

Query: 252 DITTYKWKQVEFPPNHPIPDARSGHSIIPTQDGAVLWGGYCKV--KAGKGLQKGKTLTDC 309
           DI+TYKW ++E    +  PDARSGH  IPT + A+L GGYCK+  K  K L KGK L D 
Sbjct: 233 DISTYKWTKLE---TNSKPDARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDA 289

Query: 310 WYLKMKSDVSAIRWERRKKQGFQPSPRVGCSM-VHHKGRGMLFGGVYDFEETEEGLASEF 368
           W L +  D    +WE+ K    QPSPRVG S  +  + + + FGGVYD +ETEE L S F
Sbjct: 290 WKLNLTPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVF 349

Query: 369 FNDLFSYQVEANRWYSVKMRPQK----KKTVAISRNNRNKDE--ELENILNDILQQANLA 422
           +NDL+ + +E N+W  ++++PQ+    K + A S+   NKD+  EL+++LN IL ++NL 
Sbjct: 350 YNDLYMFHLELNKWSKLRIKPQRQTNSKNSPATSKRKSNKDQEKELQDLLNSILAKSNLN 409

Query: 423 XXXXXXXNEIKRELQRI-----DEEEALENSRKQYEVVGQLPHPRFNATTAVVDDFLFIF 477
                  +        I     +E+++  ++++   +  QLPHPRFNA T VV D LFI+
Sbjct: 410 DDDDDNDDNSTTGPNSIDDDEDNEDDSDLDNQEDITISNQLPHPRFNAATCVVGDSLFIY 469

Query: 478 GGVWEFGERDFSIDSFYSIDLNKLDGVKVYWENLSELEKAKALGXXXXXXXXXXXXXXXX 537
            GVWE GE+D+ I+SFYSIDLNKLDGVKVYWE+LS +E+AK LG                
Sbjct: 470 SGVWELGEKDYPINSFYSIDLNKLDGVKVYWEDLSAIEEAKRLGDRDSDEDEFEYEDDEE 529

Query: 538 XXXXXTADQK---LVAXXXXXXXXXXXXXXXXXIPDLRPWLPHPKPFETLRAFYIRTGAE 594
                  +Q    L                   IPD R WLPHPKPFETLRAFY+R GA 
Sbjct: 530 DEDDGEEEQDAGPLEGDEDEESESDDDKQAQMEIPDERSWLPHPKPFETLRAFYLREGAN 589

Query: 595 FLKWAISNNRDAKGKHLKKQSFDLC 619
           FL W+ISNNR+ KGK LK +SF+LC
Sbjct: 590 FLTWSISNNRNLKGKQLKTKSFELC 614

>Skud_16.14 Chr16 complement(23637..25595) [1959 bp, 652 aa] {ON}
           YPL263C (REAL)
          Length = 652

 Score =  512 bits (1318), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 266/567 (46%), Positives = 359/567 (63%), Gaps = 27/567 (4%)

Query: 76  EVLANFKKEQELFQEVLVTPVERPSQRINSCMVANPIHGKRELLIFGGEHTNSTNSLTAF 135
           E+L++F K+Q   + V +T VER S R +  M ANP H KREL IFGGE T+    LT F
Sbjct: 53  EILSSFTKKQTELEHVDITAVERLSCRTHPLMFANPQHNKRELFIFGGEFTDPETKLTHF 112

Query: 136 YNELFTYSLDSDQWRKITSRNSPMPRXXXXXXXXXXGVALIHGGEFSSPKQNTFYHYSDT 195
           YN+L++YS+ ++ W+K  S+N+P+PR          G+AL+HGGEFSSPKQ+ FYHYSDT
Sbjct: 113 YNDLYSYSIKNNSWKKYVSKNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDT 172

Query: 196 WLLDCTTKEWTKME---QKNGPSARSGHRMTIWKNFFILHGGFRDLGTS-TTYLNDLWIF 251
           WL DC  +++TK+E   + + PSARSGHR+  WKN+FIL GGFRDLG   T+YLNDLW F
Sbjct: 173 WLFDCAERKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCF 232

Query: 252 DITTYKWKQVEFPPNHPIPDARSGHSIIPTQDGAVLWGGYCKV--KAGKGLQKGKTLTDC 309
           DI+ YKW ++E    +  P+ARSGH  IPT + A+L GGYCK+  K  K L KGK L D 
Sbjct: 233 DISNYKWTKLE---TNTKPEARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDA 289

Query: 310 WYLKMKSDVSAIRWERRKKQGFQPSPRVGCSM-VHHKGRGMLFGGVYDFEETEEGLASEF 368
           W L +  D    +WE+ K    QPSPRVG S  +  + + + FGGVYD +ETEE L S F
Sbjct: 290 WKLNLTPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVF 349

Query: 369 FNDLFSYQVEANRWYSVKMRPQKKKT------VAISRNNRNKDEELENILNDILQQANLA 422
           +NDL+ + +E N+W  ++++PQ++         +  ++N+++++EL+++LN IL ++NL 
Sbjct: 350 YNDLYMFHLELNKWSKLRIKPQRQTNNKNAPLTSKRKSNKDQEKELQDLLNSILAKSNLN 409

Query: 423 XXXXXX-----XNEIKRELQRIDEEEALENSRKQYEVVGQLPHPRFNATTAVVDDFLFIF 477
                       N I  + +  D++  L+N  +   +  QLPHPRFNA T VVDD LFI+
Sbjct: 410 DDDDDDNTTTGSNSIDGDDEGEDDDSDLDNP-ENITISNQLPHPRFNAATCVVDDSLFIY 468

Query: 478 GGVWEFGERDFSIDSFYSIDLNKLDGVKVYWENLSELEKAKALGXXXXXXXXXXXXXXXX 537
            GVWE GE+D+ I+SFYSIDLNKLDGV VYWE+LS +E+AK LG                
Sbjct: 469 SGVWELGEKDYPINSFYSIDLNKLDGVNVYWEDLSTIEEAKRLGDRDSDEDDFEYEDDDD 528

Query: 538 XXXXXTADQK-----LVAXXXXXXXXXXXXXXXXXIPDLRPWLPHPKPFETLRAFYIRTG 592
                  +++     L                   IPD R WLPHPKPFETLRAFY+R G
Sbjct: 529 DDGEDNDEEEQDVALLEGDEDEEGENEDNGQAQMEIPDERSWLPHPKPFETLRAFYLREG 588

Query: 593 AEFLKWAISNNRDAKGKHLKKQSFDLC 619
           A FL W+ISNN+D KGKHLK +SF++C
Sbjct: 589 ANFLTWSISNNKDLKGKHLKTKSFEIC 615

>Smik_6.471 Chr6 (774663..776618) [1956 bp, 651 aa] {ON} YPL263C
           (REAL)
          Length = 651

 Score =  502 bits (1292), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 267/564 (47%), Positives = 353/564 (62%), Gaps = 24/564 (4%)

Query: 77  VLANFKKEQELFQEVLVTPVERPSQRINSCMVANPIHGKRELLIFGGEHTNSTNSLTAFY 136
           +L++F K+Q   + V +T VERPS R +  M ANP H K EL IFGGE T+S   LT FY
Sbjct: 54  ILSSFTKKQTELEHVDITAVERPSCRTHPLMFANPQHNKHELFIFGGEFTDSETKLTHFY 113

Query: 137 NELFTYSLDSDQWRKITSRNSPMPRXXXXXXXXXXGVALIHGGEFSSPKQNTFYHYSDTW 196
           N+L++YS+ ++ W+K  S+N+P+PR          G+AL+HGGEFSSPKQ+ FYHYSDTW
Sbjct: 114 NDLYSYSIKNNSWKKYVSQNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTW 173

Query: 197 LLDCTTKEWTKME---QKNGPSARSGHRMTIWKNFFILHGGFRDLGTS-TTYLNDLWIFD 252
           L DC  +++ K+E   + + PSARSGHR+  WKN+FIL GGFRDLG   T+YLNDLW FD
Sbjct: 174 LFDCVERKFNKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFD 233

Query: 253 ITTYKWKQVEFPPNHPIPDARSGHSIIPTQDGAVLWGGYCK--VKAGKGLQKGKTLTDCW 310
           I+ YKW ++E    +  PDARSGH  IPT + A+L GGYCK   K  K L KGK L D W
Sbjct: 234 ISNYKWSKIE---TNSKPDARSGHCFIPTDNSAILMGGYCKTIAKNNKNLMKGKILNDAW 290

Query: 311 YLKMKSDVSAIRWERRKKQGFQPSPRVGCSM-VHHKGRGMLFGGVYDFEETEEGLASEFF 369
            L +  D    +WE+ K    QPSPRVG S  +  + + + FGGVYD +ETEE L S F+
Sbjct: 291 KLNLTPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFY 350

Query: 370 NDLFSYQVEANRWYSVKMRPQK----KKTVAISRNNRNKDE--ELENILNDILQQANLAX 423
           NDL+ + +E N+W  ++++ Q+    + + A S+   NKD+  EL+++LN IL ++NL  
Sbjct: 351 NDLYMFHLELNKWSKLRIKSQRQTSNRNSPATSKRKSNKDQEKELQDLLNSILAKSNLND 410

Query: 424 XXXXXXNEIKRELQRI-----DEEEALENSRKQYEVVGQLPHPRFNATTAVVDDFLFIFG 478
                 +        I     +E+++  ++++   +  QLPHPRFNA T VV D LFI+ 
Sbjct: 411 DDDENDDYTATGSNSIDGDEDEEDDSDLDNQEDITISNQLPHPRFNAATCVVGDSLFIYS 470

Query: 479 GVWEFGERDFSIDSFYSIDLNKLDGVKVYWENLSELEKAKALGXXXXXXXXXXXXXXXXX 538
           GVWE GE+D+ I+SFYSIDLNKLDGVKVYWE LS +E+AK LG                 
Sbjct: 471 GVWELGEKDYPINSFYSIDLNKLDGVKVYWEELSAIEEAKRLGDRDSDEEEFEYEDEEDD 530

Query: 539 XXXXTADQK---LVAXXXXXXXXXXXXXXXXXIPDLRPWLPHPKPFETLRAFYIRTGAEF 595
                 +Q    L +                 IPD R WLPHPKPFETLRAFY+R GA F
Sbjct: 531 EDQSEEEQDAGLLESDEDEESDDEDDGQAQMEIPDERSWLPHPKPFETLRAFYLREGANF 590

Query: 596 LKWAISNNRDAKGKHLKKQSFDLC 619
           L W+ISNNR+ KGK LK +SF+LC
Sbjct: 591 LTWSISNNRNLKGKQLKTKSFELC 614

>Kpol_1050.69 s1050 complement(150301..153555) [3255 bp, 1084 aa]
           {ON} complement(150301..153555) [3255 nt, 1085 aa]
          Length = 1084

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 70/254 (27%), Positives = 103/254 (40%), Gaps = 44/254 (17%)

Query: 149 WRKITSRNSPMPRXXXXXXXXXXGVALIH--GGEFSSPKQNTFYHYSDTWLLDCTTKEWT 206
           W +I  +NSP PR              I+  GG            Y DTW++ C   + T
Sbjct: 139 WNRIKLQNSPFPRYRHVSSAYATASNNIYILGGLHDQSV------YGDTWIISCN-PDAT 191

Query: 207 KMEQK------NGPSARSGHRMTIWKNFFILHGG-FRDLGTSTTYLNDLWIFDITTYKWK 259
           +   K      N P  R GH  T+  N FI+ GG    +       +D+++F+I +YKW 
Sbjct: 192 QFSSKSVDIGENTPPPRVGHAATLCGNAFIVFGGDTHKVNKEGLMDDDIYLFNINSYKWT 251

Query: 260 QVEFP-PNHPIPDARSGHSIIPTQDGAVLWGGYCKVKAGKGLQKGKTLTDCWYLKMKS-D 317
               P P  P P  R GH I       +L     K K       G    D ++  +   D
Sbjct: 252 ---IPNPIGPRPLGRYGHKI------CILATSTVKTKL---YLFGGQFDDTYFNDLAVFD 299

Query: 318 VSAIR-----WERRKKQGFQPSPRVGCSMVHHKGRGMLFGGVYDFEETEEGLASEFFNDL 372
           +S+ R     WE  K +GF P P    +MV +     ++GG     +T++GL     ND+
Sbjct: 300 LSSFRRQDSHWEFIKSKGFMPPPLTNHTMVTYGSDLWIYGG-----DTQQGL----INDI 350

Query: 373 FSYQVEANRWYSVK 386
           F +    N W  V+
Sbjct: 351 FKFSPNTNTWTKVE 364

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 54/205 (26%), Positives = 87/205 (42%), Gaps = 30/205 (14%)

Query: 95  PVERPSQRINSCMVANPIHGKRELLIFGGEHTNSTNSLTAFYNELFTYSLDS-----DQW 149
           P+ R   +I  C++A     K +L +FGG+  ++      ++N+L  + L S       W
Sbjct: 260 PLGRYGHKI--CILATST-VKTKLYLFGGQFDDT------YFNDLAVFDLSSFRRQDSHW 310

Query: 150 RKITSRNSPMPRXXXXXXXXXXGVAL-IHGGEFSSPKQNTFYHYSDTWLLDCTTKEWTKM 208
             I S+   MP           G  L I+GG+      N  + +S        T  WTK+
Sbjct: 311 EFIKSKGF-MPPPLTNHTMVTYGSDLWIYGGDTQQGLINDIFKFS------PNTNTWTKV 363

Query: 209 EQK-NGPSARSGHRMTIWKNFFILHGGFRDLGTSTTYLNDLWIFDITTYKWKQVEFPP-N 266
           E     P     H   ++KN   + GG  +   +  YLN +++F+  + KW    FP   
Sbjct: 364 ETTGTKPPPMQEHAAVVYKNIMCVVGGKDE---NDMYLNSVYLFNFDSSKW--YTFPDFK 418

Query: 267 HPIPDARSGHSI-IPTQDGAVLWGG 290
             I   RSGHS+ +   D  ++ GG
Sbjct: 419 SGIIQGRSGHSVTLLNNDKLLIMGG 443

>NCAS0F00520 Chr6 (100048..103308) [3261 bp, 1086 aa] {ON} Anc_5.88
           YGR238C
          Length = 1086

 Score = 67.4 bits (163), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 78/298 (26%), Positives = 115/298 (38%), Gaps = 74/298 (24%)

Query: 149 WRKITSRNSPMPR---XXXXXXXXXXGVALIHGGEFSSPKQNTFYHYSDTWLLDCTTKEW 205
           W +I  +NSP PR              V +I G    S        Y DTW+L C   + 
Sbjct: 131 WNRIKLQNSPFPRYRHVASSVISDTNQVYVIGGLHDQS-------VYGDTWVLTCEDPQT 183

Query: 206 TKM-------EQKNGPSARSGHRMTIWKNFFILHGGFRDLGTSTTYL-NDLWIFDITTYK 257
           + M         +  P  R GH  T+  N F++ GG          + +D+++F+I +YK
Sbjct: 184 STMFSSRTVDITETTPPPRVGHASTLCGNAFVIFGGDTHKKNEMGEMDDDIYLFNINSYK 243

Query: 258 WKQVEFPPNHPI---PDARSGHSIIPTQDGAVLWGGYCKVKAGKGLQK-----GKTLTDC 309
           W     P  HPI   P  R GH I               + A K +Q      G    D 
Sbjct: 244 WT---IP--HPIGPRPKGRYGHKI--------------SIIARKQMQTKLYLFGGQFDDN 284

Query: 310 WYLKMKS-DVSAIR-----WERRKKQGFQPSPRVGCSMVHHKGRGMLFGGVYDFEETEEG 363
           ++  +   D+S+ R     WE  K + F P P    +MV +  +  +FGG     +T EG
Sbjct: 285 YFNDLVVFDLSSFRRDDSHWEFIKPRSFIPPPITNHTMVSYDFKLWVFGG-----DTLEG 339

Query: 364 LASEFFNDLFSYQVEANRWYSVKMRPQKKKTVAISRNNRNKDEELENILNDILQQANL 421
           L     N +F Y    N W  V+   Q              D++LEN+   + + A L
Sbjct: 340 L----LNQVFMYDPAVNDWCVVETTCQ--------------DDDLENMPPPMQEHATL 379

>ZYRO0B08228g Chr2 (641988..645869) [3882 bp, 1293 aa] {ON} similar
           to uniprot|Q75AR9 Ashbya gossypii ADL149W ADL149Wp and
           some similarites with YHR158C uniprot|P38853
           Saccharomyces cerevisiae YHR158C KEL1 Protein required
           for proper cell fusion and cell morphology functions in
           a complex with Kel2p to negatively regulate mitotic exit
           interacts with Tem1p and Lte1p localizes to regions of
           polarized growth potential Cdc28p substrate
          Length = 1293

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 68/259 (26%), Positives = 103/259 (39%), Gaps = 62/259 (23%)

Query: 149 WRKITSRNSPMPRXXXXXXXXXXGVALIHGGEFSSPKQNTFY-----H----YSDTWLLD 199
           W ++  +NSP PR               H    +  + N+ Y     H    Y DTW++ 
Sbjct: 141 WNRVKLQNSPFPRYR-------------HVASSNCSEDNSLYVIGGLHDQSVYGDTWII- 186

Query: 200 CTTKEWTKMEQKN------GPSARSGHRMTIWKNFFILHGG-FRDLGTSTTYLNDLWIFD 252
            T    T+ + K        P  R GH  T+  N F+L GG    + +     +DL++F+
Sbjct: 187 STNDNGTQFQSKTVEISETTPPPRVGHAATLCGNAFVLFGGDTHKVNSEGLMDDDLYLFN 246

Query: 253 ITTYKWKQVEFPPNHPI---PDARSGHSIIPTQDGAVLWGGYCKVKAGKGLQKGKTLTDC 309
           + +YKW     P  HPI   P  R GH I      +++     K K       G    D 
Sbjct: 247 VNSYKWT---IP--HPIGPRPLGRYGHKI------SIMAANQMKTKL---YLFGGQFDDT 292

Query: 310 WYLKMKS-DVSAIR-----WERRKKQGFQPSPRVGCSMVHHKGRGMLFGGVYDFEETEEG 363
           ++  +   D+S+ R     WE  K   F P P    +M+ +     +FGG     +T +G
Sbjct: 293 YFNDLAVFDLSSFRRPDSHWEFLKPTTFSPPPLTNHTMISYDNHLWVFGG-----DTLQG 347

Query: 364 LASEFFNDLFSYQVEANRW 382
           L     N +F Y V  N W
Sbjct: 348 L----INQVFKYDVANNDW 362

>KAFR0B04320 Chr2 complement(893930..896890) [2961 bp, 986 aa] {ON}
           Anc_5.88 YGR238C
          Length = 986

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 72/273 (26%), Positives = 105/273 (38%), Gaps = 54/273 (19%)

Query: 145 DSDQWRKITSRNSPMPR---XXXXXXXXXXGVALIHGGEFSSPKQNTFYHYSDTWLLDCT 201
           D   W +I   NSP PR              + +I G    S        Y DTW+L   
Sbjct: 130 DQTVWNRIKLANSPFPRYRHVASAYATEDDKIYVIGGLHDQSV-------YGDTWILTSE 182

Query: 202 TKEWTKMEQ-----KNGPSARSGHRMTIWKNFFILHGG-FRDLGTSTTYLNDLWIFDITT 255
                 + Q      N P  R GH  T+  N FI+ GG    +       +DL++F+I +
Sbjct: 183 NNASRFISQTVDISDNTPPPRVGHAATLCGNAFIIFGGDTHKVNKDGLMDDDLYLFNINS 242

Query: 256 YKWKQVEFP-PNHPIPDARSGH--SIIPTQDGAV---LWGGYCKVKAGKGLQKGKTLTDC 309
           +KW     P P  P P  R GH  SII T +      L+GG                 D 
Sbjct: 243 HKWT---IPNPVGPRPLGRYGHKISIIATANSKTRLYLFGGQ--------------FDDA 285

Query: 310 WYLKMKS-DVSAIR-----WERRKKQGFQPSPRVGCSMVHHKGRGMLFGGVYDFEETEEG 363
           ++  +   D+S+ R     WE  K + F P P    +MV +  +  +FGG     +T +G
Sbjct: 286 YFNDLVVFDLSSFRRPDSRWEFVKPKSFVPPPLTNHTMVSYDNKLWVFGG-----DTLQG 340

Query: 364 LASEFFNDLFSYQVEANRWYSVKMRPQKKKTVA 396
           L     N +F Y    N W +++        +A
Sbjct: 341 LT----NRVFMYDPMINDWTTIETSSDNPNNIA 369

 Score = 52.0 bits (123), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 53/211 (25%), Positives = 87/211 (41%), Gaps = 26/211 (12%)

Query: 95  PVERPSQRINSCMVANPIHGKRELLIFGGEHTNSTNSLTAFYNELFTYSLDS-----DQW 149
           P+ R   +I+    AN    K  L +FGG+  +      A++N+L  + L S      +W
Sbjct: 255 PLGRYGHKISIIATAN---SKTRLYLFGGQFDD------AYFNDLVVFDLSSFRRPDSRW 305

Query: 150 RKITSRNSPMPRXXXXXXXXXXGVALIHGGEFSSPKQNTFYHYSDTWLLDCTTKEWTKME 209
             +  ++   P               + GG+      N  + Y D  + D TT E +   
Sbjct: 306 EFVKPKSFVPPPLTNHTMVSYDNKLWVFGGDTLQGLTNRVFMY-DPMINDWTTIETSSDN 364

Query: 210 QKNGPSARSGHRMTIWKNFFILHGGFRDLGTSTTYLNDLWIFDITTYKWKQVE-FPPNHP 268
             N       H   ++K+   + GG  +     TYLN ++  ++ T KW ++  F P   
Sbjct: 365 PNNIAPPMQEHAAIVYKDLMCIFGGKDE---QDTYLNGVYFLNLRTLKWYKLPIFAPG-- 419

Query: 269 IPDARSGHSI-IPTQDGAVLWGG----YCKV 294
           IP  RSGHSI +   D  ++ GG    Y +V
Sbjct: 420 IPQGRSGHSITLLKNDKLLIMGGDKFDYARV 450

>KNAG0K00560 Chr11 complement(96678..99992) [3315 bp, 1104 aa] {ON}
           Anc_5.88 YGR238C
          Length = 1104

 Score = 64.7 bits (156), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 72/265 (27%), Positives = 106/265 (40%), Gaps = 60/265 (22%)

Query: 149 WRKITSRNSPMPR--XXXXXXXXXXGVALIHGGEFSSPKQNTFYHYSDTWLL-------- 198
           W +I  ++SP PR                + GG      Q+ F    D W++        
Sbjct: 197 WNRIKLKDSPFPRYRHVTSSYATEDDRVFVIGGLHD---QSVF---GDVWIIKSLENGTK 250

Query: 199 -DCTTKEWTKMEQKNGPSARSGHRMTIWKNFFILHGG-FRDLGTSTTYLNDLWIFDITTY 256
              TT + T+    N P  R GH  T+  N F++ GG    +       +DL++F+I +Y
Sbjct: 251 FTSTTIDITE----NTPPPRVGHAATLCGNAFVVFGGDTHKVNKDGLMDDDLYLFNINSY 306

Query: 257 KWKQVEFP-PNHPIPDARSGH--SII---PTQDGAVLWGGYCKVKAGKGLQKGKTLTDCW 310
           KW     P P  P P  R GH  SII   P +    L+GG                 D +
Sbjct: 307 KWT---IPNPIGPRPLGRYGHKVSIIATTPMKTKLYLFGGQ--------------FDDTY 349

Query: 311 YLKMKS-DVSAIR-----WERRKKQGFQPSPRVGCSMVHHKGRGMLFGGVYDFEETEEGL 364
           +  +   D+S  R     WE  K + F P P    +MV ++ +  +FGG     +T +GL
Sbjct: 350 FNNLAVFDLSQFRRPDSHWEFLKPKSFMPPPLTNHTMVSYQNKLWIFGG-----DTLQGL 404

Query: 365 ASEFFNDLFSYQVEANRWYSVKMRP 389
                N +F Y  E N W  V+  P
Sbjct: 405 ----INKIFMYDPEVNDWTVVETFP 425

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 49/213 (23%), Positives = 83/213 (38%), Gaps = 22/213 (10%)

Query: 105 SCMVANPIHGKRELLIFGGEHTNST-NSLTAFYNELFTYSLDSDQWRKITSRNSPMPRXX 163
           S +   P+  K +L +FGG+  ++  N+L  F  +L  +      W  +  ++   P   
Sbjct: 327 SIIATTPM--KTKLYLFGGQFDDTYFNNLAVF--DLSQFRRPDSHWEFLKPKSFMPPPLT 382

Query: 164 XXXXXXXXGVALIHGGEFSSPKQNTFYHYSDTWLLDCTTKEWTKME-------QKNGPSA 216
                       I GG+      N  + Y      D    +WT +E       Q+N P  
Sbjct: 383 NHTMVSYQNKLWIFGGDTLQGLINKIFMY------DPEVNDWTVVETFPANNDQENFPPP 436

Query: 217 RSGHRMTIWKNFFILHGGFRDLGTSTTYLNDLWIFDITTYKWKQVEFPPNHPIPDARSGH 276
              H   ++ +  ++ GG  +      YLN ++   I T +W ++ F  +  IP  RSGH
Sbjct: 437 MQEHASVMYGDLMVVMGGKDE---QDNYLNTVYFLKINTLEWYKLPFL-SVGIPQGRSGH 492

Query: 277 SIIPTQDGAVLWGGYCKVKAGKGLQKGKTLTDC 309
           SI   +   +L  G  K    +  + G   TD 
Sbjct: 493 SITLLKGNKLLIMGGDKFDYARPEEHGLHTTDT 525

>KLLA0E15511g Chr5 (1388626..1391343) [2718 bp, 905 aa] {ON} similar
           to uniprot|P50090 Saccharomyces cerevisiae YGR238C KEL2
           Protein that functions in a complex with Kel1p to
           negatively regulate mitotic exit interacts with Tem1p
           and Lte1p localizes to regions of polarized growth
           potential Cdc28p substrate AND similar to YHR158C
           uniprot|P38853 Saccharomyces cerevisiae YHR158C KEL1
           Protein required for proper cell fusion and cell
           morphology functions in a complex with Kel2p to
           negatively regulate mitotic exit interacts with Tem1p
           and Lte1p localizes to regions of polarized growth
           potential Cdc28p substrate
          Length = 905

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 70/274 (25%), Positives = 109/274 (39%), Gaps = 48/274 (17%)

Query: 128 STNSLTAFYNELFTYSLDSDQWRKITSRNSPMPR--XXXXXXXXXXGVALIHGGEFSSPK 185
           ST++ +    ++FT       W +I  + SP PR            G   + GG      
Sbjct: 78  STSTQSTLQQQVFT------PWNRIRLKQSPFPRYRHVASSYATDSGELFVIGGLHDQSV 131

Query: 186 QNTFYHYSDTWL---LDCTT--KEWTKMEQKNGPSARSGHRMTIWKNFFILHGG-FRDLG 239
                 Y DTW+   LD  T  K  T       P  R GH  T+  N F++ GG    + 
Sbjct: 132 ------YGDTWIIKSLDNATSFKSITVPIADATPPPRVGHASTLCGNAFVIFGGDTHKVN 185

Query: 240 TSTTYLNDLWIFDITTYKWKQVEFP-PNHPIPDARSGHSIIPTQDGAVLWGGYCKVKAGK 298
            +    +D+++F+I ++KW     P P  P P  R GH I      +++     K K   
Sbjct: 186 DAGLMDDDIYLFNINSHKWT---IPTPQGPRPLGRYGHKI------SIIAANQMKTKL-- 234

Query: 299 GLQKGKTLTDCWYLKMKS-DVSAIR-----WERRKKQGFQPSPRVGCSMVHHKGRGMLFG 352
               G    D ++  +   D+S+ R     WE  K   F P P    +M+    +  +FG
Sbjct: 235 -YVFGGQFDDTYFNDLAEFDLSSFRRSDSHWEFIKPATFMPPPLANHTMISFDHKLWVFG 293

Query: 353 GVYDFEETEEGLASEFFNDLFSYQVEANRWYSVK 386
           G     +T +GL     N++F +   AN W  V+
Sbjct: 294 G-----DTPQGLT----NEVFMFDPAANDWCVVQ 318

 Score = 37.4 bits (85), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 49/212 (23%), Positives = 87/212 (41%), Gaps = 27/212 (12%)

Query: 95  PVERPSQRINSCMVANPIHGKRELLIFGGEHTNSTNSLTAFYNELFTYSLDS-----DQW 149
           P+ R   +I S + AN +  K +L +FGG+  ++      ++N+L  + L S       W
Sbjct: 214 PLGRYGHKI-SIIAANQM--KTKLYVFGGQFDDT------YFNDLAEFDLSSFRRSDSHW 264

Query: 150 RKITSRNSPMPRXXXXXXXXXXGVALIHGGEFSSPKQNTFYHYSDTWLLDCTTKEWTKME 209
             I       P               + GG+  +P+  T    ++ ++ D    +W  ++
Sbjct: 265 EFIKPATFMPPPLANHTMISFDHKLWVFGGD--TPQGLT----NEVFMFDPAANDWCVVQ 318

Query: 210 QK-NGPSARSGHRMTIWKNFFILHGGFRDLGTSTTYLNDLWIFDITTYKWKQVEFPP-NH 267
              N P     H   I+++   + GG +D      Y N ++  +  + KW   + P  N+
Sbjct: 319 TTGNIPPPLQEHAAIIYRDLMCVFGG-KD--AQDNYSNAVYFLNFRSLKW--FKLPTFNN 373

Query: 268 PIPDARSGHSIIPTQDGAVLWGGYCKVKAGKG 299
            IP ARSGHS+    +  +L  G  K     G
Sbjct: 374 MIPRARSGHSLTLLSNNKLLIMGGDKFDYAVG 405

>Skud_8.222 Chr8 complement(385114..388623) [3510 bp, 1169 aa] {ON}
           YHR158C (REAL)
          Length = 1169

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 68/262 (25%), Positives = 106/262 (40%), Gaps = 42/262 (16%)

Query: 149 WRKITSRNSPMPRXXXXXXXXXXGVALIH--GGEFSSPKQNTFYHYSDTWLL---DCTTK 203
           W +I  +NSP PR              I+  GG            Y DTW+L   D  TK
Sbjct: 113 WNRIKLQNSPFPRYRHVASAYVTDKNQIYVIGGLHDQSV------YGDTWILTALDNATK 166

Query: 204 -EWTKME-QKNGPSARSGHRMTIWKNFFILHGG-FRDLGTSTTYLNDLWIFDITTYKWKQ 260
              T ++  +  P  R GH   +  N F++ GG    +       +D+++ +I +YKW  
Sbjct: 167 FSTTTIDISEATPPPRVGHAAVLCGNAFVVFGGDTHKVNKEGLMDDDIYLLNINSYKWT- 225

Query: 261 VEFP-PNHPIPDARSGHSIIPTQDGAVLWGGYCKVKAGKGLQKGKTLTDCWYLKMKS-DV 318
              P P  P P  R GH I      +++     K K       G    D ++  +   D+
Sbjct: 226 --VPAPVGPRPLGRYGHKI------SIIATTQMKTKL---YVFGGQFDDTYFNDLAVYDL 274

Query: 319 SAIR-----WERRKKQGFQPSPRVGCSMVHHKGRGMLFGGVYDFEETEEGLASEFFNDLF 373
           S+ R     WE  K + F P P    +M+ +  +  +FGG     +T +GL     ND+F
Sbjct: 275 SSFRRPDSHWEFLKPKAFTPPPITNFTMISYDSKLWVFGG-----DTLQGL----INDVF 325

Query: 374 SYQVEANRWYSVKMRPQKKKTV 395
            Y    N W+ ++   +K   V
Sbjct: 326 MYDPAINDWFIIETTGEKPPPV 347

 Score = 37.4 bits (85), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 39/183 (21%), Positives = 70/183 (38%), Gaps = 24/183 (13%)

Query: 115 KRELLIFGGEHTNSTNSLTAFYNELFTYSLDS-----DQWRKITSRNSPMPRXXXXXXXX 169
           K +L +FGG+  ++      ++N+L  Y L S       W  +  +    P         
Sbjct: 251 KTKLYVFGGQFDDT------YFNDLAVYDLSSFRRPDSHWEFLKPKAFTPPPITNFTMIS 304

Query: 170 XXGVALIHGGEFSSPKQNTFYHYSDTWLLDCTTKEWTKMEQK-NGPSARSGHRMTIWKNF 228
                 + GG+      N      D ++ D    +W  +E     P     H   ++ + 
Sbjct: 305 YDSKLWVFGGDTLQGLIN------DVFMYDPAINDWFIIETTGEKPPPVQEHASVVYNDL 358

Query: 229 FILHGGFRDLGTSTTYLNDLWIFDITTYKWKQVEFPP-NHPIPDARSGHSIIPTQDGAVL 287
             + GG  +      YLN ++  ++ ++KW   + P     IP  RSGHS+   +D  +L
Sbjct: 359 MCVVGGKDE---HDAYLNSVYFLNLKSHKW--FKLPVFTAGIPQGRSGHSLTLLKDDKIL 413

Query: 288 WGG 290
             G
Sbjct: 414 IMG 416

>Suva_15.357 Chr15 complement(617637..618952,619001..621203) [3519
           bp, 1172 aa] {ON} YHR158C (REAL)
          Length = 1172

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 65/262 (24%), Positives = 105/262 (40%), Gaps = 42/262 (16%)

Query: 149 WRKITSRNSPMPRXXXXXXXXXXGVALIH--GGEFSSPKQNTFYHYSDTWLL----DCTT 202
           W +I  +NSP PR              I+  GG            Y DTW+L    D T 
Sbjct: 113 WNRIKLQNSPFPRYRHVASAYATDKNQIYVIGGLHDQSV------YGDTWILSAFDDATK 166

Query: 203 KEWTKME-QKNGPSARSGHRMTIWKNFFILHGG-FRDLGTSTTYLNDLWIFDITTYKWKQ 260
              T ++  +  P  R GH   +  N F++ GG    +       +D+++ ++ +YKW  
Sbjct: 167 FSTTTIDISEATPPPRVGHAAVLCGNAFVVFGGDTHKVNREGLMDDDIYLLNVNSYKWT- 225

Query: 261 VEFP-PNHPIPDARSGHSIIPTQDGAVLWGGYCKVKAGKGLQKGKTLTDCWYLKMKS-DV 318
              P P  P P  R GH I      +++     K K       G    D ++  +   D+
Sbjct: 226 --VPAPVGPRPLGRYGHKI------SIIATTQMKTKL---YVFGGQFDDTYFNDLAVYDL 274

Query: 319 SAIR-----WERRKKQGFQPSPRVGCSMVHHKGRGMLFGGVYDFEETEEGLASEFFNDLF 373
           S+ R     W+  K   F P P    +M+ +  +  +FGG     +T +GL     ND+F
Sbjct: 275 SSFRRPDSHWDFLKPMTFTPPPMTNFTMISYDSKLWVFGG-----DTLQGL----INDVF 325

Query: 374 SYQVEANRWYSVKMRPQKKKTV 395
            Y    N W++++   +K   V
Sbjct: 326 MYDPAKNDWFTIETSGEKPPPV 347

 Score = 40.8 bits (94), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 67/318 (21%), Positives = 117/318 (36%), Gaps = 74/318 (23%)

Query: 205 WTKMEQKNGPSARSGHRMTIW---KNFFILHGGFRDLGTSTTYLNDLWIF----DITTYK 257
           W +++ +N P  R  H  + +   KN   + GG  D     +   D WI     D T + 
Sbjct: 113 WNRIKLQNSPFPRYRHVASAYATDKNQIYVIGGLHD----QSVYGDTWILSAFDDATKFS 168

Query: 258 WKQVEFPPNHPIPDARSGHSIIPTQDGAVLWGGYCKVKAGKGLQKGKTLTDCWYLKMKSD 317
              ++     P P  R GH+ +   +  V++GG       +GL     + D  YL    +
Sbjct: 169 TTTIDISEATPPP--RVGHAAVLCGNAFVVFGGDTHKVNREGL-----MDDDIYLL---N 218

Query: 318 VSAIRWERRKKQGFQPSPRVG-----CSMVHHKGRGMLFGGVYDFEETEEGLASEFFNDL 372
           V++ +W      G +P  R G      +    K +  +FGG +D           +FNDL
Sbjct: 219 VNSYKWTVPAPVGPRPLGRYGHKISIIATTQMKTKLYVFGGQFD---------DTYFNDL 269

Query: 373 FSYQVEANR-----WYSVK----MRPQKKKTVAISRNNRN---KDEELENILNDILQQAN 420
             Y + + R     W  +K      P       IS +++      + L+ ++ND+     
Sbjct: 270 AVYDLSSFRRPDSHWDFLKPMTFTPPPMTNFTMISYDSKLWVFGGDTLQGLINDVFMY-- 327

Query: 421 LAXXXXXXXNEIKRELQRIDEEEALENSRKQYEVVGQLPHPRFNATTAVVDDFLFIFGGV 480
                                 +  +N     E  G+ P P     T V +D + + GG 
Sbjct: 328 ----------------------DPAKNDWFTIETSGEKPPPVQEHATVVYNDLMCVVGGK 365

Query: 481 WEFGERDFSIDSFYSIDL 498
               E D  +++ Y ++L
Sbjct: 366 ---DEHDAYLNTVYFLNL 380

 Score = 37.0 bits (84), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 45/100 (45%), Gaps = 7/100 (7%)

Query: 193 SDTWLLDCTTKEWTKMEQK-NGPSARSGHRMTIWKNFFILHGGFRDLGTSTTYLNDLWIF 251
           +D ++ D    +W  +E     P     H   ++ +   + GG  +      YLN ++  
Sbjct: 322 NDVFMYDPAKNDWFTIETSGEKPPPVQEHATVVYNDLMCVVGGKDE---HDAYLNTVYFL 378

Query: 252 DITTYKWKQVE-FPPNHPIPDARSGHSIIPTQDGAVLWGG 290
           ++ T+KW ++  F     IP  RSGHS+   ++  VL  G
Sbjct: 379 NLKTHKWFKLPIFAAG--IPQGRSGHSLTLLKNDKVLIMG 416

 Score = 36.2 bits (82), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 48/120 (40%), Gaps = 15/120 (12%)

Query: 118 LLIFGGEHTNSTNSLTAFYNELFTYSLDSDQWRKI-TSRNSPMPRXXXXXXXXXXGVALI 176
           L +FGG+      +L    N++F Y    + W  I TS   P P            + ++
Sbjct: 309 LWVFGGD------TLQGLINDVFMYDPAKNDWFTIETSGEKPPPVQEHATVVYNDLMCVV 362

Query: 177 HGGEFSSPKQNTFYHYSDTWLLDCTTKEWTKME--QKNGPSARSGHRMTIWKNFFILHGG 234
            G +      NT Y       L+  T +W K+       P  RSGH +T+ KN  +L  G
Sbjct: 363 GGKDEHDAYLNTVY------FLNLKTHKWFKLPIFAAGIPQGRSGHSLTLLKNDKVLIMG 416

>SAKL0H02618g Chr8 (259684..262941) [3258 bp, 1085 aa] {ON} similar
           to uniprot|P38853 Saccharomyces cerevisiae YHR158C KEL1
           Protein required for proper cell fusion and cell
           morphology functions in a complex with Kel2p to
           negatively regulate mitotic exit interacts with Tem1p
           and Lte1p localizes to regions of polarized growth
           potential Cdc28p substrate
          Length = 1085

 Score = 62.0 bits (149), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 59/209 (28%), Positives = 87/209 (41%), Gaps = 36/209 (17%)

Query: 192 YSDTWLLDCTTKEWTKMEQKN------GPSARSGHRMTIWKNFFILHGG-FRDLGTSTTY 244
           Y DTW+L       T+   K        P  R GH  T+  N F++ GG    +      
Sbjct: 112 YGDTWILTAHANN-TRFTSKTVDISDTTPPPRVGHASTLCGNAFVIFGGDTHKVNNEGLM 170

Query: 245 LNDLWIFDITTYKWKQVEFP-PNHPIPDARSGHSIIPTQDGAVLWGGYCKVKAGKGLQKG 303
            +D+++F+I +YKW     P P  P P  R GH I      +V+     K K       G
Sbjct: 171 DDDVYLFNINSYKWT---IPHPVGPRPLGRYGHKI------SVIATSQMKTKL---YVFG 218

Query: 304 KTLTDCWYLKMKS-DVSAIR-----WERRKKQGFQPSPRVGCSMVHHKGRGMLFGGVYDF 357
               D ++  +   D+S+ R     WE  K Q F P P    +MV +  +  +FGG    
Sbjct: 219 GQFDDTYFNDLCVYDLSSFRRPDSHWEFLKPQSFVPPPLTNHTMVSYDYKLWIFGG---- 274

Query: 358 EETEEGLASEFFNDLFSYQVEANRWYSVK 386
            +T +GL     N++F Y    N W  V+
Sbjct: 275 -DTAQGL----INEVFMYDPTVNDWTVVE 298

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 40/168 (23%), Positives = 71/168 (42%), Gaps = 22/168 (13%)

Query: 115 KRELLIFGGEHTNSTNSLTAFYNELFTYSLDS-----DQWRKITSRNSPMPRXXXXXXXX 169
           K +L +FGG+  ++      ++N+L  Y L S       W  +  ++   P         
Sbjct: 211 KTKLYVFGGQFDDT------YFNDLCVYDLSSFRRPDSHWEFLKPQSFVPPPLTNHTMVS 264

Query: 170 XXGVALIHGGEFSSPKQNTFYHYSDTWLLDCTTKEWTKMEQKNG-PSARSGHRMTIWKNF 228
                 I GG+ +    N  + Y      D T  +WT +E     P A   H   ++K+ 
Sbjct: 265 YDYKLWIFGGDTAQGLINEVFMY------DPTVNDWTVVETTGSKPPAIQEHAAVVYKDL 318

Query: 229 FILHGGFRDLGTSTTYLNDLWIFDITTYKWKQVEFPPNHPIPDARSGH 276
             + GG  +     +Y ND++  ++ ++KW ++ F  N  +P  RSGH
Sbjct: 319 MCVTGGKDE---QDSYSNDVYFLNLKSFKWFKLPFFKNG-VPQGRSGH 362

>YHR158C Chr8 complement(413685..417179) [3495 bp, 1164 aa] {ON}
           KEL1Protein required for proper cell fusion and cell
           morphology; functions in a complex with Kel2p to
           negatively regulate mitotic exit, interacts with Tem1p
           and Lte1p; localizes to regions of polarized growth;
           potential Cdc28p substrate
          Length = 1164

 Score = 61.6 bits (148), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 66/262 (25%), Positives = 104/262 (39%), Gaps = 42/262 (16%)

Query: 149 WRKITSRNSPMPRXXXXXXXXXXGVALIH--GGEFSSPKQNTFYHYSDTWLL----DCTT 202
           W +I  +NSP PR              I+  GG            Y DTW+L    + T 
Sbjct: 113 WNRIKLQNSPFPRYRHVASAYVTDKNQIYVIGGLHDQSV------YGDTWILTAFDNATR 166

Query: 203 KEWTKME-QKNGPSARSGHRMTIWKNFFILHGG-FRDLGTSTTYLNDLWIFDITTYKWKQ 260
              T ++  +  P  R GH   +  N F++ GG    +       +D+++ +I +YKW  
Sbjct: 167 FSTTTIDISEATPPPRVGHAAVLCGNAFVVFGGDTHKVNKEGLMDDDIYLLNINSYKWT- 225

Query: 261 VEFP-PNHPIPDARSGHSIIPTQDGAVLWGGYCKVKAGKGLQKGKTLTDCWYLKMKS-DV 318
              P P  P P  R GH I      +++     K K       G    D ++  +   D+
Sbjct: 226 --VPAPVGPRPLGRYGHKI------SIIATTQMKTKL---YVFGGQFDDTYFNDLAVYDL 274

Query: 319 SAIR-----WERRKKQGFQPSPRVGCSMVHHKGRGMLFGGVYDFEETEEGLASEFFNDLF 373
           S+ R     WE  K + F P P    +M+ +  +  +FGG     +T +GL     ND+F
Sbjct: 275 SSFRRPDSHWEFLKPRTFTPPPITNFTMISYDSKLWVFGG-----DTLQGLV----NDVF 325

Query: 374 SYQVEANRWYSVKMRPQKKKTV 395
            Y    N W+ +    +K   V
Sbjct: 326 MYDPAINDWFIIDTTGEKPPPV 347

 Score = 36.6 bits (83), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 40/185 (21%), Positives = 69/185 (37%), Gaps = 28/185 (15%)

Query: 115 KRELLIFGGEHTNSTNSLTAFYNELFTYSLDS-----DQWRKITSRNSPMPRXXXXXXXX 169
           K +L +FGG+  ++      ++N+L  Y L S       W  +  R    P         
Sbjct: 251 KTKLYVFGGQFDDT------YFNDLAVYDLSSFRRPDSHWEFLKPRTFTPPPITNFTMIS 304

Query: 170 XXGVALIHGGEFSSPKQNTFYHYS---DTWLLDCTTKEWTKMEQKNGPSARSGHRMTIWK 226
                 + GG+      N  + Y    + W +  TT E         P     H   ++ 
Sbjct: 305 YDSKLWVFGGDTLQGLVNDVFMYDPAINDWFIIDTTGE--------KPPPVQEHATVVYN 356

Query: 227 NFFILHGGFRDLGTSTTYLNDLWIFDITTYKWKQVEFPP-NHPIPDARSGHSIIPTQDGA 285
           +   + GG  +      YLN ++  ++ + KW   + P     IP  RSGHS+   ++  
Sbjct: 357 DLMCVVGGKDE---HDAYLNSVYFLNLKSRKW--FKLPVFTAGIPQGRSGHSLTLLKNDK 411

Query: 286 VLWGG 290
           +L  G
Sbjct: 412 ILIMG 416

>Smik_8.242 Chr8 complement(390631..394137) [3507 bp, 1168 aa] {ON}
           YHR158C (REAL)
          Length = 1168

 Score = 61.2 bits (147), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 67/262 (25%), Positives = 106/262 (40%), Gaps = 42/262 (16%)

Query: 149 WRKITSRNSPMPRXXXXXXXXXXGVALIH--GGEFSSPKQNTFYHYSDTWLL---DCTTK 203
           W +I  ++SP PR              I+  GG            Y DTW+L   D  TK
Sbjct: 113 WNRIKLQDSPFPRYRHVSSAYVTDKNQIYVIGGLHDQSV------YGDTWILTAFDNATK 166

Query: 204 -EWTKME-QKNGPSARSGHRMTIWKNFFILHGG-FRDLGTSTTYLNDLWIFDITTYKWKQ 260
              T ++  +  P  R GH   +  N F++ GG    +       +D+++ +I +YKW  
Sbjct: 167 FSTTTIDISEATPPPRVGHAAVLCGNAFVVFGGDTHKVNKEGLMDDDIYLLNINSYKWT- 225

Query: 261 VEFP-PNHPIPDARSGHSIIPTQDGAVLWGGYCKVKAGKGLQKGKTLTDCWYLKMKS-DV 318
              P P  P P  R GH I      +++     K K       G    D ++  +   D+
Sbjct: 226 --VPAPVGPRPLGRYGHKI------SIIATNQMKTKL---YVFGGQFDDTYFNDLAVYDL 274

Query: 319 SAIR-----WERRKKQGFQPSPRVGCSMVHHKGRGMLFGGVYDFEETEEGLASEFFNDLF 373
           S+ R     WE  K + F P P    +M+ +  +  +FGG     +T +GL     ND+F
Sbjct: 275 SSFRRPDSHWEFLKPKTFSPPPITNFTMISYDSKLWVFGG-----DTLQGLV----NDVF 325

Query: 374 SYQVEANRWYSVKMRPQKKKTV 395
            Y    N W+ ++   +K   V
Sbjct: 326 MYDPALNDWFIIETTGEKPPPV 347

 Score = 35.0 bits (79), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 44/205 (21%), Positives = 78/205 (38%), Gaps = 31/205 (15%)

Query: 95  PVERPSQRINSCMVANPIHGKRELLIFGGEHTNSTNSLTAFYNELFTYSLDS-----DQW 149
           P+ R   +I S +  N +  K +L +FGG+  ++      ++N+L  Y L S       W
Sbjct: 234 PLGRYGHKI-SIIATNQM--KTKLYVFGGQFDDT------YFNDLAVYDLSSFRRPDSHW 284

Query: 150 RKITSRNSPMPRXXXXXXXXXXGVALIHGGEFSSPKQNTFYHYS---DTWLLDCTTKEWT 206
             +  +    P               + GG+      N  + Y    + W +  TT E  
Sbjct: 285 EFLKPKTFSPPPITNFTMISYDSKLWVFGGDTLQGLVNDVFMYDPALNDWFIIETTGE-- 342

Query: 207 KMEQKNGPSARSGHRMTIWKNFFILHGGFRDLGTSTTYLNDLWIFDITTYKWKQVEFPP- 265
                  P     H   ++ +   + GG  +      YLN ++  ++ + KW   + P  
Sbjct: 343 ------KPPPVQEHATVVYNDLMCVVGGKDE---HDAYLNSVYFLNLKSNKW--FKLPVF 391

Query: 266 NHPIPDARSGHSIIPTQDGAVLWGG 290
              IP  RSGHS+   ++  +L  G
Sbjct: 392 TAGIPQGRSGHSLTLLKNDKILIMG 416

 Score = 34.7 bits (78), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 33/142 (23%), Positives = 53/142 (37%), Gaps = 13/142 (9%)

Query: 118 LLIFGGEHTNSTNSLTAFYNELFTYSLDSDQWRKITSRNSPMPRXXXXXXXXXXGVALIH 177
           L +FGG+      +L    N++F Y    + W  I +     P            +  + 
Sbjct: 309 LWVFGGD------TLQGLVNDVFMYDPALNDWFIIETTGEKPPPVQEHATVVYNDLMCVV 362

Query: 178 GGEFSSPKQNTFYHYSDTWLLDCTTKEWTKME--QKNGPSARSGHRMTIWKNFFILHGGF 235
           GG     K     + +  + L+  + +W K+       P  RSGH +T+ KN  IL  G 
Sbjct: 363 GG-----KDEHDAYLNSVYFLNLKSNKWFKLPVFTAGIPQGRSGHSLTLLKNDKILIMGG 417

Query: 236 RDLGTSTTYLNDLWIFDITTYK 257
                +    +DL   DI   K
Sbjct: 418 DKFDYARVEESDLHTSDIDMQK 439

>TDEL0G01120 Chr7 (229805..232834) [3030 bp, 1009 aa] {ON} Anc_5.88
           YGR238C
          Length = 1009

 Score = 60.5 bits (145), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 56/209 (26%), Positives = 90/209 (43%), Gaps = 36/209 (17%)

Query: 192 YSDTWLLDCTTKEWTKMEQKN------GPSARSGHRMTIWKNFFILHGG-FRDLGTSTTY 244
           Y DTW+++      T+   K        P  R GH  T+  N F++ GG    + +    
Sbjct: 133 YGDTWIINVD-DSGTQFSSKTVDISEFTPPPRVGHAATLCGNAFVIFGGDTHKVNSEGLM 191

Query: 245 LNDLWIFDITTYKWKQVEFP-PNHPIPDARSGHSIIPTQDGAVLWGGYCKVKAGKGLQKG 303
            +DL++F+I ++KW     P P  P P  R GH I      +++     K K       G
Sbjct: 192 DDDLYLFNINSFKWT---IPHPVGPRPLGRYGHKI------SIIATNQMKTKL---YLFG 239

Query: 304 KTLTDCWYLKMKS-DVSAIR-----WERRKKQGFQPSPRVGCSMVHHKGRGMLFGGVYDF 357
               D ++  +   D+S+ R     WE  K + F P P    +MV +  +  +FGG    
Sbjct: 240 GQFDDTFFNDLAVYDLSSFRRSDSHWEFLKPKTFVPPPLANHTMVSYDHKLWIFGG---- 295

Query: 358 EETEEGLASEFFNDLFSYQVEANRWYSVK 386
            +T +GL     N +F Y + +N W  V+
Sbjct: 296 -DTMQGL----INKVFVYDIMSNDWSLVE 319

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 43/183 (23%), Positives = 72/183 (39%), Gaps = 24/183 (13%)

Query: 115 KRELLIFGGEHTNSTNSLTAFYNELFTYSLDS-----DQWRKITSRNSPMPRXXXXXXXX 169
           K +L +FGG+  ++      F+N+L  Y L S       W  +  +    P         
Sbjct: 232 KTKLYLFGGQFDDT------FFNDLAVYDLSSFRRSDSHWEFLKPKTFVPPPLANHTMVS 285

Query: 170 XXGVALIHGGEFSSPKQNTFYHYSDTWLLDCTTKEWTKMEQKNG-PSARSGHRMTIWKNF 228
                 I GG+      N  + Y      D  + +W+ +E     P     H   I+K+ 
Sbjct: 286 YDHKLWIFGGDTMQGLINKVFVY------DIMSNDWSLVETTGARPPPLQEHAALIYKDL 339

Query: 229 FILHGGFRDLGTSTTYLNDLWIFDITTYKWKQVEFPP-NHPIPDARSGHSIIPTQDGAVL 287
             + GG  +      YLN ++  ++ + +W   +FP     IP  RSGHSI   ++  +L
Sbjct: 340 MCVVGGKDE---QDIYLNSIYFLNLKSCRW--FKFPVFKAGIPQGRSGHSITLLKNNKIL 394

Query: 288 WGG 290
             G
Sbjct: 395 IMG 397

>Kwal_14.1019 s14 (159934..162870) [2937 bp, 978 aa] {ON} YHR158C
           (KEL1) - involved in cell fusion and morphology;
           contains six Kelch repeats [contig 244] FULL
          Length = 978

 Score = 60.1 bits (144), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 65/266 (24%), Positives = 106/266 (39%), Gaps = 58/266 (21%)

Query: 149 WRKITSRNSPMPRXXXXXXXXXXGVALIHGGEFSSPKQNTFY-----H----YSDTWLLD 199
           WR+I   NSP PR               H     + +QN  Y     H    Y DTW++ 
Sbjct: 76  WRRIKLANSPFPRYR-------------HVASAYASEQNQVYVIGGLHDQSVYGDTWIV- 121

Query: 200 CTTKEWTKMEQKN------GPSARSGHRMTIWKNFFILHGG-FRDLGTSTTYLNDLWIFD 252
            + +   +   K        P  R GH  T+  N F++ GG    + +     +D+++F+
Sbjct: 122 TSHENGARFTSKTVEISDATPPPRVGHASTLCGNAFVIFGGDTHKVNSDGLMDDDVYLFN 181

Query: 253 ITTYKWKQVEFP-PNHPIPDARSGHSIIPTQDGAVLWGGYCKVKAGKGLQKGKTLTDCWY 311
           I +YKW     P P  P P  R GH I      +++     K K       G    D ++
Sbjct: 182 INSYKWT---IPNPVGPRPLGRYGHKI------SIIAMSPMKTKL---YVFGGQFDDTYF 229

Query: 312 LKMKS-DVSAIR-----WERRKKQGFQPSPRVGCSMVHHKGRGMLFGGVYDFEETEEGLA 365
             +   D+S+ R     W+      F P P    +M+ +  +  +FGG     +T +GL 
Sbjct: 230 NDLAVFDLSSFRRPDSSWQFITPNSFTPPPLTNHAMISYDYKLWVFGG-----DTPQGL- 283

Query: 366 SEFFNDLFSYQVEANRWYSVKMRPQK 391
               +D+F +  + N W  ++   QK
Sbjct: 284 ---IDDVFVFDPQVNDWKFIQTTGQK 306

>KLTH0C01474g Chr3 (131243..134413) [3171 bp, 1056 aa] {ON} similar
           to uniprot|P38853 Saccharomyces cerevisiae YHR158C KEL1
           Protein required for proper cell fusion and cell
           morphology functions in a complex with Kel2p to
           negatively regulate mitotic exit interacts with Tem1p
           and Lte1p localizes to regions of polarized growth
           potential Cdc28p substrate
          Length = 1056

 Score = 58.9 bits (141), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 64/256 (25%), Positives = 103/256 (40%), Gaps = 56/256 (21%)

Query: 149 WRKITSRNSPMPRXXXXXXXXXXGVALIHGGEFSSPKQNTFY-----H----YSDTWLL- 198
           W ++   NSP PR               H     + +QN  Y     H    Y DTW++ 
Sbjct: 78  WSRVKLANSPFPRYR-------------HVASAYASEQNQVYVIGGLHDQSVYGDTWIIS 124

Query: 199 --DCTTKEWTKMEQ--KNGPSARSGHRMTIWKNFFILHGG-FRDLGTSTTYLNDLWIFDI 253
             D  +K  +K        P  R GH  T+  N F++ GG    + +     +D+++F+I
Sbjct: 125 AHDNGSKFSSKTVDITDTTPPPRVGHASTLCGNAFVIFGGDTHKVNSDGLMDDDVYLFNI 184

Query: 254 TTYKWKQVEFP-PNHPIPDARSGHSIIPTQDGAVLWGGYCKVKAGKGLQKGKTLTDCWYL 312
            +YKW     P P  P P  R GH I      +++     + K       G    D ++ 
Sbjct: 185 NSYKWT---IPRPVGPRPLGRYGHKI------SIIATSQMRTKL---YVFGGQFDDTYFN 232

Query: 313 KMKS-DVSAIR-----WERRKKQGFQPSPRVGCSMVHHKGRGMLFGGVYDFEETEEGLAS 366
            +   D+S+ R     W+  K   F P P    +M+ +  +  +FGG     +T +GL  
Sbjct: 233 DLTVFDLSSFRRPDSHWQFIKPNTFTPPPLTNHTMISYDYKLWVFGG-----DTPQGL-- 285

Query: 367 EFFNDLFSYQVEANRW 382
              ND+F +  + N W
Sbjct: 286 --INDVFMFDPQINDW 299

>NDAI0D02600 Chr4 complement(600880..604383) [3504 bp, 1167 aa] {ON}
           Anc_5.88 YGR238C
          Length = 1167

 Score = 58.5 bits (140), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 64/254 (25%), Positives = 99/254 (38%), Gaps = 42/254 (16%)

Query: 149 WRKITSRNSPMPR--XXXXXXXXXXGVALIHGGEFSSPKQNTFYHYSDTWLLD------- 199
           W +I  +NSP PR            G   + GG            Y DTW+L        
Sbjct: 160 WNRIKLQNSPFPRYRHVASSYVSDDGKIYVIGGLHDQSV------YGDTWILSYENNGLS 213

Query: 200 CTTKEWTKMEQKNGPSARSGHRMTIWKNFFILHGG-FRDLGTSTTYLNDLWIFDITTYKW 258
            T    T    +N P  R GH  T+  N F++ GG    +    +  +D+++F+I +YKW
Sbjct: 214 TTITSKTVDISENTPPPRVGHAATLCGNAFVIFGGDTHKVNKDGSMDDDIYLFNINSYKW 273

Query: 259 KQVEFPPNHPIPDARSGHSIIPTQDGAVLWGGYCKVKAGKGLQKGKTLTDCWYLKMKS-D 317
              +  P    P  R GH I      +++     K K       G    D ++  +   D
Sbjct: 274 TIPK--PVGQRPLGRYGHKI------SIIATSQMKTKL---YLFGGQFDDTYFNDLVVFD 322

Query: 318 VSAIR-----WERRKKQGFQPSPRVGCSMVHHKGRGMLFGGVYDFEETEEGLASEFFNDL 372
           +S+ R     WE  + + F P P    +M  +  +  +FGG     +T +GL     N +
Sbjct: 323 LSSFRRPDSHWEFIRPKSFIPPPLTNHTMCSYDHKLWVFGG-----DTLQGLT----NQV 373

Query: 373 FSYQVEANRWYSVK 386
           F Y    N W  V+
Sbjct: 374 FMYDPVDNDWCVVE 387

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/188 (22%), Positives = 74/188 (39%), Gaps = 28/188 (14%)

Query: 115 KRELLIFGGEHTNSTNSLTAFYNELFTYSLDS-----DQWRKITSRNSPMPRXXXXXXXX 169
           K +L +FGG+  ++      ++N+L  + L S       W  I  ++   P         
Sbjct: 300 KTKLYLFGGQFDDT------YFNDLVVFDLSSFRRPDSHWEFIRPKSFIPPPLTNHTMCS 353

Query: 170 XXGVALIHGGEFSSPKQNTFYHYSDTWLLDCTTKEWTKMEQ-------KNGPSARSGHRM 222
                 + GG+      N  + Y      D    +W  +E         N P     H  
Sbjct: 354 YDHKLWVFGGDTLQGLTNQVFMY------DPVDNDWCVVETFANNNDVSNIPPPIQEHAA 407

Query: 223 TIWKNFFILHGGFRDLGTSTTYLNDLWIFDITTYKWKQVEFPPNHPIPDARSGHSIIPTQ 282
            ++K+   + GG  +   S  YLND++  ++ T KW ++ F     +P  RSGHS+   +
Sbjct: 408 VLYKDLMCVIGGKDE---SDNYLNDVYFLNLKTLKWFKLPF-YKEGVPQGRSGHSVTLLK 463

Query: 283 DGAVLWGG 290
           +  +L  G
Sbjct: 464 NDKILIMG 471

>CAGL0I02090g Chr9 complement(177324..180734) [3411 bp, 1136 aa]
           {ON} some similarities with uniprot|P38853 Saccharomyces
           cerevisiae YHR158c KEL1 involved in cell fusion and
           morphology
          Length = 1136

 Score = 58.2 bits (139), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 67/261 (25%), Positives = 99/261 (37%), Gaps = 54/261 (20%)

Query: 149 WRKITSRNSPMPR--XXXXXXXXXXGVALIHGGEFSSPKQNTFYHYSDTWLLDCTT---- 202
           W +I   NSP PR            G   + GG            Y DTW+L  +     
Sbjct: 147 WGRIRLSNSPFPRYRHVSSSHITDQGKIYVIGGLHDQSV------YGDTWILTASDIDKT 200

Query: 203 ------KEWTKMEQKNGPSARSGHRMTIWKNFFILHGG-FRDLGTSTTYLNDLWIFDITT 255
                 K  T    ++ P  R GH  T+  N F++ GG    + +     +DL++ +I +
Sbjct: 201 GAINSFKSTTIEITESTPPPRVGHASTLCGNAFVVFGGDTHKVNSDGLMDDDLYLLNINS 260

Query: 256 YKWKQVEFP-PNHPIPDARSGHSIIPT---QDGAVLWGGYCKVKAGKGLQKGKTLTDCWY 311
           YKW     P P    P  R GH I+     Q    L+GG                 D ++
Sbjct: 261 YKWT---IPKPVGQRPLGRYGHKIVTISAEQTKLYLFGGQ--------------FDDTYF 303

Query: 312 LKMKS-DVSAIR-----WERRKKQGFQPSPRVGCSMVHHKGRGMLFGGVYDFEETEEGLA 365
             +   D+S+ R     W   K  GF P P    +MV ++ +  +FGG    +  EEGL 
Sbjct: 304 GDLAVFDLSSFRRPDSHWVFLKPSGFNPPPLTNHTMVTYQDKIWVFGG----DTLEEGL- 358

Query: 366 SEFFNDLFSYQVEANRWYSVK 386
               N ++ Y    N W  V+
Sbjct: 359 ---INRVYLYSPTNNSWEIVE 376

 Score = 41.6 bits (96), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 45/96 (46%), Gaps = 5/96 (5%)

Query: 196 WLLDCTTKEWTKMEQKNG-PSARSGHRMTIWKNFFILHGGFRDLGTSTTYLNDLWIFDIT 254
           +L   T   W  +E     P     H   ++K+   + GG +D      YLN L+  ++ 
Sbjct: 363 YLYSPTNNSWEIVETTGDIPPPMQEHAAIVYKDLMCVVGG-KD--AEDNYLNTLYFLNLQ 419

Query: 255 TYKWKQVEFPPNHPIPDARSGHSIIPTQDGAVLWGG 290
           + KW ++ F  N+ IP  RSGHS+   ++  +L  G
Sbjct: 420 SLKWFKLPFYKNN-IPQGRSGHSVTLLKNDQILIMG 454

>CAGL0F07997g Chr6 complement(785803..788613) [2811 bp, 936 aa] {ON}
           weakly similar to uniprot|P50090 Saccharomyces
           cerevisiae YGR238c KEL2 or uniprot|P38853 Saccharomyces
           cerevisiae YHR158c KEL1
          Length = 936

 Score = 57.4 bits (137), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 61/250 (24%), Positives = 101/250 (40%), Gaps = 55/250 (22%)

Query: 192 YSDTWLLDCTTKEWTKMEQK-----NGPSARSGHRMTIWKNFFILHGG-FRDLGTSTTYL 245
           Y DTW+L   +       Q      N P  R GH  T+  N  ++ GG    L +     
Sbjct: 201 YGDTWMLTANSDSTNFTTQVIDLTVNTPPPRVGHAATLCGNALVIFGGDTHKLNSEGLLD 260

Query: 246 NDLWIFDITTYKWKQVEFP-PNHPIPDARSGHSI-----IPTQDGAVLWGGYCKVKAGKG 299
           +DL++F++ +++W     P P    P  R GH +      P +    L+GG         
Sbjct: 261 DDLYLFNVDSHRWT---IPTPIGTRPLGRYGHQVSVIATTPKKAKLYLFGG--------- 308

Query: 300 LQKGKTLTDCWYLKMKS-DVSAIR-----WERRKKQGFQPSPRVGCSMVHHKGRGMLFGG 353
                 L D ++  +   D+S  R     W+  K + F P P    +MV +  +  +FGG
Sbjct: 309 -----QLDDNYFNDLAMYDLSDFRNPHSRWQFLKSKAFTPPPLTNHTMVAYDYKLWVFGG 363

Query: 354 VYDFEETEEGLASEFFNDLFSYQVEANRWYSV-----KMRPQKKKTVAISRN------NR 402
                 +  G   E  N L+ Y  + N W  +     K +P ++ +  I +N       +
Sbjct: 364 ------SSRG---ELQNQLYVYIPDLNEWRCLETEGDKPQPIQEHSATIYKNLMCVFGGK 414

Query: 403 NKDEELENIL 412
           NKD+E +N +
Sbjct: 415 NKDDEYQNTM 424

>TPHA0A05170 Chr1 complement(1161610..1164660) [3051 bp, 1016 aa]
           {ON} Anc_5.88 YGR238C
          Length = 1016

 Score = 57.0 bits (136), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 65/249 (26%), Positives = 100/249 (40%), Gaps = 56/249 (22%)

Query: 149 WRKITSRNSPMPR---XXXXXXXXXXGVALIHGGEFSSPKQNTFYHYSDTWLLDCTTKEW 205
           W +I   NSP PR              + +I G    S        Y DTW +  +T   
Sbjct: 142 WNRIKLTNSPFPRYRHVASSYESVDNEIFVIGGLHDQSV-------YGDTWSI-TSTNNG 193

Query: 206 TKMEQKN------GPSARSGHRMTIWKNFFILHGG-FRDLGTSTTYLNDLWIFDITTYKW 258
           T+   K        P  R GH  T+  N F++ GG    +       +D+++F+I ++KW
Sbjct: 194 TQFISKALEILDLSPPPRVGHASTLCGNAFVVFGGDTHKVNKDGLMDDDIYLFNINSHKW 253

Query: 259 KQVEFP-PNHPIPDARSGH--SIIPTQDGAV---LWGGYCKVKAGKGLQKGKTLTDCWYL 312
                P P  P P  R GH  SII T        L+GG                 D ++ 
Sbjct: 254 T---IPSPVGPRPLGRYGHKISIIATSSSKTKLYLFGGQ--------------FDDTYFN 296

Query: 313 KMKS-DVSAIR-----WERRKKQGFQPSPRVGCSMVHHKGRGMLFGGVYDFEETEEGLAS 366
            +   D+S+ R     WE  K +G  P P    +MV +  +  +FGG     +T++GL  
Sbjct: 297 DIAVFDLSSFRRADSHWEFIKPKGLIPPPMTNHTMVTYDNKLWVFGG-----DTKDGL-- 349

Query: 367 EFFNDLFSY 375
              ND++++
Sbjct: 350 --INDIYAF 356

>TBLA0C06530 Chr3 complement(1577728..1581246) [3519 bp, 1172 aa]
           {ON} Anc_5.88 YGR238C
          Length = 1172

 Score = 57.0 bits (136), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 55/193 (28%), Positives = 81/193 (41%), Gaps = 35/193 (18%)

Query: 214 PSARSGHRMTIWKNFFILHGGFRDLGTSTTYLND-LWIFDITTYKWKQVEFPPNHPIPDA 272
           P  R GH  T+  N F++ GG          ++D +++F+I +YKW   +  P  P P  
Sbjct: 140 PPPRVGHASTLCGNAFVIFGGDTHKTNKDGLMDDDIYLFNINSYKWTIPQ--PVGPRPLG 197

Query: 273 RSGH--SIIPTQDGAV---LWGGYCKVKAGKGLQKGKTLTDCWYLKMKSDVSAIR----- 322
           R GH  SII T        ++GG         L        C Y     D+S+ R     
Sbjct: 198 RYGHKISIIATSQMKTKLYVFGGQFDDSYFNDL--------CVY-----DLSSFRKPESH 244

Query: 323 WERRKKQGFQPSPRVGCSMVHHKGRGMLFGGVYDFEETEEGLASEFFNDLFSYQVEANRW 382
           WE  K + F P P    +MV +  +  +FGG     +T++GL     N LF +    N W
Sbjct: 245 WEFLKPKSFIPPPLTNHTMVSYDYKLWVFGG-----DTQQGL----INQLFMFDPVINDW 295

Query: 383 YSVKMRPQKKKTV 395
             V+   +K   V
Sbjct: 296 RVVETTGEKPPPV 308

 Score = 34.7 bits (78), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 40/183 (21%), Positives = 71/183 (38%), Gaps = 24/183 (13%)

Query: 115 KRELLIFGGEHTNSTNSLTAFYNELFTYSLDS-----DQWRKITSRNSPMPRXXXXXXXX 169
           K +L +FGG+  +S      ++N+L  Y L S       W  +  ++   P         
Sbjct: 212 KTKLYVFGGQFDDS------YFNDLCVYDLSSFRKPESHWEFLKPKSFIPPPLTNHTMVS 265

Query: 170 XXGVALIHGGEFSSPKQNTFYHYSDTWLLDCTTKEWTKMEQK-NGPSARSGHRMTIWKNF 228
                 + GG+      N  +      + D    +W  +E     P     H   ++ + 
Sbjct: 266 YDYKLWVFGGDTQQGLINQLF------MFDPVINDWRVVETTGEKPPPVQEHAAVMFNDL 319

Query: 229 FILHGGFRDLGTSTTYLNDLWIFDITTYKW-KQVEFPPNHPIPDARSGHSIIPTQDGAVL 287
             + GG  +      YLN ++  ++ + KW K  ++  N  IP  RSGHSI   ++  +L
Sbjct: 320 MCIMGGKDE---QDVYLNSVYFLNLKSLKWFKFNDYKLN--IPQGRSGHSITLLKNNRLL 374

Query: 288 WGG 290
             G
Sbjct: 375 IMG 377

>Kpol_1010.62 s1010 complement(151895..154816) [2922 bp, 973 aa]
           {ON} complement(151895..154816) [2922 nt, 974 aa]
          Length = 973

 Score = 56.6 bits (135), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 55/188 (29%), Positives = 79/188 (42%), Gaps = 43/188 (22%)

Query: 214 PSARSGHRMTIWKNFFILHGG-FRDLGTSTTYLNDLWIFDITTYKWKQVEFPPNHPI--- 269
           P  R GH  TI  N  IL GG    +       +DL++F++ +YKW   E     PI   
Sbjct: 102 PPPRVGHASTICGNALILFGGDTHKVNEDGLMDDDLYLFNLNSYKWTIPE-----PIGLR 156

Query: 270 PDARSGH--SII---PTQDGAVLWGGYCKVKAGKGLQKGKTLTDCWYLKMKS-DVSAIR- 322
           P  R GH  SII   PT+    L+GG                 D ++  +   D+S  R 
Sbjct: 157 PLGRYGHKISIIATQPTKTKLFLFGGQ--------------FDDTYFNDLSMFDLSTFRK 202

Query: 323 ----WERRKKQGFQPSPRVGCSMVHHKGRGMLFGGVYDFEETEEGLASEFFNDLFSYQVE 378
               WE  K + F P P    +M+ +  +  +FGG     ET +GL     N++F Y   
Sbjct: 203 PDAQWEFIKPKSFFPPPVSNHTMISYDNKLWVFGG-----ETLQGL----INEVFVYDPI 253

Query: 379 ANRWYSVK 386
            N W  ++
Sbjct: 254 VNDWSVIE 261

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 48/196 (24%), Positives = 82/196 (41%), Gaps = 19/196 (9%)

Query: 95  PVERPSQRINSCMVANPIHGKRELLIFGGEHTNST-NSLTAFYNELFTYSLDSDQWRKIT 153
           P+ R   +I S +   P   K +L +FGG+  ++  N L+ F  +L T+     QW  I 
Sbjct: 157 PLGRYGHKI-SIIATQPT--KTKLFLFGGQFDDTYFNDLSMF--DLSTFRKPDAQWEFIK 211

Query: 154 SRNSPMPRXXXXXXXXXXGVALIHGGEFSSPKQNTFYHYSDTWLLDCTTKEWTKMEQK-N 212
            ++   P               + GGE      N  + Y      D    +W+ +E   +
Sbjct: 212 PKSFFPPPVSNHTMISYDNKLWVFGGETLQGLINEVFVY------DPIVNDWSVIETTGS 265

Query: 213 GPSARSGHRMTIWKNFFILHGGFRDLGTSTTYLNDLWIFDITTYKWKQVEFPPNHP-IPD 271
            P     H   ++KN   + GG +D  +   Y+N ++  ++ T KW   + P  +P I  
Sbjct: 266 SPPPIQEHAAVVYKNLMCVVGG-KD--SKDNYMNSVYFLNLNTLKW--FKLPHINPGIMQ 320

Query: 272 ARSGHSIIPTQDGAVL 287
            RSGH+     D ++L
Sbjct: 321 GRSGHTATLLNDDSIL 336

 Score = 39.3 bits (90), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 48/107 (44%), Gaps = 15/107 (14%)

Query: 194 DTWLLDCTTKEWTKMEQKN-GPSARSGHRMTIWKN------FFILHGGFRDLGTSTTYLN 246
           D +L +  + +WT  E     P  R GH+++I          F+  G F D     TY N
Sbjct: 136 DLYLFNLNSYKWTIPEPIGLRPLGRYGHKISIIATQPTKTKLFLFGGQFDD-----TYFN 190

Query: 247 DLWIFDITTYKWKQVE---FPPNHPIPDARSGHSIIPTQDGAVLWGG 290
           DL +FD++T++    +     P    P   S H++I   +   ++GG
Sbjct: 191 DLSMFDLSTFRKPDAQWEFIKPKSFFPPPVSNHTMISYDNKLWVFGG 237

>YGR238C Chr7 complement(966039..968687) [2649 bp, 882 aa] {ON}
           KEL2Protein that functions in a complex with Kel1p to
           negatively regulate mitotic exit, interacts with Tem1p
           and Lte1p; localizes to regions of polarized growth;
           potential Cdc28p substrate
          Length = 882

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 71/273 (26%), Positives = 105/273 (38%), Gaps = 72/273 (26%)

Query: 149 WRKITSRNSPMPRXXXXXXXXXXGVALIHGGEFSSPKQNTFYH---------YSDTWLL- 198
           W ++  +NSP PR               H   F     N  +          Y D W + 
Sbjct: 73  WNRVKLKNSPFPRYR-------------HSSSFIVTNDNRIFVTGGLHDQSVYGDVWQIA 119

Query: 199 ---DCTTKEWTKME-QKNGPSARSGHRMTIWKNFFILHGG-FRDLGTSTTYLNDLWIFDI 253
              D T+    +++  +N P  R GH  TI  N +++ GG    L  +    +DL++F+I
Sbjct: 120 ANADGTSFTSKRIDIDQNTPPPRVGHASTICGNAYVVFGGDTHKLNKNGLLDDDLYLFNI 179

Query: 254 TTYKWKQVEFPPNHPI---PDARSGH--SII---PTQDGAVLWGGYCKVKAGKGLQKGKT 305
            +YKW     P   PI   P  R GH  SII   P Q    L+GG               
Sbjct: 180 NSYKWT---IP--QPIGRRPLGRYGHKISIIASNPMQTKLYLFGGQV------------- 221

Query: 306 LTDCWYLK--MKSDVSAIR-----WERRKKQGFQPSPRVGCSMVHHKGRGMLFGGVYDFE 358
             D  Y    +  D+S+ R     WE  +  G  P P    +MV +  +  +FGG     
Sbjct: 222 --DETYFNDLVVFDLSSFRRPNSHWEFLEPVGDLPPPLTNHTMVAYDNKLWVFGG----- 274

Query: 359 ETEEGLASEFFNDLFSYQVEANRWYSVKMRPQK 391
           ET + ++    ND + Y    + W  VK   +K
Sbjct: 275 ETPKTIS----NDTYRYDPAQSEWSKVKTTGEK 303

 Score = 37.4 bits (85), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 44/167 (26%), Positives = 68/167 (40%), Gaps = 24/167 (14%)

Query: 99  PSQRINSCMVANPIHGKRELLIFGGEHTNSTNSLTAFYNELFTYSLDSDQWRKITSRNSP 158
           P    N  MVA       +L +FGGE      +     N+ + Y     +W K+ +    
Sbjct: 254 PPPLTNHTMVAY----DNKLWVFGGE------TPKTISNDTYRYDPAQSEWSKVKTTGEK 303

Query: 159 MPRXXXXXXXXXXGVALIHGGEFSSPKQNTFYHYS-DTWLLDCTTKEWTKMEQ-KNG-PS 215
            P            +  + GG      ++T   YS D + L+  + +W K+ + K G P 
Sbjct: 304 PPPIQEHASVVYKHLMCVLGG------KDTHNAYSNDVYFLNLLSLKWYKLPRMKEGIPQ 357

Query: 216 ARSGHRMTIWKNFFILHGGFRDLGTSTTYLNDLWIFDITTYKWKQVE 262
            RSGH +T+ KN  +L  G    G  T Y +   I D+ T +  Q E
Sbjct: 358 ERSGHSLTLMKNEKLLIMG----GDKTDYASP-NIHDLQTSETDQGE 399

 Score = 35.0 bits (79), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 53/253 (20%), Positives = 97/253 (38%), Gaps = 49/253 (19%)

Query: 119 LIFGGEHTNSTNSLTAFYNELFTYSLDSDQWRKITSRNSPMPRXXXXXXXXXXGVALIHG 178
           ++FGG+ T+  N      ++L+ ++++S +W        P P            +++I  
Sbjct: 155 VVFGGD-THKLNKNGLLDDDLYLFNINSYKW------TIPQPIGRRPLGRYGHKISII-- 205

Query: 179 GEFSSPKQNTFYHY----SDTWLLDCTTKEWTKMEQKNG-----------PSARSGHRMT 223
              S+P Q   Y +     +T+  D    + +   + N            P   + H M 
Sbjct: 206 --ASNPMQTKLYLFGGQVDETYFNDLVVFDLSSFRRPNSHWEFLEPVGDLPPPLTNHTMV 263

Query: 224 IWKNFFILHGGFRDLGTSTTYLNDLWIFDITTYKWKQVEFPPNHPIPDARSGHSIIPTQD 283
            + N   + GG     T  T  ND + +D    +W +V+           +G    P Q+
Sbjct: 264 AYDNKLWVFGG----ETPKTISNDTYRYDPAQSEWSKVK----------TTGEKPPPIQE 309

Query: 284 GA-VLWGGYCKVKAGKGLQKGKTLTDCWYLKMKSDVSAIRWER--RKKQGFQPSPRVGCS 340
            A V++     V  GK      +  D ++L + S    ++W +  R K+G  P  R G S
Sbjct: 310 HASVVYKHLMCVLGGKDTHNAYS-NDVYFLNLLS----LKWYKLPRMKEGI-PQERSGHS 363

Query: 341 MVHHKGRGMLFGG 353
           +   K   +L  G
Sbjct: 364 LTLMKNEKLLIMG 376

>Suva_7.530 Chr7 complement(920446..923130) [2685 bp, 894 aa] {ON}
           YGR238C (REAL)
          Length = 894

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 68/264 (25%), Positives = 102/264 (38%), Gaps = 46/264 (17%)

Query: 149 WRKITSRNSPMPRXXXXXXXXXXGVALIHGGEFSSPKQNTFYHYSDTWL----LDCTT-K 203
           W +I  +NSP PR              I    F +   +    Y DTW     LD T+  
Sbjct: 73  WNRIKLKNSPFPRYRHSASPIVTNDNRI----FVTGGLHDHLVYGDTWQITGNLDGTSFV 128

Query: 204 EWTKMEQKNGPSARSGHRMTIWKNFFILHGG-FRDLGTSTTYLNDLWIFDITTYKWKQVE 262
             T    +N P  R GH  TI  N +++ GG    L  +    +DL++F+I +YKW   +
Sbjct: 129 SKTIQIGQNTPPPRVGHASTICGNAYVVFGGDTHKLNMNRLLDDDLYLFNINSYKWTIPQ 188

Query: 263 FPPNHPIPDARSGH--SII---PTQDGAVLWGGYCKVKAGKGLQKGKTLTDCWYLKMKS- 316
             P    P  R GH  SII   P Q    L+GG               + + ++  +   
Sbjct: 189 --PVGTRPLGRYGHKISIIANNPMQTKLFLFGGQ--------------IDETYFNDLAMF 232

Query: 317 DVSAIR-----WERRKKQGFQPSPRVGCSMVHHKGRGMLFGGVYDFEETEEGLASEFFND 371
           D+S+ R     W   K     P P    +MV    +  +FGG     +T   L+    N+
Sbjct: 233 DLSSFRRPNSHWVFLKPVSIVPPPLTNHTMVTFDNKLWVFGG-----KTPNTLS----NE 283

Query: 372 LFSYQVEANRWYSVKMRPQKKKTV 395
            F Y    N W  ++   ++   V
Sbjct: 284 TFCYDPVQNDWSKIQTTGERPPAV 307

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 51/210 (24%), Positives = 90/210 (42%), Gaps = 28/210 (13%)

Query: 89  QEVLVTPVERPSQRINSCMVANPIHGKRELLIFGGEHTNSTNSLTAFYNELFTYSLDS-- 146
           Q V   P+ R   +I S +  NP+  K  L +FGG+   +      ++N+L  + L S  
Sbjct: 188 QPVGTRPLGRYGHKI-SIIANNPMQTK--LFLFGGQIDET------YFNDLAMFDLSSFR 238

Query: 147 ---DQWRKITSRNSPMPRXXXXXXXXXXGVALIHGGEFSSPKQNTFYHYSDTWLLDCTTK 203
                W  +   +   P               + GG+  +   N      +T+  D    
Sbjct: 239 RPNSHWVFLKPVSIVPPPLTNHTMVTFDNKLWVFGGKTPNTLSN------ETFCYDPVQN 292

Query: 204 EWTKMEQKNG--PSARSGHRMTIWKNFFILHGGFRDLGTSTTYLNDLWIFDITTYKWKQV 261
           +W+K+ Q  G  P A   H   ++K+   + GG +D+  +  Y ND++  ++ T+KW ++
Sbjct: 293 DWSKI-QTTGERPPAVQEHASVVYKHLMCIFGG-KDIQNA--YSNDVYFLNLITFKWYKL 348

Query: 262 EFPPNHPIPDARSGHSI-IPTQDGAVLWGG 290
                  +P  RSGHS+ +   D  V+ GG
Sbjct: 349 PR-IKEGLPKERSGHSLTLIKNDKLVIMGG 377

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 40/139 (28%), Positives = 60/139 (43%), Gaps = 23/139 (16%)

Query: 117 ELLIFGGEHTNSTNSLTAFYNELFTYSLDSDQWRKITSRNSPMPRXXXXXXXXXXGVALI 176
           +L +FGG+  N+        NE F Y    + W KI +     P            +  I
Sbjct: 268 KLWVFGGKTPNT------LSNETFCYDPVQNDWSKIQTTGERPPAVQEHASVVYKHLMCI 321

Query: 177 HGGEFSSPKQNTFYHYSDTWLLDCTTKEWTKMEQ-KNG-PSARSGHRMTIWKN-FFILHG 233
            GG+     QN + +  D + L+  T +W K+ + K G P  RSGH +T+ KN   ++ G
Sbjct: 322 FGGK---DIQNAYSN--DVYFLNLITFKWYKLPRIKEGLPKERSGHSLTLIKNDKLVIMG 376

Query: 234 G---------FRDLGTSTT 243
           G           DL TS+T
Sbjct: 377 GDKFDYASSDIHDLHTSST 395

>Ecym_2061 Chr2 (99788..103876) [4089 bp, 1362 aa] {ON} similar to
           Ashbya gossypii ADL149W
          Length = 1362

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 55/209 (26%), Positives = 86/209 (41%), Gaps = 38/209 (18%)

Query: 192 YSDTWLLDC-------TTKEWTKMEQKNGPSARSGHRMTIWKNFFILHGGFRDLGTSTTY 244
           Y DTW++         T+K     E    P  R GH  T+  N F++ GG      +   
Sbjct: 197 YGDTWIIKSHENGNKFTSKTVEITETT--PPPRVGHASTLCGNAFVIFGGDTHKTNAEGL 254

Query: 245 L-NDLWIFDITTYKWKQVEFP-PNHPIPDARSGHSIIPTQDGAVLWGGYCKVKAGKGLQK 302
           + +D+++ +I ++KW     P P  P P  R GH I      +++     K K       
Sbjct: 255 MDDDVYLLNINSHKWT---IPRPVGPRPLGRYGHKI------SIIATSQMKTKL---YVF 302

Query: 303 GKTLTDCWYLKMKS-DVSAIR-----WERRKKQGFQPSPRVGCSMVHHKGRGMLFGGVYD 356
           G    D ++  +   D+S+ R     W+  K   F P P    +MV +  +  +FGG   
Sbjct: 303 GGQFDDTYFNDLAVYDLSSFRRPDSHWQFLKPVSFVPPPLTNHTMVSYDYKLWVFGG--- 359

Query: 357 FEETEEGLASEFFNDLFSYQVEANRWYSV 385
             +T +GL     N+LF Y    N W  V
Sbjct: 360 --DTPQGL----INELFMYDPTTNDWSVV 382

 Score = 35.0 bits (79), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 54/269 (20%), Positives = 102/269 (37%), Gaps = 39/269 (14%)

Query: 118 LLIFGGEHTNSTNSLTAFYNELFTYSLDSDQWRKITSRNSPMPRXXXXXXXXXXGVALIH 177
            +IFGG+ T+ TN+     ++++  +++S +W        P P            +++I 
Sbjct: 239 FVIFGGD-THKTNAEGLMDDDVYLLNINSHKW------TIPRPVGPRPLGRYGHKISIIA 291

Query: 178 GGEFSSPKQNTFYHYSDTWLLDCTTKEWTKMEQKNG-----------PSARSGHRMTIWK 226
             +  +        + DT+  D    + +   + +            P   + H M  + 
Sbjct: 292 TSQMKTKLYVFGGQFDDTYFNDLAVYDLSSFRRPDSHWQFLKPVSFVPPPLTNHTMVSYD 351

Query: 227 NFFILHGGFRDLGTSTTYLNDLWIFDITTYKWKQVEFPPNHPIPDARSGHSIIPTQDGAV 286
               + GG     T    +N+L+++D TT  W  V+     P P           +  A+
Sbjct: 352 YKLWVFGG----DTPQGLINELFMYDPTTNDWSVVDTTGVKPPP---------LQEHAAL 398

Query: 287 LWGGYCKVKAGKGLQKGKTLTDCWYLKMKSDVSAIRWERRKK-QGFQPSPRVGCSMVHHK 345
           L+     +  GK  Q   +  + ++L +KS     RW +    +   PSPR G S+    
Sbjct: 399 LYKDLMCIVGGKDDQDNYS-QEVYFLNLKS----FRWFKLPHFRSLVPSPRSGHSVTLLS 453

Query: 346 GRGMLF--GGVYDFEETEEGLASEFFNDL 372
            + +L   G  +D+    EG  S    DL
Sbjct: 454 NKKLLIMGGDKFDYAGPGEGEFSTADQDL 482

>TPHA0H01080 Chr8 complement(232804..235290) [2487 bp, 828 aa] {ON}
           Anc_5.88 YGR238C
          Length = 828

 Score = 52.0 bits (123), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 68/255 (26%), Positives = 93/255 (36%), Gaps = 43/255 (16%)

Query: 145 DSDQWRKITSRNSPMPRXXXXXXXXX--XGVALIHGGEFSSPKQNTFYHYSDTWLLDCTT 202
           D   W KI  + +P PR                I+GG F S        Y DTW L+   
Sbjct: 18  DYSPWSKINVKGTPFPRYRHITSSYIYPSNDLYINGGLFESDV------YGDTWKLNIKE 71

Query: 203 K-EWTKMEQ-----------KNGPSARSGHRMTIWKNFFILHGG-FRDLGTSTTYLND-L 248
                 +E+              P  R GH  T+  N  I+ GG    +  S   ++D L
Sbjct: 72  NYNENDLERWHYSCNIIDIMGTTPPPRVGHAATLCGNALIVFGGDTHKVNVSNGLMDDDL 131

Query: 249 WIFDITTYKWKQVEFP-PNHPIPDARSGHSIIPTQDGAVLWGGYCKVKAGKGLQKGKTLT 307
           +  ++ T KW     P P    P  R GH I        L+GG         L K     
Sbjct: 132 YFLNLDTTKWT---IPSPKGIRPLGRYGHKISVINSNLYLFGGQFDETYFNDLVK----F 184

Query: 308 DCWYLKMKSDVSAIRWERRKKQGFQPSPRVGCSMVHHKGRGMLFGGVYDFEETEEGLASE 367
           D    K   D ++ +WE  K +GF P P    SM   + +  +FGG     +T + L   
Sbjct: 185 DLLNFK---DANS-QWEFIKPKGFIPPPLSNFSMCTFENKLYVFGG-----DTYQVLT-- 233

Query: 368 FFNDLFSYQVEANRW 382
             N+ F Y  E N W
Sbjct: 234 --NETFVYDPELNEW 246

>ADL149W Chr4 (427096..430731) [3636 bp, 1211 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR158C (KEL1) and
           YGR238C (KEL2)
          Length = 1211

 Score = 51.2 bits (121), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 55/212 (25%), Positives = 86/212 (40%), Gaps = 42/212 (19%)

Query: 192 YSDTWLL---------DCTTKEWTKMEQKNGPSARSGHRMTIWKNFFILHGGFRDLGTST 242
           Y DTW+L            T E T+      P  R GH  T+  N F++ GG      + 
Sbjct: 91  YGDTWILRAQDNGKQFSARTIEITETT----PPPRVGHAATLCGNAFVIFGGDTHKTNNE 146

Query: 243 TYL-NDLWIFDITTYKWKQVEFP-PNHPIPDARSGHSIIPTQDGAVLWGGYCKVKAGKGL 300
             + +D+++ ++ ++KW     P P  P P  R GH I      +++     K K     
Sbjct: 147 GLMDDDVYLLNVNSHKWT---IPHPVGPRPLGRYGHKI------SIIATSQMKTKL---Y 194

Query: 301 QKGKTLTDCWYLKMKS-DVSAIR-----WERRKKQGFQPSPRVGCSMVHHKGRGMLFGGV 354
             G    D ++  +   D+S+ R     W   K   F P P    +MV +  +  +FGG 
Sbjct: 195 VFGGQFDDTYFNDLAVYDLSSFRRPDSHWVFVKPASFVPPPLTNHTMVSYDYKLWVFGG- 253

Query: 355 YDFEETEEGLASEFFNDLFSYQVEANRWYSVK 386
               +T +GL     N+LF Y    N W  V+
Sbjct: 254 ----DTPQGL----INELFVYDPVVNDWSVVE 277

 Score = 40.4 bits (93), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 55/261 (21%), Positives = 98/261 (37%), Gaps = 39/261 (14%)

Query: 118 LLIFGGEHTNSTNSLTAFYNELFTYSLDSDQWRKITSRNSPMPRXXXXXXXXXXGVALIH 177
            +IFGG+ T+ TN+     ++++  +++S +W        P P            +++I 
Sbjct: 133 FVIFGGD-THKTNNEGLMDDDVYLLNVNSHKW------TIPHPVGPRPLGRYGHKISIIA 185

Query: 178 GGEFSSPKQNTFYHYSDTWLLDCTTKEWTKMEQKNG-----------PSARSGHRMTIWK 226
             +  +        + DT+  D    + +   + +            P   + H M  + 
Sbjct: 186 TSQMKTKLYVFGGQFDDTYFNDLAVYDLSSFRRPDSHWVFVKPASFVPPPLTNHTMVSYD 245

Query: 227 NFFILHGGFRDLGTSTTYLNDLWIFDITTYKWKQVEFPPNHPIPDARSGHSIIPTQD-GA 285
               + GG     T    +N+L+++D     W  VE           +G    P Q+  A
Sbjct: 246 YKLWVFGG----DTPQGLINELFVYDPVVNDWSVVET----------TGAKPPPLQEHAA 291

Query: 286 VLWGGYCKVKAGKGLQKGKTLTDCWYLKMKSDVSAIRWERRKK-QGFQPSPRVGCSMVHH 344
           VL+     V  GK  Q   +  D +++ MK+     RW +    Q   PSPR G S+   
Sbjct: 292 VLYRDLMCVVGGKDDQDNYS-QDVYFMNMKT----FRWFKLPHFQDMVPSPRSGHSVTLL 346

Query: 345 KGRGMLFGGVYDFEETEEGLA 365
             R +L  G   F+    G A
Sbjct: 347 ANRKLLIMGGDKFDYARPGDA 367

>Smik_16.68 Chr16 (128068..130752) [2685 bp, 894 aa] {ON} YGR238C
           (REAL)
          Length = 894

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 65/276 (23%), Positives = 104/276 (37%), Gaps = 70/276 (25%)

Query: 149 WRKITSRNSPMPRXXXXXXXXXXGVALIHGGEFSSPKQNTFYH---------YSDTWLLD 199
           W +I  ++SP PR               H   F +   N  +          Y D W + 
Sbjct: 73  WNRIKLKDSPFPRYR-------------HSSSFITTNDNRIFVTGGLYDQSVYGDVWEIT 119

Query: 200 CTTKEWTKMEQK-----NGPSARSGHRMTIWKNFFILHGG-FRDLGTSTTYLNDLWIFDI 253
                 +   ++     N P  R GH  T+  N +++ GG    L  +    +DL++F+I
Sbjct: 120 ANANGTSFTSKRIQIDHNTPPPRVGHASTMCGNAYVVFGGDTHKLNKNRLLDDDLYLFNI 179

Query: 254 TTYKWKQVEFPPNHPI---PDARSGH--SIIPTQDGAV---LWGGYCKVKAGKGLQKGKT 305
            +YKW     P  HPI   P  R GH  SII ++       L+GG               
Sbjct: 180 NSYKWT---IP--HPIGSRPLGRYGHKISIIASKQMHTELYLFGG--------------Q 220

Query: 306 LTDCWYLKMKS-DVSAIR-----WERRKKQGFQPSPRVGCSMVHHKGRGMLFGGVYDFEE 359
           + + ++  +   D+S+ R     WE  +     P P    +MV    +  +FGG     E
Sbjct: 221 IDETYFNDLAVFDLSSFRRPNSHWEFLEPISALPPPLTNHTMVTFDNKLWVFGG-----E 275

Query: 360 TEEGLASEFFNDLFSYQVEANRWYSVKMRPQKKKTV 395
           T + ++    ND + Y    N W  V+   +K   V
Sbjct: 276 TPKTIS----NDTYCYDPIQNAWSKVETTGEKPPPV 307

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 51/242 (21%), Positives = 101/242 (41%), Gaps = 42/242 (17%)

Query: 156 NSPMPRXXXXXXXXXXGVALIHGGEFSSPKQNTFYHYSDTWLLDCTTKEWTKMEQKNG-- 213
           N+P PR             ++ GG+     +N      D +L +  + +WT +    G  
Sbjct: 137 NTPPPRVGHASTMCGNAY-VVFGGDTHKLNKNRLLD-DDLYLFNINSYKWT-IPHPIGSR 193

Query: 214 PSARSGHRMTI-----WKNFFILHGGFRDLGTSTTYLNDLWIFDITTYK-----WKQVEF 263
           P  R GH+++I           L GG  D     TY NDL +FD+++++     W+ +E 
Sbjct: 194 PLGRYGHKISIIASKQMHTELYLFGGQID----ETYFNDLAVFDLSSFRRPNSHWEFLE- 248

Query: 264 PPNHPIPDARSGHSIIPTQDGAVLWGGYCKVKAGKGLQKGKTLTDCWYLKMKSDVSAIRW 323
            P   +P   + H+++   +   ++GG          +  KT+++  Y     D     W
Sbjct: 249 -PISALPPPLTNHTMVTFDNKLWVFGG----------ETPKTISNDTYC---YDPIQNAW 294

Query: 324 ERRKKQGFQPSPRVGCSMVHHKGRGMLFGGVYDFEETEEGLASEFFNDLFSYQVEANRWY 383
            + +  G +P P    + V +K    +FGG        + + + + ND++   + + +W+
Sbjct: 295 SKVETTGEKPPPVQEHASVVYKHLMCVFGG--------KDIHNTYSNDVYFLNLLSLKWF 346

Query: 384 SV 385
            +
Sbjct: 347 KL 348

 Score = 33.9 bits (76), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 27/128 (21%), Positives = 51/128 (39%), Gaps = 15/128 (11%)

Query: 256 YKWKQVEFPPNHPIPDARSGHSIIPTQDGAVLWGGYCKVKAGKGLQKGKTLTDCWYLKMK 315
           Y W +++   + P P  R   S I T D  +   G        GL       D W +   
Sbjct: 71  YIWNRIKLK-DSPFPRYRHSSSFITTNDNRIFVTG--------GLYDQSVYGDVWEITAN 121

Query: 316 SDVSAIRWERRKKQGFQPSPRVGCSMVHHKGRGMLFGGVYDFEETEEGLASEFF-NDLFS 374
           ++ ++   +R +     P PRVG +        ++FGG     +T +   +    +DL+ 
Sbjct: 122 ANGTSFTSKRIQIDHNTPPPRVGHASTMCGNAYVVFGG-----DTHKLNKNRLLDDDLYL 176

Query: 375 YQVEANRW 382
           + + + +W
Sbjct: 177 FNINSYKW 184

>Skud_7.572 Chr7 complement(940820..943471) [2652 bp, 883 aa] {ON}
           YGR238C (REAL)
          Length = 883

 Score = 48.9 bits (115), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 48/202 (23%), Positives = 85/202 (42%), Gaps = 25/202 (12%)

Query: 95  PVERPSQRINSCMVANPIHGKRELLIFGGEHTNSTNSLTAFYNELFTYSLDS-----DQW 149
           P+ R   +I S +  NP+  K  L +FGG+   +      ++N+L  + L S       W
Sbjct: 192 PLGRYGHKI-SIIAYNPMQTK--LYLFGGQLDKT------YFNDLAMFDLSSFRRRNSHW 242

Query: 150 RKITSRNSPMPRXXXXXXXXXXGVALIHGGEFSSPKQNTFYHYSDTWLLDCTTKEWTKME 209
             +    +  P               + GGE  +PK  +    ++T+  D    +W+K+E
Sbjct: 243 EFLEPATTVPPPLANHTMVTYGNKLWVFGGE--TPKTVS----NETYCYDPIQNDWSKIE 296

Query: 210 QKNG-PSARSGHRMTIWKNFFILHGGFRDLGTSTTYLNDLWIFDITTYKWKQVEFPPNHP 268
                P     H   ++K+   + GG     T   Y ND++  D+ ++KW ++       
Sbjct: 297 TTGEIPPPVQEHASVVYKHIMCVFGGKY---THNAYSNDVYFLDLLSFKWYKLPH-IKEG 352

Query: 269 IPDARSGHSIIPTQDGAVLWGG 290
           IP  RSGHS+   ++  +L  G
Sbjct: 353 IPRERSGHSLTLMKNEKILIMG 374

 Score = 48.9 bits (115), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 61/257 (23%), Positives = 102/257 (39%), Gaps = 50/257 (19%)

Query: 149 WRKITSRNSPMPRXXXXXX--XXXXGVALIHGGEFSSPKQNTFYHYSDTWLLDCT----- 201
           W +I  ++SP PR                + GG ++         Y D W +        
Sbjct: 71  WNRIKLKDSPFPRYRHSSSPIVSSENRIFVTGGLYNQSV------YGDVWQITANADGTS 124

Query: 202 -TKEWTKMEQKNGPSARSGHRMTIWKNFFILHGG-FRDLGTSTTYLNDLWIFDITTYKWK 259
            T +  +++ +N P  R GH  T+  N +++ GG    L       +D+++F++ +YKW 
Sbjct: 125 FTPKAIQID-RNTPPPRVGHASTLCGNAYVVFGGDTHKLNEDKLLDDDIYLFNVNSYKWT 183

Query: 260 QVEFPPNHPIPDARSGH--SII---PTQDGAVLWGGYCKVKAGKGLQKGKTLTDCWYLKM 314
             +  P    P  R GH  SII   P Q    L+GG          Q  KT  +   +  
Sbjct: 184 IPQ--PIGSRPLGRYGHKISIIAYNPMQTKLYLFGG----------QLDKTYFNDLAM-- 229

Query: 315 KSDVSAIR-----WERRKKQGFQPSPRVGCSMVHHKGRGMLFGGVYDFEETEEGLASEFF 369
             D+S+ R     WE  +     P P    +MV +  +  +FGG     ET + ++    
Sbjct: 230 -FDLSSFRRRNSHWEFLEPATTVPPPLANHTMVTYGNKLWVFGG-----ETPKTVS---- 279

Query: 370 NDLFSYQVEANRWYSVK 386
           N+ + Y    N W  ++
Sbjct: 280 NETYCYDPIQNDWSKIE 296

>ZYRO0C00550g Chr3 (39312..41858) [2547 bp, 848 aa] {ON} similar to
           uniprot|Q08886 Saccharomyces cerevisiae YOR371C GPB1
           Proposed beta subunit of the heterotrimeric G protein
           that interacts with the receptor Grp1p has signaling
           role in response to nutrients involved in regulation of
           pseudohyphal growth through cAMP levels homolog of Gpb2p
          Length = 848

 Score = 36.2 bits (82), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 37/104 (35%), Gaps = 10/104 (9%)

Query: 193 SDTWLLDCTTKEWTKMEQKNGPSARSGHRMTIWKNFFILHGGFRDLGTSTTYLNDLWIFD 252
           ++  L  C T   +          RS  +        I+HGG       T    D+W +D
Sbjct: 635 TNPLLKQCLTSSSSHSAPTKPLQPRSKTQPNFEHKVLIMHGG----SNKTDVCRDMWWYD 690

Query: 253 ITTYKWKQVEFPPNH------PIPDARSGHSIIPTQDGAVLWGG 290
           I T  W Q+     H      PI     GHS++     AV  GG
Sbjct: 691 IETETWSQITTHGKHEASKMIPIGVGLVGHSLVCVGGMAVFVGG 734

>ZYRO0C03344g Chr3 complement(259809..261785) [1977 bp, 658 aa] {ON}
           similar to similar to uniprot|Q08282 YOL141w
           Saccharomyces cerevisiae PPM2 Putative carboxyl methyl
           transferase
          Length = 658

 Score = 35.8 bits (81), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 52/122 (42%), Gaps = 18/122 (14%)

Query: 90  EVLVTPVER---PSQRINSCMVANPIHGKRELLIFGGEHTNSTNSLTAFYNELFTYSLDS 146
           +VL  PVE     + R     V +P   K++LL FGG     TN       E+ +   D 
Sbjct: 346 DVLSLPVEYFEIANVRKFGASVLDP--NKKQLLYFGGSCPQRTN-------EIISIGPDG 396

Query: 147 D-QWRKITSRNSPMPRXXXXXXXXXXGVALIHGGEFSSPKQNTFYHYSDTWLLDCTTKEW 205
           D +        +P+ R            A++ GG     ++N +   SDTW+ + ++ EW
Sbjct: 397 DCEAVPFDKTTAPVARACHTFTLVNNDTAMVVGG-----RRNPWQPLSDTWMFNLSSHEW 451

Query: 206 TK 207
           T+
Sbjct: 452 TR 453

>TBLA0A04320 Chr1 (1068199..1070715) [2517 bp, 838 aa] {ON} Anc_7.9
           YAL056W
          Length = 838

 Score = 35.4 bits (80), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 38/91 (41%), Gaps = 10/91 (10%)

Query: 206 TKMEQKNGPSARSGHRMTIWKNFFILHGGFRDLGTSTTYLNDLWIFDITTYKWKQVEFPP 265
           TK    +GP  +     T   +  ++HGG      +T   +D+W FD  T  W Q+E   
Sbjct: 636 TKSNGPSGPVLQLHINETSEGHTLVMHGG----SNATHIYSDMWWFDFETESWVQIETQA 691

Query: 266 NH------PIPDARSGHSIIPTQDGAVLWGG 290
                   PI  A +GHS+      ++  GG
Sbjct: 692 QTEDKGLVPIEMALAGHSMATVGSASIFVGG 722

>KNAG0D02100 Chr4 (351677..356740) [5064 bp, 1687 aa] {ON} Anc_8.157
           YGL197W
          Length = 1687

 Score = 35.0 bits (79), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 42/229 (18%), Positives = 90/229 (39%), Gaps = 34/229 (14%)

Query: 115 KRELLIFGGEHTNSTNSLTAFYN-------ELFTYSLDSDQWRKITSR----NSPMPRXX 163
           ++E++++  +  NS   + AF N       E+F   L S +W ++ +     + PM    
Sbjct: 88  QKEIILYFAKQKNS---VIAFKNLSDWISREIFFLDLISRKWNRLPTSFKNPDVPMRERL 144

Query: 164 XXXXXXXXGVALIHGGEFSSPKQNTFYHYSDTWLLDCTTKEWTKMEQKNGPSARSGHRMT 223
                       + GG   S         ++ W LD T + W+ + +    + R  H   
Sbjct: 145 FHTISYSHSAMYVFGGLIVSTNGYELIATNELWKLDLTNRVWSLLSEDPQITRRFNHTTQ 204

Query: 224 IWKNF-------FILHGGFRDLGTSTTYLNDLWIFDITTYKWKQVEFPPNHPIPDARSGH 276
           +   +        ++ GG  ++  S  +++   +F+IT   W+       + +     G 
Sbjct: 205 VLNTYSEAHDTKLLIIGGLNNMDQSIAHID---VFNITKGYWETANLDSKNGVLTNVGGE 261

Query: 277 SIIPTQD-GAVLWGGYCKVKAGKGLQKGKTLTDCWYLKMKSDVSAIRWE 324
            +  T D  A L   + +++A        TLT  +YL   +++ A +++
Sbjct: 262 PVCLTNDKNAPLLIEHAELEAS-------TLT--FYLSQNNNIPATKYD 301

>Kpol_538.45 s538 complement(101351..103897) [2547 bp, 848 aa] {ON}
           complement(101351..103897) [2547 nt, 849 aa]
          Length = 848

 Score = 33.9 bits (76), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 42/188 (22%), Positives = 68/188 (36%), Gaps = 45/188 (23%)

Query: 208 MEQKNGPSARSGHRMTIWK--------NFFILHGGFRDLGTSTTYLNDLWIFDITTYKWK 259
           M++K+ PS  S +     K           I+HGG       T  + D+W+F+ T   W+
Sbjct: 637 MQKKSSPSCLSLYSKRNGKLESESNKGKILIIHGG----SDHTNVIGDMWLFNFTKETWE 692

Query: 260 QVEFPPNHPIPD-------ARSGHSIIPTQDGAVLWGGYCK------------VKAG--- 297
              F   +P  D          GH++      AV +GG  +             K G   
Sbjct: 693 HEHFLIKNPQEDRYKAIDIPLVGHTLTFIGYSAVSFGGLTQDDINSVYNLGDEAKVGGDH 752

Query: 298 KGLQKGKTLT----------DCWYLKMKSDVSAIRWERRKKQGFQPSP-RVGCSMVHHKG 346
           +GL  G  L           +   LK+ +     +  R K    + +   +GC +  + G
Sbjct: 753 EGLALGSNLVNYINLKTFQLESKELKLVAGTDEYKLVRDKTVNARSTVLAIGCIVAMNNG 812

Query: 347 RGMLFGGV 354
             +L GGV
Sbjct: 813 SYLLIGGV 820

>KAFR0C04910 Chr3 (975629..978265) [2637 bp, 878 aa] {ON} Anc_7.9
           YAL056W
          Length = 878

 Score = 33.5 bits (75), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 35/76 (46%), Gaps = 12/76 (15%)

Query: 229 FILHGGFRDLGTSTTYLNDLWIFDITTYKWKQVEF---PPNH-----PIPDARSGHSIIP 280
            +LHGG  D    T    D+W FD+ T++W +V     P +      PI     GH+++ 
Sbjct: 696 IVLHGGSDD----TNVYGDMWWFDLETFQWTKVATYIKPKDQDSSLVPINIKIVGHTMMT 751

Query: 281 TQDGAVLWGGYCKVKA 296
           +   AV  GG  + + 
Sbjct: 752 SGCMAVCVGGITQAEV 767

>CAGL0K02101g Chr11 (182946..187847) [4902 bp, 1633 aa] {ON} similar
           to uniprot|P32634 Saccharomyces cerevisiae YER132c PMD1
           or uniprot|P53094 Saccharomyces cerevisiae YGL197w MDS3
          Length = 1633

 Score = 33.1 bits (74), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 23/96 (23%), Positives = 41/96 (42%), Gaps = 11/96 (11%)

Query: 172 GVALIHGGEFSSP-KQNTFYHYSDTWLLDCTTKEWTKMEQKNGPSARSGHRMTIWKN--- 227
           G   I GG   SP  +  F   +D W LD    +W+ + +  G   R  H M +  +   
Sbjct: 170 GFLYIFGGLMISPHNEYEFVATNDLWQLDLRGNKWSLLSKDPGVGRRYNHEMHVLNSEDP 229

Query: 228 ----FFILHGGFRDLGTSTTYLNDLWIFDITTYKWK 259
                 ++ GG  ++      ++   IF++TT +W+
Sbjct: 230 TKDTKLVIVGGIDNMDEPVAKID---IFNLTTLQWE 262

>Smik_7.75 Chr7 (119160..123611) [4452 bp, 1483 aa] {ON} YGL197W
           (REAL)
          Length = 1483

 Score = 33.1 bits (74), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 34/142 (23%), Positives = 53/142 (37%), Gaps = 18/142 (12%)

Query: 142 YSLDSD------QWRKITSRNSPMPRXXXXXXXXXXGVALIHGGEFSSPKQN-TFYHYSD 194
           + LD+D        RK  S  SP+            G   I GG   SP+        ++
Sbjct: 134 FKLDADTSDVQVDIRKAKSLESPLKERLFHSLCYLDGCLYIFGGLTVSPQSGYELIAANE 193

Query: 195 TWLLDCTTKEWTKMEQKNGPSARSGHRMTIWK-------NFFILHGGFRDLGTSTTYLND 247
            W LD  TK+W+ +      + R  H M +            I+ GG  ++      ++ 
Sbjct: 194 LWKLDLNTKKWSLLSDDPQIARRFNHTMHVKNENNDNRDTKLIIVGGLNNMDQPVKKID- 252

Query: 248 LWIFDITTYKWKQVEFPPNHPI 269
             I++IT   W Q E  P  P+
Sbjct: 253 --IYNITQNCW-QAETIPKQPM 271

>Kpol_1014.25 s1014 complement(42216..44105) [1890 bp, 629 aa] {ON}
           complement(42216..44105) [1890 nt, 630 aa]
          Length = 629

 Score = 32.3 bits (72), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 33/145 (22%), Positives = 58/145 (40%), Gaps = 18/145 (12%)

Query: 151 KITSRNSPMPRXXXXXXXXXXGVALIHGGEFSSPKQNTFYHYSDTWLLDCTTKEWTKMEQ 210
           KI + ++P+ R             +  GG   +P Q     + + W LD +TK+W+K  Q
Sbjct: 371 KIDTTDTPIGRMCHTLSRISESEIISIGGR-KAPGQG----FDECWKLDLSTKQWSKGAQ 425

Query: 211 KNGPSARSGHRMTIWKNFFILHGGFRDLGTSTTYLNDLWIFDITTYKWKQVE---FPPNH 267
            N    R    M   +N  I  G   D        +   +++  +  + + E   +  N 
Sbjct: 426 LNAKRYRHSAFMVDDENVLICGGDTTD--------DPFVLYNTKSNTFHKCEVNGYDINE 477

Query: 268 PIPDARSGHSIIPTQDGAVLWGGYC 292
            +  A   ++ I TQ G ++ GG C
Sbjct: 478 SLVAAAISYN-IKTQTGVII-GGAC 500

>NCAS0B05440 Chr2 (1017388..1022040) [4653 bp, 1550 aa] {ON} 
          Length = 1550

 Score = 32.3 bits (72), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 51/119 (42%), Gaps = 16/119 (13%)

Query: 176 IHGGEFSSPKQN-TFYHYSDTWLLDCTTKEWTKMEQKNGPSARSGHRMTIWK-------N 227
           I GG   SP+        ++ W L+  TK WT + +    + R  H M I          
Sbjct: 194 IFGGLIVSPQSGYELIATNELWRLNLKTKVWTLISKDPRITRRFNHNMHIKNENNDTRDT 253

Query: 228 FFILHGGFRDLGTSTTYLNDLWIFDITTYKWKQVEFPPNHPIPDARS---GHSIIPTQD 283
             I+ GG  +L    ++++   ++++T   WK    P + P+ DAR+   GH I    D
Sbjct: 254 KLIIIGGLNNLDQPVSHID---VYNLTQNCWKADSIPKD-PL-DARTNVDGHEITLNND 307

>ADR414C Chr4 complement(1450330..1452684) [2355 bp, 784 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YAL056W
           (KRH1) and YOR371C (KRH2)
          Length = 784

 Score = 32.0 bits (71), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 32/69 (46%), Gaps = 11/69 (15%)

Query: 229 FILHGGFRDLGTSTTYLNDLWIFDITTYKWKQVEF---PPN----HPIPDARSGHSIIPT 281
            I+HGG       +    D+W FD+   +W ++      P+     PI     GHSI  +
Sbjct: 611 VIIHGG----SDGSRVYGDMWWFDLADERWSRIALYSRDPDSGERRPIGLPAVGHSIFHS 666

Query: 282 QDGAVLWGG 290
           +D  +L+GG
Sbjct: 667 RDEFLLYGG 675

>TDEL0H04420 Chr8 complement(760921..763425) [2505 bp, 834 aa] {ON}
           Anc_7.9 YAL056W
          Length = 834

 Score = 32.0 bits (71), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 30/70 (42%), Gaps = 10/70 (14%)

Query: 227 NFFILHGGFRDLGTSTTYLNDLWIFDITTYKWKQVEFPPNH------PIPDARSGHSIIP 280
           + F++HGG      +T  L D+W FD+ T  W +V            PI     G S++ 
Sbjct: 638 DLFVIHGG----SDNTKVLGDMWWFDLDTESWTEVTTYGKDQERGMTPIKVCIVGQSMVT 693

Query: 281 TQDGAVLWGG 290
             D  V  GG
Sbjct: 694 VGDINVSLGG 703

>AGL293C Chr7 complement(156902..159856) [2955 bp, 984 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER114C
           (BOI2) and YBL085W (BOI1)
          Length = 984

 Score = 31.6 bits (70), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 39/96 (40%), Gaps = 14/96 (14%)

Query: 215 SARSGHRMTIWKN-FFILHGGFRDLGTSTTYLNDLWIFDITTYKWKQVEFPPNHPIPDAR 273
           S +    M +WKN FF+LHG       +TT   +  + DIT+           H +  A+
Sbjct: 740 SKKGAGTMGVWKNRFFVLHGTRLSYFANTTDNRERGLIDITS-----------HRVLPAK 788

Query: 274 SGHSIIPTQDGAVLWGGYC--KVKAGKGLQKGKTLT 307
                +     ++  G YC   V    G +KG T T
Sbjct: 789 EDDKFVALYAASIGRGRYCFKLVPPAPGSKKGLTFT 824

>Suva_10.418 Chr10 complement(739402..740181) [780 bp, 259 aa] {ON}
           YLR323C (REAL)
          Length = 259

 Score = 30.8 bits (68), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 24/111 (21%), Positives = 48/111 (43%)

Query: 361 EEGLASEFFNDLFSYQVEANRWYSVKMRPQKKKTVAISRNNRNKDEELENILNDILQQAN 420
           E+ +AS+  +D       A    + ++RP      +ISR   + D+    + +D  ++  
Sbjct: 28  EKPVASDRDDDFIGSIPSAKAGRAKRLRPSDADECSISRRKEDLDKYTLTVNDDSTKEDL 87

Query: 421 LAXXXXXXXNEIKRELQRIDEEEALENSRKQYEVVGQLPHPRFNATTAVVD 471
           L         ++++E      E AL  S K+ ++  Q+  P    TT ++D
Sbjct: 88  LNSERRELAEKVRKEQSDDSNELALSMSGKKAQLAKQINQPSNIRTTVLMD 138

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.420 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 59,975,673
Number of extensions: 2456859
Number of successful extensions: 6979
Number of sequences better than 10.0: 67
Number of HSP's gapped: 6743
Number of HSP's successfully gapped: 105
Length of query: 658
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 542
Effective length of database: 40,180,143
Effective search space: 21777637506
Effective search space used: 21777637506
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)