Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_56.223456.9ON39639621250.0
KLTH0C11550g6.9ON39839915510.0
SAKL0E00814g6.9ON39839813310.0
ZYRO0F00462g6.9ON39338112231e-167
Ecym_30126.9ON39739412021e-164
Kpol_1045.786.9ON39238011851e-161
TDEL0G046206.9ON39238311811e-161
NCAS0F001906.9ON41138211811e-161
KLLA0D00814g6.9ON40840311711e-159
NDAI0K029006.9ON43838911441e-155
ACR017W6.9ON42338111151e-150
Skud_5.336.9ON40138710951e-148
KNAG0E009806.9ON41437710871e-146
YEL056W (HAT2)6.9ON40138910851e-146
Suva_5.126.9ON40138910851e-146
TPHA0M001906.9ON39138510831e-146
Smik_5.316.9ON42738610661e-143
KAFR0L003206.9ON39138510461e-140
CAGL0B03575g6.9ON41938510481e-140
TBLA0A071206.9ON4073909951e-132
KLTH0E12694g8.548ON4184093536e-37
NDAI0C055108.548ON4194213361e-34
ZYRO0A13068g8.548ON3974093237e-33
TBLA0H036508.548ON4194203221e-32
Kwal_27.120708.548ON4184133221e-32
TPHA0L017208.548ON4194103185e-32
YBR195C (MSI1)8.548ON4224163185e-32
Ecym_70428.548ON4144063151e-31
TDEL0B029808.548ON4124273132e-31
KLLA0E23541g8.548ON4174043132e-31
Skud_2.3218.548ON4224153106e-31
Kpol_1024.398.548ON4174143106e-31
AEL250C8.548ON4174193062e-30
SAKL0H09900g8.548ON4254123053e-30
Suva_4.4498.548ON4244183044e-30
NCAS0B021708.548ON4144252973e-29
Smik_2.3358.548ON4224162956e-29
CAGL0M05291g8.548ON4194182957e-29
KAFR0I008408.548ON4134112941e-28
KNAG0A036708.548ON4264192941e-28
Kpol_1060.246.276ON4863221836e-14
Smik_4.457.310ON12702141713e-12
Suva_4.537.310ON12712111694e-12
Suva_13.3112.401ON5104121641e-11
Skud_4.637.310ON12732111623e-11
YDL195W (SEC31)7.310ON12732151607e-11
Skud_13.2912.401ON5094131588e-11
YMR131C (RRB1)2.401ON5114141571e-10
CAGL0K03861g2.401ON5134111561e-10
TPHA0D035906.276ON5983311562e-10
KAFR0A003802.401ON5163991552e-10
Kwal_33.151365.201ON4731371542e-10
NCAS0G011206.276ON4942061542e-10
Smik_13.3292.401ON5094071524e-10
TDEL0A068906.276ON4473571514e-10
ZYRO0B10450g5.201ON4821371506e-10
KLLA0F15598g5.201ON4781391507e-10
KNAG0E021802.401ON5174001499e-10
YNL317W (PFS2)3.25ON4652811481e-09
Smik_14.143.25ON4662811481e-09
TPHA0G026502.401ON5163991462e-09
ZYRO0E08184g6.276ON5063031462e-09
ZYRO0C03124g3.25ON4452211452e-09
Suva_14.223.25ON4692811452e-09
NDAI0F012406.276ON5243071453e-09
NCAS0F019702.401ON5114171444e-09
Skud_14.223.25ON4672811444e-09
Sklu_YGOB_Anc_2.4012.401ON5204161444e-09
Ecym_42498.316ON3743001425e-09
TDEL0G033402.401ON5143981435e-09
CAGL0H00781g6.276ON5133031435e-09
Kpol_1041.202.401ON5154131436e-09
CAGL0D05588g5.201ON4771161427e-09
KNAG0I009208.316ON3812991417e-09
TDEL0C023607.310ON12642681437e-09
KLTH0F19294g3.25ON4512251418e-09
KAFR0A064804.122ON5681801419e-09
KLLA0F17237g2.401ON5234121419e-09
Kwal_55.220673.25ON4512351419e-09
SAKL0H15708g8.316ON3682971401e-08
ADL184W3.25ON4492811401e-08
NDAI0H027502.401ON5124171401e-08
Kwal_47.178272.401ON5234121401e-08
KLTH0G12430g8.316ON3672971391e-08
KLTH0E09394g2.401ON5224121401e-08
ADR242C2.401ON5213981401e-08
SAKL0C13266g3.25ON4592361391e-08
TPHA0C008608.316ON3782571382e-08
NCAS0C044503.25ON4612521392e-08
KAFR0L013207.310ON12402121402e-08
YPL247C6.276ON5233901382e-08
SAKL0H22396g4.122ON5552041382e-08
TPHA0P014903.25ON4592191372e-08
Kpol_1036.658.316ON3712971363e-08
TBLA0A023106.276ON5313141363e-08
ZYRO0F05808g7.310ON12822131374e-08
Kpol_1061.364.122ON5891701364e-08
NDAI0G038303.25ON5102191347e-08
Kpol_1048.598.544ON8501651349e-08
CAGL0M04081g3.25ON4552811321e-07
TBLA0C050107.356ON5721531321e-07
TPHA0F007704.122ON6311791321e-07
CAGL0A00605g4.122ON6401581321e-07
KLLA0E07085g3.25ON4522091311e-07
ZYRO0A08690g2.401ON5164011292e-07
ZYRO0D05852g8.316ON3712561292e-07
Kpol_1013.377.534ON4682111293e-07
Kpol_1014.193.25ON4522191283e-07
Kwal_56.238958.316ON3672971274e-07
ADR090W7.310ON12332381284e-07
TBLA0G014904.122ON7321431285e-07
KAFR0B057008.316ON3723361265e-07
YPR178W (PRP4)7.534ON4652151275e-07
KNAG0A012303.22ON13211941285e-07
KAFR0I028403.25ON4562521266e-07
Kpol_2001.657.322ON12062791276e-07
AAR078W7.356ON5621941266e-07
KLLA0E04093g8.316ON3722591256e-07
Smik_6.4516.276ON5233041267e-07
Ecym_8044na 1ON3111691247e-07
CAGL0B01529g8.316ON3692911248e-07
KLLA0C08547g6.340ON5153371258e-07
KLLA0A08822g4.122ON5821891258e-07
Suva_16.606.276ON5263941258e-07
KAFR0J009805.201ON4802531259e-07
Kwal_56.243326.276ON4182161249e-07
AFL157C6.276ON4383311249e-07
TBLA0H002303.22ON13331971251e-06
TBLA0B092502.401ON5263971241e-06
TDEL0F044308.316ON3673021231e-06
NDAI0J003307.534ON4722061241e-06
KNAG0I010508.288ON11591641251e-06
Ecym_60672.401ON5223991241e-06
Skud_7.2844.122ON5661791241e-06
Kpol_1028.416.340ON5123171241e-06
Ecym_47177.356ON6031931231e-06
NDAI0J018504.122ON5751701232e-06
Smik_7.2874.122ON5662021232e-06
KLLA0F19734g8.288ON11331571242e-06
KAFR0B055808.288ON11201751242e-06
NCAS0B036908.288ON11451561232e-06
AGL190W8.316ON3702971212e-06
KLTH0H02772g6.276ON4202091212e-06
Skud_16.4827.534ON4652141222e-06
Skud_16.326.276ON5223881212e-06
TDEL0F022304.122ON5562001212e-06
Ecym_20263.25ON4512371213e-06
KLLA0E20967g3.22ON13211981223e-06
Smik_10.1261.247ON7121501213e-06
KAFR0F010606.276ON5533041213e-06
KNAG0B055504.122ON6171661213e-06
Kpol_1028.236.363ON7442461213e-06
Suva_2.2918.288ON11511641213e-06
KLLA0F05159g7.310ON12312131213e-06
KNAG0D007406.276ON5043801203e-06
ZYRO0G10472g4.122ON5601791204e-06
Smik_16.4427.534ON4702161194e-06
KLTH0E08162g4.122ON5561451204e-06
TDEL0A004403.25ON4512191194e-06
NCAS0E037507.310ON12762181204e-06
Kwal_56.236858.288ON11021531204e-06
SAKL0F11506g7.356ON5681931194e-06
NCAS0J011104.122ON5951881195e-06
TPHA0E030805.201ON4882541195e-06
YJL112W (MDV1)1.247ON7141501196e-06
Ecym_80617.310ON12282661196e-06
KAFR0L015207.356ON5841941186e-06
KNAG0B028007.310ON13072201196e-06
CAGL0A04037g7.356ON5831921177e-06
AEL269C7.534ON4552061169e-06
YGL003C (CDH1)4.122ON5661581179e-06
TBLA0E007607.534ON3842131169e-06
TBLA0F021407.310ON13002171179e-06
SAKL0A02970g6.276ON4153001161e-05
NDAI0J010408.316ON3981771151e-05
Suva_7.2794.122ON5661581161e-05
CAGL0A02772g5.429ON4412631151e-05
Skud_10.1021.247ON7081501161e-05
NCAS0E028407.356ON6071921151e-05
Kpol_1019.307.310ON12521801161e-05
KLLA0E08449g2.283ON4221901151e-05
SAKL0A01276g6.340ON5153071151e-05
SAKL0F10384g7.310ON12611831161e-05
Kpol_1028.546.325ON9051691152e-05
NDAI0J011808.288ON11341541152e-05
KLTH0G13068g8.288ON11012061152e-05
SAKL0H16390g8.288ON11401531152e-05
YDR128W (MTC5)8.288ON11481641152e-05
KLTH0F16192g5.429ON4621021142e-05
Smik_4.3748.288ON11521641152e-05
NDAI0K023506.363ON7931631142e-05
ZYRO0G20152g2.431ON3192401132e-05
KAFR0B003707.534ON4612091132e-05
TBLA0F024007.338ON2982531122e-05
Kpol_530.257.356ON5741941132e-05
Kwal_27.122398.585ON3162241122e-05
SAKL0A00660g6.363ON6602971132e-05
Ecym_41348.435ON8102061142e-05
TBLA0F022307.322ON12162421143e-05
NDAI0D022505.139ON7952421133e-05
NDAI0I004606.325ON9171591133e-05
NCAS0D046106.340ON5153191123e-05
Skud_4.3898.288ON11511921133e-05
AGL234W6.363ON6292521133e-05
TDEL0C022407.322ON12012791133e-05
KNAG0G008005.139ON7902351133e-05
ZYRO0F10406g8.324ON9382071133e-05
TPHA0D045007.322ON12082791133e-05
Ecym_21396.276ON4352151114e-05
SAKL0E03960g2.431ON3202411104e-05
Kpol_1031.361.247ON7061521124e-05
CAGL0J03476g6.340ON5171681114e-05
KNAG0A012503.25ON4522351114e-05
Suva_16.5107.534ON4652151114e-05
Suva_3.1216.363ON7002181124e-05
Kwal_56.244787.310ON12961841124e-05
SAKL0F15972g7.534ON4701521114e-05
Kpol_1038.203.22ON13131991124e-05
NCAS0C044303.22ON13114111125e-05
YCR084C (TUP1)6.363ON7132181115e-05
TBLA0A038908.316ON3622051105e-05
SAKL0F10648g7.322ON12033041115e-05
Kwal_55.220763.22ON12862811115e-05
KLTH0A06754g6.340ON5143081105e-05
ZYRO0A09636g8.435ON8082191115e-05
KLLA0E19515g7.356ON5721951105e-05
Suva_6.1871.247ON7141501106e-05
Skud_12.565.201ON4891981106e-05
Smik_4.907.322ON12012411116e-05
ADL186C3.22ON13611971116e-05
Ecym_25236.363ON6462511098e-05
Skud_3.1566.363ON7132041099e-05
NDAI0A020907.322ON12002421099e-05
TDEL0A004103.22ON12622511099e-05
TBLA0B087303.25ON4611491089e-05
KLTH0D04466g2.431ON3192411079e-05
NCAS0A151707.534ON4742001081e-04
SAKL0C13332g3.22ON13532251091e-04
KNAG0I028406.340ON5193241081e-04
SAKL0A01738g6.325ON9091621091e-04
TPHA0A003803.22ON13101981091e-04
NCAS0G036001.399ON3272701071e-04
AER255C5.429ON4671051071e-04
Suva_4.997.322ON12012951081e-04
Skud_4.1097.322ON12012951081e-04
TBLA0B091002.431ON3172411061e-04
KAFR0F043506.340ON5153181071e-04
CAGL0I03718g7.322ON12012791081e-04
Ecym_42808.288ON11322231081e-04
CAGL0K09284g6.325ON9111591081e-04
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_56.22345
         (396 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_56.22345 s56 complement(58523..59713) [1191 bp, 396 aa] {ON...   823   0.0  
KLTH0C11550g Chr3 (949063..950259) [1197 bp, 398 aa] {ON} simila...   602   0.0  
SAKL0E00814g Chr5 complement(59724..60920) [1197 bp, 398 aa] {ON...   517   0.0  
ZYRO0F00462g Chr6 complement(46021..47202) [1182 bp, 393 aa] {ON...   475   e-167
Ecym_3012 Chr3 complement(24573..25766) [1194 bp, 397 aa] {ON} s...   467   e-164
Kpol_1045.78 s1045 (183044..184222) [1179 bp, 392 aa] {ON} (1830...   461   e-161
TDEL0G04620 Chr7 (842202..843380) [1179 bp, 392 aa] {ON} Anc_6.9...   459   e-161
NCAS0F00190 Chr6 complement(29012..30247) [1236 bp, 411 aa] {ON}...   459   e-161
KLLA0D00814g Chr4 complement(76687..77913) [1227 bp, 408 aa] {ON...   455   e-159
NDAI0K02900 Chr11 (657436..658752) [1317 bp, 438 aa] {ON} Anc_6.9     445   e-155
ACR017W Chr3 (387122..388393) [1272 bp, 423 aa] {ON} Syntenic ho...   434   e-150
Skud_5.33 Chr5 (46184..47389) [1206 bp, 401 aa] {ON} YEL056W (REAL)   426   e-148
KNAG0E00980 Chr5 complement(186207..187451) [1245 bp, 414 aa] {O...   423   e-146
YEL056W Chr5 (47168..48373) [1206 bp, 401 aa] {ON}  HAT2Subunit ...   422   e-146
Suva_5.12 Chr5 (23273..24478) [1206 bp, 401 aa] {ON} YEL056W (REAL)   422   e-146
TPHA0M00190 Chr13 complement(38571..39746) [1176 bp, 391 aa] {ON...   421   e-146
Smik_5.31 Chr5 (49406..50689) [1284 bp, 427 aa] {ON} YEL056W (REAL)   415   e-143
KAFR0L00320 Chr12 (56449..57624) [1176 bp, 391 aa] {ON} Anc_6.9 ...   407   e-140
CAGL0B03575g Chr2 complement(357525..358784) [1260 bp, 419 aa] {...   408   e-140
TBLA0A07120 Chr1 complement(1765718..1766941) [1224 bp, 407 aa] ...   387   e-132
KLTH0E12694g Chr5 (1126940..1128196) [1257 bp, 418 aa] {ON} simi...   140   6e-37
NDAI0C05510 Chr3 (1281190..1282449) [1260 bp, 419 aa] {ON} Anc_8...   134   1e-34
ZYRO0A13068g Chr1 (1032695..1033888) [1194 bp, 397 aa] {ON} simi...   129   7e-33
TBLA0H03650 Chr8 (888840..890099) [1260 bp, 419 aa] {ON} Anc_8.5...   128   1e-32
Kwal_27.12070 s27 (1071472..1072728) [1257 bp, 418 aa] {ON} YBR1...   128   1e-32
TPHA0L01720 Chr12 (362572..363831) [1260 bp, 419 aa] {ON} Anc_8....   127   5e-32
YBR195C Chr2 complement(610614..611882) [1269 bp, 422 aa] {ON}  ...   127   5e-32
Ecym_7042 Chr7 (86859..88103) [1245 bp, 414 aa] {ON} similar to ...   125   1e-31
TDEL0B02980 Chr2 complement(529584..530822) [1239 bp, 412 aa] {O...   125   2e-31
KLLA0E23541g Chr5 (2095246..2096499) [1254 bp, 417 aa] {ON} simi...   125   2e-31
Skud_2.321 Chr2 complement(577912..579180) [1269 bp, 422 aa] {ON...   124   6e-31
Kpol_1024.39 s1024 complement(104336..105589) [1254 bp, 417 aa] ...   124   6e-31
AEL250C Chr5 complement(168010..169263) [1254 bp, 417 aa] {ON} S...   122   2e-30
SAKL0H09900g Chr8 complement(847975..849252) [1278 bp, 425 aa] {...   122   3e-30
Suva_4.449 Chr4 complement(780822..782096) [1275 bp, 424 aa] {ON...   121   4e-30
NCAS0B02170 Chr2 complement(354274..355518) [1245 bp, 414 aa] {O...   119   3e-29
Smik_2.335 Chr2 complement(596903..598171) [1269 bp, 422 aa] {ON...   118   6e-29
CAGL0M05291g Chr13 complement(566250..567509) [1260 bp, 419 aa] ...   118   7e-29
KAFR0I00840 Chr9 complement(162878..164119) [1242 bp, 413 aa] {O...   117   1e-28
KNAG0A03670 Chr1 complement(472849..474129) [1281 bp, 426 aa] {O...   117   1e-28
Kpol_1060.24 s1060 complement(61507..62967) [1461 bp, 486 aa] {O...    75   6e-14
Smik_4.45 Chr4 (85422..89234) [3813 bp, 1270 aa] {ON} YDL195W (R...    70   3e-12
Suva_4.53 Chr4 (95619..99434) [3816 bp, 1271 aa] {ON} YDL195W (R...    70   4e-12
Suva_13.311 Chr13 complement(511812..513344) [1533 bp, 510 aa] {...    68   1e-11
Skud_4.63 Chr4 (104587..108408) [3822 bp, 1273 aa] {ON} YDL195W ...    67   3e-11
YDL195W Chr4 (107208..111029) [3822 bp, 1273 aa] {ON}  SEC31Comp...    66   7e-11
Skud_13.291 Chr13 complement(506764..508293) [1530 bp, 509 aa] {...    65   8e-11
YMR131C Chr13 complement(533163..534698) [1536 bp, 511 aa] {ON} ...    65   1e-10
CAGL0K03861g Chr11 complement(360277..361818) [1542 bp, 513 aa] ...    65   1e-10
TPHA0D03590 Chr4 (752790..754586) [1797 bp, 598 aa] {ON} Anc_6.2...    65   2e-10
KAFR0A00380 Chr1 (70400..71950) [1551 bp, 516 aa] {ON} Anc_2.401...    64   2e-10
Kwal_33.15136 s33 (974095..975516) [1422 bp, 473 aa] {ON} YLL011...    64   2e-10
NCAS0G01120 Chr7 complement(199561..201045) [1485 bp, 494 aa] {O...    64   2e-10
Smik_13.329 Chr13 complement(515612..517141) [1530 bp, 509 aa] {...    63   4e-10
TDEL0A06890 Chr1 (1202790..1204133) [1344 bp, 447 aa] {ON} Anc_6...    63   4e-10
ZYRO0B10450g Chr2 complement(825240..826688) [1449 bp, 482 aa] {...    62   6e-10
KLLA0F15598g Chr6 (1439610..1441046) [1437 bp, 478 aa] {ON} high...    62   7e-10
KNAG0E02180 Chr5 (440039..441592) [1554 bp, 517 aa] {ON} Anc_2.4...    62   9e-10
YNL317W Chr14 (40619..42016) [1398 bp, 465 aa] {ON}  PFS2Integra...    62   1e-09
Smik_14.14 Chr14 (25114..26514) [1401 bp, 466 aa] {ON} YNL317W (...    62   1e-09
TPHA0G02650 Chr7 (558370..559920) [1551 bp, 516 aa] {ON} Anc_2.4...    61   2e-09
ZYRO0E08184g Chr5 (639823..641343) [1521 bp, 506 aa] {ON} simila...    61   2e-09
ZYRO0C03124g Chr3 complement(240321..241658) [1338 bp, 445 aa] {...    60   2e-09
Suva_14.22 Chr14 (36853..38262) [1410 bp, 469 aa] {ON} YNL317W (...    60   2e-09
NDAI0F01240 Chr6 complement(302631..304205) [1575 bp, 524 aa] {O...    60   3e-09
NCAS0F01970 Chr6 complement(396326..397861) [1536 bp, 511 aa] {O...    60   4e-09
Skud_14.22 Chr14 (34087..35490) [1404 bp, 467 aa] {ON} YNL317W (...    60   4e-09
Sklu_YGOB_Anc_2.401 Chr5 complement(385202..386764) [1563 bp, 52...    60   4e-09
Ecym_4249 Chr4 complement(516064..517188) [1125 bp, 374 aa] {ON}...    59   5e-09
TDEL0G03340 Chr7 (618276..619820) [1545 bp, 514 aa] {ON} Anc_2.4...    60   5e-09
CAGL0H00781g Chr8 complement(77292..78833) [1542 bp, 513 aa] {ON...    60   5e-09
Kpol_1041.20 s1041 complement(56019..57566) [1548 bp, 515 aa] {O...    60   6e-09
CAGL0D05588g Chr4 (533235..534668) [1434 bp, 477 aa] {ON} highly...    59   7e-09
KNAG0I00920 Chr9 (173033..174178) [1146 bp, 381 aa] {ON} Anc_8.3...    59   7e-09
TDEL0C02360 Chr3 (412482..416276) [3795 bp, 1264 aa] {ON} Anc_7....    60   7e-09
KLTH0F19294g Chr6 complement(1560167..1561522) [1356 bp, 451 aa]...    59   8e-09
KAFR0A06480 Chr1 complement(1312834..1314540) [1707 bp, 568 aa] ...    59   9e-09
KLLA0F17237g Chr6 (1577197..1578768) [1572 bp, 523 aa] {ON} high...    59   9e-09
Kwal_55.22067 s55 complement(1094600..1095955) [1356 bp, 451 aa]...    59   9e-09
SAKL0H15708g Chr8 (1370148..1371254) [1107 bp, 368 aa] {ON} high...    59   1e-08
ADL184W Chr4 (375530..376879) [1350 bp, 449 aa] {ON} Syntenic ho...    59   1e-08
NDAI0H02750 Chr8 (677299..678837) [1539 bp, 512 aa] {ON} Anc_2.4...    59   1e-08
Kwal_47.17827 s47 complement(570622..572193) [1572 bp, 523 aa] {...    59   1e-08
KLTH0G12430g Chr7 (1057236..1058339) [1104 bp, 367 aa] {ON} simi...    58   1e-08
KLTH0E09394g Chr5 complement(853592..855160) [1569 bp, 522 aa] {...    59   1e-08
ADR242C Chr4 complement(1126441..1128006) [1566 bp, 521 aa] {ON}...    59   1e-08
SAKL0C13266g Chr3 complement(1171961..1173340) [1380 bp, 459 aa]...    58   1e-08
TPHA0C00860 Chr3 (180116..181252) [1137 bp, 378 aa] {ON} Anc_8.3...    58   2e-08
NCAS0C04450 Chr3 (912688..914073) [1386 bp, 461 aa] {ON} Anc_3.25      58   2e-08
KAFR0L01320 Chr12 complement(244228..247950) [3723 bp, 1240 aa] ...    59   2e-08
YPL247C Chr16 complement(82625..84196) [1572 bp, 523 aa] {ON} Pu...    58   2e-08
SAKL0H22396g Chr8 complement(1949474..1951141) [1668 bp, 555 aa]...    58   2e-08
TPHA0P01490 Chr16 complement(302996..304375) [1380 bp, 459 aa] {...    57   2e-08
Kpol_1036.65 s1036 complement(180839..181954) [1116 bp, 371 aa] ...    57   3e-08
TBLA0A02310 Chr1 (557822..559417) [1596 bp, 531 aa] {ON} Anc_6.2...    57   3e-08
ZYRO0F05808g Chr6 complement(479060..482908) [3849 bp, 1282 aa] ...    57   4e-08
Kpol_1061.36 s1061 (100800..102569) [1770 bp, 589 aa] {ON} (1008...    57   4e-08
NDAI0G03830 Chr7 (919944..921476) [1533 bp, 510 aa] {ON} Anc_3.25      56   7e-08
Kpol_1048.59 s1048 complement(166721..169273) [2553 bp, 850 aa] ...    56   9e-08
CAGL0M04081g Chr13 complement(450572..451939) [1368 bp, 455 aa] ...    55   1e-07
TBLA0C05010 Chr3 complement(1217846..1219564) [1719 bp, 572 aa] ...    55   1e-07
TPHA0F00770 Chr6 (175091..176986) [1896 bp, 631 aa] {ON} Anc_4.1...    55   1e-07
CAGL0A00605g Chr1 complement(67281..69203) [1923 bp, 640 aa] {ON...    55   1e-07
KLLA0E07085g Chr5 (645766..647124) [1359 bp, 452 aa] {ON} simila...    55   1e-07
ZYRO0A08690g Chr1 (691253..692803) [1551 bp, 516 aa] {ON} highly...    54   2e-07
ZYRO0D05852g Chr4 (498219..499334) [1116 bp, 371 aa] {ON} simila...    54   2e-07
Kpol_1013.37 s1013 complement(88637..88936,88986..88994,89037..9...    54   3e-07
Kpol_1014.19 s1014 complement(30466..31824) [1359 bp, 452 aa] {O...    54   3e-07
Kwal_56.23895 s56 complement(763257..764360) [1104 bp, 367 aa] {...    54   4e-07
ADR090W Chr4 (868742..872443) [3702 bp, 1233 aa] {ON} Syntenic h...    54   4e-07
TBLA0G01490 Chr7 (389958..392156) [2199 bp, 732 aa] {ON} Anc_4.1...    54   5e-07
KAFR0B05700 Chr2 complement(1176020..1177138) [1119 bp, 372 aa] ...    53   5e-07
YPR178W Chr16 (892332..893729) [1398 bp, 465 aa] {ON}  PRP4Splic...    54   5e-07
KNAG0A01230 Chr1 complement(17341..21306) [3966 bp, 1321 aa] {ON...    54   5e-07
KAFR0I02840 Chr9 complement(570039..571409) [1371 bp, 456 aa] {O...    53   6e-07
Kpol_2001.65 s2001 (178299..181919) [3621 bp, 1206 aa] {ON} (178...    54   6e-07
AAR078W Chr1 (483989..485677) [1689 bp, 562 aa] {ON} Syntenic ho...    53   6e-07
KLLA0E04093g Chr5 (371642..372760) [1119 bp, 372 aa] {ON} simila...    53   6e-07
Smik_6.451 Chr6 (740074..741645) [1572 bp, 523 aa] {ON} YPL247C ...    53   7e-07
Ecym_8044 Chr8 (97649..98584) [936 bp, 311 aa] {ON} similar to A...    52   7e-07
CAGL0B01529g Chr2 (137174..138283) [1110 bp, 369 aa] {ON} highly...    52   8e-07
KLLA0C08547g Chr3 (749737..751284) [1548 bp, 515 aa] {ON} highly...    53   8e-07
KLLA0A08822g Chr1 (772565..774313) [1749 bp, 582 aa] {ON} simila...    53   8e-07
Suva_16.60 Chr16 complement(91552..93132) [1581 bp, 526 aa] {ON}...    53   8e-07
KAFR0J00980 Chr10 (176984..178426) [1443 bp, 480 aa] {ON} Anc_5....    53   9e-07
Kwal_56.24332 s56 (959476..960732) [1257 bp, 418 aa] {ON} YPL247...    52   9e-07
AFL157C Chr6 complement(140404..141720) [1317 bp, 438 aa] {ON} S...    52   9e-07
TBLA0H00230 Chr8 complement(31016..35017) [4002 bp, 1333 aa] {ON...    53   1e-06
TBLA0B09250 Chr2 (2194005..2195585) [1581 bp, 526 aa] {ON} Anc_2...    52   1e-06
TDEL0F04430 Chr6 complement(831678..832781) [1104 bp, 367 aa] {O...    52   1e-06
NDAI0J00330 Chr10 (54580..55998) [1419 bp, 472 aa] {ON} Anc_7.534      52   1e-06
KNAG0I01050 Chr9 complement(200338..203817) [3480 bp, 1159 aa] {...    53   1e-06
Ecym_6067 Chr6 (124870..126438) [1569 bp, 522 aa] {ON} similar t...    52   1e-06
Skud_7.284 Chr7 complement(495549..497249) [1701 bp, 566 aa] {ON...    52   1e-06
Kpol_1028.41 s1028 (100720..102258) [1539 bp, 512 aa] {ON} (1007...    52   1e-06
Ecym_4717 Chr4 (1407391..1409202) [1812 bp, 603 aa] {ON} similar...    52   1e-06
NDAI0J01850 Chr10 (461283..463010) [1728 bp, 575 aa] {ON} Anc_4....    52   2e-06
Smik_7.287 Chr7 complement(484376..486076) [1701 bp, 566 aa] {ON...    52   2e-06
KLLA0F19734g Chr6 (1826828..1830229) [3402 bp, 1133 aa] {ON} sim...    52   2e-06
KAFR0B05580 Chr2 (1142731..1146093) [3363 bp, 1120 aa] {ON} Anc_...    52   2e-06
NCAS0B03690 Chr2 complement(657488..660925) [3438 bp, 1145 aa] {...    52   2e-06
AGL190W Chr7 (341382..342494) [1113 bp, 370 aa] {ON} Syntenic ho...    51   2e-06
KLTH0H02772g Chr8 complement(248747..250009) [1263 bp, 420 aa] {...    51   2e-06
Skud_16.482 Chr16 (834842..836239) [1398 bp, 465 aa] {ON} YPR178...    52   2e-06
Skud_16.32 Chr16 complement(56168..57736) [1569 bp, 522 aa] {ON}...    51   2e-06
TDEL0F02230 Chr6 (407699..409369) [1671 bp, 556 aa] {ON} Anc_4.1...    51   2e-06
Ecym_2026 Chr2 (42179..43534) [1356 bp, 451 aa] {ON} similar to ...    51   3e-06
KLLA0E20967g Chr5 (1872227..1876192) [3966 bp, 1321 aa] {ON} sim...    52   3e-06
Smik_10.126 Chr10 (196821..198959) [2139 bp, 712 aa] {ON} YJL112...    51   3e-06
KAFR0F01060 Chr6 complement(201465..203126) [1662 bp, 553 aa] {O...    51   3e-06
KNAG0B05550 Chr2 (1080707..1082560) [1854 bp, 617 aa] {ON} Anc_4...    51   3e-06
Kpol_1028.23 s1028 (63032..65266) [2235 bp, 744 aa] {ON} (63032....    51   3e-06
Suva_2.291 Chr2 (504722..508177) [3456 bp, 1151 aa] {ON} YDR128W...    51   3e-06
KLLA0F05159g Chr6 (506007..509702) [3696 bp, 1231 aa] {ON} simil...    51   3e-06
KNAG0D00740 Chr4 complement(115399..116913) [1515 bp, 504 aa] {O...    51   3e-06
ZYRO0G10472g Chr7 complement(844939..846621) [1683 bp, 560 aa] {...    51   4e-06
Smik_16.442 Chr16 (754983..756395) [1413 bp, 470 aa] {ON} YPR178...    50   4e-06
KLTH0E08162g Chr5 complement(749584..751254) [1671 bp, 556 aa] {...    51   4e-06
TDEL0A00440 Chr1 (78820..80175) [1356 bp, 451 aa] {ON} Anc_3.25 ...    50   4e-06
NCAS0E03750 Chr5 complement(736672..740502) [3831 bp, 1276 aa] {...    51   4e-06
Kwal_56.23685 s56 complement(656691..659999) [3309 bp, 1102 aa] ...    51   4e-06
SAKL0F11506g Chr6 complement(894080..895786) [1707 bp, 568 aa] {...    50   4e-06
NCAS0J01110 Chr10 (189535..191322) [1788 bp, 595 aa] {ON}              50   5e-06
TPHA0E03080 Chr5 complement(646691..648157) [1467 bp, 488 aa] {O...    50   5e-06
YJL112W Chr10 (205305..207449) [2145 bp, 714 aa] {ON}  MDV1Perip...    50   6e-06
Ecym_8061 Chr8 complement(131761..135447) [3687 bp, 1228 aa] {ON...    50   6e-06
KAFR0L01520 Chr12 complement(278754..280508) [1755 bp, 584 aa] {...    50   6e-06
KNAG0B02800 Chr2 (537056..540979) [3924 bp, 1307 aa] {ON} Anc_7....    50   6e-06
CAGL0A04037g Chr1 complement(404063..405814) [1752 bp, 583 aa] {...    50   7e-06
AEL269C Chr5 complement(134760..136127) [1368 bp, 455 aa] {ON} S...    49   9e-06
YGL003C Chr7 complement(492474..494174) [1701 bp, 566 aa] {ON}  ...    50   9e-06
TBLA0E00760 Chr5 (158338..159492) [1155 bp, 384 aa] {ON}               49   9e-06
TBLA0F02140 Chr6 complement(526982..530884) [3903 bp, 1300 aa] {...    50   9e-06
SAKL0A02970g Chr1 complement(275095..276342) [1248 bp, 415 aa] {...    49   1e-05
NDAI0J01040 Chr10 (238940..240136) [1197 bp, 398 aa] {ON} Anc_8....    49   1e-05
Suva_7.279 Chr7 complement(484066..485766) [1701 bp, 566 aa] {ON...    49   1e-05
CAGL0A02772g Chr1 complement(293966..295291) [1326 bp, 441 aa] {...    49   1e-05
Skud_10.102 Chr10 (173179..175305) [2127 bp, 708 aa] {ON} YJL112...    49   1e-05
NCAS0E02840 Chr5 (558336..560159) [1824 bp, 607 aa] {ON} Anc_7.3...    49   1e-05
Kpol_1019.30 s1019 (56367..60125) [3759 bp, 1252 aa] {ON} (56367...    49   1e-05
KLLA0E08449g Chr5 (759718..760986) [1269 bp, 422 aa] {ON} simila...    49   1e-05
SAKL0A01276g Chr1 (124778..126325) [1548 bp, 515 aa] {ON} highly...    49   1e-05
SAKL0F10384g Chr6 complement(799553..803338) [3786 bp, 1261 aa] ...    49   1e-05
Kpol_1028.54 s1028 (125940..128657) [2718 bp, 905 aa] {ON} (1259...    49   2e-05
NDAI0J01180 Chr10 complement(273472..276876) [3405 bp, 1134 aa] ...    49   2e-05
KLTH0G13068g Chr7 complement(1118964..1122269) [3306 bp, 1101 aa...    49   2e-05
SAKL0H16390g Chr8 complement(1437966..1441388) [3423 bp, 1140 aa...    49   2e-05
YDR128W Chr4 (709549..712995) [3447 bp, 1148 aa] {ON}  MTC5Subun...    49   2e-05
KLTH0F16192g Chr6 (1312331..1313719) [1389 bp, 462 aa] {ON} simi...    49   2e-05
Smik_4.374 Chr4 (670748..674206) [3459 bp, 1152 aa] {ON} YDR128W...    49   2e-05
NDAI0K02350 Chr11 complement(524551..526932) [2382 bp, 793 aa] {...    49   2e-05
ZYRO0G20152g Chr7 complement(1669233..1669655,1669872..1670408) ...    48   2e-05
KAFR0B00370 Chr2 complement(83264..84649) [1386 bp, 461 aa] {ON}...    48   2e-05
TBLA0F02400 Chr6 complement(590293..591189) [897 bp, 298 aa] {ON...    48   2e-05
Kpol_530.25 s530 (67445..69169) [1725 bp, 574 aa] {ON} (67445..6...    48   2e-05
Kwal_27.12239 s27 complement(1143763..1144713) [951 bp, 316 aa] ...    48   2e-05
SAKL0A00660g Chr1 (71855..73837) [1983 bp, 660 aa] {ON} some sim...    48   2e-05
Ecym_4134 Chr4 complement(280146..282578) [2433 bp, 810 aa] {ON}...    49   2e-05
TBLA0F02230 Chr6 (551746..555396) [3651 bp, 1216 aa] {ON} Anc_7....    49   3e-05
NDAI0D02250 Chr4 complement(526907..529294) [2388 bp, 795 aa] {O...    48   3e-05
NDAI0I00460 Chr9 (91809..94562) [2754 bp, 917 aa] {ON} Anc_6.325       48   3e-05
NCAS0D04610 Chr4 (881005..882552) [1548 bp, 515 aa] {ON} Anc_6.340     48   3e-05
Skud_4.389 Chr4 (681326..684781) [3456 bp, 1151 aa] {ON} YDR128W...    48   3e-05
AGL234W Chr7 (257969..259858) [1890 bp, 629 aa] {ON} Syntenic ho...    48   3e-05
TDEL0C02240 Chr3 complement(388060..391665) [3606 bp, 1201 aa] {...    48   3e-05
KNAG0G00800 Chr7 (147792..150164) [2373 bp, 790 aa] {ON} Anc_5.1...    48   3e-05
ZYRO0F10406g Chr6 (843429..846245) [2817 bp, 938 aa] {ON} simila...    48   3e-05
TPHA0D04500 Chr4 (978756..982382) [3627 bp, 1208 aa] {ON} Anc_7....    48   3e-05
Ecym_2139 Chr2 complement(262217..263524) [1308 bp, 435 aa] {ON}...    47   4e-05
SAKL0E03960g Chr5 complement(319708..320130,320346..320885) [963...    47   4e-05
Kpol_1031.36 s1031 complement(87105..89225) [2121 bp, 706 aa] {O...    48   4e-05
CAGL0J03476g Chr10 (334536..336089) [1554 bp, 517 aa] {ON} highl...    47   4e-05
KNAG0A01250 Chr1 (23559..24917) [1359 bp, 452 aa] {ON} Anc_3.25 ...    47   4e-05
Suva_16.510 Chr16 (874866..876263) [1398 bp, 465 aa] {ON} YPR178...    47   4e-05
Suva_3.121 Chr3 complement(177765..179864) [2100 bp, 700 aa] {ON...    48   4e-05
Kwal_56.24478 s56 complement(1010876..1014766) [3891 bp, 1296 aa...    48   4e-05
SAKL0F15972g Chr6 (1291625..1293037) [1413 bp, 470 aa] {ON} simi...    47   4e-05
Kpol_1038.20 s1038 complement(43719..47660) [3942 bp, 1313 aa] {...    48   4e-05
NCAS0C04430 Chr3 complement(905927..909862) [3936 bp, 1311 aa] {...    48   5e-05
YCR084C Chr3 complement(260311..262452) [2142 bp, 713 aa] {ON}  ...    47   5e-05
TBLA0A03890 Chr1 complement(973249..974337) [1089 bp, 362 aa] {O...    47   5e-05
SAKL0F10648g Chr6 (827399..831010) [3612 bp, 1203 aa] {ON} highl...    47   5e-05
Kwal_55.22076 s55 (1098857..1102717) [3861 bp, 1286 aa] {ON} YOL...    47   5e-05
KLTH0A06754g Chr1 complement(560921..562465) [1545 bp, 514 aa] {...    47   5e-05
ZYRO0A09636g Chr1 (779501..781927) [2427 bp, 808 aa] {ON} highly...    47   5e-05
KLLA0E19515g Chr5 complement(1733708..1735426) [1719 bp, 572 aa]...    47   5e-05
Suva_6.187 Chr6 complement(344709..346853) [2145 bp, 714 aa] {ON...    47   6e-05
Skud_12.56 Chr12 (118914..120383) [1470 bp, 489 aa] {ON} YLL011W...    47   6e-05
Smik_4.90 Chr4 complement(171469..175074) [3606 bp, 1201 aa] {ON...    47   6e-05
ADL186C Chr4 complement(369320..373405) [4086 bp, 1361 aa] {ON} ...    47   6e-05
Ecym_2523 Chr2 complement(1021566..1023506) [1941 bp, 646 aa] {O...    47   8e-05
Skud_3.156 Chr3 complement(244873..247014) [2142 bp, 713 aa] {ON...    47   9e-05
NDAI0A02090 Chr1 complement(466744..470346) [3603 bp, 1200 aa] {...    47   9e-05
TDEL0A00410 Chr1 complement(70940..74728) [3789 bp, 1262 aa] {ON...    47   9e-05
TBLA0B08730 Chr2 complement(2077729..2079114) [1386 bp, 461 aa] ...    46   9e-05
KLTH0D04466g Chr4 (413024..413560,413816..414238) [960 bp, 319 a...    46   9e-05
NCAS0A15170 Chr1 (2984221..2985645) [1425 bp, 474 aa] {ON} Anc_7...    46   1e-04
SAKL0C13332g Chr3 (1177358..1181419) [4062 bp, 1353 aa] {ON} sim...    47   1e-04
KNAG0I02840 Chr9 (554645..556204) [1560 bp, 519 aa] {ON} Anc_6.3...    46   1e-04
SAKL0A01738g Chr1 (157360..160089) [2730 bp, 909 aa] {ON} highly...    47   1e-04
TPHA0A00380 Chr1 complement(55881..59813) [3933 bp, 1310 aa] {ON...    47   1e-04
NCAS0G03600 Chr7 complement(672904..673887) [984 bp, 327 aa] {ON...    46   1e-04
AER255C Chr5 complement(1107932..1109335) [1404 bp, 467 aa] {ON}...    46   1e-04
Suva_4.99 Chr4 complement(182425..186030) [3606 bp, 1201 aa] {ON...    46   1e-04
Skud_4.109 Chr4 complement(190191..193796) [3606 bp, 1201 aa] {O...    46   1e-04
TBLA0B09100 Chr2 complement(2156320..2156742,2157014..2157544) [...    45   1e-04
KAFR0F04350 Chr6 (853842..855389) [1548 bp, 515 aa] {ON} Anc_6.3...    46   1e-04
CAGL0I03718g Chr9 complement(317565..321170) [3606 bp, 1201 aa] ...    46   1e-04
Ecym_4280 Chr4 complement(600066..603464) [3399 bp, 1132 aa] {ON...    46   1e-04
CAGL0K09284g Chr11 (915766..918501) [2736 bp, 911 aa] {ON} highl...    46   1e-04
Ecym_5528 Chr5 complement(1070598..1072013) [1416 bp, 471 aa] {O...    46   1e-04
CAGL0C03608g Chr3 (360681..362612) [1932 bp, 643 aa] {ON} simila...    46   1e-04
KLLA0C08976g Chr3 (784536..787271) [2736 bp, 911 aa] {ON} highly...    46   1e-04
TDEL0F04150 Chr6 (765748..769152) [3405 bp, 1134 aa] {ON} Anc_8....    46   1e-04
Smik_13.277 Chr13 (437902..439443) [1542 bp, 513 aa] {ON} YMR093...    46   1e-04
Suva_10.292 Chr10 (516694..518436) [1743 bp, 580 aa] {ON} YLR196...    46   1e-04
TPHA0G02380 Chr7 (484477..485010,485373..485795) [957 bp, 318 aa...    45   1e-04
ZYRO0F11110g Chr6 (908737..912342) [3606 bp, 1201 aa] {ON} highl...    46   1e-04
TPHA0F03030 Chr6 complement(661801..663549) [1749 bp, 582 aa] {O...    46   1e-04
AER263C Chr5 complement(1118228..1119769) [1542 bp, 513 aa] {ON}...    46   1e-04
NDAI0E04440 Chr5 (1002113..1003858) [1746 bp, 581 aa] {ON} Anc_7...    46   2e-04
Suva_13.295 Chr13 complement(480518..480940,481217..481753) [960...    45   2e-04
Skud_13.275 Chr13 complement(474770..475192,475471..476007) [960...    45   2e-04
Smik_13.305 Chr13 complement(482912..483334,483612..484148) [960...    45   2e-04
YMR116C Chr13 complement(499456..499878,500152..500688) [960 bp,...    45   2e-04
KAFR0H02450 Chr8 complement(468767..470020) [1254 bp, 417 aa] {O...    45   2e-04
NDAI0E03440 Chr5 complement(735469..738042) [2574 bp, 857 aa] {O...    46   2e-04
KNAG0G02450 Chr7 (557570..560398) [2829 bp, 942 aa] {ON} Anc_8.3...    46   2e-04
Ecym_4255 Chr4 (529455..532268) [2814 bp, 937 aa] {ON} similar t...    46   2e-04
Suva_3.109 Chr3 complement(158211..159758) [1548 bp, 515 aa] {ON...    45   2e-04
YDL145C Chr4 complement(194571..198176) [3606 bp, 1201 aa] {ON} ...    46   2e-04
Smik_3.157 Chr3 complement(218522..221296) [2775 bp, 924 aa] {ON...    45   2e-04
Skud_3.133 Chr3 complement(204741..207488) [2748 bp, 916 aa] {ON...    45   2e-04
TDEL0A02450 Chr1 complement(437732..439264) [1533 bp, 510 aa] {O...    45   2e-04
TPHA0B00590 Chr2 complement(134906..136672) [1767 bp, 588 aa] {O...    45   2e-04
NDAI0H02710 Chr8 complement(668900..669322,669678..670211) [957 ...    45   2e-04
TPHA0D00580 Chr4 (100671..102869) [2199 bp, 732 aa] {ON} Anc_8.6...    45   2e-04
CAGL0B02013g Chr2 (184252..187614) [3363 bp, 1120 aa] {ON} highl...    45   2e-04
SAKL0B02244g Chr2 (212226..214547) [2322 bp, 773 aa] {ON} simila...    45   2e-04
KNAG0B02580 Chr2 (501215..502957) [1743 bp, 580 aa] {ON} Anc_7.3...    45   2e-04
TPHA0I01880 Chr9 complement(418620..421724) [3105 bp, 1034 aa] {...    45   2e-04
Smik_12.256 Chr12 (490929..492659) [1731 bp, 576 aa] {ON} YLR196...    45   2e-04
Suva_3.93 Chr3 complement(133524..136286) [2763 bp, 920 aa] {ON}...    45   2e-04
NCAS0F03340 Chr6 complement(675569..676915) [1347 bp, 448 aa] {O...    45   2e-04
KAFR0L01390 Chr12 (257344..260964) [3621 bp, 1206 aa] {ON} Anc_7...    45   2e-04
NCAS0B03550 Chr2 complement(627953..629080) [1128 bp, 375 aa] {O...    45   2e-04
KNAG0B02720 Chr2 complement(523885..527499) [3615 bp, 1204 aa] {...    45   2e-04
Kpol_1033.19 s1033 (40266..43685) [3420 bp, 1139 aa] {ON} (40266...    45   2e-04
ZYRO0B02486g Chr2 complement(199474..201201) [1728 bp, 575 aa] {...    45   2e-04
KNAG0I02540 Chr9 (489509..492265) [2757 bp, 918 aa] {ON} Anc_6.3...    45   2e-04
TBLA0F04130 Chr6 complement(1021035..1022579) [1545 bp, 514 aa] ...    45   3e-04
ZYRO0D08206g Chr4 (711937..713484) [1548 bp, 515 aa] {ON} highly...    45   3e-04
YCR072C Chr3 complement(240805..242352) [1548 bp, 515 aa] {ON}  ...    45   3e-04
Ecym_2093 Chr2 (165578..168349) [2772 bp, 923 aa] {ON} similar t...    45   3e-04
AGR180W Chr7 (1090641..1093061) [2421 bp, 806 aa] {ON} Syntenic ...    45   3e-04
TBLA0I02280 Chr9 complement(523331..526114) [2784 bp, 927 aa] {O...    45   3e-04
TPHA0G01610 Chr7 complement(332529..333773) [1245 bp, 414 aa] {O...    45   3e-04
KNAG0J01680 Chr10 (307280..308476) [1197 bp, 398 aa] {ON} Anc_8....    45   3e-04
KLTH0E15576g Chr5 complement(1384027..1386198) [2172 bp, 723 aa]...    45   3e-04
TDEL0A07780 Chr1 complement(1352017..1353990) [1974 bp, 657 aa] ...    45   3e-04
TDEL0A02070 Chr1 (372046..372582,372798..373220) [960 bp, 319 aa...    44   3e-04
YMR093W Chr13 (454015..455556) [1542 bp, 513 aa] {ON}  UTP15Nucl...    45   3e-04
ADR077C Chr4 complement(843169..846783) [3615 bp, 1204 aa] {ON} ...    45   3e-04
TDEL0A07400 Chr1 complement(1292494..1295199) [2706 bp, 901 aa] ...    45   3e-04
TDEL0C01920 Chr3 (337685..339376) [1692 bp, 563 aa] {ON} Anc_7.3...    45   3e-04
Suva_2.303 Chr2 complement(535706..536839) [1134 bp, 377 aa] {ON...    44   3e-04
Skud_4.401 Chr4 complement(712131..713261) [1131 bp, 376 aa] {ON...    44   4e-04
NCAS0D04780 Chr4 (916321..918186) [1866 bp, 621 aa] {ON} Anc_6.363     45   4e-04
KAFR0A03380 Chr1 (690272..692272) [2001 bp, 666 aa] {ON} Anc_1.2...    45   4e-04
KLLA0F21406g Chr6 complement(1996260..1998377) [2118 bp, 705 aa]...    45   4e-04
Ecym_6169 Chr6 complement(314473..316128) [1656 bp, 551 aa] {ON}...    44   4e-04
ZYRO0F07282g Chr6 (590095..591378) [1284 bp, 427 aa] {ON} simila...    44   4e-04
CAGL0M02563g Chr13 complement(295156..296529) [1374 bp, 457 aa] ...    44   4e-04
YDR364C Chr4 complement(1202843..1204210) [1368 bp, 455 aa] {ON}...    44   4e-04
Kpol_297.7 s297 (10035..10568,10902..11324) [957 bp, 318 aa] {ON...    44   4e-04
KAFR0I02860 Chr9 (573406..577503) [4098 bp, 1365 aa] {ON} Anc_3....    44   4e-04
KLTH0A07282g Chr1 complement(604949..607126) [2178 bp, 725 aa] {...    44   4e-04
ZYRO0D06556g Chr4 complement(564778..568221) [3444 bp, 1147 aa] ...    44   4e-04
Kwal_23.6429 s23 complement(1577398..1579650) [2253 bp, 750 aa] ...    44   5e-04
NDAI0E02400 Chr5 (499223..500527) [1305 bp, 434 aa] {ON} Anc_8.672     44   5e-04
KLTH0F19338g Chr6 (1564555..1568427) [3873 bp, 1290 aa] {ON} sim...    44   5e-04
Kwal_23.6240 s23 complement(1503990..1506731) [2742 bp, 913 aa] ...    44   5e-04
KAFR0J02550 Chr10 complement(484360..487080) [2721 bp, 906 aa] {...    44   5e-04
Suva_16.159 Chr16 complement(275378..276733) [1356 bp, 451 aa] {...    44   5e-04
Kpol_1062.32 s1062 (69674..71074) [1401 bp, 466 aa] {ON} (69674....    44   5e-04
Kwal_23.5035 s23 (975572..977806) [2235 bp, 744 aa] {ON} YFL009W...    44   5e-04
Smik_4.386 Chr4 complement(701174..702304) [1131 bp, 376 aa] {ON...    44   5e-04
KLLA0E21187g Chr5 (1892524..1893813) [1290 bp, 429 aa] {ON} simi...    44   5e-04
Smik_6.70 Chr6 (129582..131933) [2352 bp, 783 aa] {ON} YFL009W (...    44   5e-04
NCAS0D04480 Chr4 complement(851440..854187) [2748 bp, 915 aa] {O...    44   5e-04
TBLA0F04240 Chr6 (1043577..1045760) [2184 bp, 727 aa] {ON} Anc_6...    44   5e-04
Suva_11.268 Chr11 complement(492639..494576) [1938 bp, 645 aa] {...    44   5e-04
AAR057W Chr1 (442821..445589) [2769 bp, 922 aa] {ON} Syntenic ho...    44   6e-04
Kwal_55.21450 s55 (842483..843994) [1512 bp, 503 aa] {ON} YDR364...    44   6e-04
YFL009W Chr6 (116145..118484) [2340 bp, 779 aa] {ON}  CDC4F-box ...    44   6e-04
TPHA0E01790 Chr5 (359679..361004) [1326 bp, 441 aa] {ON} Anc_5.4...    44   6e-04
Kpol_1048.38 s1048 (104927..105949) [1023 bp, 340 aa] {ON} (1049...    44   6e-04
YCR057C Chr3 complement(220457..223228) [2772 bp, 923 aa] {ON}  ...    44   6e-04
KNAG0B02670 Chr2 (517131..518042) [912 bp, 303 aa] {ON} Anc_7.33...    43   6e-04
Smik_3.172 Chr3 complement(240515..242062) [1548 bp, 515 aa] {ON...    44   6e-04
TPHA0M01830 Chr13 complement(378923..380470) [1548 bp, 515 aa] {...    44   6e-04
KLTH0A06380g Chr1 complement(532367..535114) [2748 bp, 915 aa] {...    44   6e-04
Kwal_27.11585 s27 (859952..862423) [2472 bp, 823 aa] {ON} YLR222...    44   7e-04
Skud_6.63 Chr6 (118478..120823) [2346 bp, 781 aa] {ON} YFL009W (...    44   7e-04
Kpol_467.20 s467 complement(43262..43506,43751..45251) [1746 bp,...    44   7e-04
Smik_5.200 Chr5 (297829..299004) [1176 bp, 391 aa] {ON} YFL009W ...    43   7e-04
KLLA0F04884g Chr6 complement(478044..481682) [3639 bp, 1212 aa] ...    44   7e-04
TBLA0E04570 Chr5 (1163562..1165349) [1788 bp, 595 aa] {ON} Anc_4...    44   7e-04
KNAG0M01750 Chr13 complement(323446..324903) [1458 bp, 485 aa] {...    44   8e-04
ZYRO0D01122g Chr4 complement(86927..88327) [1401 bp, 466 aa] {ON...    44   8e-04
KLTH0H01892g Chr8 complement(167262..170891) [3630 bp, 1209 aa] ...    44   8e-04
KLLA0F11231g Chr6 complement(1034708..1036012) [1305 bp, 434 aa]...    43   8e-04
NDAI0I00350 Chr9 (71116..72663) [1548 bp, 515 aa] {ON} Anc_6.340       44   8e-04
ADL322C Chr4 complement(128828..130333) [1506 bp, 501 aa] {ON} S...    43   8e-04
Kwal_56.24526 s56 (1036575..1040207) [3633 bp, 1210 aa] {ON} YDL...    44   9e-04
TBLA0D04020 Chr4 complement(997081..1000617) [3537 bp, 1178 aa] ...    44   0.001
TPHA0A03100 Chr1 (679875..683672) [3798 bp, 1265 aa] {ON} Anc_7....    44   0.001
TPHA0G03100 Chr7 complement(659503..661032) [1530 bp, 509 aa] {O...    43   0.001
KLTH0H01122g Chr8 (113798..115537) [1740 bp, 579 aa] {ON} simila...    43   0.001
CAGL0G09845g Chr7 (940598..942100) [1503 bp, 500 aa] {ON} simila...    43   0.001
Skud_11.271 Chr11 complement(490869..492809) [1941 bp, 646 aa] {...    43   0.001
Suva_10.222 Chr10 (408217..411048) [2832 bp, 943 aa] {ON} YLR129...    43   0.001
KAFR0L01440 Chr12 complement(266463..267377) [915 bp, 304 aa] {O...    42   0.001
NDAI0I02180 Chr9 complement(499955..501394) [1440 bp, 479 aa] {O...    43   0.001
NCAS0A13940 Chr1 (2740150..2743767) [3618 bp, 1205 aa] {ON} Anc_...    43   0.001
KAFR0A00690 Chr1 complement(124349..125875) [1527 bp, 508 aa] {O...    43   0.001
SAKL0G02398g Chr7 complement(200123..201538) [1416 bp, 471 aa] {...    43   0.001
ZYRO0C03190g Chr3 (245542..249363) [3822 bp, 1273 aa] {ON} simil...    43   0.001
YLR196W Chr12 (543968..545698) [1731 bp, 576 aa] {ON}  PWP1Prote...    43   0.001
NCAS0A07270 Chr1 complement(1442956..1445355) [2400 bp, 799 aa] ...    43   0.001
Suva_10.316 Chr10 complement(551612..554068) [2457 bp, 818 aa] {...    43   0.001
KLTH0E13552g Chr5 complement(1202406..1203356) [951 bp, 316 aa] ...    42   0.001
Ecym_2498 Chr2 complement(974601..976229) [1629 bp, 542 aa] {ON}...    43   0.001
Kwal_23.6324 s23 complement(1531252..1532796) [1545 bp, 514 aa] ...    43   0.001
Skud_12.261 Chr12 (490588..492330) [1743 bp, 580 aa] {ON} YLR196...    43   0.001
YOR212W Chr15 (742910..744181) [1272 bp, 423 aa] {ON}  STE4G pro...    42   0.002
NCAS0A07860 Chr1 (1563830..1565362) [1533 bp, 510 aa] {ON} Anc_2...    42   0.002
YKR036C Chr11 complement(508702..510633) [1932 bp, 643 aa] {ON} ...    42   0.002
Suva_13.270 Chr13 (435573..437114) [1542 bp, 513 aa] {ON} YMR093...    42   0.002
KAFR0C04740 Chr3 complement(941929..943926) [1998 bp, 665 aa] {O...    42   0.002
Suva_8.265 Chr8 (481783..483054) [1272 bp, 423 aa] {ON} YOR212W ...    42   0.002
Kpol_1001.23 s1001 complement(63130..64962) [1833 bp, 610 aa] {O...    42   0.002
Ecym_6098 Chr6 (185368..185901,186107..186529) [957 bp, 318 aa] ...    42   0.002
Ecym_4644 Chr4 (1256560..1257447) [888 bp, 295 aa] {ON} similar ...    42   0.002
KLTH0D05346g Chr4 complement(475917..477440) [1524 bp, 507 aa] {...    42   0.002
TBLA0H03060 Chr8 complement(748221..750413) [2193 bp, 730 aa] {O...    42   0.002
Suva_4.491 Chr4 complement(855726..856880) [1155 bp, 384 aa] {ON...    42   0.002
ABL044C Chr2 complement(312376..313932) [1557 bp, 518 aa] {ON} S...    42   0.002
TPHA0C01050 Chr3 complement(235500..238874) [3375 bp, 1124 aa] {...    42   0.002
AFR199C Chr6 complement(799873..800295,800490..801071) [1005 bp,...    42   0.002
KNAG0H01690 Chr8 (301564..302475) [912 bp, 303 aa] {ON} Anc_1.39...    42   0.002
NDAI0C02600 Chr3 complement(605643..606554) [912 bp, 303 aa] {ON}      42   0.002
KNAG0B01610 Chr2 (294433..296457) [2025 bp, 674 aa] {ON} Anc_1.2...    42   0.002
Kwal_47.17567 s47 complement(459443..461215) [1773 bp, 590 aa] {...    42   0.002
Skud_13.249 Chr13 (427918..429459) [1542 bp, 513 aa] {ON} YMR093...    42   0.002
ZYRO0D08558g Chr4 (736975..739713) [2739 bp, 912 aa] {ON} highly...    42   0.002
TPHA0D03830 Chr4 complement(802754..805492) [2739 bp, 912 aa] {O...    42   0.002
TDEL0D01090 Chr4 complement(204076..206004) [1929 bp, 642 aa] {O...    42   0.002
Kpol_1011.6 s1011 complement(17489..19777) [2289 bp, 762 aa] {ON...    42   0.003
CAGL0E00561g Chr5 (49987..52497) [2511 bp, 836 aa] {ON} some sim...    42   0.003
Skud_4.634 Chr4 complement(1131614..1132978) [1365 bp, 454 aa] {...    42   0.003
KLTH0D11132g Chr4 (910259..911572) [1314 bp, 437 aa] {ON} simila...    42   0.003
KNAG0D00250 Chr4 (32581..34548) [1968 bp, 655 aa] {ON} Anc_6.363...    42   0.003
Skud_12.285 Chr12 complement(525831..528284) [2454 bp, 817 aa] {...    42   0.003
NDAI0G02580 Chr7 complement(590030..592906) [2877 bp, 958 aa] {O...    42   0.003
CAGL0G01628g Chr7 complement(151262..152392) [1131 bp, 376 aa] {...    41   0.003
TDEL0C00940 Chr3 (150797..152719) [1923 bp, 640 aa] {ON} Anc_8.6...    42   0.003
KAFR0H01750 Chr8 complement(322707..325058) [2352 bp, 783 aa] {O...    42   0.003
ZYRO0F11484g Chr6 complement(943018..943902) [885 bp, 294 aa] {O...    41   0.003
KLTH0A02750g Chr1 complement(239284..241545) [2262 bp, 753 aa] {...    42   0.003
YBR234C Chr2 complement(685438..686592) [1155 bp, 384 aa] {ON}  ...    41   0.003
Ecym_2808 Chr2 (1568103..1569500) [1398 bp, 465 aa] {ON} similar...    41   0.004
KLLA0F10263g Chr6 (949926..951974) [2049 bp, 682 aa] {ON} unipro...    41   0.004
ZYRO0F14960g Chr6 complement(1228479..1229438) [960 bp, 319 aa] ...    41   0.004
TBLA0I01220 Chr9 (261925..263460) [1536 bp, 511 aa] {ON} Anc_2.4...    41   0.004
ADR108C Chr4 complement(899198..900097) [900 bp, 299 aa] {ON} NO...    41   0.004
NDAI0A05790 Chr1 (1315884..1317374) [1491 bp, 496 aa] {ON}             41   0.004
SAKL0G16962g Chr7 (1463359..1463363,1463442..1465290) [1854 bp, ...    41   0.004
Skud_3.145 Chr3 complement(225459..227006) [1548 bp, 515 aa] {ON...    41   0.004
TBLA0D02630 Chr4 (645439..648027) [2589 bp, 862 aa] {ON} Anc_8.6...    41   0.004
Smik_3.183 Chr3 complement(259959..262088) [2130 bp, 709 aa] {ON...    41   0.004
Kwal_56.24596 s56 complement(1068314..1069198) [885 bp, 294 aa] ...    40   0.004
TPHA0P00330 Chr16 (63488..65419) [1932 bp, 643 aa] {ON} Anc_8.67...    41   0.004
KLTH0H02134g Chr8 (191540..195439) [3900 bp, 1299 aa] {ON} simil...    41   0.005
KAFR0A00510 Chr1 (93452..93988,94240..94662) [960 bp, 319 aa] {O...    40   0.005
CAGL0J03960g Chr10 complement(375780..377087) [1308 bp, 435 aa] ...    41   0.005
KLLA0E07965g Chr5 (717476..718648) [1173 bp, 390 aa] {ON} simila...    41   0.005
TDEL0B05970 Chr2 (1055359..1056270) [912 bp, 303 aa] {ON} Anc_1....    40   0.005
KNAG0E02310 Chr5 (463866..464402,464772..465194) [960 bp, 319 aa...    40   0.005
Kpol_1036.69 s1036 (189457..192267) [2811 bp, 936 aa] {ON} (1894...    41   0.005
SAKL0E07766g Chr5 (628373..629569) [1197 bp, 398 aa] {ON} simila...    40   0.006
Kwal_14.1597 s14 complement(383549..384691) [1143 bp, 380 aa] {O...    40   0.006
Smik_15.16 Chr15 complement(29410..33390) [3981 bp, 1326 aa] {ON...    41   0.006
NDAI0G03310 Chr7 complement(777538..780195) [2658 bp, 885 aa] {O...    41   0.006
TDEL0A06180 Chr1 (1082208..1083512) [1305 bp, 434 aa] {ON} Anc_8...    40   0.006
NCAS0C02710 Chr3 complement(505852..508299) [2448 bp, 815 aa] {O...    41   0.006
TDEL0A07550 Chr1 complement(1314676..1316223) [1548 bp, 515 aa] ...    40   0.006
SAKL0D03740g Chr4 (303240..304676) [1437 bp, 478 aa] {ON} simila...    40   0.006
CAGL0G04345g Chr7 (408842..410977) [2136 bp, 711 aa] {ON} simila...    40   0.007
KAFR0F02590 Chr6 complement(504740..506842) [2103 bp, 700 aa] {O...    40   0.007
NCAS0B01660 Chr2 complement(270046..271320) [1275 bp, 424 aa] {O...    40   0.007
Smik_15.398 Chr15 (692606..693883) [1278 bp, 425 aa] {ON} YOR212...    40   0.007
ACR137W Chr3 (590077..591354) [1278 bp, 425 aa] {ON} Syntenic ho...    40   0.007
NDAI0F02240 Chr6 (542551..545610) [3060 bp, 1019 aa] {ON} Anc_6....    40   0.007
TPHA0F02890 Chr6 complement(640553..641440) [888 bp, 295 aa] {ON...    40   0.008
CAGL0J06512g Chr10 complement(622640..624277) [1638 bp, 545 aa] ...    40   0.008
Kwal_26.8776 s26 (938508..939809) [1302 bp, 433 aa] {ON} YPL151C...    40   0.008
SAKL0H06666g Chr8 complement(586110..587435) [1326 bp, 441 aa] {...    40   0.008
NDAI0H02240 Chr8 complement(545073..546617) [1545 bp, 514 aa] {O...    40   0.008
KLTH0G10296g Chr7 complement(869990..871270) [1281 bp, 426 aa] {...    40   0.008
Kpol_1016.11 s1016 (27192..29201) [2010 bp, 669 aa] {ON} (27192....    40   0.008
YNL035C Chr14 complement(568522..569691) [1170 bp, 389 aa] {ON} ...    40   0.008
ZYRO0F06776g Chr6 (555965..557263) [1299 bp, 432 aa] {ON} simila...    40   0.009
CAGL0D02090g Chr4 (214357..214893,215564..215860) [834 bp, 277 a...    40   0.009
Ecym_8090 Chr8 (194643..196793) [2151 bp, 716 aa] {ON} similar t...    40   0.009
NCAS0C03990 Chr3 complement(804313..806505) [2193 bp, 730 aa] {O...    40   0.009
KAFR0E01230 Chr5 complement(247314..248423) [1110 bp, 369 aa] {O...    40   0.009
Smik_2.338 Chr2 complement(602610..605012) [2403 bp, 800 aa] {ON...    40   0.009
Kwal_56.24661 s56 complement(1093040..1094725) [1686 bp, 561 aa]...    40   0.009
Suva_7.152 Chr7 (284623..286461) [1839 bp, 612 aa] {ON} YGL116W ...    40   0.009
Ecym_2024 Chr2 complement(35886..39839) [3954 bp, 1317 aa] {ON} ...    40   0.010
CAGL0E01485g Chr5 complement(139067..143077) [4011 bp, 1336 aa] ...    40   0.010
ZYRO0D03828g Chr4 (310049..312229) [2181 bp, 726 aa] {ON} simila...    40   0.011
TPHA0M02000 Chr13 complement(414262..416361) [2100 bp, 699 aa] {...    40   0.011
TBLA0B04390 Chr2 (1014987..1015997) [1011 bp, 336 aa] {ON} Anc_8...    39   0.011
NDAI0D04730 Chr4 (1109256..1111241) [1986 bp, 661 aa] {ON} Anc_4...    40   0.011
TPHA0L01690 Chr12 (355859..358357) [2499 bp, 832 aa] {ON} Anc_8....    40   0.011
KAFR0C03830 Chr3 complement(776653..777798) [1146 bp, 381 aa] {O...    40   0.011
Kpol_1058.31 s1058 (85899..87926) [2028 bp, 675 aa] {ON} (85899....    40   0.011
Skud_12.272 Chr12 (506157..507050) [894 bp, 297 aa] {ON} YLR208W...    39   0.011
NCAS0B00480 Chr2 (69598..70968) [1371 bp, 456 aa] {ON} Anc_8.721       40   0.012
Suva_10.302 Chr10 (532343..533236) [894 bp, 297 aa] {ON} YLR208W...    39   0.012
Skud_14.298 Chr14 complement(546083..547252) [1170 bp, 389 aa] {...    39   0.012
CAGL0C01661g Chr3 complement(177284..178411) [1128 bp, 375 aa] {...    39   0.012
KAFR0A05610 Chr1 complement(1126349..1128211) [1863 bp, 620 aa] ...    40   0.013
AAL157C Chr1 complement(70077..71516) [1440 bp, 479 aa] {ON} Syn...    39   0.013
TPHA0I03240 Chr9 (714446..715879) [1434 bp, 477 aa] {ON} Anc_7.5...    39   0.014
TBLA0C01840 Chr3 (435021..436292) [1272 bp, 423 aa] {ON} Anc_8.6...    39   0.014
NDAI0E02310 Chr5 (477468..478811) [1344 bp, 447 aa] {ON}               39   0.014
NCAS0C01680 Chr3 (309670..310965) [1296 bp, 431 aa] {ON} Anc_8.672     39   0.014
KLTH0F16764g Chr6 complement(1358483..1359478) [996 bp, 331 aa] ...    39   0.014
NDAI0B05630 Chr2 complement(1376242..1377549) [1308 bp, 435 aa] ...    39   0.015
KNAG0H02040 Chr8 (366384..367583) [1200 bp, 399 aa] {ON} Anc_2.2...    39   0.015
CAGL0M08646g Chr13 (861488..862501) [1014 bp, 337 aa] {ON} simil...    39   0.015
Smik_6.348 Chr6 (556719..558074) [1356 bp, 451 aa] {ON} YPL151C ...    39   0.015
ZYRO0G11660g Chr7 (924314..926665) [2352 bp, 783 aa] {ON} simila...    39   0.016
TPHA0C00810 Chr3 complement(158582..161395) [2814 bp, 937 aa] {O...    39   0.016
Kwal_26.7736 s26 complement(491687..493210) [1524 bp, 507 aa] {O...    39   0.016
Smik_12.192 Chr12 (380993..383824) [2832 bp, 943 aa] {ON} YLR129...    39   0.016
Ecym_8072 Chr8 (157039..160644) [3606 bp, 1201 aa] {ON} similar ...    39   0.016
TPHA0B01120 Chr2 (254017..256176) [2160 bp, 719 aa] {ON} Anc_1.2...    39   0.017
NCAS0D02730 Chr4 (523453..524880) [1428 bp, 475 aa] {ON} Anc_5.201     39   0.017
Suva_5.178 Chr5 (266333..267301) [969 bp, 322 aa] {ON} YFL009W (...    39   0.017
KNAG0A03080 Chr1 complement(380346..381686) [1341 bp, 446 aa] {O...    39   0.017
Suva_8.321 Chr8 (572329..573711) [1383 bp, 460 aa] {ON} YOR272W ...    39   0.017
CAGL0K00957g Chr11 (95657..98038) [2382 bp, 793 aa] {ON} similar...    39   0.018
Skud_15.16 Chr15 complement(26552..30550) [3999 bp, 1332 aa] {ON...    39   0.018
YOR272W Chr15 (832813..834195) [1383 bp, 460 aa] {ON}  YTM1Const...    39   0.018
YPL151C Chr16 complement(266180..267535) [1356 bp, 451 aa] {ON} ...    39   0.018
KAFR0I00500 Chr9 complement(104685..106268) [1584 bp, 527 aa] {O...    39   0.018
NDAI0B05190 Chr2 complement(1269217..1271223) [2007 bp, 668 aa] ...    39   0.019
CAGL0L02629g Chr12 complement(309320..311707) [2388 bp, 795 aa] ...    39   0.019
KAFR0C03190 Chr3 complement(639680..641698) [2019 bp, 672 aa] {O...    39   0.019
Skud_15.379 Chr15 (681934..683211) [1278 bp, 425 aa] {ON} YOR212...    39   0.019
Smik_7.159 Chr7 (285146..286981) [1836 bp, 611 aa] {ON} YGL116W ...    39   0.019
Skud_15.437 Chr15 (771566..772951) [1386 bp, 461 aa] {ON} YOR272...    39   0.019
KNAG0G01080 Chr7 (235280..237520) [2241 bp, 746 aa] {ON}  YER066W      39   0.020
KNAG0B06450 Chr2 complement(1274888..1276792) [1905 bp, 634 aa] ...    39   0.021
TDEL0G02140 Chr7 complement(420388..421566) [1179 bp, 392 aa] {O...    39   0.021
KNAG0E02470 Chr5 (490378..491907) [1530 bp, 509 aa] {ON} Anc_2.4...    39   0.021
TBLA0A03750 Chr1 complement(937167..938510) [1344 bp, 447 aa] {O...    39   0.021
Kpol_1061.6 s1061 complement(19407..20762) [1356 bp, 451 aa] {ON...    39   0.021
KAFR0H03140 Chr8 complement(600224..601135) [912 bp, 303 aa] {ON...    39   0.021
KLTH0H12122g Chr8 (1034092..1035003) [912 bp, 303 aa] {ON} highl...    39   0.022
SAKL0F11022g Chr6 (863614..864504) [891 bp, 296 aa] {ON} highly ...    39   0.022
NCAS0G03870 Chr7 (717809..718978) [1170 bp, 389 aa] {ON} Anc_2.283     39   0.022
YDR142C Chr4 complement(740473..741600) [1128 bp, 375 aa] {ON}  ...    39   0.023
ZYRO0F03784g Chr6 (314914..317247) [2334 bp, 777 aa] {ON} simila...    39   0.023
ZYRO0B13838g Chr2 (1121025..1123079) [2055 bp, 684 aa] {ON} some...    39   0.023
KLLA0D07546g Chr4 complement(647984..649927) [1944 bp, 647 aa] {...    39   0.023
KLLA0C16643g Chr3 complement(1457590..1458498) [909 bp, 302 aa] ...    38   0.024
Ecym_7028 Chr7 (52132..52136,52211..54083) [1878 bp, 625 aa] {ON...    39   0.024
KLTH0H01518g Chr8 (138469..139353) [885 bp, 294 aa] {ON} highly ...    38   0.024
NCAS0H01190 Chr8 complement(226606..227715) [1110 bp, 369 aa] {O...    39   0.024
Smik_12.266 Chr12 (506562..507455) [894 bp, 297 aa] {ON} YLR208W...    38   0.024
CAGL0C00737g Chr3 complement(75028..77478) [2451 bp, 816 aa] {ON...    39   0.024
TPHA0L01080 Chr12 (226790..229297) [2508 bp, 835 aa] {ON} Anc_8....    39   0.024
YLR208W Chr12 (559551..560444) [894 bp, 297 aa] {ON}  SEC13Struc...    38   0.024
TDEL0F04500 Chr6 (843307..846123) [2817 bp, 938 aa] {ON} Anc_8.3...    39   0.026
Suva_15.22 Chr15 complement(39171..43181) [4011 bp, 1336 aa] {ON...    39   0.026
KLTH0A00880g Chr1 complement(90125..91540) [1416 bp, 471 aa] {ON...    39   0.028
ZYRO0D17292g Chr4 complement(1424965..1427121) [2157 bp, 718 aa]...    39   0.028
YGL116W Chr7 (289809..291641) [1833 bp, 610 aa] {ON}  CDC20Cell-...    39   0.029
CAGL0E00979g Chr5 complement(89783..91048) [1266 bp, 421 aa] {ON...    38   0.029
AEL314W Chr5 (52978..55125) [2148 bp, 715 aa] {ON} Syntenic homo...    39   0.029
Smik_16.106 Chr16 (194195..196564) [2370 bp, 789 aa] {ON} YGR200...    39   0.031
Skud_16.131 Chr16 complement(237797..239152) [1356 bp, 451 aa] {...    38   0.031
Skud_7.160 Chr7 (294214..296055) [1842 bp, 613 aa] {ON} YGL116W ...    39   0.031
ACR199C Chr3 complement(698881..699768) [888 bp, 295 aa] {ON} Sy...    38   0.031
Smik_15.454 Chr15 (782403..783788) [1386 bp, 461 aa] {ON} YOR272...    38   0.034
CAGL0J03806g Chr10 (363777..365039) [1263 bp, 420 aa] {ON} simil...    38   0.035
TBLA0G03080 Chr7 complement(817595..818923) [1329 bp, 442 aa] {O...    38   0.035
Suva_7.494 Chr7 complement(856266..858641) [2376 bp, 791 aa] {ON...    38   0.035
AGR067W Chr7 (842176..845553) [3378 bp, 1125 aa] {ON} Syntenic h...    38   0.036
KLLA0D12760g Chr4 complement(1090428..1091909) [1482 bp, 493 aa]...    38   0.036
KNAG0F02420 Chr6 complement(453743..455668) [1926 bp, 641 aa] {O...    38   0.036
Ecym_7105 Chr7 complement(205465..206919) [1455 bp, 484 aa] {ON}...    38   0.037
NCAS0C03260 Chr3 complement(640108..643059) [2952 bp, 983 aa] {O...    38   0.038
YGR200C Chr7 complement(899904..902270) [2367 bp, 788 aa] {ON}  ...    38   0.038
KLLA0D16390g Chr4 (1378884..1381694) [2811 bp, 936 aa] {ON} simi...    38   0.039
Ecym_7403 Chr7 (829923..831476) [1554 bp, 517 aa] {ON} similar t...    38   0.040
TDEL0C02080 Chr3 (360056..360940) [885 bp, 294 aa] {ON} Anc_7.33...    37   0.042
KNAG0G00130 Chr7 complement(8702..10888) [2187 bp, 728 aa] {ON} ...    38   0.043
TDEL0H00370 Chr8 complement(57487..58884) [1398 bp, 465 aa] {ON}...    38   0.044
Skud_2.366 Chr2 complement(654186..655340) [1155 bp, 384 aa] {ON...    38   0.044
Smik_4.631 Chr4 complement(1128746..1130113) [1368 bp, 455 aa] {...    38   0.046
NCAS0A05520 Chr1 complement(1085200..1087215) [2016 bp, 671 aa] ...    38   0.046
Kpol_2001.68 s2001 complement(187786..188673) [888 bp, 295 aa] {...    37   0.048
CAGL0L10890g Chr12 (1165380..1166753) [1374 bp, 457 aa] {ON} hig...    38   0.049
NDAI0G00630 Chr7 complement(137826..139019) [1194 bp, 397 aa] {O...    37   0.050
CAGL0J08778g Chr10 (868299..869195) [897 bp, 298 aa] {ON} highly...    37   0.051
TDEL0D03660 Chr4 (671946..673298) [1353 bp, 450 aa] {ON} Anc_3.2...    37   0.052
NDAI0A02610 Chr1 (585697..588000) [2304 bp, 767 aa] {ON} Anc_7.231     38   0.054
TPHA0F03650 Chr6 (793481..795703) [2223 bp, 740 aa] {ON} Anc_1.5...    38   0.054
KLTH0D12188g Chr4 (990209..991582) [1374 bp, 457 aa] {ON} simila...    37   0.055
Skud_7.536 Chr7 complement(874704..877070) [2367 bp, 788 aa] {ON...    38   0.055
KLLA0F13772g Chr6 (1276532..1278094) [1563 bp, 520 aa] {ON} high...    37   0.057
KLLA0D04840g Chr4 (413362..414273) [912 bp, 303 aa] {ON} highly ...    37   0.057
CAGL0J08998g Chr10 (884779..888624) [3846 bp, 1281 aa] {ON} high...    38   0.061
KNAG0G02820 Chr7 (623677..625050) [1374 bp, 457 aa] {ON} Anc_8.7...    37   0.062
Smik_2.377 Chr2 complement(671569..672723) [1155 bp, 384 aa] {ON...    37   0.063
KLTH0A04114g Chr1 complement(344618..346594) [1977 bp, 658 aa] {...    37   0.065
KLTH0D15840g Chr4 (1305121..1305125,1305195..1307283) [2094 bp, ...    37   0.065
KAFR0E03900 Chr5 complement(771649..772968) [1320 bp, 439 aa] {O...    37   0.067
NDAI0J02410 Chr10 complement(586395..589244) [2850 bp, 949 aa] {...    37   0.067
Suva_10.64 Chr10 (132461..133933) [1473 bp, 490 aa] {ON} YLL011W...    37   0.068
Suva_2.537 Chr2 complement(959258..960625) [1368 bp, 455 aa] {ON...    37   0.070
Ecym_2401 Chr2 complement(781043..782323) [1281 bp, 426 aa] {ON}...    37   0.070
Skud_2.324 Chr2 complement(583774..586182) [2409 bp, 802 aa] {ON...    37   0.073
ZYRO0A01804g Chr1 complement(150103..151233) [1131 bp, 376 aa] {...    37   0.074
Kwal_14.1675 s14 (419094..420215) [1122 bp, 373 aa] {ON} YBR234C...    37   0.074
NCAS0H00700 Chr8 (125259..126152) [894 bp, 297 aa] {ON} Anc_7.33...    37   0.076
Kpol_530.39 s530 (90456..91340) [885 bp, 294 aa] {ON} (90456..91...    37   0.076
KLLA0A04928g Chr1 (439349..441934) [2586 bp, 861 aa] {ON} simila...    37   0.076
SAKL0A05412g Chr1 complement(489032..492025) [2994 bp, 997 aa] {...    37   0.077
TBLA0B03570 Chr2 complement(828308..829684) [1377 bp, 458 aa] {O...    37   0.077
KAFR0G01170 Chr7 (265249..267603) [2355 bp, 784 aa] {ON} Anc_5.1...    37   0.080
ZYRO0F09922g Chr6 complement(805666..807033) [1368 bp, 455 aa] {...    37   0.080
CAGL0M04279g Chr13 (469040..471862) [2823 bp, 940 aa] {ON} highl...    37   0.081
YBR175W Chr2 (582408..583355) [948 bp, 315 aa] {ON}  SWD3Essenti...    37   0.085
NDAI0J02490 Chr10 complement(613859..615748) [1890 bp, 629 aa] {...    37   0.085
Skud_12.198 Chr12 (382439..385270) [2832 bp, 943 aa] {ON} YLR129...    37   0.088
KAFR0H00550 Chr8 (97619..98683) [1065 bp, 354 aa] {ON} Anc_5.631...    37   0.089
TBLA0A03950 Chr1 (986923..989733) [2811 bp, 936 aa] {ON} Anc_8.3...    37   0.094
TPHA0O00710 Chr15 (135136..136050) [915 bp, 304 aa] {ON} Anc_1.3...    37   0.095
TPHA0C03370 Chr3 complement(738736..739977) [1242 bp, 413 aa] {O...    37   0.098
Kpol_361.3 s361 complement(3792..5675) [1884 bp, 627 aa] {ON} co...    37   0.099
NDAI0E01500 Chr5 complement(295871..297157) [1287 bp, 428 aa] {O...    37   0.10 
TDEL0E04900 Chr5 complement(913381..915738) [2358 bp, 785 aa] {O...    37   0.10 
KLLA0D02530g Chr4 complement(212703..214826) [2124 bp, 707 aa] {...    37   0.10 
TDEL0E01960 Chr5 (369744..371102) [1359 bp, 452 aa] {ON} Anc_5.4...    37   0.10 
YOL138C Chr15 complement(61325..65350) [4026 bp, 1341 aa] {ON}  ...    37   0.11 
YLL011W Chr12 (127523..128992) [1470 bp, 489 aa] {ON}  SOF1Essen...    37   0.11 
Smik_14.322 Chr14 (578426..579337) [912 bp, 303 aa] {ON} YNL006W...    36   0.11 
YNL006W Chr14 (620067..620978) [912 bp, 303 aa] {ON}  LST8Protei...    36   0.11 
Skud_14.321 Chr14 (586864..587775) [912 bp, 303 aa] {ON} YNL006W...    36   0.11 
TPHA0C01150 Chr3 (263944..266007) [2064 bp, 687 aa] {ON} Anc_7.2...    37   0.12 
NDAI0E01320 Chr5 complement(262712..263995) [1284 bp, 427 aa] {O...    36   0.12 
KNAG0D01690 Chr4 (286791..288755) [1965 bp, 654 aa] {ON} Anc_7.2...    37   0.12 
Smik_13.32 Chr13 (64435..65841) [1407 bp, 468 aa] {ON} YML102W (...    36   0.12 
CAGL0J01265g Chr10 complement(118375..119928) [1554 bp, 517 aa] ...    37   0.12 
CAGL0I03454g Chr9 (292823..293734) [912 bp, 303 aa] {ON} similar...    36   0.12 
NDAI0I01520 Chr9 complement(358776..360710) [1935 bp, 644 aa] {O...    37   0.13 
CAGL0L03201g Chr12 complement(368792..370531) [1740 bp, 579 aa] ...    36   0.13 
ZYRO0F09372g Chr6 (761606..762952) [1347 bp, 448 aa] {ON} highly...    36   0.13 
Suva_14.342 Chr14 (600032..600943) [912 bp, 303 aa] {ON} YNL006W...    36   0.13 
Kwal_27.10591 s27 complement(407375..410320) [2946 bp, 981 aa] {...    37   0.13 
TBLA0C00990 Chr3 (195791..196972) [1182 bp, 393 aa] {ON} Anc_2.6...    36   0.13 
YLR429W Chr12 (990777..992732) [1956 bp, 651 aa] {ON}  CRN1Coron...    36   0.13 
TBLA0F00520 Chr6 complement(134791..136782) [1992 bp, 663 aa] {O...    36   0.13 
TDEL0D01310 Chr4 complement(251119..253248) [2130 bp, 709 aa] {O...    36   0.14 
Ecym_6228 Chr6 (425765..427102) [1338 bp, 445 aa] {ON} similar t...    36   0.15 
TDEL0A05770 Chr1 (1018340..1019641) [1302 bp, 433 aa] {ON} Anc_8...    36   0.16 
ACR091W Chr3 (520609..521595) [987 bp, 328 aa] {ON} Syntenic hom...    36   0.16 
Kwal_0.212 s0 (105364..106275) [912 bp, 303 aa] {ON} YNL006W (LS...    36   0.16 
Suva_14.311 Chr14 complement(553987..555156) [1170 bp, 389 aa] {...    36   0.17 
TDEL0A05970 Chr1 (1047306..1048733) [1428 bp, 475 aa] {ON} Anc_8...    36   0.17 
NCAS0D03330 Chr4 (623172..625046) [1875 bp, 624 aa] {ON} Anc_6.135     36   0.18 
KNAG0C01410 Chr3 (277054..279015) [1962 bp, 653 aa] {ON} Anc_1.2...    36   0.18 
Suva_13.325 Chr13 complement(536805..537848) [1044 bp, 347 aa] {...    36   0.18 
TBLA0B05920 Chr2 complement(1390257..1391468) [1212 bp, 403 aa] ...    36   0.18 
TDEL0E05480 Chr5 complement(1002913..1005540,1005640..1005657) [...    36   0.19 
TPHA0I00460 Chr9 (89882..91564) [1683 bp, 560 aa] {ON} Anc_8.817...    36   0.19 
NDAI0G00150 Chr7 complement(18719..20887) [2169 bp, 722 aa] {ON}...    36   0.19 
Skud_9.123 Chr9 (237466..239385) [1920 bp, 639 aa] {ON} YIL046W ...    36   0.19 
TBLA0D04130 Chr4 (1027726..1029450) [1725 bp, 574 aa] {ON} Anc_7...    36   0.19 
AFL041C Chr6 complement(361724..362833) [1110 bp, 369 aa] {ON} S...    35   0.20 
SAKL0H08932g Chr8 (763703..764647) [945 bp, 314 aa] {ON} similar...    35   0.20 
CAGL0M05335g Chr13 complement(569132..571552) [2421 bp, 806 aa] ...    36   0.20 
NCAS0B01430 Chr2 (233965..235317) [1353 bp, 450 aa] {ON}               35   0.20 
Smik_9.144 Chr9 (242718..244610) [1893 bp, 630 aa] {ON} YIL046W ...    36   0.22 
Kwal_33.15591 s33 (1174119..1176263) [2145 bp, 714 aa] {ON} YKL2...    36   0.23 
Smik_12.52 Chr12 (114649..116118) [1470 bp, 489 aa] {ON} YLL011W...    35   0.23 
Kwal_23.4118 s23 (579251..582070) [2820 bp, 939 aa] {ON} YLR409C...    36   0.23 
Skud_16.96 Chr16 complement(172716..175757) [3042 bp, 1013 aa] {...    36   0.23 
NDAI0D03490 Chr4 (820778..822079) [1302 bp, 433 aa] {ON} Anc_4.1...    35   0.23 
ACR097W Chr3 (529784..531187) [1404 bp, 467 aa] {ON} Syntenic ho...    35   0.24 
Kpol_1024.42 s1024 complement(112044..114575) [2532 bp, 843 aa] ...    35   0.24 
TDEL0D05940 Chr4 (1076418..1077710) [1293 bp, 430 aa] {ON} Anc_3...    35   0.24 
Kpol_1050.22 s1050 (54876..56171) [1296 bp, 431 aa] {ON} (54876....    35   0.24 
TDEL0H02130 Chr8 (362711..364465) [1755 bp, 584 aa] {ON} Anc_7.2...    35   0.25 
KLTH0B03410g Chr2 complement(276115..277548) [1434 bp, 477 aa] {...    35   0.25 
KNAG0F03870 Chr6 complement(731884..733281) [1398 bp, 465 aa] {O...    35   0.25 
KAFR0I01880 Chr9 (386694..388469) [1776 bp, 591 aa] {ON} Anc_7.2...    35   0.25 
Kpol_487.7 s487 complement(37021..37932) [912 bp, 303 aa] {ON} c...    35   0.25 
SAKL0H05456g Chr8 complement(490546..491886) [1341 bp, 446 aa] {...    35   0.26 
TPHA0J01890 Chr10 (430218..432287) [2070 bp, 689 aa] {ON} Anc_6....    35   0.26 
Smik_11.298 Chr11 complement(497968..499956) [1989 bp, 662 aa] {...    35   0.26 
KLLA0E21781g Chr5 complement(1944865..1945866) [1002 bp, 333 aa]...    35   0.27 
NCAS0B02200 Chr2 complement(359080..361548) [2469 bp, 822 aa] {O...    35   0.27 
KLLA0F13244g Chr6 (1224178..1226622) [2445 bp, 814 aa] {ON} high...    35   0.28 
Skud_4.283 Chr4 complement(493677..495191) [1515 bp, 504 aa] {ON...    35   0.29 
Smik_2.315 Chr2 (568572..569519) [948 bp, 315 aa] {ON} YBR175W (...    35   0.29 
AER114W Chr5 (850726..850730,850789..852685) [1902 bp, 633 aa] {...    35   0.29 
AFL118W Chr6 (216252..216269,216423..218903) [2499 bp, 832 aa] {...    35   0.29 
Ecym_3321 Chr3 complement(615730..616959) [1230 bp, 409 aa] {ON}...    35   0.30 
Skud_12.521 Chr12 (924571..926508) [1938 bp, 645 aa] {ON} YLR429...    35   0.30 
KLLA0F10791g Chr6 complement(991642..993279) [1638 bp, 545 aa] {...    35   0.30 
TDEL0B07580 Chr2 (1329080..1330252) [1173 bp, 390 aa] {ON} Anc_2...    35   0.30 
CAGL0L02761g Chr12 complement(322823..324082) [1260 bp, 419 aa] ...    35   0.31 
KLTH0G12276g Chr7 complement(1042617..1045430) [2814 bp, 937 aa]...    35   0.32 
KAFR0G01970 Chr7 complement(414143..415420) [1278 bp, 425 aa] {O...    35   0.32 
NDAI0D00630 Chr4 (139065..139967) [903 bp, 300 aa] {ON} Anc_7.33...    35   0.32 
Kwal_23.5769 s23 complement(1311598..1313481) [1884 bp, 627 aa] ...    35   0.33 
TBLA0A01480 Chr1 (344851..346026) [1176 bp, 391 aa] {ON} Anc_6.1...    35   0.33 
CAGL0H08932g Chr8 (871668..871685,872089..874779) [2709 bp, 902 ...    35   0.33 
NDAI0B01710 Chr2 (407575..408939) [1365 bp, 454 aa] {ON} Anc_7.1...    35   0.33 
TBLA0B04070 Chr2 complement(930877..932130) [1254 bp, 417 aa] {O...    35   0.34 
NCAS0A13430 Chr1 complement(2641588..2643414) [1827 bp, 608 aa] ...    35   0.34 
Kpol_1003.34 s1003 complement(85833..86999) [1167 bp, 388 aa] {O...    35   0.34 
CAGL0F07337g Chr6 complement(714870..716735) [1866 bp, 621 aa] {...    35   0.35 
ACR116W Chr3 (555946..557307) [1362 bp, 453 aa] {ON} Syntenic ho...    35   0.36 
Suva_10.545 Chr10 (945641..947569) [1929 bp, 642 aa] {ON} YLR429...    35   0.37 
TBLA0A01540 Chr1 complement(355418..357592) [2175 bp, 724 aa] {O...    35   0.37 
KAFR0H02550 Chr8 complement(487226..488521) [1296 bp, 431 aa] {O...    35   0.37 
CAGL0H03729g Chr8 (342948..343859) [912 bp, 303 aa] {ON} highly ...    35   0.38 
Ecym_7038 Chr7 (80529..82931) [2403 bp, 800 aa] {ON} similar to ...    35   0.38 
TPHA0D01130 Chr4 (236199..237554) [1356 bp, 451 aa] {ON} Anc_8.6...    35   0.38 
KLTH0H05038g Chr8 complement(449230..452217) [2988 bp, 995 aa] {...    35   0.38 
Suva_4.452 Chr4 complement(786121..788523) [2403 bp, 800 aa] {ON...    35   0.39 
Kpol_1012.5 s1012 (8531..8920,8923..9909) [1377 bp, 458 aa] {ON}...    35   0.40 
KAFR0A04480 Chr1 (889486..890616) [1131 bp, 376 aa] {ON} Anc_6.1...    35   0.41 
KNAG0A04990 Chr1 complement(726567..727844) [1278 bp, 425 aa] {O...    35   0.42 
TPHA0G01840 Chr7 complement(379782..381077) [1296 bp, 431 aa] {O...    35   0.42 
NCAS0I01170 Chr9 complement(210377..212017) [1641 bp, 546 aa] {O...    35   0.42 
SAKL0D04796g Chr4 (372598..374907) [2310 bp, 769 aa] {ON} simila...    35   0.44 
YLR129W Chr12 (399657..402488) [2832 bp, 943 aa] {ON}  DIP2Nucle...    35   0.44 
CAGL0L00781g Chr12 (97503..99524) [2022 bp, 673 aa] {ON} similar...    35   0.46 
KNAG0H01290 Chr8 (227947..229341) [1395 bp, 464 aa] {ON} Anc_3.2...    35   0.47 
YIL046W Chr9 (268651..270573) [1923 bp, 640 aa] {ON}  MET30F-box...    35   0.48 
Smik_13.219 Chr13 complement(356393..358813) [2421 bp, 806 aa] {...    35   0.49 
KAFR0I00640 Chr9 (128872..129819) [948 bp, 315 aa] {ON} Anc_8.58...    34   0.49 
NCAS0I02490 Chr9 complement(465916..467796) [1881 bp, 626 aa] {O...    35   0.49 
TBLA0G02090 Chr7 (545989..547911) [1923 bp, 640 aa] {ON} Anc_4.3...    35   0.50 
Skud_13.39 Chr13 (67722..69146) [1425 bp, 474 aa] {ON} YML102W (...    34   0.50 
SAKL0D08756g Chr4 complement(728765..729676) [912 bp, 303 aa] {O...    34   0.50 
ZYRO0E04620g Chr5 (348647..349558) [912 bp, 303 aa] {ON} highly ...    34   0.50 
ZYRO0G03586g Chr7 (285054..287969) [2916 bp, 971 aa] {ON} simila...    35   0.51 
AEL246C Chr5 complement(172849..175296) [2448 bp, 815 aa] {ON} S...    35   0.51 
Kpol_1070.11 s1070 (30012..32012) [2001 bp, 666 aa] {ON} (30012....    35   0.51 
Ecym_8317 Chr8 (648256..649527) [1272 bp, 423 aa] {ON} similar t...    34   0.52 
YML102W Chr13 (68294..69700) [1407 bp, 468 aa] {ON}  CAC2Subunit...    34   0.53 
TDEL0B03020 Chr2 complement(534847..537342) [2496 bp, 831 aa] {O...    35   0.53 
Kwal_27.11550 s27 (845458..846681) [1224 bp, 407 aa] {ON} YNL035...    34   0.54 
YBR198C Chr2 complement(616127..618523) [2397 bp, 798 aa] {ON}  ...    34   0.55 
NDAI0C05770 Chr3 complement(1328677..1329684) [1008 bp, 335 aa] ...    34   0.55 
NDAI0I02940 Chr9 (693605..694816) [1212 bp, 403 aa] {ON} Anc_3.5...    34   0.55 
Smik_14.296 Chr14 complement(535060..536229) [1170 bp, 389 aa] {...    34   0.56 
ZYRO0D16742g Chr4 complement(1385330..1387156) [1827 bp, 608 aa]...    34   0.56 
CAGL0A00561g Chr1 complement(63710..64948) [1239 bp, 412 aa] {ON...    34   0.56 
TDEL0A06650 Chr1 (1160677..1162032) [1356 bp, 451 aa] {ON} Anc_8...    34   0.57 
TDEL0B02010 Chr2 complement(355418..357835) [2418 bp, 805 aa] {O...    34   0.57 
Ecym_5635 Chr5 (1285780..1286937) [1158 bp, 385 aa] {ON} similar...    34   0.58 
Kwal_27.11126 s27 (651113..654103) [2991 bp, 996 aa] {ON} YPL183...    34   0.59 
NDAI0E00910 Chr5 complement(182574..183968) [1395 bp, 464 aa] {O...    34   0.59 
Kpol_1064.35 s1064 (64223..65584) [1362 bp, 453 aa] {ON} (64223....    34   0.61 
KNAG0C04950 Chr3 (955701..957023) [1323 bp, 440 aa] {ON} Anc_5.4...    34   0.62 
Ecym_6170 Chr6 complement(316353..317675) [1323 bp, 440 aa] {ON}...    34   0.64 
Kwal_26.8975 s26 (1026741..1028078) [1338 bp, 445 aa] {ON} YOR27...    34   0.64 
KLTH0H05962g Chr8 (525898..527019) [1122 bp, 373 aa] {ON} highly...    34   0.65 
NCAS0A10500 Chr1 complement(2087347..2088783) [1437 bp, 478 aa] ...    34   0.65 
Suva_4.427 Chr4 (751909..752856) [948 bp, 315 aa] {ON} YBR175W (...    34   0.66 
KLLA0B01958g Chr2 (170646..170663,170896..173550) [2673 bp, 890 ...    34   0.67 
ZYRO0E07392g Chr5 complement(564166..566841,567011..567028) [269...    34   0.67 
KLLA0B07667g Chr2 (667863..673862) [6000 bp, 1999 aa] {ON} some ...    34   0.67 
TPHA0N01850 Chr14 (393690..394910) [1221 bp, 406 aa] {ON} Anc_2....    34   0.69 
YDR030C Chr4 complement(501753..503273) [1521 bp, 506 aa] {ON}  ...    34   0.69 
NCAS0A03470 Chr1 (684361..686811) [2451 bp, 816 aa] {ON} Anc_4.106     34   0.69 
Kwal_26.8953 s26 (1017811..1019187) [1377 bp, 458 aa] {ON} YOR26...    34   0.71 
TPHA0E03760 Chr5 complement(791726..794116) [2391 bp, 796 aa] {O...    34   0.71 
NCAS0A09610 Chr1 complement(1920171..1922258) [2088 bp, 695 aa] ...    34   0.72 
Kpol_1002.74 s1002 complement(195739..198756) [3018 bp, 1005 aa]...    34   0.75 
TBLA0A01870 Chr1 (455007..458021) [3015 bp, 1004 aa] {ON} Anc_6....    34   0.75 
Suva_16.126 Chr16 complement(209255..212296) [3042 bp, 1013 aa] ...    34   0.76 
KLLA0A09471g Chr1 complement(827264..831784) [4521 bp, 1506 aa] ...    34   0.77 
KAFR0D03800 Chr4 complement(735667..736953) [1287 bp, 428 aa] {O...    34   0.78 
KAFR0E03950 Chr5 (781992..784232) [2241 bp, 746 aa] {ON} Anc_5.4...    34   0.78 
NDAI0C00170 Chr3 complement(24683..25888) [1206 bp, 401 aa] {ON}...    33   0.79 
SAKL0A10406g Chr1 (910452..912587) [2136 bp, 711 aa] {ON} simila...    34   0.79 
SAKL0E03080g Chr5 (253338..254885) [1548 bp, 515 aa] {ON} highly...    33   0.87 
Kwal_26.7570 s26 (423448..424104) [657 bp, 218 aa] {ON} YMR116C ...    33   0.87 
KLLA0F10615g Chr6 (978492..979604) [1113 bp, 370 aa] {ON} highly...    33   0.87 
YGL100W Chr7 (313234..314283) [1050 bp, 349 aa] {ON}  SEH1Compon...    33   0.87 
SAKL0H07150g Chr8 complement(626019..627341,627428..627430) [132...    33   0.88 
KLLA0C07425g Chr3 complement(647673..649007) [1335 bp, 444 aa] {...    33   0.89 
TBLA0D03580 Chr4 complement(885182..887353) [2172 bp, 723 aa] {O...    34   0.89 
KAFR0A04080 Chr1 (820402..821889) [1488 bp, 495 aa] {ON} Anc_8.7...    33   0.93 
Kpol_1027.5 s1027 complement(11866..14520) [2655 bp, 884 aa] {ON...    34   0.93 
KAFR0A04110 Chr1 (826618..828000) [1383 bp, 460 aa] {ON} Anc_8.7...    33   0.93 
Smik_7.173 Chr7 (308539..309588) [1050 bp, 349 aa] {ON} YGL100W ...    33   0.93 
KAFR0H02260 Chr8 complement(430272..433088) [2817 bp, 938 aa] {O...    34   0.94 
CAGL0M02277g Chr13 complement(271836..273119) [1284 bp, 427 aa] ...    33   0.95 
KAFR0A04550 Chr1 complement(901244..903100) [1857 bp, 618 aa] {O...    33   0.95 
Kpol_1050.33 s1050 complement(78024..80390) [2367 bp, 788 aa] {O...    33   0.95 
Ecym_2075 Chr2 (127773..129054,129182..129780) [1881 bp, 626 aa]...    33   0.96 
CAGL0C02937g Chr3 (290289..291692) [1404 bp, 467 aa] {ON} simila...    33   1.0  
AFL006C Chr6 complement(425925..427226) [1302 bp, 433 aa] {ON} S...    33   1.0  
Kpol_1072.41 s1072 complement(90370..91632) [1263 bp, 420 aa] {O...    33   1.0  
CAGL0J01287g Chr10 (120215..122047) [1833 bp, 610 aa] {ON} simil...    33   1.0  
Kpol_2002.99 s2002 (237070..238533) [1464 bp, 487 aa] {ON} (2370...    33   1.0  
TBLA0D04870 Chr4 complement(1194448..1195431) [984 bp, 327 aa] {...    33   1.1  
SAKL0F08404g Chr6 complement(640436..642367) [1932 bp, 643 aa] {...    33   1.1  
CAGL0J04818g Chr10 (458449..460413) [1965 bp, 654 aa] {ON} highl...    33   1.1  
Smik_13.344 Chr13 complement(540043..541086) [1044 bp, 347 aa] {...    33   1.1  
TPHA0B01530 Chr2 complement(340332..343493) [3162 bp, 1053 aa] {...    33   1.1  
KAFR0A06490 Chr1 complement(1314794..1316098) [1305 bp, 434 aa] ...    33   1.1  
KAFR0E03180 Chr5 (637055..639499) [2445 bp, 814 aa] {ON} Anc_8.5...    33   1.1  
TBLA0H03620 Chr8 (882587..885025) [2439 bp, 812 aa] {ON} Anc_8.5...    33   1.1  
TPHA0G01740 Chr7 complement(357600..358946) [1347 bp, 448 aa] {O...    33   1.1  
Kwal_14.884 s14 complement(95068..96255) [1188 bp, 395 aa] {ON} ...    33   1.2  
Suva_8.318 Chr8 (565468..566961) [1494 bp, 497 aa] {ON} YOR269W ...    33   1.2  
SAKL0H09988g Chr8 complement(853060..855309) [2250 bp, 749 aa] {...    33   1.2  
Smik_12.279 Chr12 complement(526367..528820) [2454 bp, 817 aa] {...    33   1.2  
KLTH0E10120g Chr5 (916575..919055) [2481 bp, 826 aa] {ON} highly...    33   1.2  
AGL024W Chr7 (667533..669803) [2271 bp, 756 aa] {ON} Syntenic ho...    33   1.3  
AAL009C Chr1 complement(325785..326696) [912 bp, 303 aa] {ON} Sy...    33   1.3  
KLLA0E18899g Chr5 (1680775..1683747) [2973 bp, 990 aa] {ON} simi...    33   1.3  
Ecym_7078 Chr7 complement(156495..157436) [942 bp, 313 aa] {ON} ...    33   1.3  
YHR186C Chr8 complement(475999..480672) [4674 bp, 1557 aa] {ON} ...    33   1.3  
NCAS0G04300 Chr7 (799388..801565) [2178 bp, 725 aa] {ON} Anc_1.5...    33   1.3  
SAKL0G19668g Chr7 (1695030..1696214) [1185 bp, 394 aa] {ON} simi...    33   1.4  
KNAG0J02460 Chr10 complement(465585..466361) [777 bp, 258 aa] {O...    33   1.4  
NCAS0B07840 Chr2 complement(1486900..1488669) [1770 bp, 589 aa] ...    33   1.4  
KLLA0F06688g Chr6 (644040..645299) [1260 bp, 419 aa] {ON} simila...    33   1.4  
Skud_7.174 Chr7 (317467..318516) [1050 bp, 349 aa] {ON} YGL100W ...    33   1.4  
SAKL0H15532g Chr8 complement(1351712..1354537) [2826 bp, 941 aa]...    33   1.5  
Kpol_1002.101 s1002 complement(252330..254240) [1911 bp, 636 aa]...    33   1.5  
KNAG0E02460 Chr5 complement(488247..490064) [1818 bp, 605 aa] {O...    33   1.6  
NCAS0H03530 Chr8 (671246..672400) [1155 bp, 384 aa] {ON} Anc_2.663     33   1.6  
Ecym_4343 Chr4 (733111..734862) [1752 bp, 583 aa] {ON} similar t...    33   1.6  
ZYRO0A12980g Chr1 (1025863..1028337) [2475 bp, 824 aa] {ON} simi...    33   1.7  
CAGL0M13409g Chr13 complement(1317818..1322401) [4584 bp, 1527 a...    33   1.7  
SAKL0G01760g Chr7 (147664..148656) [993 bp, 330 aa] {ON} highly ...    32   1.7  
NDAI0A00340 Chr1 (50320..53166) [2847 bp, 948 aa] {ON} Anc_1.34 ...    33   1.7  
TDEL0B00800 Chr2 (152025..153452) [1428 bp, 475 aa] {ON} Anc_8.8...    33   1.7  
Kwal_14.1710 s14 (433526..435250) [1725 bp, 574 aa] {ON} YGL116W...    33   1.8  
KLTH0G01650g Chr7 complement(121279..122466,122554..122556) [119...    33   1.8  
NDAI0G05340 Chr7 (1301733..1303889) [2157 bp, 718 aa] {ON} Anc_1...    33   1.8  
Smik_11.10 Chr11 complement(16139..18292) [2154 bp, 717 aa] {ON}...    33   1.8  
KNAG0A03220 Chr1 complement(399879..401150) [1272 bp, 423 aa] {O...    33   1.8  
SAKL0A03872g Chr1 (361507..361524,361720..364338) [2637 bp, 878 ...    33   1.9  
Ecym_7301 Chr7 (634995..637349) [2355 bp, 784 aa] {ON} similar t...    33   2.0  
TDEL0F02260 Chr6 (414020..415309) [1290 bp, 429 aa] {ON} Anc_4.1...    32   2.0  
KLTH0H06160g Chr8 complement(538741..540465) [1725 bp, 574 aa] {...    32   2.1  
AFL014C Chr6 complement(409496..411169) [1674 bp, 557 aa] {ON} S...    32   2.1  
CAGL0C01441g Chr3 complement(156930..159947) [3018 bp, 1005 aa] ...    33   2.1  
KLTH0B00924g Chr2 complement(79302..81446) [2145 bp, 714 aa] {ON...    32   2.1  
KAFR0B01580 Chr2 (298942..303528) [4587 bp, 1528 aa] {ON} Anc_5....    33   2.1  
YLR222C Chr12 complement(579318..581771) [2454 bp, 817 aa] {ON} ...    33   2.1  
TBLA0H02000 Chr8 complement(474850..476271) [1422 bp, 473 aa] {O...    32   2.1  
NCAS0A02800 Chr1 (533712..535517) [1806 bp, 601 aa] {ON} Anc_4.3...    32   2.2  
KNAG0M00450 Chr13 complement(65548..68523) [2976 bp, 991 aa] {ON...    33   2.2  
Kpol_1072.17 s1072 complement(40550..41851) [1302 bp, 433 aa] {O...    32   2.2  
KLLA0E23453g Chr5 (2088516..2090996) [2481 bp, 826 aa] {ON} simi...    32   2.4  
TBLA0A06060 Chr1 (1493832..1493849,1494107..1496755) [2667 bp, 8...    32   2.4  
KLTH0D10186g Chr4 (845352..846617) [1266 bp, 421 aa] {ON} simila...    32   2.4  
Kpol_2001.63 s2001 complement(171777..175607) [3831 bp, 1276 aa]...    32   2.4  
Kwal_33.13148 s33 (94593..96614) [2022 bp, 673 aa] {ON} YCL039W ...    32   2.4  
ADL082C Chr4 complement(538945..540654) [1710 bp, 569 aa] {ON} S...    32   2.5  
TPHA0D04530 Chr4 complement(988612..989496) [885 bp, 294 aa] {ON...    32   2.6  
KAFR0E00180 Chr5 complement(35535..37721) [2187 bp, 728 aa] {ON}...    32   2.6  
TBLA0A04150 Chr1 (1027635..1029005) [1371 bp, 456 aa] {ON} Anc_8...    32   2.6  
Suva_13.43 Chr13 (68221..68556,68574..69404) [1167 bp, 388 aa] {...    32   2.6  
Skud_13.307 Chr13 complement(530776..531819) [1044 bp, 347 aa] {...    32   2.6  
TBLA0B04680 Chr2 complement(1095348..1099997) [4650 bp, 1549 aa]...    32   2.6  
KAFR0B06670 Chr2 (1390238..1393234) [2997 bp, 998 aa] {ON} Anc_6...    32   2.6  
YKL213C Chr11 complement(31960..34107) [2148 bp, 715 aa] {ON}  D...    32   2.6  
SAKL0H07656g Chr8 complement(659189..660469) [1281 bp, 426 aa] {...    32   2.7  
Kpol_2000.39 s2000 complement(76168..77499) [1332 bp, 443 aa] {O...    32   2.7  
TPHA0F00240 Chr6 complement(44772..46340) [1569 bp, 522 aa] {ON}...    32   2.7  
Kwal_26.7738 s26 (493416..495251) [1836 bp, 611 aa] {ON} YMR092C...    32   2.7  
Kwal_47.19083 s47 (1089260..1090234) [975 bp, 324 aa] {ON} YGL21...    32   2.7  
Suva_13.269 Chr13 complement(433166..435016) [1851 bp, 616 aa] {...    32   2.7  
TDEL0A05290 Chr1 complement(933493..934452) [960 bp, 319 aa] {ON...    32   2.7  
KLTH0C09636g Chr3 (800421..802229) [1809 bp, 602 aa] {ON} weakly...    32   2.7  
Kwal_47.17465 s47 (415977..418379) [2403 bp, 800 aa] {ON} YBL008...    32   2.9  
TBLA0C04110 Chr3 complement(994729..997278) [2550 bp, 849 aa] {O...    32   2.9  
Ecym_2695 Chr2 complement(1343162..1344724) [1563 bp, 520 aa] {O...    32   3.0  
NCAS0F02050 Chr6 complement(409352..413923) [4572 bp, 1523 aa] {...    32   3.0  
TBLA0I02570 Chr9 (597481..600027) [2547 bp, 848 aa] {ON} Anc_8.7...    32   3.0  
Skud_4.762 Chr4 complement(1348926..1350539) [1614 bp, 537 aa] {...    32   3.0  
SAKL0G12892g Chr7 complement(1102157..1103587) [1431 bp, 476 aa]...    32   3.0  
KAFR0A00700 Chr1 (126326..128149) [1824 bp, 607 aa] {ON} Anc_2.4...    32   3.1  
Ecym_1293 Chr1 (595329..596240) [912 bp, 303 aa] {ON} similar to...    32   3.1  
NCAS0E03000 Chr5 (595862..598918) [3057 bp, 1018 aa] {ON} Anc_7....    32   3.1  
TBLA0D05560 Chr4 complement(1366222..1367991) [1770 bp, 589 aa] ...    32   3.2  
KNAG0F00620 Chr6 (105380..106768) [1389 bp, 462 aa] {ON} Anc_1.1...    32   3.2  
Kwal_27.12667 s27 complement(1325822..1327987) [2166 bp, 721 aa]...    32   3.2  
ZYRO0G10054g Chr7 (802784..805312) [2529 bp, 842 aa] {ON} simila...    32   3.2  
TBLA0H02380 Chr8 (568334..570721) [2388 bp, 795 aa] {ON} Anc_5.1...    32   3.3  
KAFR0A06990 Chr1 complement(1405904..1408543,1408655..1408672) [...    32   3.3  
KLLA0E18877g Chr5 complement(1676876..1680310) [3435 bp, 1144 aa...    32   3.3  
KLLA0F27511g Chr6 (2546533..2548404) [1872 bp, 623 aa] {ON} simi...    32   3.3  
SAKL0B11220g Chr2 (978268..978297,978363..979733) [1401 bp, 466 ...    32   3.6  
KNAG0F01840 Chr6 (348492..351227) [2736 bp, 911 aa] {ON} Anc_6.2...    32   3.6  
TBLA0A09070 Chr1 complement(2236928..2238094) [1167 bp, 388 aa] ...    32   3.6  
Suva_9.154 Chr9 (257284..259200) [1917 bp, 638 aa] {ON} YIL046W ...    32   3.6  
TPHA0G02840 Chr7 (604491..605033) [543 bp, 180 aa] {ON} Anc_2.43...    31   3.7  
YPL183C Chr16 complement(199495..202536) [3042 bp, 1013 aa] {ON}...    32   3.7  
Kpol_1002.36 s1002 (110010..112229) [2220 bp, 739 aa] {ON} (1100...    32   3.7  
NCAS0J01860 Chr10 (350125..352011) [1887 bp, 628 aa] {ON} Anc_4....    32   3.7  
TDEL0D01740 Chr4 (346288..348957) [2670 bp, 889 aa] {ON} Anc_1.3...    32   3.8  
NDAI0A02880 Chr1 (644069..647938) [3870 bp, 1289 aa] {ON} Anc_7....    32   4.1  
TPHA0G00680 Chr7 complement(127929..129302) [1374 bp, 457 aa] {O...    32   4.2  
KLLA0E12277g Chr5 (1086778..1087329,1087730..1088158) [981 bp, 3...    31   4.2  
KAFR0F04190 Chr6 (822926..824110) [1185 bp, 394 aa] {ON} Anc_3.5...    31   4.2  
KLLA0E04819g Chr5 (428278..429657) [1380 bp, 459 aa] {ON} simila...    32   4.3  
KNAG0G02790 Chr7 (617832..619247) [1416 bp, 471 aa] {ON} Anc_8.7...    32   4.3  
Suva_3.173 Chr3 (262525..262587,262614..264791) [2241 bp, 746 aa...    32   4.4  
Skud_11.207 Chr11 complement(378222..379469) [1248 bp, 415 aa] {...    31   4.4  
YMR092C Chr13 complement(451632..453479) [1848 bp, 615 aa] {ON} ...    32   4.5  
SAKL0H12760g Chr8 complement(1089272..1091797) [2526 bp, 841 aa]...    32   4.5  
KLTH0H03608g Chr8 (327747..327764,327941..330550) [2628 bp, 875 ...    32   4.7  
KNAG0C00410 Chr3 (69301..71367) [2067 bp, 688 aa] {ON} Anc_1.34 ...    31   4.8  
KNAG0G03310 Chr7 complement(709092..710552) [1461 bp, 486 aa] {O...    31   4.8  
Kpol_1036.90 s1036 (235306..236667) [1362 bp, 453 aa] {ON} (2353...    31   4.9  
Ecym_7149 Chr7 (308042..309139) [1098 bp, 365 aa] {ON} similar t...    31   4.9  
ADL022C Chr4 complement(660327..670505) [10179 bp, 3392 aa] {ON}...    32   5.0  
NCAS0A07850 Chr1 complement(1561758..1563596) [1839 bp, 612 aa] ...    31   5.1  
KLLA0F22000g Chr6 complement(2044973..2047354) [2382 bp, 793 aa]...    31   5.1  
ZYRO0G03146g Chr7 complement(238354..239886) [1533 bp, 510 aa] {...    31   5.2  
Ecym_6451 Chr6 (876748..879243) [2496 bp, 831 aa] {ON} similar t...    31   5.2  
Kwal_56.23035 s56 complement(373146..374420) [1275 bp, 424 aa] {...    31   5.2  
TDEL0E04280 Chr5 complement(799966..801411) [1446 bp, 481 aa] {O...    31   5.3  
AGL196C Chr7 complement(328838..331645) [2808 bp, 935 aa] {ON} S...    31   5.3  
Smik_12.525 Chr12 (919777..921735) [1959 bp, 652 aa] {ON} YLR429...    31   5.3  
Ecym_8336 Chr8 (677880..679250) [1371 bp, 456 aa] {ON} similar t...    31   5.6  
KLTH0C07634g Chr3 (654087..655364) [1278 bp, 425 aa] {ON} weakly...    31   5.7  
Kwal_27.12053 s27 (1065073..1067340) [2268 bp, 755 aa] {ON} YBR1...    31   5.7  
Ecym_2282 Chr2 complement(552170..553879) [1710 bp, 569 aa] {ON}...    31   5.7  
TPHA0J02160 Chr10 (484299..487313) [3015 bp, 1004 aa] {ON} Anc_6...    31   5.8  
ADL218C Chr4 complement(319674..320885) [1212 bp, 403 aa] {ON} S...    31   5.8  
NDAI0G03810 Chr7 complement(911595..915776) [4182 bp, 1393 aa] {...    31   5.9  
SAKL0H22330g Chr8 complement(1943859..1945094) [1236 bp, 411 aa]...    31   5.9  
Kwal_23.5351 s23 (1122565..1123989) [1425 bp, 474 aa] {ON} YPR17...    31   6.1  
KLTH0E07700g Chr5 (705358..707778) [2421 bp, 806 aa] {ON} simila...    31   6.2  
Skud_2.229 Chr2 (415869..417506) [1638 bp, 545 aa] {ON} YBR103W ...    31   6.2  
NCAS0H01060 Chr8 complement(197867..200875) [3009 bp, 1002 aa] {...    31   6.3  
Kwal_26.8628 s26 (871377..872645) [1269 bp, 422 aa] {ON} YOR212W...    31   6.4  
ACR166W Chr3 (647933..649102) [1170 bp, 389 aa] {ON} Syntenic ho...    31   6.4  
ZYRO0F06314g Chr6 (526555..527850) [1296 bp, 431 aa] {ON} simila...    31   6.5  
NCAS0C05310 Chr3 complement(1079501..1080550) [1050 bp, 349 aa] ...    31   6.5  
KAFR0H03340 Chr8 (637913..639016) [1104 bp, 367 aa] {ON} Anc_2.2...    31   6.8  
KLLA0A01650g Chr1 complement(146030..147235) [1206 bp, 401 aa] {...    31   6.9  
Skud_15.434 Chr15 (765132..766616) [1485 bp, 494 aa] {ON} YOR269...    31   7.0  
NCAS0E00530 Chr5 (89654..90853) [1200 bp, 399 aa] {ON} Anc_3.526...    31   7.0  
NDAI0F04030 Chr6 complement(958364..959839) [1476 bp, 491 aa] {O...    31   7.0  
Smik_4.265 Chr4 complement(483300..484820) [1521 bp, 506 aa] {ON...    31   7.2  
Skud_3.23 Chr3 (40457..42805) [2349 bp, 782 aa] {ON} YCL039W (REAL)    31   7.2  
TDEL0F01740 Chr6 complement(322088..325102) [3015 bp, 1004 aa] {...    31   7.3  
Suva_7.166 Chr7 (307962..309014) [1053 bp, 350 aa] {ON} YGL100W ...    30   7.4  
TBLA0D01190 Chr4 complement(301525..302820) [1296 bp, 431 aa] {O...    30   7.8  
KNAG0A03700 Chr1 complement(477870..480323) [2454 bp, 817 aa] {O...    31   7.9  
Smik_4.765 Chr4 complement(1350539..1352125) [1587 bp, 528 aa] {...    30   8.5  
KLTH0C01848g Chr3 complement(165526..166121,166518..167517) [159...    30   8.8  
TBLA0I03300 Chr9 (802032..803279) [1248 bp, 415 aa] {ON} Anc_3.5...    30   8.8  
SAKL0A06534g Chr1 complement(584399..586162) [1764 bp, 587 aa] {...    30   8.9  
TPHA0C00320 Chr3 (53120..54184) [1065 bp, 354 aa] {ON} Anc_5.631...    30   9.2  
AER337W Chr5 (1256750..1258087) [1338 bp, 445 aa] {ON} Syntenic ...    30   9.2  
YBL008W Chr2 (209653..212175) [2523 bp, 840 aa] {ON}  HIR1Subuni...    30   9.9  

>Kwal_56.22345 s56 complement(58523..59713) [1191 bp, 396 aa] {ON}
           YEL056W (HAT2) - subunit of a cytoplasmic histone
           acetyltransferase [contig 186] FULL
          Length = 396

 Score =  823 bits (2125), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/396 (100%), Positives = 396/396 (100%)

Query: 1   MQSTEPERELSIDDEYDLWKSNVPLMYDFVSETRLLWPSLTIQWLPRAEDSTEQELLVGT 60
           MQSTEPERELSIDDEYDLWKSNVPLMYDFVSETRLLWPSLTIQWLPRAEDSTEQELLVGT
Sbjct: 1   MQSTEPERELSIDDEYDLWKSNVPLMYDFVSETRLLWPSLTIQWLPRAEDSTEQELLVGT 60

Query: 61  HTSDSEQNYLKIAEINLPQEILSNEGPVLQNDNNGSDEQVPSKIKIIKKFKHENEVTRAR 120
           HTSDSEQNYLKIAEINLPQEILSNEGPVLQNDNNGSDEQVPSKIKIIKKFKHENEVTRAR
Sbjct: 61  HTSDSEQNYLKIAEINLPQEILSNEGPVLQNDNNGSDEQVPSKIKIIKKFKHENEVTRAR 120

Query: 121 YAPFDSNLIATISGTGTVFLYDRTKDDENALRGKYAYHKENGYGLNFSVASPGELISCSD 180
           YAPFDSNLIATISGTGTVFLYDRTKDDENALRGKYAYHKENGYGLNFSVASPGELISCSD
Sbjct: 121 YAPFDSNLIATISGTGTVFLYDRTKDDENALRGKYAYHKENGYGLNFSVASPGELISCSD 180

Query: 181 DGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDKRSEKPL 240
           DGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDKRSEKPL
Sbjct: 181 DGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDKRSEKPL 240

Query: 241 QKLLQKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEAVTSLEFAH 300
           QKLLQKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEAVTSLEFAH
Sbjct: 241 QKLLQKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEAVTSLEFAH 300

Query: 301 HKDGILCSGGSDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGHKSAINDFSFSPNVP 360
           HKDGILCSGGSDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGHKSAINDFSFSPNVP
Sbjct: 301 HKDGILCSGGSDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGHKSAINDFSFSPNVP 360

Query: 361 WLMASVEEENIVQIWKPSRKLTNPYFPQGYDIRSLE 396
           WLMASVEEENIVQIWKPSRKLTNPYFPQGYDIRSLE
Sbjct: 361 WLMASVEEENIVQIWKPSRKLTNPYFPQGYDIRSLE 396

>KLTH0C11550g Chr3 (949063..950259) [1197 bp, 398 aa] {ON} similar
           to uniprot|P39984 Saccharomyces cerevisiae YEL056W
          Length = 398

 Score =  602 bits (1551), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/399 (70%), Positives = 340/399 (85%), Gaps = 4/399 (1%)

Query: 1   MQSTEPERELSIDDEYDLWKSNVPLMYDFVSETRLLWPSLTIQWLPRAEDSTEQELLVGT 60
           MQ+T PE E+S+D+EYDLWKSNVPLMYDFVSET+LLWPSLTIQWLP  + S EQEL++GT
Sbjct: 1   MQATIPENEVSVDEEYDLWKSNVPLMYDFVSETKLLWPSLTIQWLPSNDRSNEQELILGT 60

Query: 61  HTSDSEQNYLKIAEINLPQEILSN---EGPVLQNDNNGSDEQVPSKIKIIKKFKHENEVT 117
           HTS +EQNYLKIA ++LP E++S+     P   +D+  S  Q  SKIKI++KF+H +EVT
Sbjct: 61  HTSGTEQNYLKIASVHLPDEVVSDVKCSAPS-TDDSKESGHQPQSKIKIVRKFEHRDEVT 119

Query: 118 RARYAPFDSNLIATISGTGTVFLYDRTKDDENALRGKYAYHKENGYGLNFSVASPGELIS 177
           RARYAPF+ NLIATISG+G VFLYDR+KD ++AL  ++++HKENGYGLNFSV SPGEL+S
Sbjct: 120 RARYAPFNPNLIATISGSGKVFLYDRSKDSDSALTAEFSFHKENGYGLNFSVISPGELLS 179

Query: 178 CSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDKRSE 237
           CSDDGSIAIWD+ SGK  P  V++ H++IVNECKWHE  P ++GSVS+DS L+IHDKR +
Sbjct: 180 CSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRID 239

Query: 238 KPLQKLLQKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEAVTSLE 297
           KP+ K+LQ EP+NT+AFSKHSSNLFAAAGTD+ V L+D RKP   +HSMSGH ++VTSLE
Sbjct: 240 KPVVKILQSEPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVTSLE 299

Query: 298 FAHHKDGILCSGGSDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGHKSAINDFSFSP 357
           FA HKDGILCSG SDRRVL+WDLFQIG EQQ+EDADDG PELLMMHAGHKS +NDFS SP
Sbjct: 300 FAPHKDGILCSGSSDRRVLIWDLFQIGAEQQQEDADDGVPELLMMHAGHKSPVNDFSCSP 359

Query: 358 NVPWLMASVEEENIVQIWKPSRKLTNPYFPQGYDIRSLE 396
           N+PWLMASVEEEN+VQIWK S+KLT+PY P+ Y+IRSLE
Sbjct: 360 NIPWLMASVEEENVVQIWKASKKLTSPYIPRDYNIRSLE 398

>SAKL0E00814g Chr5 complement(59724..60920) [1197 bp, 398 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056W
          Length = 398

 Score =  517 bits (1331), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 244/398 (61%), Positives = 307/398 (77%), Gaps = 2/398 (0%)

Query: 1   MQSTEPERELSIDDEYDLWKSNVPLMYDFVSETRLLWPSLTIQWLPRAEDSTEQELLVGT 60
           M   E  + LSI++EY+LWK+NVPLMYDFVSET+L WPSLTIQWLP    ST+QE+++GT
Sbjct: 1   MSIEEENKLLSIEEEYELWKTNVPLMYDFVSETKLTWPSLTIQWLPGNSSSTKQEMILGT 60

Query: 61  HTSDSEQNYLKIAEINLPQEILSNEGPVLQNDNNGSDEQ--VPSKIKIIKKFKHENEVTR 118
           HTS  + NYLKIA I LP++IL  E          +++Q  V S+IKI KK KHE E+TR
Sbjct: 61  HTSGEDDNYLKIASIELPEDILGAEFSETPESTEETEQQRNVQSRIKITKKIKHEEEITR 120

Query: 119 ARYAPFDSNLIATISGTGTVFLYDRTKDDENALRGKYAYHKENGYGLNFSVASPGELISC 178
           AR+ P D N IATI+G G VFL+DR+KD   AL  ++A+HK+NGYGL+F+  + GEL+SC
Sbjct: 121 ARFMPQDPNFIATINGVGKVFLFDRSKDKNEALVSEHAFHKDNGYGLSFNPRTKGELLSC 180

Query: 179 SDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDKRSEK 238
           SDDG+IA+W++    T P+   + H DIVN+C WHE + N++GSVSED  L IHDKR+  
Sbjct: 181 SDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRTNS 240

Query: 239 PLQKLLQKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEAVTSLEF 298
            + +L    PFNT+ FSKHS NLFAAAGTD++VYL+D R   +ALH+MSGH+++VTSLEF
Sbjct: 241 TVHRLTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHEDSVTSLEF 300

Query: 299 AHHKDGILCSGGSDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGHKSAINDFSFSPN 358
           + HKDGILCS GSDRRVLLWDL QIG+EQ +EDA DG PEL+MMHAGHKSA+NDFSF+ N
Sbjct: 301 SPHKDGILCSSGSDRRVLLWDLMQIGSEQAQEDAADGVPELMMMHAGHKSAVNDFSFNWN 360

Query: 359 VPWLMASVEEENIVQIWKPSRKLTNPYFPQGYDIRSLE 396
           +PWLMASVEE+NIV +WK S+KLT+P   Q YDIRSLE
Sbjct: 361 IPWLMASVEEDNIVHVWKVSKKLTSPGLIQDYDIRSLE 398

>ZYRO0F00462g Chr6 complement(46021..47202) [1182 bp, 393 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056W
          Length = 393

 Score =  475 bits (1223), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 225/381 (59%), Positives = 288/381 (75%), Gaps = 8/381 (2%)

Query: 3   STEPERELSIDDEYDLWKSNVPLMYDFVSETRLLWPSLTIQWLPRAEDSTEQELLVGTHT 62
           S  PE+ LSID+EYDLWKSNVPLMYDFVSET L WPSLT++WLP +  S  QE+++GTHT
Sbjct: 4   SNPPEKPLSIDEEYDLWKSNVPLMYDFVSETNLTWPSLTLEWLPGSRSSNRQEMILGTHT 63

Query: 63  SDSEQNYLKIAEINLPQEILSNEGPVLQNDNNGSDEQVPSKIKIIKKFKHENEVTRARYA 122
           SD EQNYLKIA I LP E++ +  P         +E + S +KIIKKF+HENEVTRARY 
Sbjct: 64  SDEEQNYLKIAAIYLPDEVVPDAEP------KEEEEVLKSNVKIIKKFEHENEVTRARYM 117

Query: 123 PFDSNLIATISGTGTVFLYDRTKDDENALRGKYAYHKENGYGLNFSVASPGELISCSDDG 182
           P D NLIATISG GT++LY+R  + E+ L   + +H ENGYGL+F+    G+L+S SDD 
Sbjct: 118 PQDDNLIATISGVGTIYLYNRANEVESGLLSTFQFHNENGYGLSFNPNEKGKLLSGSDDS 177

Query: 183 SIAIWDIKSGKTVPT-SVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDKR-SEKPL 240
           +I +WD+      P  +    HSDIVN+CKWH  D NI+GSVSEDS L +HD+R  +  +
Sbjct: 178 NIVLWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAV 237

Query: 241 QKLLQKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEAVTSLEFAH 300
           +K+  K+P+NT+AFS HS+NLFAAAGTD+MVYL+D R+ ++ LH M GH++AVTSLEF  
Sbjct: 238 EKVQAKKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHP 297

Query: 301 HKDGILCSGGSDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGHKSAINDFSFSPNVP 360
            +DG+L S GSDRR +LWDL +IG EQ  +DADDG PE++M+HAGH+S+INDFS +PN+P
Sbjct: 298 QEDGVLISAGSDRRTILWDLAEIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIP 357

Query: 361 WLMASVEEENIVQIWKPSRKL 381
           WL A+ EEENIVQ+WKPS KL
Sbjct: 358 WLTATAEEENIVQVWKPSSKL 378

>Ecym_3012 Chr3 complement(24573..25766) [1194 bp, 397 aa] {ON}
           similar to Ashbya gossypii ACR017W
          Length = 397

 Score =  467 bits (1202), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 228/394 (57%), Positives = 293/394 (74%), Gaps = 11/394 (2%)

Query: 7   ERELSIDDEYDLWKSNVPLMYDFVSETRLLWPSLTIQWLPRAEDST---EQELLVGTHTS 63
           E  L++D EY+LWKSNV LMYDFVSET+L WPSL+IQWLP  + +    +QE+++GTHTS
Sbjct: 11  ESPLTVDQEYELWKSNVSLMYDFVSETKLTWPSLSIQWLPSVDANVPLKQQEMILGTHTS 70

Query: 64  DSEQNYLKIAEINLPQEILSNEGPVLQNDNNGSDEQVPSKIKIIKKFKHENEVTRARYAP 123
             E NYLKIA I+LP E++      L +++N S E V S IK+ KKF+HE+EV RARY P
Sbjct: 71  GDENNYLKIAAIDLPYEVVG-----LPDEDNSS-EPVKSMIKVTKKFEHEDEVIRARYMP 124

Query: 124 FDSNLIATISGTGTVFLYDRTKDDENALRGKYAYHKENGYGLNFSVASPGELISCSDDGS 183
            +  +IATI+G G +F+YDR+K     L    +YHK+NGYGL F+    GEL+S SDD +
Sbjct: 125 KNDKIIATINGKGKIFIYDRSKSKSEGLCKTLSYHKDNGYGLAFNPQIEGELLSASDDTT 184

Query: 184 IAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDKRS-EKPLQK 242
           +A+WDI S    P S+   H+DIVN+ KWHE D NI+G+VSED  L +HDKRS     Q 
Sbjct: 185 VALWDINSTDR-PVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNSAQV 243

Query: 243 LLQKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEAVTSLEFAHHK 302
           L  ++P N +AFSKHS NL AAAGTD  VYL+D R+ +E LH+M+GHQ+AVTS+EF+ HK
Sbjct: 244 LPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHK 303

Query: 303 DGILCSGGSDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGHKSAINDFSFSPNVPWL 362
           DGILCS GSDRR+ +WDL QIG EQ +EDADDG PEL+MMHAGH+SAINDFSF+P VPWL
Sbjct: 304 DGILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNPQVPWL 363

Query: 363 MASVEEENIVQIWKPSRKLTNPYFPQGYDIRSLE 396
           +AS EE+N+VQ+WK S+KL +   P+  D++SLE
Sbjct: 364 IASAEEDNVVQVWKISKKLVSNIIPEYTDLKSLE 397

>Kpol_1045.78 s1045 (183044..184222) [1179 bp, 392 aa] {ON}
           (183046..184224) [1179 nt, 393 aa]
          Length = 392

 Score =  461 bits (1185), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 220/380 (57%), Positives = 287/380 (75%), Gaps = 9/380 (2%)

Query: 5   EPERELSIDDEYDLWKSNVPLMYDFVSETRLLWPSLTIQWLPRAEDSTEQELLVGTHTSD 64
           E E  L++D EY+LWK+NVPLMYDFVSETRL WPSLT QWLP +E+ T Q +++GTHTS 
Sbjct: 6   EQEEPLTVDQEYELWKTNVPLMYDFVSETRLTWPSLTAQWLPGSEEDTRQYMILGTHTSG 65

Query: 65  SEQNYLKIAEINLPQEILSNEGPVLQNDNNGSDEQVPSKIKIIKKFKHENEVTRARYAPF 124
            E +YLK+A ++LP E+++ E     ND+N    +  S IKI+KKF+H+ E+ RARY P 
Sbjct: 66  EEVDYLKVAALDLPDEVVTGEA----NDDN---RRTKSNIKIVKKFEHDGEINRARYMPK 118

Query: 125 DSNLIATISGTGTVFLYDRTKDDENALRGKYAYHKENGYGLNFSVASPGELISCSDDGSI 184
           DSN+IATI+G G V +YDR+K   + LR    YHKENGYGL+F+     ELIS SDD +I
Sbjct: 119 DSNIIATINGEGNVSIYDRSKSRSDGLRTTLKYHKENGYGLSFNPNVSNELISGSDDFTI 178

Query: 185 AIWDIKSGKTVPTSV-NSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDKRS-EKPLQK 242
           A+WDI SG   P SV +++HSDIVN+C WH  D N++GSVSEDS L +HDKRS  K +  
Sbjct: 179 ALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKLHDKRSTSKVINT 238

Query: 243 LLQKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEAVTSLEFAHHK 302
           +  K  FNT+AFSKHS+NLFAAAG D  +YL+D R+ T+ LH M+GH++A+T L+F   +
Sbjct: 239 IQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGHEDAITCLQFHPKE 298

Query: 303 DGILCSGGSDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGHKSAINDFSFSPNVPWL 362
           DGIL SGG+DRRV+LWDL +IG EQQ ++ADDG PE+LM+HAGH+SAINDF+  P +PWL
Sbjct: 299 DGILVSGGADRRVILWDLAEIGAEQQPDEADDGSPEILMIHAGHRSAINDFTLHPTIPWL 358

Query: 363 MASVEEENIVQIWKPSRKLT 382
            ASVEE+N+VQ+WK S+ L+
Sbjct: 359 SASVEEDNVVQVWKCSKNLS 378

>TDEL0G04620 Chr7 (842202..843380) [1179 bp, 392 aa] {ON} Anc_6.9
           YEL056W
          Length = 392

 Score =  459 bits (1181), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 223/383 (58%), Positives = 283/383 (73%), Gaps = 8/383 (2%)

Query: 1   MQSTEPERELSIDDEYDLWKSNVPLMYDFVSETRLLWPSLTIQWLPRAEDSTEQELLVGT 60
           M   + ++ LSID+EY+LW+SNVPLMYDFVSET L WP+LT++WLP    S  QEL++GT
Sbjct: 1   MAEEQVDKPLSIDEEYELWRSNVPLMYDFVSETNLTWPTLTLEWLPGNSHSNRQELILGT 60

Query: 61  HTSDSEQNYLKIAEINLPQEILSNEGPVLQNDNNGSDEQVPSKIKIIKKFKHENEVTRAR 120
           HTS+ E NYLKIA I+LP EI+  +      ++   D    S IKIIKKFKHE EVTRAR
Sbjct: 61  HTSEEEPNYLKIAAIDLPDEIVPGK------EDRERDGFTKSNIKIIKKFKHEQEVTRAR 114

Query: 121 YAPFDSNLIATISGTGTVFLYDRTKDDENALRGKYAYHKENGYGLNFSVASPGELISCSD 180
           Y P DSNLIATI+G+GTVFLYDR+KD +  L     +H++NGYGL+F+    G+L+S SD
Sbjct: 115 YMPQDSNLIATINGSGTVFLYDRSKDGDEGLLSSLGFHEDNGYGLSFNPVDKGKLLSGSD 174

Query: 181 DGSIAIWDIKSGKTVPTSV-NSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDKRSEKP 239
           D  IA+WDI +  T P S   S H D VN+CKWHE + N +GSVSED  L +HD+R +  
Sbjct: 175 DSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSVSEDCTLQLHDQRVKDS 234

Query: 240 L-QKLLQKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEAVTSLEF 298
           +  K+     FNTIAFSKHS+NLFAAAGTD+++YL+DSR+    LH+MSGH+  VT+LEF
Sbjct: 235 VTDKIKTVTAFNTIAFSKHSTNLFAAAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEF 294

Query: 299 AHHKDGILCSGGSDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGHKSAINDFSFSPN 358
              KDGI+ S G DRRV++WDL +IG EQ  +DADDG PE++M+HAGH+S +NDFS +PN
Sbjct: 295 YAAKDGIVMSSGEDRRVIMWDLMEIGAEQVPDDADDGSPEVVMIHAGHRSPVNDFSMNPN 354

Query: 359 VPWLMASVEEENIVQIWKPSRKL 381
           +PWLMAS EEENIVQ+WK S KL
Sbjct: 355 IPWLMASAEEENIVQVWKCSSKL 377

>NCAS0F00190 Chr6 complement(29012..30247) [1236 bp, 411 aa] {ON}
           Anc_6.9 YEL056W
          Length = 411

 Score =  459 bits (1181), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 220/382 (57%), Positives = 287/382 (75%), Gaps = 7/382 (1%)

Query: 5   EPERELSIDDEYDLWKSNVPLMYDFVSETRLLWPSLTIQWLPR---AEDSTEQELLVGTH 61
           +P +ELSID+EY+LW+SNVPLMYDFVSETRL WPSL+++WLP+   A+    QEL++GTH
Sbjct: 17  DPNKELSIDEEYELWRSNVPLMYDFVSETRLTWPSLSLEWLPQEKSAQAPNRQELIIGTH 76

Query: 62  TSDSEQNYLKIAEINLPQEILSNEGPVLQNDNNGSDEQVPSKIKIIKKFKHENEVTRARY 121
           TS  E NYLKIA I+LP +I+ +   +   D    +    S IKIIKKFKHE E+TRARY
Sbjct: 77  TSGEEDNYLKIAAIDLPNDIIPSTEKL--EDQQKGETTTKSNIKIIKKFKHEEEITRARY 134

Query: 122 APFDSNLIATISGTGTVFLYDRTKDDENALRGKYAYHKENGYGLNFSVASPGELISCSDD 181
            P +SNL+ATI+G+G VFLYDR+KD  + L   + YHKENGYGL+F+    G+L+S SDD
Sbjct: 135 MPQNSNLVATINGSGKVFLYDRSKDKHSGLVSTFEYHKENGYGLSFNCNDAGKLLSGSDD 194

Query: 182 GSIAIWDIKSGKTVPTSV-NSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDKRSEKPL 240
           G+IA+W++ +  + P  V +S+HSDIVN+CKW   D N++GSVSEDS L +HD+R +   
Sbjct: 195 GTIALWNVNNSNSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHDQREKDTF 254

Query: 241 QKLLQKE-PFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEAVTSLEFA 299
               + + PFNT+AFSKHS  LFAAAGTD+ VYLFD R  +  LHSM+GH  AVT++EF+
Sbjct: 255 TSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEFS 314

Query: 300 HHKDGILCSGGSDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGHKSAINDFSFSPNV 359
             +DGIL + G DRR ++WD+  IG EQ  +DA+DG PE+LM+HAGH+SAINDFS +PN+
Sbjct: 315 PDQDGILMTSGEDRRAIIWDICDIGVEQIPDDAEDGAPEVLMIHAGHRSAINDFSMNPNI 374

Query: 360 PWLMASVEEENIVQIWKPSRKL 381
           PWLMAS EEENI+Q+WK S KL
Sbjct: 375 PWLMASSEEENIIQVWKCSHKL 396

>KLLA0D00814g Chr4 complement(76687..77913) [1227 bp, 408 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056W
          Length = 408

 Score =  455 bits (1171), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 218/403 (54%), Positives = 292/403 (72%), Gaps = 11/403 (2%)

Query: 5   EPERELSIDDEYDLWKSNVPLMYDFVSETRLLWPSLTIQWLPRAEDSTE--------QEL 56
           EPE+  +I++EYDLW SNVP+MYDFVSETRL WPSLT+QWLP      E        QEL
Sbjct: 6   EPEQPTTINEEYDLWVSNVPMMYDFVSETRLTWPSLTVQWLPTEMQPREVDGQQLLRQEL 65

Query: 57  LVGTHTSDSEQNYLKIAEINLPQEILSNEGPVLQNDNNGSDEQVPSKIKIIKKFKHENEV 116
           L+GT T+D+E NYLKIA I+LP+ + S++  V  +          SKIKI++KFKHE EV
Sbjct: 66  LIGTLTTDNEPNYLKIAAIDLPENVTSSKPSVSDDAKENELSHRQSKIKIVRKFKHEQEV 125

Query: 117 TRARYAPFDSNLIATISGTGTVFLYDRT-KDDENALRGKYAYHKENGYGLNFSVASPGEL 175
           TRARY P   N+IAT++G G V+++DR  K+ ++     ++YHKENGYGL F+    G+L
Sbjct: 126 TRARYMPQSPNIIATLNGAGIVYIFDRNIKEKDHGAIASFSYHKENGYGLAFNPTVSGQL 185

Query: 176 ISCSDDGSIAIWDIKS-GKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDK 234
           +S SDDG++A+WD+ S     P+    +H+DIVN+CKWHE   +++G+VSED+ L+IHD 
Sbjct: 186 LSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLIIHDT 245

Query: 235 RSEKPLQKLLQKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEAVT 294
            S++ +QKL     FNT+AFSK S NL AAAGTD+ VYL+D R+  + LHSM+GH+++VT
Sbjct: 246 NSDRAIQKLSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHEDSVT 305

Query: 295 SLEFAHHKDGILCSGGSDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGHKSAINDFS 354
           SLEF+ H+DG+L S GSDRR+++WDLF IG EQQ +DA DG PEL MMH GH+S +N+FS
Sbjct: 306 SLEFSPHQDGLLTSSGSDRRIIMWDLFNIGAEQQPDDAYDGVPELFMMHGGHRSPVNEFS 365

Query: 355 FSPNVPWLMASVEEENIVQIWKPSRKLTNPYFPQG-YDIRSLE 396
            + NVPWLM SVEEEN++QIWKP+ K+  P  P   +DI +LE
Sbjct: 366 HNSNVPWLMCSVEEENVLQIWKPANKIVRPPQPPADFDITTLE 408

>NDAI0K02900 Chr11 (657436..658752) [1317 bp, 438 aa] {ON} Anc_6.9
          Length = 438

 Score =  445 bits (1144), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 212/389 (54%), Positives = 295/389 (75%), Gaps = 15/389 (3%)

Query: 8   RELSIDDEYDLWKSNVPLMYDFVSETRLLWPSLTIQWLPRAEDST----EQELLVGTHTS 63
           +EL+ID+EYDLWKSNVPLMYDFVSET+L WP+LT++WLP +  ST     QEL++GTHTS
Sbjct: 35  KELTIDEEYDLWKSNVPLMYDFVSETKLTWPTLTVEWLPSSHSSTPVSNRQELILGTHTS 94

Query: 64  DSEQNYLKIAEINLPQEILSNEGPVLQNDNNGS-----DEQVP-SKIKIIKKFKHENEVT 117
             E NYLKIA I+LP E++      L+            +Q P S IKI+KKFKHE E+T
Sbjct: 95  GEEDNYLKIAAIDLPDEVVQPSTNSLKAQREDDEDEDDQKQKPRSNIKIVKKFKHEEEIT 154

Query: 118 RARYAPFDSNLIATISGTGTVFLYDRTKDDENALRGKYAYHKENGYGLNFSVASPGELIS 177
           RAR+ P ++++IATI+G+GTVF+Y+++ D ++AL     +HKENGYGL+F+    G+L+S
Sbjct: 155 RARFMPQNTDIIATINGSGTVFIYNQSNDKQSALISTLRFHKENGYGLSFNPNDKGKLLS 214

Query: 178 CSDDGSIAIWDIKSGKTV---PTSV-NSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHD 233
            SDDG+IA+WDI+   T+   P  + +S+H+DIVN+CKW+E + N++ SVSEDS L +HD
Sbjct: 215 GSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQLHD 274

Query: 234 KRSEKPL-QKLLQKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEA 292
           +R +  +   +   +PFNT+AFSKHS  L AAAGTD++VYL+DSR  +  L+SM+GH+++
Sbjct: 275 QREQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLSVPLYSMNGHEDS 334

Query: 293 VTSLEFAHHKDGILCSGGSDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGHKSAIND 352
           +T+LEF+ H DG+L S G+DRRV++WD+  IG EQ  +DA+DG PE++M+HAGH+SA+ND
Sbjct: 335 ITNLEFSPHTDGVLISSGNDRRVIMWDINDIGAEQIPDDAEDGAPEVIMIHAGHRSAVND 394

Query: 353 FSFSPNVPWLMASVEEENIVQIWKPSRKL 381
           FS +PN+PWLMAS EEENI+Q+WK S KL
Sbjct: 395 FSINPNIPWLMASAEEENIIQVWKCSHKL 423

>ACR017W Chr3 (387122..388393) [1272 bp, 423 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL056W (HAT2)
          Length = 423

 Score =  434 bits (1115), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 205/381 (53%), Positives = 272/381 (71%), Gaps = 7/381 (1%)

Query: 8   RELSIDDEYDLWKSNVPLMYDFVSETRLLWPSLTIQWLPRAEDSTEQELLVGTHTSDSEQ 67
           + L++++EY+LW SNVP+MY+FVSET+L WPSLTIQWLP    S EQ L+ GTHT+  E 
Sbjct: 40  QSLTVEEEYELWNSNVPVMYEFVSETKLTWPSLTIQWLPSDGQSPEQSLIFGTHTAGEEV 99

Query: 68  NYLKIAEINLPQEILSNEGPVLQNDNNGSDEQVPSKIKIIKKFKHENEVTRARYAPFDSN 127
           NYLK+A INLP  I       L   +   +    S   I  KF H  EV RARY P +SN
Sbjct: 100 NYLKVATINLPAGIAG-----LDQGDEEDEANDHSSFAIANKFPHIEEVIRARYMPANSN 154

Query: 128 LIATISGTGTVFLYDRTKDDENALRGKYAYHKENGYGLNFSVASPGELISCSDDGSIAIW 187
           +IATI+G GT+ ++DRT ++  A     A+HKENGYGL F+    GEL+S SDD ++A+W
Sbjct: 155 IIATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGELLSGSDDTTVALW 214

Query: 188 DIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDKRSE-KPLQKLLQK 246
           DI++ K  P S+ + H DIVN+ KWHE + N++G+VSED  L +HDKR   +P++KL   
Sbjct: 215 DIEAAKK-PKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKKLPTA 273

Query: 247 EPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEAVTSLEFAHHKDGIL 306
            PFNT++FSKHS NL AAAG D+ +YL+D R  +  LH MSGHQ++VT++EF+ H DGI+
Sbjct: 274 SPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGII 333

Query: 307 CSGGSDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGHKSAINDFSFSPNVPWLMASV 366
           CS GSDRR ++WDL QIG EQ ++DADDG PEL+MMHAGH+S +N+FSF+P +PWL+AS 
Sbjct: 334 CSSGSDRRAIIWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVNEFSFNPQIPWLLAST 393

Query: 367 EEENIVQIWKPSRKLTNPYFP 387
           EE+N++Q WK S KL N   P
Sbjct: 394 EEDNVIQAWKVSMKLVNASPP 414

>Skud_5.33 Chr5 (46184..47389) [1206 bp, 401 aa] {ON} YEL056W (REAL)
          Length = 401

 Score =  426 bits (1095), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 212/387 (54%), Positives = 278/387 (71%), Gaps = 17/387 (4%)

Query: 7   ERELSIDDEYDLWKSNVPLMYDFVSETRLLWPSLTIQWLPRAEDS-----TEQELLVGTH 61
           E+ LS+D+EYDLWKSNVPLMYDFVSETRL WPSLT+QWLP           +QEL++GTH
Sbjct: 5   EKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQQPKGGFIKQELIIGTH 64

Query: 62  TSDSEQNYLKIAEINLPQEILSNEGPVLQNDNNGSDEQVP---SKIKIIKKFKHENEVTR 118
           TS  E+NYLK AEINLP+E+L+NE P  Q +  G +  +P   S I+I  K++HE E+TR
Sbjct: 65  TSGEEENYLKFAEINLPKEVLNNENPQEQAEM-GDEASLPPPRSNIRITAKYEHEEEITR 123

Query: 119 ARYAPFDSNLIATISGTGTVFLYDRTKDDENALRGKYAYHKENGYGLNFSVASPGELISC 178
           ARY P D N++ATI+G GTVFLY R+    + L+    +HK+NGY L+FS    G L+S 
Sbjct: 124 ARYMPQDPNMVATINGQGTVFLYSRS----DGLQSTLKFHKDNGYALSFSPLIKGHLLSG 179

Query: 179 SDDGSIAIWDIKSGKTVPTSVNS---LHSDIVNECKWHESDPNIYGSVSEDSFLMIHDKR 235
           SDD S+A+WD+  G    T + +   LHSDIVN+ KWH  + +++G+VSEDS L I+D R
Sbjct: 180 SDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDIR 239

Query: 236 SEKP-LQKLLQKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEAVT 294
           +E   +      +PFNT+AFS HSSN+ AAAG D+ VYL+D R   E LH MSGH++AVT
Sbjct: 240 AENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLRNMKEPLHHMSGHEDAVT 299

Query: 295 SLEFAHHKDGILCSGGSDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGHKSAINDFS 354
           +LEF+ H DG++ S GSD R+++WDL QIG EQ  +DA+DG PEL+M+HAGH+SA+NDF 
Sbjct: 300 NLEFSPHVDGVVVSSGSDNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSAVNDFD 359

Query: 355 FSPNVPWLMASVEEENIVQIWKPSRKL 381
            +  VPWL+AS EEENI+Q+WK S  L
Sbjct: 360 LNAQVPWLIASTEEENILQVWKCSHSL 386

>KNAG0E00980 Chr5 complement(186207..187451) [1245 bp, 414 aa] {ON}
           Anc_6.9 YEL056W
          Length = 414

 Score =  423 bits (1087), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 203/377 (53%), Positives = 271/377 (71%), Gaps = 9/377 (2%)

Query: 8   RELSIDDEYDLWKSNVPLMYDFVSETRLLWPSLTIQWLPRAEDS--TEQELLVGTHTSDS 65
           R L   +EYDLWKSNVP+MYDFVSETRL+WPSLT+QWLP +  +  T QEL++GTHTSD 
Sbjct: 29  RPLDPSEEYDLWKSNVPMMYDFVSETRLVWPSLTVQWLPHSAPNPVTRQELILGTHTSDE 88

Query: 66  EQNYLKIAEINLPQEILSNEGPVLQNDNNGSDEQVPSKIKIIKKFKHENEVTRARYAPFD 125
           EQNYLKIA ++LP E+         N     +EQV S I++ +KFKH++EVTRARY P D
Sbjct: 89  EQNYLKIAVVDLPTEVTDT-----SNLTESDEEQVRSNIRVTRKFKHDSEVTRARYMPQD 143

Query: 126 SNLIATISGTGTVFLYDRTKDDENALRGKYAYHKENGYGLNFSVASPGELISCSDDGSIA 185
            N++ATISGTGTV++YDR+ + + A      YH +NGYGL F+    G L+S SDD ++A
Sbjct: 144 PNILATISGTGTVYIYDRSNERDTA-SITLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVA 202

Query: 186 IWDIKSGKTVPTSV-NSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDKRSEKPLQKLL 244
           +WD+ S +  P     ++HSDIVN+C+WH    +++G+VSEDS L IHD R  KP+  + 
Sbjct: 203 LWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRESKPVATIN 262

Query: 245 QKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEAVTSLEFAHHKDG 304
             +PFNT++FS HS NL A  G ++ VYL+D R   E LH MSGH +AVTSL+F+   DG
Sbjct: 263 GTKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVTSLDFSSQDDG 322

Query: 305 ILCSGGSDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGHKSAINDFSFSPNVPWLMA 364
           I+ S G+D+RV++WD+  IG EQ  EDA+D   E++M+HAGH+S INDF+ +P++PWL+A
Sbjct: 323 IILSAGADKRVIIWDINDIGAEQVLEDAEDATSEVMMIHAGHRSPINDFAINPSIPWLVA 382

Query: 365 SVEEENIVQIWKPSRKL 381
           S EEENIVQ+WK S KL
Sbjct: 383 SAEEENIVQLWKCSHKL 399

>YEL056W Chr5 (47168..48373) [1206 bp, 401 aa] {ON}  HAT2Subunit of
           the Hat1p-Hat2p histone acetyltransferase complex;
           required for high affinity binding of the complex to
           free histone H4, thereby enhancing Hat1p activity;
           similar to human RbAp46 and 48; has a role in telomeric
           silencing
          Length = 401

 Score =  422 bits (1085), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 212/389 (54%), Positives = 279/389 (71%), Gaps = 21/389 (5%)

Query: 7   ERELSIDDEYDLWKSNVPLMYDFVSETRLLWPSLTIQWLPRAEDS-----TEQELLVGTH 61
           E+ LS+D+EYDLWKSNVPLMYDFVSETRL WPSLT+QWLP           +QEL++GTH
Sbjct: 5   EKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQELDGGFIKQELIIGTH 64

Query: 62  TSDSEQNYLKIAEINLPQEILSNEGPVLQNDNNGSDEQ--VP---SKIKIIKKFKHENEV 116
           TS  E+NYLK AEINLP+EILSNE P    +  G + Q  +P   S I+I  K++HE E+
Sbjct: 65  TSGEEENYLKFAEINLPKEILSNEDP---QEEAGEEYQSSLPAPRSNIRITAKYEHEEEI 121

Query: 117 TRARYAPFDSNLIATISGTGTVFLYDRTKDDENALRGKYAYHKENGYGLNFSVASPGELI 176
           TRARY P D N++ATI+G GTVFLY R++     L+    +HK+NGY L+FS    G L+
Sbjct: 122 TRARYMPQDPNIVATINGQGTVFLYSRSE----GLQSTLKFHKDNGYALSFSTLVKGRLL 177

Query: 177 SCSDDGSIAIWDIKSG--KTVPTSV-NSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHD 233
           S SDD ++A+W++ SG   T P    N LHSDI+N+ KWH  + +++G+VSEDS L I+D
Sbjct: 178 SGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKIND 237

Query: 234 KRSEKP-LQKLLQKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEA 292
            R+    +  +   +PFNT+AFS HSSNL AAAG D+ VYL+D R   E LH MSGH++A
Sbjct: 238 VRANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDA 297

Query: 293 VTSLEFAHHKDGILCSGGSDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGHKSAIND 352
           V +LEF+ H DG++ S GSD R+++WDL QIG EQ  +DA+DG PEL+M+HAGH+S++ND
Sbjct: 298 VNNLEFSTHVDGVVVSSGSDNRLMMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVND 357

Query: 353 FSFSPNVPWLMASVEEENIVQIWKPSRKL 381
           F  +P +PWL+AS EEENI+Q+WK S  L
Sbjct: 358 FDLNPQIPWLVASAEEENILQVWKCSHSL 386

>Suva_5.12 Chr5 (23273..24478) [1206 bp, 401 aa] {ON} YEL056W (REAL)
          Length = 401

 Score =  422 bits (1085), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 216/389 (55%), Positives = 276/389 (70%), Gaps = 21/389 (5%)

Query: 7   ERELSIDDEYDLWKSNVPLMYDFVSETRLLWPSLTIQWLPRAEDSTE-----QELLVGTH 61
           E+ LS+D+EYDLWKSNVPLMYDFVSETRL WPSLT+QWLP      E     QEL++GTH
Sbjct: 5   EKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQEPEGGFIKQELIIGTH 64

Query: 62  TSDSEQNYLKIAEINLPQEILSNEGPVLQNDNNGSDEQVP-----SKIKIIKKFKHENEV 116
           TS  E+NYLK AEINLP+EIL+NE P    +  G D++V      S IKI  K+KHE E+
Sbjct: 65  TSGEEENYLKFAEINLPKEILNNEDP---QEEAGEDDEVSAPAPRSNIKITAKYKHEEEI 121

Query: 117 TRARYAPFDSNLIATISGTGTVFLYDRTKDDENALRGKYAYHKENGYGLNFSVASPGELI 176
           TRARY P +   +ATI+G GTVF+Y R++     L+    +H+ENGY L+FS    G L+
Sbjct: 122 TRARYMPQNPGTVATINGQGTVFIYSRSE----GLQSTLKFHEENGYALSFSPLVEGLLL 177

Query: 177 SCSDDGSIAIWDIK--SGKTVPTSV-NSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHD 233
           S SDD ++A+WD+   S  T P    + LHSDIVN+ KWH  + +++G+VSEDS L I+D
Sbjct: 178 SGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKIND 237

Query: 234 KRSEKPLQKLLQ-KEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEA 292
            R E       +  EPFNT+AFS HSSNL AAAGTD+ VYL+D R   E LH MSGH++A
Sbjct: 238 LRVENTTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLRNMKEPLHHMSGHEDA 297

Query: 293 VTSLEFAHHKDGILCSGGSDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGHKSAIND 352
           VT+LEF+ H DG++ S GSD R+++WDL QIG EQ  +DA+DG PEL+M+HAGHKSA+ND
Sbjct: 298 VTNLEFSPHVDGVVVSSGSDNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHKSAVND 357

Query: 353 FSFSPNVPWLMASVEEENIVQIWKPSRKL 381
           F  +  +PWL+AS EEENI+Q+WK S  L
Sbjct: 358 FDLNAQIPWLVASTEEENILQVWKCSHSL 386

>TPHA0M00190 Chr13 complement(38571..39746) [1176 bp, 391 aa] {ON}
           Anc_6.9 YEL056W
          Length = 391

 Score =  421 bits (1083), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 211/385 (54%), Positives = 279/385 (72%), Gaps = 13/385 (3%)

Query: 1   MQSTEPERE-LSIDDEYDLWKSNVPLMYDFVSETRLLWPSLTIQWLPRAEDSTEQELLVG 59
           M+  E + E L++D EYDLWKSNVPL+YDFVSETRL WPSLT+QWLP  + ST Q L++G
Sbjct: 1   MEKVEQQEEPLTVDQEYDLWKSNVPLLYDFVSETRLTWPSLTLQWLPGDKTSTRQHLILG 60

Query: 60  THTSDSEQNYLKIAEINLPQEILSNEGPVLQNDNNGSDEQVPSKIKIIKKFKHENEVTRA 119
           T TS +E +YLKIA ++LP EI+  +          SD+ V S +K++KKF H+ E+ RA
Sbjct: 61  TLTSGAETDYLKIAALDLPDEIIIGKK---------SDKVVKSNLKVVKKFAHDGEINRA 111

Query: 120 RYAPFDSNLIATISGTGTVFLYDRTKDDENALRGKYAYHKENGYGLNFSVASPGELISCS 179
           RY P ++N+IAT++G GT+F+YD ++D ++AL     YHK+N YGL F+  + GELIS S
Sbjct: 112 RYMPQNTNIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGELISGS 171

Query: 180 DDGSIAIWDIKSGKTVP--TSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDKRSE 237
           DD +IA+WD  + K         + HSDIVN+C+WH  + N++GSVSEDS L + DKR+ 
Sbjct: 172 DDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRNG 231

Query: 238 -KPLQKLLQKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEAVTSL 296
            K   K+  K  +N+IAFS  S NLFAAAGT   +YL+D R   + LHSM+GH+E VTSL
Sbjct: 232 GKSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTGKILHSMTGHEEPVTSL 291

Query: 297 EFAHHKDGILCSGGSDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGHKSAINDFSFS 356
           EF++ KDGIL SG SDRRV++WDLF+IG EQQ ++ADDG PE++M+HAG +SAIND S  
Sbjct: 292 EFSNDKDGILISGSSDRRVIMWDLFEIGAEQQPDEADDGLPEVMMIHAGSRSAINDISTH 351

Query: 357 PNVPWLMASVEEENIVQIWKPSRKL 381
           P++PWL ASVEE NIVQ+WK S KL
Sbjct: 352 PSIPWLNASVEENNIVQVWKCSSKL 376

>Smik_5.31 Chr5 (49406..50689) [1284 bp, 427 aa] {ON} YEL056W (REAL)
          Length = 427

 Score =  415 bits (1066), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 202/386 (52%), Positives = 274/386 (70%), Gaps = 15/386 (3%)

Query: 7   ERELSIDDEYDLWKSNVPLMYDFVSETRLLWPSLTIQWLPRAEDSTE-----QELLVGTH 61
           E+ LS+D+EYDLWKSNVPLMYDFVSETRL WPSL++QWLP      E     QEL++GTH
Sbjct: 31  EKALSVDEEYDLWKSNVPLMYDFVSETRLTWPSLSVQWLPTPIQEAEGGFIRQELIIGTH 90

Query: 62  TSDSEQNYLKIAEINLPQEILSNEGPV--LQNDNNGSDEQVPSKIKIIKKFKHENEVTRA 119
           TS  E+NYLK AEIN+P+EIL+N+ P    + D+  +     S I+I  K+ HE E+TRA
Sbjct: 91  TSGEEENYLKFAEINIPKEILNNQDPQEEAEEDDKATLNAPKSNIRITAKYVHEEEITRA 150

Query: 120 RYAPFDSNLIATISGTGTVFLYDRTKDDENALRGKYAYHKENGYGLNFSVASPGELISCS 179
           RY P + + +AT++G GTVFLY R+      L+    +HK+NGY L+F+    G+L+S S
Sbjct: 151 RYMPQNPDFVATLNGQGTVFLYSRS----GGLQSTLKFHKDNGYALSFNALVEGQLLSGS 206

Query: 180 DDGSIAIWDIKSGKTVPTSV---NSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDKRS 236
           DD ++A+W++ S  T  + V   N LHSDIVN+ KWH  +  ++G+VSEDS L I+D R+
Sbjct: 207 DDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKINDVRA 266

Query: 237 EK-PLQKLLQKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEAVTS 295
               +  +   +PFNT+AFS HSSNL AAAG D+ VYL+D R   E LH MSGH++AVT+
Sbjct: 267 HNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMREPLHHMSGHEDAVTN 326

Query: 296 LEFAHHKDGILCSGGSDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGHKSAINDFSF 355
           +EF+ H DG++ S GSD R+++WDL QIG EQ  +DA+DG PEL+M+HAGH+S++NDF  
Sbjct: 327 IEFSTHVDGVVVSSGSDNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDL 386

Query: 356 SPNVPWLMASVEEENIVQIWKPSRKL 381
           +  +PWL+AS EEENI+Q+WK S  L
Sbjct: 387 NAQIPWLVASSEEENILQVWKCSHNL 412

>KAFR0L00320 Chr12 (56449..57624) [1176 bp, 391 aa] {ON} Anc_6.9
           YEL056W
          Length = 391

 Score =  407 bits (1046), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 201/385 (52%), Positives = 272/385 (70%), Gaps = 14/385 (3%)

Query: 1   MQSTEPERELSIDDEYDLWKSNVPLMYDFVSETRLLWPSLTIQWLPRAEDS--TEQELLV 58
           M   E ERELSID+EY LWKSNVPLMYDFVSET+L WPSLT++WLP    +  T+QE+++
Sbjct: 1   MGPQEEERELSIDEEYKLWKSNVPLMYDFVSETKLTWPSLTVEWLPHDPQAPLTQQEMII 60

Query: 59  GTHTSDSEQNYLKIAEINLPQEILSNEGPVLQNDNNGSDEQVPSKIKIIKKFKHENEVTR 118
           GTHTSD E NY+KIA I LP E++        + +N SD  V S ++I KKFK E E+TR
Sbjct: 61  GTHTSDQEPNYVKIASIELPNEVI--------DPHNVSDAPVKSNVRITKKFKLEKEITR 112

Query: 119 ARYAPFDSNLIATISGTGTVFLYDRTKDDENALRGKYAYHKENGYGLNFSVASPGELISC 178
           +RY   D N+I+TI G GTV ++DR   D       Y+YHK+NGYGL+F+  S G+L+S 
Sbjct: 113 SRYMVQDPNIISTIDGNGTVSIFDRNSSDSPV--KTYSYHKDNGYGLSFNPISKGQLLSA 170

Query: 179 SDDGSIAIWDIKSGKTVPTSV-NSLHSDIVNECKWHESDPNIYGSVSED-SFLMIHDKRS 236
           +DDG IA++DI +    P     S  + I+N+ KWH  D  ++G+VSE+ + L I+D R+
Sbjct: 171 ADDGYIAMYDINAESEDPVETWQSTDNCIINDIKWHHFDATLFGTVSEEKNTLSIYDLRT 230

Query: 237 EKPLQKLLQKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEAVTSL 296
           +  +  +  ++PFN++AFSKHS NLF+AAGTD  VYL+D R   + LHSMSGH+  VT+L
Sbjct: 231 KDKVTSIEMEQPFNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNL 290

Query: 297 EFAHHKDGILCSGGSDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGHKSAINDFSFS 356
           EF    DGIL S   DRR+++WDL +IG+EQ  EDA D  PEL+M+HAGH+S++NDFS +
Sbjct: 291 EFHDSVDGILVSSSEDRRIIIWDLMEIGSEQVNEDAQDATPELMMIHAGHRSSVNDFSLN 350

Query: 357 PNVPWLMASVEEENIVQIWKPSRKL 381
            ++PWL+AS EEENI+Q+WK S +L
Sbjct: 351 SSIPWLIASTEEENIIQVWKSSSRL 375

>CAGL0B03575g Chr2 complement(357525..358784) [1260 bp, 419 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056w HAT2
          Length = 419

 Score =  408 bits (1048), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 199/385 (51%), Positives = 276/385 (71%), Gaps = 10/385 (2%)

Query: 3   STEPERELSIDDEYDLWKSNVPLMYDFVSETRLLWPSLTIQWLPR---AEDSTEQELLVG 59
           S EP   +++D+EY+LWKSNVP++YDFVSETRL WP+LT++WLP+       T Q+L++G
Sbjct: 24  SNEP---MTVDEEYELWKSNVPMLYDFVSETRLTWPTLTVEWLPQKNLVAARTRQQLILG 80

Query: 60  THTSDSEQNYLKIAEINLPQEILSNEGPVLQNDNNGSDEQVPSKIKIIKKFKHENEVTRA 119
           THTS  EQNYLKI  ++LP E+  N     + D     + V S +KI+KKF H+ E+TRA
Sbjct: 81  THTSGEEQNYLKIGAVDLPVEVTENSKKDREIDEEDE-DMVLSNVKIVKKFPHDGEITRA 139

Query: 120 RYAPFDSNLIATISGTGTVFLYDRTKDDENALRGKYAYHKENGYGLNFSVASPGELISCS 179
           RY P D N+IATI+G G +F+YDR+K+   AL     YH ENGYGL F+      L+S S
Sbjct: 140 RYMPQDDNIIATINGEGKIFIYDRSKNGVEALLSTLEYHTENGYGLAFNANEKYSLLSGS 199

Query: 180 DDGSIAIWDIKS--GKTVPT-SVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDKRS 236
           DD +IA+WDI +      PT +    H+DI+N+ KWH S+ +I+GSVSEDS + + DKRS
Sbjct: 200 DDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRS 259

Query: 237 EKPLQKLLQKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEAVTSL 296
            + +  +  K+P+NT+AFS  SSNLFAAAGTD +VYL+D R  +  L++M+GH++AVT++
Sbjct: 260 SQIIHNINTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAI 319

Query: 297 EFAHHKDGILCSGGSDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGHKSAINDFSFS 356
           EF  + DGIL S GSDRR ++WDL +IG EQ +++ +DG PE+LM+HAGHK++IND + +
Sbjct: 320 EFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVN 379

Query: 357 PNVPWLMASVEEENIVQIWKPSRKL 381
           PN+ WL+AS EE+NIVQIWK S  +
Sbjct: 380 PNINWLVASAEEDNIVQIWKCSSNI 404

>TBLA0A07120 Chr1 complement(1765718..1766941) [1224 bp, 407 aa]
           {ON} Anc_6.9 YEL056W
          Length = 407

 Score =  387 bits (995), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 202/390 (51%), Positives = 273/390 (70%), Gaps = 22/390 (5%)

Query: 5   EPERELSIDDEYDLWKSNVPLMYDFVSETRLLWPSLTIQWLPRAED----STEQELLVGT 60
           E E  L+ D EY+LWKSNVPL+YDFVSET+L+WPSLT++WLP  E     S EQ LL+GT
Sbjct: 15  EEEEPLTTDQEYELWKSNVPLLYDFVSETKLVWPSLTVEWLPSNETTNLPSNEQRLLLGT 74

Query: 61  HTSDSEQNYLKIAEINLPQEILSNEGPVLQNDNNGSDEQVPSKIKIIKKFKHENEVTRAR 120
           HTS  EQNYLKIAEI LP +I++      +   + SD+ V S I+IIKKFKHE EVTRA 
Sbjct: 75  HTSGEEQNYLKIAEITLPDQIIN------EKTEDNSDKHVKSNIRIIKKFKHELEVTRAH 128

Query: 121 YAPFDSNLIATISGTGTVFLYDRTKDDE--NALRGKYAYHKENGYGLNFSVASPGELISC 178
           Y P DS +IATI+G GTVF+YD + D+   N +  K ++HKENGYGL F+    G+L+S 
Sbjct: 129 YMPQDSTIIATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGKLLSS 188

Query: 179 SDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDKRSEK 238
           SDDGS+A W+I+  K++P  +    + I+N+ +W++ + N++G V+E S L + D R+  
Sbjct: 189 SDDGSVAYWNIQ--KSIPL-LTLQETSIINDVRWNQFNQNLFGYVTESSCLNLKDVRNNN 245

Query: 239 PLQKLLQ----KEP--FNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEA 292
              K++     K P  FN +AFS HS  L AA+G D+++YL+D+R   + LH M GH+++
Sbjct: 246 NDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDS 305

Query: 293 VTSLEFAHHKDGILCSGGSDRRVLLWDLFQIGTEQQEEDADDGG-PELLMMHAGHKSAIN 351
           VTSL+F    DGI+ SGGSD+RV +WDL QIG EQ  ++ +DG  PELLM+HAGH+S IN
Sbjct: 306 VTSLDFHALNDGIVISGGSDKRVAVWDLKQIGQEQTSDEIEDGDVPELLMIHAGHRSPIN 365

Query: 352 DFSFSPNVPWLMASVEEENIVQIWKPSRKL 381
           DFS S N+ WL AS+EE+NIVQ+WK +  L
Sbjct: 366 DFSMSNNLNWLCASIEEDNIVQVWKMNNSL 395

>KLTH0E12694g Chr5 (1126940..1128196) [1257 bp, 418 aa] {ON} similar
           to uniprot|P13712 Saccharomyces cerevisiae YBR195C MSI1
           Subunit of chromatin assembly factor I (CAF- I)
           regulates the RAS/cAMP pathway via sequestration of
           Npr1p kinase localizes to the nucleus and cytoplasm
           homologous to human retinoblastoma binding proteins
           RbAp48 and RbAp46
          Length = 418

 Score =  140 bits (353), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 111/409 (27%), Positives = 189/409 (46%), Gaps = 54/409 (13%)

Query: 15  EYDLWKSNVPLMYDFVSETRLLWPSLTIQWLPRAEDST-EQELLVGTHTSDS--EQNYLK 71
            Y  WK N  L YD+++     WPSLT Q  P  + +T E  +L+ + TS    E   L 
Sbjct: 24  RYTRWKKNSKLYYDYLNTNSTKWPSLTCQLFPDLDLATDEHRILLSSFTSSQVPEDESLY 83

Query: 72  IAEI----NLPQEILSN---EGPVLQNDNNGSDEQVPSK--IKIIKKFKHENEVTRARYA 122
           +A +    ++P   L+N   E    + DN+    ++PSK  ++ ++      +  +ARY 
Sbjct: 84  VARLSSMKHIPWSSLNNFDMEEKEFKVDNS---LKLPSKSLVEDLRIKFPAGDCNKARYC 140

Query: 123 PFDSNLIATISGTGTVFLYDRTK------------DDENALRGKYAY----HKENGYGLN 166
           P + +LI + S  G+++++DRTK            D ++ +  + +     HK     L 
Sbjct: 141 PSNPDLIGSASSNGSIYVFDRTKHGFARQKLISAGDTDHQIHCQLSTSLEEHKNEAVSLA 200

Query: 167 FSVASPGELISCSDDGSIAIWDI-KSGKTVPTSVNSLHSDIV-----NECKWHESDPNIY 220
           ++    G L +    G + +WD+ K  K  PT +N L    V     NE  W     ++ 
Sbjct: 201 WNWQRQGLLATSYSHGQVCVWDLEKYDKNSPTLINPLAMSTVDPRGSNEVSWMVRHDSLL 260

Query: 221 GSVSEDSFLMIHDKRSEKPLQKL----LQKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDS 276
              SED+ + I D R+ +  Q            NT  F+ H   L  +A +   + L+D 
Sbjct: 261 AYCSEDNLVGIMDIRNPEKGQSSGSNPHHSNGINTCQFNYHRDMLLCSADSAGRINLWDI 320

Query: 277 RKPTEALHSMSGHQEAVTSLEFAHHKDGILCSGGSDRRVL-LWDLFQIGTEQQEEDADDG 335
           R  T+ L ++  H ++++ L++   +  +L +GG D  ++ +WDL Q             
Sbjct: 321 RNFTQPLKTLL-HNDSISVLQWNPREPTVLATGGQDGGLVKIWDLSQ-----------PE 368

Query: 336 GPELLMMHAGHKSAINDFSFSPNVPWLMASVEEENIVQIWKPSRKLTNP 384
           G EL+  H GH   +ND S+ P+  W+M SV  +N +Q+W+PS  L  P
Sbjct: 369 GQELIFTHGGHMLGVNDISWDPHDTWMMCSVANDNSIQVWRPSNSLVEP 417

>NDAI0C05510 Chr3 (1281190..1282449) [1260 bp, 419 aa] {ON}
           Anc_8.548
          Length = 419

 Score =  134 bits (336), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 110/421 (26%), Positives = 193/421 (45%), Gaps = 57/421 (13%)

Query: 2   QSTEPERELSIDDEYDLWKSNVPLMYDFVSETRLLWPSLTIQWLPRAEDSTE-QELLVGT 60
           QST P     +   Y  WK N  L+YD+++     WPSLT Q+ P  + +++   +L+ +
Sbjct: 10  QSTIPN---DLQQRYSNWKKNTKLLYDYLNTNATKWPSLTCQFFPDLDTTSDTHRILISS 66

Query: 61  HTSDS--EQNYLKIAEINLPQEILSNEGPVLQNDNNGSDEQVPSKIKIIKK-------FK 111
            TS    E   + I++I+  + +  N   V   D +  + +  + +K+  K        K
Sbjct: 67  FTSSQLPEDEAIHISKISTLKHL--NWASVNNFDMDEMEFKPDTNLKLPSKHLVNDLTIK 124

Query: 112 HEN-EVTRARYAPFDSNLIATISGTGTVFLYDRTKDDENALRGKYAY------------- 157
             N +  RARY P + ++IA  S  G+V+++DRTK   + +R                  
Sbjct: 125 FPNGDCNRARYLPQNPDVIAAASSNGSVYIFDRTKHGSSRIRQSKNLKPYDAVLFNNSET 184

Query: 158 ------HKENGYGLNFSVASPGELISCSDDGSIAIWDIK----SGKTVPTSVNSLHSDI- 206
                 +      L ++    G L SC   G + IWDIK    S   +   V ++  D  
Sbjct: 185 VEELHENTNEAISLAWNYQKEGTLASCYLQGQVQIWDIKQYFHSNPVLDKPVLNIQFDAL 244

Query: 207 -VNECKWHESDPNIYGSVSEDSFLMIHDKRSEKPLQKLLQKE---PFNTIAFSKHSSNLF 262
            VN+  W  S  +++ +  E   L + D+R  K + ++ Q       N+  F+  ++ L 
Sbjct: 245 GVNDVSWMPSHDSLFVACGESDTLALFDQRIGKEVSRIAQNRHNGGVNSCKFNYQNNMLL 304

Query: 263 AAAGTDAMVYLFDSRKPTEALHSMSGHQEAVTSLEFAHHKDGILCSGG-SDRRVLLWDLF 321
           A+A ++ +V ++D R   +       H  +++++E+  + D I+ + G +D  V LWD+ 
Sbjct: 305 ASADSEGLVNMWDIRNLDQYPIKSINHGSSISTIEWNPNLDTIIATAGQNDGLVKLWDV- 363

Query: 322 QIGTEQQEEDADDGGPELLMMHAGHKSAINDFSFSPNVPWLMASVEEENIVQIWKPSRKL 381
                    + D+   ELL +H GH   +ND S+  +  WLM SV  +N +QIWKP+  L
Sbjct: 364 --------SNTDN---ELLFVHGGHMLGVNDISWDLHDSWLMCSVSNDNSIQIWKPAHNL 412

Query: 382 T 382
            
Sbjct: 413 V 413

>ZYRO0A13068g Chr1 (1032695..1033888) [1194 bp, 397 aa] {ON} similar
           to uniprot|P13712 Saccharomyces cerevisiae YBR195C MSI1
           Subunit of chromatin assembly factor I (CAF- I)
           regulates the RAS/cAMP pathway via sequestration of
           Npr1p kinase localizes to the nucleus and cytoplasm
           homologous to human retinoblastoma binding proteins
           RbAp48 and RbAp46
          Length = 397

 Score =  129 bits (323), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 111/409 (27%), Positives = 184/409 (44%), Gaps = 66/409 (16%)

Query: 15  EYDLWKSNVPLMYDFVSETRLLWPSLTIQWLPRAEDSTEQELLVGTHTSDSE---QNYLK 71
            Y LWK N  L+YD+++     WPSL+ Q+ P  + S++   L+ T  + S+      + 
Sbjct: 11  RYTLWKKNTKLLYDYLNTNSFKWPSLSCQFFPDLDTSSDTHRLLFTSFTSSQLPQDENVT 70

Query: 72  IAEINLPQEILSNEGPVLQNDNNGSDE---------QVPSK---IKIIKKFKHENEVTRA 119
           IA I+  + +     P    +N   DE         ++P K   I++   F H  +  RA
Sbjct: 71  IASISTLRHV-----PWSSLNNFDMDEMEFKPDLSTKLPPKNLQIQLTINFPH-GDCNRA 124

Query: 120 RYAPFDSNLIATISGTGTVFLYDRTKDDENA---LRGKYAYH---KENGYGLNFSVA--- 170
            Y P + +LI+T S  G+V+++DRTK  ++    LRG +        NG  +  +VA   
Sbjct: 125 TYLPQNPDLISTASSDGSVYIFDRTKRGKSPISHLRGPFEAQLLPNNNGSPIGETVALDW 184

Query: 171 ---SPGELISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIV-------NECKWHESDPNIY 220
                G L S   +G + IWDIK  +     ++   +D +       N+  W  S   + 
Sbjct: 185 NRQIEGILASTYSNGQLCIWDIKKFEKRNPIMSQPSADFIDTESQGFNDVSWMPSHDCLL 244

Query: 221 GSVSEDSFLMIHDKRSEKPLQKLLQKEP-------FNTIAFSKHSSNLFAAAGTDAMVYL 273
               ED+ + + D R+      + Q  P        N   F+     L A A  D +V L
Sbjct: 245 SIAREDNIMTLFDTRTNG---NIAQTGPSTNHASGINCTKFNPSQPLLVATASGDGLVQL 301

Query: 274 FDSRKPTEALHSMSGHQEAVTSLEFAHHKDGILCSGGS-DRRVLLWDLFQIGTEQQEEDA 332
           +D RK    + +++  +  +++LE+      +L +GG  D  V LW+            A
Sbjct: 302 WDIRKLHNPIKTINC-ESPLSALEWNPQLPTVLATGGQEDGLVKLWN------------A 348

Query: 333 DDGGPELLMMHAGHKSAINDFSFSPNVPWLMASVEEENIVQIWKPSRKL 381
            +G  +LL  H GH   +ND ++SP+  WLM SV  +N   +WKP+ +L
Sbjct: 349 SNG--QLLFTHGGHMLGVNDIAWSPHDKWLMCSVANDNSTHLWKPASRL 395

>TBLA0H03650 Chr8 (888840..890099) [1260 bp, 419 aa] {ON} Anc_8.548
           YBR195C
          Length = 419

 Score =  128 bits (322), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 112/420 (26%), Positives = 193/420 (45%), Gaps = 66/420 (15%)

Query: 12  IDDEYDLWKSNVPLMYDFVSETRLLWPSLTIQWLPRAEDSTE-QELLVGTHTS----DSE 66
           +   Y  WK N  L+YD+++     WPSLT Q+ P  + S +   LL+ T TS    D E
Sbjct: 13  LQQRYSHWKKNTKLLYDYLNTNSNKWPSLTCQFFPDIDKSNDTHRLLLSTFTSSQIPDDE 72

Query: 67  QNYLK-IAEIN-LPQEILSN---EGPVLQNDNNGSDEQVPSK--IKIIKKFKHENEVTRA 119
             Y+  I+ +N L    L+N   +    + DN     + PSK  I  I     E +  +A
Sbjct: 73  SIYISHISTLNHLDWSSLNNFDMDEMEFKPDNR---IKFPSKNLITDISITFPEGDCNKA 129

Query: 120 RYAPFDSNLIATISGTGTVFLYDRTK--------------DDENALRGKYAYHK----EN 161
           RY P + ++I   S  G ++++DRTK                  A   K A  +    E+
Sbjct: 130 RYMPQNPDIIGCASSNGCIYIFDRTKRGSKLSTTTSARFSSGSKAYEAKLAKQRKFVIED 189

Query: 162 G--------YGLNFSVASPGELISCSDDGSIAIWDI-KSGKTVPTSVNSLHSDI------ 206
           G          + ++    G+L+SC  +G+I +WD  K   +    +N+   D       
Sbjct: 190 GTKNDEFECLSIAWNPQQEGQLLSCESNGNIHLWDFQKEFSSKNREINNTIWDTNFDDLG 249

Query: 207 VNECKWHESDPNIYGSVSEDSFLMIHDKRSEKPLQKLLQKE---PFNTIAFSKHSSNLFA 263
            NE  W     +I+ +  E++ + + D R E  +  + Q       N+  F+  ++ L A
Sbjct: 250 CNEVTWMNGHNSIFATCGENNKMAVFDTRKEGIVNSIEQGNHNGGINSCKFNYENAMLLA 309

Query: 264 AAGTDAMVYLFDSRKPTEALHSMSGHQEAVTSLEFAHHKDGILCSGGS-DRRVLLWDLFQ 322
           +  ++ ++ L+D RK  + + ++  H  +++++E++   + ++ SGG  D  V LWD+  
Sbjct: 310 SGDSNGIINLWDIRKLNKPIRNLY-HGSSISTIEWSPLMNEMIASGGQEDGLVKLWDI-- 366

Query: 323 IGTEQQEEDADDGGPELLMMHAGHKSAINDFSFSPNVPWLMASVEEENIVQIWKPSRKLT 382
                 EE       E + +H GH   IND S+  + PWL+ SV  +N +QIWKP++ L 
Sbjct: 367 ----SNEE-------EPIFIHGGHMLGINDLSWDLHDPWLLCSVGSDNSIQIWKPAKHLV 415

>Kwal_27.12070 s27 (1071472..1072728) [1257 bp, 418 aa] {ON} YBR195C
           (MSI1) - p50 subunit of the yeast Chromatin Assembly
           Factor-I (CAF-I) negative regulator of ras-mediated cAMP
           induction; homologous to beta subunit of GTP-binding
           proteins [contig 24] FULL
          Length = 418

 Score =  128 bits (322), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 106/413 (25%), Positives = 188/413 (45%), Gaps = 62/413 (15%)

Query: 15  EYDLWKSNVPLMYDFVSETRLLWPSLTIQWLPRAE-DSTEQELLVGTHTSDS--EQNYLK 71
            Y  WK N  L+Y++++     WPSLT Q  P  +    E  +L+ + TS    E   + 
Sbjct: 24  RYTHWKKNCKLLYEYLNTNNTKWPSLTCQLFPDLDLAGDEHRILLSSFTSSQLPEDEAIY 83

Query: 72  IAEINLPQEILSNEGPVLQNDNNGSDE---------QVPSKIKIIKKFKHE---NEVTRA 119
           +A ++  + I     P    +N  +DE         ++P K  I++  + +    +  +A
Sbjct: 84  VARLSSMKHI-----PWSSLNNFDTDEMEFKMDNSLKLPPK-NIVEDLRIKFPAGDCNKA 137

Query: 120 RYAPFDSNLIATISGTGTVFLYDRTK------------DDENALRGKYAYHKEN----GY 163
           RY P + +LI++ S  G+V+++DRTK            D ++ +  + +   E       
Sbjct: 138 RYCPSNPDLISSASSNGSVYVFDRTKHGSARQKLISGGDPDHQIHCQLSTSLEERQNEAL 197

Query: 164 GLNFSVASPGELISCSDDGSIAIWDI-KSGKTVPTSVNSLHSDIV------NECKWHESD 216
            L ++    G L +C   G + +WD+ K  K  PT ++  HS ++      N+  W  + 
Sbjct: 198 NLAWNWQQQGLLATCYSGGEVCVWDLAKYDKASPTLIDP-HSSLLADPQGSNDISWMVNH 256

Query: 217 PNIYGSVSEDSFLMIHDKR-SEKPLQKLL---QKEPFNTIAFSKHSSNLFAAAGTDAMVY 272
            ++     E + L + D R +++P Q           N   F+ +   L  +A +   + 
Sbjct: 257 DSLLAYCGEGNALGVLDTRITKQPPQSFSNPHHSNGVNACQFNYYKDLLLCSADSAGRIN 316

Query: 273 LFDSRKPTEALHSMSGHQEAVTSLEFAHHKDGILCSGGSDRRVL-LWDLFQIGTEQQEED 331
           L+D R  +  + S+  H  +V++L++  H   IL + G D  ++ +WDL Q   +     
Sbjct: 317 LWDIRDFSSPIRSLD-HHGSVSALQWNPHHPTILATAGQDDGLVKIWDLSQPVDQ----- 370

Query: 332 ADDGGPELLMMHAGHKSAINDFSFSPNVPWLMASVEEENIVQIWKPSRKLTNP 384
                 EL   H GH   +ND S+ PN PW+M SV  +N +Q+WKPS+ L  P
Sbjct: 371 ------ELKFTHGGHMLGVNDISWDPNDPWMMCSVSNDNSIQLWKPSQNLMTP 417

>TPHA0L01720 Chr12 (362572..363831) [1260 bp, 419 aa] {ON} Anc_8.548
           YBR195C
          Length = 419

 Score =  127 bits (318), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 104/410 (25%), Positives = 189/410 (46%), Gaps = 58/410 (14%)

Query: 12  IDDEYDLWKSNVPLMYDFVSETRLLWPSLTIQWLPRAEDSTE-QELLVGTHTSD--SEQN 68
           + + Y  WK N  L+YD+++     WPSL+ Q+        +   +L+ + TS    EQ 
Sbjct: 23  LQERYTHWKKNTRLLYDYLNTNSTKWPSLSCQFFQDVNTKNDSHRILLSSFTSGLMPEQE 82

Query: 69  YLKIAEI----NLPQEILSN---EGPVLQNDNNGSDEQVPSKIKIIKKFKHEN-EVTRAR 120
            + I  I    ++P   L+N   +    + DNN   +  P  +   +     N +  RAR
Sbjct: 83  SINIMSISTLKHVPWASLNNFDMDEMEFKPDNNL--KLPPKNLHTEQTITFPNGDCNRAR 140

Query: 121 YAPFDSNLIATISGTGTVFLYDRTK-------------------DDENALRGKYAYHKEN 161
           Y P + ++IA  S  GTV++++RTK                   + EN ++   +   E 
Sbjct: 141 YLPQNQDIIAGASSDGTVYIFNRTKYGSTLRQTSSFQSYQARFAEPENTVQSVDSNPNE- 199

Query: 162 GYGLNFSVASPGELISCSDDGSIAIWDIK------SGKTVPTSVNSLHSDIVNECKWHES 215
              ++++V   G L +   DG I  WD+K      +  T PT    + ++  N+  W   
Sbjct: 200 ALSIDWNVQREGLLAASYSDGEIKTWDLKKFSNANTTITTPTVSIMMDTNGANDVTWMPL 259

Query: 216 DPNIYGSVSEDSFLMIHDKRSEK---PLQKLLQKEPFNTIAFSKHSSNLFAAAGTDAMVY 272
             ++  +  E + L+I+D R  +    +   + ++  N   F+  ++ + A+A T   V+
Sbjct: 260 HDSLLAACGESNKLIIYDIRGSREHTTISSGIHEDGINACRFNYANNLIVASADTVGNVH 319

Query: 273 LFDSRKPTEALHSMSGHQEAVTSLEFAHHKDGILCSGGSDRRVL-LWDLFQIGTEQQEED 331
           ++D RK  E + ++  H  +++++E+  + D IL + G D  ++ LWD+           
Sbjct: 320 IWDIRKSNEIVKTIP-HGSSISTIEWNPNMDTILATAGQDDGLVKLWDVTD--------- 369

Query: 332 ADDGGPELLMMHAGHKSAINDFSFSPNVPWLMASVEEENIVQIWKPSRKL 381
                 EL+  H GH   +ND S++ + PWLM SV  +N VQIW+P+  L
Sbjct: 370 -----SELIFTHGGHMLGVNDISWNRHDPWLMCSVARDNSVQIWRPAHNL 414

>YBR195C Chr2 complement(610614..611882) [1269 bp, 422 aa] {ON}
           MSI1Subunit of chromatin assembly factor I (CAF-1);
           chromatin assembly by CAF-1 is important for multiple
           processes including silencing at telomeres, mating type
           loci, and rDNA; maintenance of kinetochore structure;
           deactivation of the DNA damage checkpoint after DNA
           repair; and chromatin dynamics during transcription;
           Msi1p localizes to both nucleus and cytoplasm and has an
           independent role as a negative regulator of the RAS/cAMP
           pathway via sequestration of Npr1p kinase
          Length = 422

 Score =  127 bits (318), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 106/416 (25%), Positives = 186/416 (44%), Gaps = 58/416 (13%)

Query: 10  LSIDDEYDLWKSNVPLMYDFVSETRLLWPSLTIQWLPRAEDST-EQELLVGTHTSDS--E 66
           + + + Y  WK N  L+YD+++     WPSLT Q+ P  + ++ E  +L+ + TS    E
Sbjct: 17  IDLQERYSHWKKNTKLLYDYLNTNSTKWPSLTCQFFPDLDTTSDEHRILLSSFTSSQKPE 76

Query: 67  QNYLKIAEINLPQEI----LSNEGPVLQNDNNGSDEQVPSK--IKIIKKFKHENEVTRAR 120
              + I++I+    I    L+N           +  + PSK  +  I  F    E  RAR
Sbjct: 77  DETIYISKISTLGHIKWSSLNNFDMDEMEFKPENSTRFPSKHLVNDISIFFPNGECNRAR 136

Query: 121 YAPFDSNLIATISGTGTVFLYDRTKDDENALRGKYAYHK--------------------- 159
           Y P + ++IA  S  G ++++DRTK     +R     H                      
Sbjct: 137 YLPQNPDIIAGASSDGAIYIFDRTKHGSTRIRQSKISHPFETKLFGSHGVIQDVEAMDTS 196

Query: 160 ----ENGYGLNFSVASPGELISCSDDGSIAIWDIKS----GKTVPTSVNSLHSD--IVNE 209
                    L +++     L+S   +G + +WDIK        +   + S++SD   VN+
Sbjct: 197 SADINEATSLAWNLQQEALLLSSHSNGQVQVWDIKQYSHENPIIDLPLVSINSDGTAVND 256

Query: 210 CKWHESDPNIYGSVSEDSFLMIHDKRSEK-PLQKLLQKEP--FNTIAFSKHSSNLFAAAG 266
             W  +  +++ + +E + + + D R++K  LQ   +K     N+  F+  +S + A+A 
Sbjct: 257 VTWMPTHDSLFAACTEGNAVSLLDLRTKKEKLQSNREKHDGGVNSCRFNYKNSLILASAD 316

Query: 267 TDAMVYLFDSRKPTEALHSMSGHQEAVTSLEFAHHKDGILCSGGS-DRRVLLWDLFQIGT 325
           ++  + L+D R   ++  +   H  +V++LE++ + D +L + G  D  V LWD      
Sbjct: 317 SNGRLNLWDIRNMNKSPIATMEHGTSVSTLEWSPNFDTVLATAGQEDGLVKLWDT----- 371

Query: 326 EQQEEDADDGGPELLMMHAGHKSAINDFSFSPNVPWLMASVEEENIVQIWKPSRKL 381
                       E +  H GH   +ND S+  + PWLM SV  +N V IWKP+  L
Sbjct: 372 ---------SCEETIFTHGGHMLGVNDISWDAHDPWLMCSVANDNSVHIWKPAGNL 418

>Ecym_7042 Chr7 (86859..88103) [1245 bp, 414 aa] {ON} similar to
           Ashbya gossypii AEL250C
          Length = 414

 Score =  125 bits (315), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 110/406 (27%), Positives = 190/406 (46%), Gaps = 50/406 (12%)

Query: 12  IDDEYDLWKSNVPLMYDFVSETRLLWPSLTIQWLPRAEDSTEQ-ELLVGTHTSDS--EQN 68
           +   Y  WK N  L+Y++++     WPSLT Q++P  + ++++  +L+ + TS    E  
Sbjct: 21  LQQRYTNWKKNTRLLYEYLNTNSTKWPSLTCQFMPDMDIASDKHRILLSSFTSAQLPEDE 80

Query: 69  YLKIAEINLPQEILSNEGPVLQNDNNGSDE-QVPSKIKIIKKFKH-------ENEVTRAR 120
            + I+EI+  + I  +    L N +    E +V +++K+ K           E +  RAR
Sbjct: 81  AIYISEISTMKHIAWSS---LNNFHMEEMEFKVDNQVKLSKNLTETIKIQFPEGDCNRAR 137

Query: 121 YAPFDSNLIATISGTGTVFLYDRTKDDEN---ALRGKYAYH---KENGYGLNFSVAS--- 171
           Y P + ++IA+ S  G+V+++DRTK   N    L   + Y    KE   G N+  +S   
Sbjct: 138 YMPQNPDVIASASSLGSVYIFDRTKHGSNRPKILGNTFKYDMELKEVESGCNYEASSLAW 197

Query: 172 ----PGELISCSDDGSIAIWDI-KSGK-----TVPTSVNSLHSDIVNECKWHESDPNIYG 221
                G L +   DG + IWDI K  K     TVP     +  +  NE  W     +I  
Sbjct: 198 NYQRSGILAASYSDGDVKIWDITKYNKAQPQLTVPDLRWQVDKEGANEVSWMVHHSSILA 257

Query: 222 SVSEDSFLMIHDKRSEKPL---QKLLQKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRK 278
              E + L I D R+       +        N + F+  +  L  +A ++  + + D R+
Sbjct: 258 VCGEGNGLTILDTRTPTTFSTKRHSCHTGGINAVQFNYDNDFLLCSADSEGTLNICDIRQ 317

Query: 279 PTEALHSMSGHQEAVTSLEFAHHKDGILCSGG-SDRRVLLWDLFQIGTEQQEEDADDGGP 337
               + + S H +AV+++++      ++ S G +D  V +WDL       QE+D      
Sbjct: 318 LEHPVKTWS-HLDAVSTIQWNPKFPTVIASAGQNDGLVKIWDL------AQEDDP----- 365

Query: 338 ELLMMHAGHKSAINDFSFSPNVPWLMASVEEENIVQIWKPSRKLTN 383
            L+ +H GH   +ND +++ + PW+M SV  +N V IWKP+  + N
Sbjct: 366 -LVFIHGGHMLGVNDIAWNHHDPWVMCSVSNDNSVHIWKPAANIVN 410

>TDEL0B02980 Chr2 complement(529584..530822) [1239 bp, 412 aa] {ON}
           Anc_8.548 YBR195C
          Length = 412

 Score =  125 bits (313), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 106/427 (24%), Positives = 190/427 (44%), Gaps = 68/427 (15%)

Query: 5   EPERELSIDDE----YDLWKSNVPLMYDFVSETRLLWPSLTIQWLPRAEDSTE-QELLVG 59
           EP  + +I +E    Y  WK N  L+YD+++     WPSLT ++ P  + +T+   LL+ 
Sbjct: 4   EPAIDYAISNERQQRYSNWKKNTKLLYDYLNTNSAKWPSLTCEFFPDLDTTTDSHRLLLS 63

Query: 60  THTSDS--EQNYLKIAEINLPQEILSNEGPVLQNDNNGSDEQVPSKIKIIKKFKHENEVT 117
           + TS    E   + I+ I+  + +       L N +    E  P     +      ++++
Sbjct: 64  SFTSSQLPEDESIYISRISTLKHL---HWSSLNNFDMDEMEFKPENSTKLPPRNLTDDIS 120

Query: 118 ---------RARYAPFDSNLIATISGTGTVFLYDRTKDDENALRGKYAYHKENGYGLNFS 168
                    RARY P + ++I+  S  G+++++DRTK +    R   +      Y +   
Sbjct: 121 IRIPSGDSNRARYLPQNPDVISAASSDGSIYIFDRTKHNSTISRSTTS----RPYEIKLE 176

Query: 169 VA-------SPGELIS-------------CSDDGSIAIWDIK----SGKTVPT---SVNS 201
           VA       SP E++S             C   G + +WDI     S  T+ T   S++ 
Sbjct: 177 VAPQVELMDSPNEVVSLDWNKRKEGILASCHSRGQLLVWDISQYLHSNPTIQTPICSIDD 236

Query: 202 LHSDIVNECKWHESDPNIYGSVSEDSFLMIHDKRSEKPLQKL---LQKEPFNTIAFSKHS 258
                 N+  W  S  ++  +  E + + I+D RS+  + K+   L     N+  F+ H+
Sbjct: 237 FDPQGANDITWMPSHDSLLAACGESNTVAIYDTRSKSQVSKIQPGLHNGGINSCDFNAHN 296

Query: 259 SNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEAVTSLEFAHHKDGILCSGGS-DRRVLL 317
             L A+A +   V+++D RK  +       H  +++++++  +   I+   G  D  V L
Sbjct: 297 DYLLASADSIGTVHMWDIRKLDQDPIQSVSHGSSISTVKWNPNVATIIAVAGQEDGLVKL 356

Query: 318 WDLFQIGTEQQEEDADDGGPELLMMHAGHKSAINDFSFSPNVPWLMASVEEENIVQIWKP 377
           WD            A +G  +L+  H GH   +ND +++ + PWLM SV  +N + +W+P
Sbjct: 357 WD------------ASNG--QLIFTHGGHMLGVNDIAWNAHDPWLMCSVSNDNSIHLWRP 402

Query: 378 SRKLTNP 384
           S  L  P
Sbjct: 403 SSHLVEP 409

>KLLA0E23541g Chr5 (2095246..2096499) [1254 bp, 417 aa] {ON} similar
           to uniprot|P13712 Saccharomyces cerevisiae YBR195C MSI1
           Subunit of chromatin assembly factor I (CAF- I)
           regulates the RAS/cAMP pathway via sequestration of
           Npr1p kinase localizes to the nucleus and cytoplasm
           homologous to human retinoblastoma binding proteins
           RbAp48 and RbAp46
          Length = 417

 Score =  125 bits (313), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 96/404 (23%), Positives = 183/404 (45%), Gaps = 42/404 (10%)

Query: 12  IDDEYDLWKSNVPLMYDFVSETRLLWPSLTIQWLP-RAEDSTEQELLVGTHTSD------ 64
           +   Y  WK N  L+YD+++     WPSL+ Q+ P R   + +Q +L+ + TS       
Sbjct: 20  VQQRYTNWKKNTKLLYDYLNTNTSKWPSLSCQFFPDRTLTNDKQRILLSSFTSQQLPQDE 79

Query: 65  -------SEQNYLKIAEINLPQEILSNEGPVLQNDNNGSDEQVPSKIKIIKKFKHENEVT 117
                  S  N++K + IN     +      L N    +D+ +  +++I      + +  
Sbjct: 80  SIYIGSISTMNHMKWSSIN--NFDMDEMEFKLDNSLKLNDKTLEEEVRITYP---DGDCN 134

Query: 118 RARYAPFDSNLIATISGTGTVFLYDRTKDDENALRGKY--AYHKENG-------YGLNFS 168
           R RY P + ++I T S  G+V+++DRTK       G+      + NG         L ++
Sbjct: 135 RCRYMPQNPDIIGTASSNGSVYIFDRTKHGNKISTGRKFEIECRNNGDDEQDESLSLAWN 194

Query: 169 VASPGELISCSDDGSIAIWDI------KSGKTVPTSVNSLHSDIVNECKWHESDPNIYGS 222
               G L +C  +G + +WD+      K    +P   + + ++ VN+  W  +  +I  S
Sbjct: 195 YQLEGTLATCQSNGKVKVWDLTKFDKSKQRMEIPERESVMDANGVNDVSWMVNHTSILAS 254

Query: 223 VSEDSFLMIHDKRSEKP---LQKLLQKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKP 279
             E + + + D R +     L +    +  N I F+  +  +     +   + ++D R  
Sbjct: 255 CGESNVIGLIDIRQDTKMDTLHRTTHTDGINAIEFNYKNDMILCTGDSQGQLKIWDIRDF 314

Query: 280 TEALHSMS-GHQEAVTSLEFAHHKDGILCSGGSDRRVLLWDLFQIGTEQQEEDADDGGPE 338
            E +     G Q+ ++++++      IL +  +D++  L  ++    EQ++ +A++    
Sbjct: 315 KEPIKEWEHGDQDPISAIQWNPQIPQILAT--ADQQSGLVKIWDASGEQEDSNAENN--M 370

Query: 339 LLMMHAGHKSAINDFSFSPNVPWLMASVEEENIVQIWKPSRKLT 382
           LL +H GH   +ND S+S + PW M SV  +N + IWKP+  L 
Sbjct: 371 LLFVHGGHMLGVNDISWSQHDPWTMCSVSNDNSIHIWKPAANLV 414

>Skud_2.321 Chr2 complement(577912..579180) [1269 bp, 422 aa] {ON}
           YBR195C (REAL)
          Length = 422

 Score =  124 bits (310), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 106/415 (25%), Positives = 182/415 (43%), Gaps = 58/415 (13%)

Query: 12  IDDEYDLWKSNVPLMYDFVSETRLLWPSLTIQWLPRAEDS-TEQELLVGTHTSDS--EQN 68
           + + Y  WK N  L+YD+++     WPSLT Q+ P  + +  E  +L+ + TS    E  
Sbjct: 19  LQERYSHWKKNTKLLYDYLNTNSTKWPSLTCQFFPDLDTTLNEHRILLSSFTSSQKPEDE 78

Query: 69  YLKIAEINLPQEI----LSNEGPVLQNDNNGSDEQVPSK--IKIIKKFKHENEVTRARYA 122
            + I+ I+    I    L+N           +    PSK  +  I+ F    E  RARY 
Sbjct: 79  TIYISRISTLGHIKWASLNNFDMDEMEFKPENTTTYPSKHLVDDIRIFFPNGECNRARYL 138

Query: 123 PFDSNLIATISGTGTVFLYDRTKDDENALRGKYAYHK----------------------- 159
           P + ++IA  S  G ++++DRTK     +R     H                        
Sbjct: 139 PQNPDIIAGASSDGAIYIFDRTKHGSTRIRQSKISHPFEIKLLGSHGVIQDVETMDTSLV 198

Query: 160 --ENGYGLNFSVASPGELISCSDDGSIAIWDIKS----GKTVPTSVNSLHSD--IVNECK 211
                  L +++     L+S   +G I +WDIK        +   + S+ SD   VN+  
Sbjct: 199 DINEATSLAWNLQQEALLLSSHSNGQIQVWDIKQYSHDNPIIDVPLMSIDSDGSSVNDVT 258

Query: 212 WHESDPNIYGSVSEDSFLMIHDKRSEKPLQK---LLQKEPFNTIAFSKHSSNLFAAAGTD 268
           W  +  +++ + +E + + + D R++K   K    +     N+  F+  +S + A+A ++
Sbjct: 259 WMPTHDSLFAACTERNAVSLLDLRTKKEKLKSNCKIHGGGVNSCKFNYKNSLILASADSN 318

Query: 269 AMVYLFDSRKPTEALHSMSGHQEAVTSLEFAHHKDGILCSGGS-DRRVLLWDLFQIGTEQ 327
             + L+D R   E   +   H  +V++LE++ + D +L + G  D  V LWD     T +
Sbjct: 319 GRLNLWDIRNMNENPIATMEHGASVSTLEWSPNFDTVLATAGQEDGLVKLWD-----TTR 373

Query: 328 QEEDADDGGPELLMMHAGHKSAINDFSFSPNVPWLMASVEEENIVQIWKPSRKLT 382
           +E          +  H GH   +ND S+  + PWLM SV  +N V IWKP+  + 
Sbjct: 374 EES---------IFTHGGHMFGVNDISWDVHDPWLMCSVANDNSVHIWKPAENIV 419

>Kpol_1024.39 s1024 complement(104336..105589) [1254 bp, 417 aa]
           {ON} complement(104336..105589) [1254 nt, 418 aa]
          Length = 417

 Score =  124 bits (310), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 102/414 (24%), Positives = 186/414 (44%), Gaps = 67/414 (16%)

Query: 14  DEYDLWKSNVPLMYDFVSETRLLWPSLTIQWLPRAEDSTE-QELLVGTHTSD--SEQNYL 70
           D Y  WK N  L+Y++++     WPSLT Q+ P      +   +L+ + TS    E   L
Sbjct: 23  DRYTTWKKNTKLLYEYLNTNSNKWPSLTCQFFPDVNTKNDSHRILLSSFTSSLVPEDESL 82

Query: 71  KIAEINLPQEI----LSN-EGPVLQNDNNGSDEQVPSK---IKIIKKFKHENEVTRARYA 122
            I  I+  + +    L+N +   ++   + S+ ++P K    +++ +F +  +  RARY 
Sbjct: 83  YITRISTLKHLSWASLNNFDLDEMEFKPDNSNIKLPPKNLTTELVIRFPN-GDCNRARYL 141

Query: 123 PFDSNLIATISGTGTVFLYDRTKDDENALRGKYAYHKENGYG------------------ 164
           P + +LIA  S  G+V+++DRTK       G   + +++G+                   
Sbjct: 142 PQNPDLIAAASSDGSVYIFDRTK------HGTAMHSRQSGFTQSYQAKLAVNNNSQSLNG 195

Query: 165 ------LNFSVASPGELISCSDDGSIAIWDIKSGK------TVPTSVNSLHSDIVNECKW 212
                 ++++    G L+    DG +  WDI   K        P     L     N+  W
Sbjct: 196 ENEALTIDWNHQKEGHLVVAYSDGHVKAWDITKYKRSDPVIKAPEYNYKLDESGCNDAVW 255

Query: 213 HESDPNIYGSVSEDSFLMIHDKRSEKPLQKL---LQKEPFNTIAFSKHSSNLFAAAGTDA 269
                +++ + SED+ L + D R E  +  +   + K   N   F+  +S L A+  +  
Sbjct: 256 MPEHNSLFAACSEDNRLSLFDTRDESNIIDISTSVHKGGINACRFNPRNSLLLASGDSIG 315

Query: 270 MVYLFDSRKPTEALHSMSGHQEAVTSLEFAHHKDGILCSGGSDRRVL-LWDLFQIGTEQQ 328
            + L+D RK    ++ +  H  +++++E+  +   +L S G D  ++ LWD         
Sbjct: 316 NICLWDIRKKETPINILD-HGSSISTIEWNPNLSTVLASAGQDDGLVKLWDA-------- 366

Query: 329 EEDADDGGPELLMMHAGHKSAINDFSFSPNVPWLMASVEEENIVQIWKPSRKLT 382
                 G  + + +H GH   +ND S++ + PWLM SV ++N +QIWKP+  L 
Sbjct: 367 ------GSDKPVFIHGGHMLGVNDISWNMHDPWLMCSVSKDNSIQIWKPAHNLV 414

>AEL250C Chr5 complement(168010..169263) [1254 bp, 417 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR195C
           (MSI1)
          Length = 417

 Score =  122 bits (306), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 111/419 (26%), Positives = 195/419 (46%), Gaps = 57/419 (13%)

Query: 6   PERELSIDDE----YDLWKSNVPLMYDFVSETRLLWPSLTIQWLPRAEDSTEQ-ELLVGT 60
           P+    I DE    Y  WK N  L+YD+++     WPSLT Q++P  E  T++  LL+ +
Sbjct: 11  PQVSSEISDELQQRYTNWKKNTKLLYDYLNTNSTKWPSLTCQFMPDLEVPTDKHRLLLSS 70

Query: 61  HTSDS--EQNYLKIAEIN----LPQEILSN---EGPVLQNDNNGSDEQVPSK--IKIIKK 109
            TS    E   + I+E++    +P   L+N   +    + DN     ++P+K  ++ ++ 
Sbjct: 71  FTSSQLPEDEAVYISELSTMRHVPWSSLNNFDMDEMEFKVDNQA---KLPNKNLVETVRI 127

Query: 110 FKHENEVTRARYAPFDSNLIATISGTGTVFLYDRTKDDEN--ALRGKYAYHK-------- 159
                +  RA Y P + ++I  I+ TG V ++DRTK   N   L G  A ++        
Sbjct: 128 QFPSGDCNRACYMPQNPDIIGAIASTGAVNIFDRTKHGTNRPKLLGSAASYEIQLNEPES 187

Query: 160 ------ENGYGLNFSVASPGELISCSDDGSIAIWDI-KSGKTVPTSVNSLHSDI-----V 207
                      L ++    G + S   +G I +WDI +  K+ PT  N     +      
Sbjct: 188 LGDADSAEALSLAWNWQKAGIIASSYSNGLIKVWDITRYQKSQPTISNPELRILQDKAGT 247

Query: 208 NECKWHESDPNIYGSVSEDSFLMIHDKRSE---KPLQKLLQKEPFNTIAFSKHSSNLFAA 264
           N+  W     +I  +  E + + + D R+    KP +        N + F+  +  L  A
Sbjct: 248 NDVSWMVHHSSILAACGESNTIGLLDTRAPDAFKPTKASPHTGGINALQFNYANDMLLCA 307

Query: 265 AGTDAMVYLFDSRKPTEALHSMSGHQEAVTSLEFAHHKDGILCSGG-SDRRVLLWDLFQI 323
           A ++  + L+D R  ++ L S+  H ++V++L++  +   I+ + G  D  + +WD    
Sbjct: 308 ADSNGGIALWDCRAFSKPL-SVFNHGDSVSALQWNPNLPTIVATAGQGDGLIKIWD---- 362

Query: 324 GTEQQEEDADDGGPELLMMHAGHKSAINDFSFSPNVPWLMASVEEENIVQIWKPSRKLT 382
            T ++ ED+      LL +H GH   +ND +++ + PWLM SV  +N V +WKP+  L 
Sbjct: 363 -TSREPEDS------LLFVHGGHMLGVNDIAWNYHDPWLMCSVANDNSVHVWKPAANLV 414

>SAKL0H09900g Chr8 complement(847975..849252) [1278 bp, 425 aa] {ON}
           similar to uniprot|P13712 Saccharomyces cerevisiae
           YBR195C MSI1 Subunit of chromatin assembly factor I
           (CAF- I) regulates the RAS/cAMP pathway via
           sequestration of Npr1p kinase localizes to the nucleus
           and cytoplasm homologous to human retinoblastoma binding
           proteins RbAp48 and RbAp46
          Length = 425

 Score =  122 bits (305), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 106/412 (25%), Positives = 187/412 (45%), Gaps = 60/412 (14%)

Query: 12  IDDEYDLWKSNVPLMYDFVSETRLLWPSLTIQWLPRAEDSTEQ-ELLVGTHTSDS--EQN 68
           +   Y  WK N  L+YD+++     WPSLT Q+ P  + + +Q  LL+ + TS    E  
Sbjct: 30  VQTRYTNWKKNTKLLYDYLNTNSTKWPSLTCQFFPDLDTTNDQHRLLLSSFTSSQLPEDE 89

Query: 69  YLKIAEI----NLPQEILSN---EGPVLQNDNNGSDEQVPSKIKIIKKFKHE---NEVTR 118
            + ++ +    +LP   L+N   +    + DN+    ++PSK  +IK+        +   
Sbjct: 90  SIYVSRVSTLKHLPWSSLNNFDMDEMEFKLDNSS---KLPSK-NLIKELNISFPMGDCNG 145

Query: 119 ARYAPFDSNLIATISGTGTVFLYDRTKDDENALRGKYAYHKENGYGLNFSVAS------- 171
           ARY P + ++IA  S  G+++++DRTK   + L  +  +   + + L F  +S       
Sbjct: 146 ARYLPQNPDVIAAASSNGSIYVFDRTK---HGLTRQKLHDGGSMFELEFQSSSLEEHQEV 202

Query: 172 ---------PGELISCSDDGSIAIWDIKS-GKTVPT--SVNSLHS---DIVNECKWHESD 216
                     G L +C   G + +WD+K   +  P     +  H+      N+  W  + 
Sbjct: 203 VSLAWNWQREGLLAACYSGGDVKVWDVKKYSRNFPVIDKADYTHNADPRGCNDVSWMVNH 262

Query: 217 PNIYGSVSEDSFLMIHDKRSEKPLQKLLQ-----KEPFNTIAFSKHSSNLFAAAGTDAMV 271
            +I     E + + + D R++K +    +         N+  F+ H+  L  +  +   V
Sbjct: 263 ASILACCGESNSINVIDTRAQKGVLSSTKDTKHHSRGINSSQFNYHNDMLLCSGDSTGRV 322

Query: 272 YLFDSRKPTEALHSMSGHQEAVTSLEFAHHKDGILCSGG-SDRRVLLWDLFQIGTEQQEE 330
            L+D R     L S+  H  +++  ++  +   IL +   SD  V LWD+          
Sbjct: 323 NLWDIRDLETPLKSLD-HGSSISKTQWNPNLSTILATADQSDGLVKLWDI---------- 371

Query: 331 DADDGGPELLMMHAGHKSAINDFSFSPNVPWLMASVEEENIVQIWKPSRKLT 382
            A + G ELL +H GH   +ND S++ + PWLM SV  +N VQ+W+P+R L 
Sbjct: 372 -AQEPGEELLFVHGGHMLGVNDISWNYHDPWLMCSVANDNSVQLWRPARNLV 422

>Suva_4.449 Chr4 complement(780822..782096) [1275 bp, 424 aa] {ON}
           YBR195C (REAL)
          Length = 424

 Score =  121 bits (304), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 104/418 (24%), Positives = 185/418 (44%), Gaps = 62/418 (14%)

Query: 10  LSIDDEYDLWKSNVPLMYDFVSETRLLWPSLTIQWLPRAEDST-EQELLVGTHTSDS--E 66
           + + + Y  WK N  L+YD+++     WPSLT Q+ P  + +  E  +L+ + TS    E
Sbjct: 17  IDLQERYSHWKKNTKLLYDYLNTNSTKWPSLTCQFFPDLDTTLDEHRILLSSFTSSQKPE 76

Query: 67  QNYLKIAEINLPQEI----LSN-EGPVLQNDNNGSDEQVPSK-IKIIKKFKHENEVTRAR 120
              + I++I+    I    L+N +   ++     +    PS  +  I  F    +  RAR
Sbjct: 77  DETIYISKISTLGHIKWSSLNNFDMDEMEFKPENTTRLPPSHLVNDISIFFPNGDCNRAR 136

Query: 121 YAPFDSNLIATISGTGTVFLYDRTKDDENALRGKYAYHK--------------------- 159
           Y P + ++IA  S  G ++++DRTK     +R     H                      
Sbjct: 137 YLPQNPDIIAGASSDGAIYIFDRTKHGSTRIRQSKNSHPFEAKLFGSHGVIQDVEAMDTS 196

Query: 160 ----ENGYGLNFSVASPGELISCSDDGSIAIWDIKS----GKTVPTSVNSLHSDI--VNE 209
                    L +++     L+S   +G + IWDIK        + + + S+ SD   VN+
Sbjct: 197 SADVNEATSLAWNLQQEALLLSSHSNGQVQIWDIKQYSHENPLIDSPLVSIESDASGVND 256

Query: 210 CKWHESDPNIYGSVSEDSFLMIHDKRSEKPLQKLLQKEP-----FNTIAFSKHSSNLFAA 264
             W  +  +++ + +E + + + D R++K  +KL           N+  F+  +S + A+
Sbjct: 257 VTWMPTHDSLFAACTEGNVVSLLDLRTKK--EKLRSNRQNHTGGVNSCKFNYRNSLVLAS 314

Query: 265 AGTDAMVYLFDSRKPTEALHSMSGHQEAVTSLEFAHHKDGILCSGGS-DRRVLLWDLFQI 323
           A ++  + L+D RK  E+  +   H  ++++LE+  +   +L + G  D  V LWD  + 
Sbjct: 315 ADSNGRLNLWDIRKMNESPITTMEHGASISTLEWNPNFSTVLATAGQQDGLVKLWDTAR- 373

Query: 324 GTEQQEEDADDGGPELLMMHAGHKSAINDFSFSPNVPWLMASVEEENIVQIWKPSRKL 381
                         E +  H GH   +ND S+  + PWLM SV  +N V IWKP+  L
Sbjct: 374 -------------EETIFTHGGHMLGVNDVSWDVHDPWLMCSVANDNSVHIWKPAENL 418

>NCAS0B02170 Chr2 complement(354274..355518) [1245 bp, 414 aa] {ON}
           Anc_8.548
          Length = 414

 Score =  119 bits (297), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 110/425 (25%), Positives = 191/425 (44%), Gaps = 68/425 (16%)

Query: 2   QSTEPERELSIDDEYDLWKSNVPLMYDFVSETRLLWPSLTIQWLPRAEDSTE-QELLVGT 60
           QS+ PE    +   Y  WK N  L+YD+++     WPSLT Q+    + +++   +L+  
Sbjct: 11  QSSIPE---DLQQRYSNWKKNTRLLYDYLNTNSKKWPSLTCQFFHDLDTTSDTHRILLSA 67

Query: 61  HTSDS--EQNYLKIAEINLPQEILSNEGPVLQNDNNGSDEQVP-SKIKIIKKFKHENEVT 117
            TS    E   + IA+++  + +   E   + N +    E  P + IK+  K    +   
Sbjct: 68  FTSSQLPEDEAIYIAKLSTLKHL---EWASINNFDMDEMEFKPENNIKLPSKNLTNDISI 124

Query: 118 R--------ARYAPFDSNLIATISGTGTVFLYDRTKDDENALRG---------------K 154
           R        ARY P + ++IA  S  G+++++DRTK     +R                K
Sbjct: 125 RFPDGDCNIARYLPQNPDVIAGASSHGSIYIFDRTKHGSLRMRQSKNLKPYEAALYCPPK 184

Query: 155 YAYHKEN---GYGLNFSVASPGELISCSDDGSIAIWDIK--SGKTVPTSVNSLHSDI--- 206
              + EN      +++++   G L SC   G I +WD+K  S   +      L+ D    
Sbjct: 185 GIENVENTNEATSISWNLQREGLLASCYSSGQIQLWDLKKYSNSKLEMDTPLLNVDFDAL 244

Query: 207 -VNECKWHESDPNIYGSVSEDSFLMIHDKRSEKPLQK---LLQKEPFNTIAFSKHSSNLF 262
            VN+  WH S  +I  +  E + + + D R    + +    +     N+  F+ H  +L 
Sbjct: 245 GVNDVNWHPSHDSILAASGESNIIGLFDNRLGTEILRSNEKMHNGGINSCKFNSHCDSLL 304

Query: 263 AAAGTDAMVYLFDSRK----PTEALHSMSGHQEAVTSLEFAHHKDGILCSGGSDRRVL-L 317
            +  ++  + L+D RK    P + LH    H  ++++LE+  + + I+ S G D  ++ L
Sbjct: 305 ISGDSEGRINLWDLRKLDGEPIKTLH----HGSSISTLEWNPNLETIVASAGQDDGLVKL 360

Query: 318 WDLFQIGTEQQEEDADDGGPELLMMHAGHKSAINDFSFSPNVPWLMASVEEENIVQIWKP 377
           WD   + T+           EL+  H GH   +ND S++ +  WLM SV  +N VQ+WKP
Sbjct: 361 WD---VSTD-----------ELVFTHGGHMLGVNDISWNLHDTWLMCSVSNDNSVQVWKP 406

Query: 378 SRKLT 382
           +  L 
Sbjct: 407 AHNLV 411

>Smik_2.335 Chr2 complement(596903..598171) [1269 bp, 422 aa] {ON}
           YBR195C (REAL)
          Length = 422

 Score =  118 bits (295), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 102/416 (24%), Positives = 184/416 (44%), Gaps = 58/416 (13%)

Query: 11  SIDDEYDLWKSNVPLMYDFVSETRLLWPSLTIQWLPRAEDST-EQELLVGTHTSDS--EQ 67
           ++ + Y  WK N  L+Y++++     WPSLT Q+ P  + +  E  +L+ + TS    E 
Sbjct: 18  NLQERYSHWKKNTKLLYEYLNTNSTKWPSLTCQFFPDLDTTLDEHRILLSSFTSSQKPED 77

Query: 68  NYLKIAEINLPQEI----LSNEGPVLQNDNNGSDEQVPSK--IKIIKKFKHENEVTRARY 121
             + I++I+    I    L+N           +  + P K  +  I  F    E  RARY
Sbjct: 78  ESIYISKISTLGHIKWSSLNNFDMDEMEFKPENSTRYPPKHLVNDISIFFPNGECNRARY 137

Query: 122 APFDSNLIATISGTGTVFLYDRTKDDENALRGKYAYHK---------------------- 159
            P + ++IA  S  G ++++DRTK     +R     H                       
Sbjct: 138 LPQNPDIIAGASSDGAIYIFDRTKHGSTRIRQSKISHPFEAKLFGSHGVIQDVETMDASS 197

Query: 160 ---ENGYGLNFSVASPGELISCSDDGSIAIWDIKS----GKTVPTSVNSLHSDI--VNEC 210
                   + +++     L+S   +G + +WDIK        +   + S++SD   VN+ 
Sbjct: 198 ADINEATSIAWNLQQEALLLSSHSNGQVQVWDIKQYSHENPIIDLPLVSINSDGSGVNDV 257

Query: 211 KWHESDPNIYGSVSEDSFLMIHDKRSEKPLQKLLQKE---PFNTIAFSKHSSNLFAAAGT 267
            W  +  +++ + +E + + + D R++K   K   +      N+  F+  +S + A+A +
Sbjct: 258 TWMPTHDSLFAACTEGNTVSLLDLRTKKEKLKSNCRSHNGGVNSCKFNYRNSLILASADS 317

Query: 268 DAMVYLFDSRKPTEALHSMSGHQEAVTSLEFAHHKDGILCSGGS-DRRVLLWDLFQIGTE 326
           +  + L+D R   +   +   H  +V++LE++ + D +L + G  D  V LWD     T 
Sbjct: 318 NGKLNLWDIRNMNDCPLTTMEHGGSVSTLEWSPNFDTVLATAGQEDGLVKLWD-----TS 372

Query: 327 QQEEDADDGGPELLMMHAGHKSAINDFSFSPNVPWLMASVEEENIVQIWKPSRKLT 382
           ++E          +  H GH   +ND S+  + PWLM SV  +N V IWKP+  L 
Sbjct: 373 REEN---------IFTHGGHMLGVNDISWDAHDPWLMCSVANDNSVHIWKPAVNLV 419

>CAGL0M05291g Chr13 complement(566250..567509) [1260 bp, 419 aa]
           {ON} similar to uniprot|P13712 Saccharomyces cerevisiae
           YBR195c MSI1
          Length = 419

 Score =  118 bits (295), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 109/418 (26%), Positives = 191/418 (45%), Gaps = 55/418 (13%)

Query: 3   STEPERELSIDDEYDLWKSNVPLMYDFVSETRLLWPSLTIQWLPRAEDSTEQ-ELLVGTH 61
           ST PE    +   Y  WK N  L+YD+++     WPSLT Q+ P  + S++Q  LL+ + 
Sbjct: 15  STIPE---DVQTRYIHWKKNTKLLYDYLNTNSTKWPSLTCQFFPDLDTSSDQHRLLLSSF 71

Query: 62  TSDS--EQNYLKIAEINLPQEI----LSN-EGPVLQNDNNGSDEQVPSKIKIIKKFKHEN 114
           TS    E   + I++I+  + +    L+N +   ++   + S +  P  +      +  N
Sbjct: 72  TSSQLPEDESVYISKISTLKHLNWSSLNNFDMDEMEFKPDPSVKLPPKNLTTEVSIRFPN 131

Query: 115 -EVTRARYAPFDSNLIATISGTGTVFLYDRTKDDENALRGKYA-----------YHKENG 162
            +  R+RY P + +LIA  S  G+V+++++TK   + LR K +           +  +N 
Sbjct: 132 GDCNRSRYLPQNPDLIAAASSDGSVYIFNKTKHGNSVLRSKSSDDFQARLFSGSHDAQNL 191

Query: 163 YGLNFSVA------SPGELISCSDDGSIAIWDIKSGK------TVPTSVNSLHSDIVNEC 210
              N +V+        G L      G   IWD+K         + P    +  S+  N+ 
Sbjct: 192 DNFNEAVSLSWNKHKEGILGVSYSQGQCNIWDVKKFSRSNILISQPELTVTFDSNGCNDL 251

Query: 211 KWHESDPNIYGSVSEDSFLMIHDKR--SEKPLQKL---LQKEPFNTIAFSKHSSNLFAAA 265
            W     +++ +  E + L + D R   EK +  +     ++  NT  F+  +S L A+A
Sbjct: 252 DWMPMHDSMFIACGESNKLGLFDMRLNGEKEVNSISNYKHEDGINTCKFNPGNSLLVASA 311

Query: 266 GTDAMVYLFDSRKPTEALHSMSGHQEAVTSLEFAHHKDGILCSGGS-DRRVLLWDLFQIG 324
            T   + L+D RK  +   S   H  +++++E+  +   +  S G  D  V LWD   +G
Sbjct: 312 DTCGRINLWDIRKLDQEPISTMQHGSSISTIEWNPNIGVVFASAGQEDGLVKLWDA-SVG 370

Query: 325 TEQQEEDADDGGPELLMMHAGHKSAINDFSFSPNVPWLMASVEEENIVQIWKPSRKLT 382
            E             + +H GH   +ND S+  + PWLMASV  +N +QIW+P++ + 
Sbjct: 371 KE-------------IFVHGGHMLGVNDISWDMHDPWLMASVSNDNTIQIWRPAKNIV 415

>KAFR0I00840 Chr9 complement(162878..164119) [1242 bp, 413 aa] {ON}
           Anc_8.548 YBR195C
          Length = 413

 Score =  117 bits (294), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 104/411 (25%), Positives = 189/411 (45%), Gaps = 59/411 (14%)

Query: 12  IDDEYDLWKSNVPLMYDFVSETRLLWPSLTIQWLPRAEDSTE-QELLVGTHTSDS--EQN 68
           + + Y  WK N  L+Y +++     WPSLT Q+ P  + +T+   +L+ T TS    E  
Sbjct: 16  LQERYSRWKKNTKLLYSYLNTNTSKWPSLTCQFFPDLDTTTDTHRILLSTFTSSQLPEDE 75

Query: 69  YLKIAEINLPQEI----LSN---EGPVLQNDNNGSDEQVPSK---IKIIKKFKHENEVTR 118
            L IA ++    +    L+N   +    + DN+    + PSK   + I   F +  +  R
Sbjct: 76  SLYIANLSTSNHLNWSSLNNFDMDEMEFKPDNS---TKFPSKNLNVDISIPFPN-GDCNR 131

Query: 119 ARYAPFDSNLIATISGTGTVFLYDRTKDDENALRGK--------YAYHK--EN------G 162
           ARY P + +L+A  S  G++++++RTK     L           Y+  K  EN       
Sbjct: 132 ARYLPQNPDLLAAASSNGSIYIFNRTKHGSRRLNSNQRSFEARLYSTDKMDENFTNSNEA 191

Query: 163 YGLNFSVASPGELISCSDDGSIAIWDI-KSGKTVPTSVNS-----LHSDIVNECKWHESD 216
             + +++   G L S    GSI IWDI K   + PT   +        +  NE  W  + 
Sbjct: 192 VSIAWNLQKNGTLASSYSQGSIKIWDITKYSCSDPTLRENELTIPFDPEGCNEVTWMVNH 251

Query: 217 PNIYGSVSEDSFLMIHDKRSEKPLQKLLQK-----EPFNTIAFSKHSSNLFAAAGTDAMV 271
            +I+ + SE + L + D R+++ + K+ +         N+  F+ ++  L A+A +   +
Sbjct: 252 DSIFAACSESNKLSLFDVRTKEEMLKMTENIGTHSGGINSCKFNYYNDMLLASADSTGKI 311

Query: 272 YLFDSRKPTEALHSMSGHQEAVTSLEFAHHKDGILCSGGSDRRVL-LWDLFQIGTEQQEE 330
            ++D RK  +       H  ++++LE+  + + IL + G D  ++ +WD           
Sbjct: 312 NMWDIRKLDKEPIKSFNHNSSISTLEWNPNLETILVTAGQDDGLVKIWDT---------- 361

Query: 331 DADDGGPELLMMHAGHKSAINDFSFSPNVPWLMASVEEENIVQIWKPSRKL 381
                  + + +H GH   +ND S+  + PWL++SV  +N + +WKP+  L
Sbjct: 362 ----ANGQNIFVHGGHMLGVNDVSWDLHDPWLLSSVSNDNSIHVWKPATNL 408

>KNAG0A03670 Chr1 complement(472849..474129) [1281 bp, 426 aa] {ON}
           Anc_8.548 YBR195C
          Length = 426

 Score =  117 bits (294), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 104/419 (24%), Positives = 180/419 (42%), Gaps = 69/419 (16%)

Query: 15  EYDLWKSNVPLMYDFVSETRLLWPSLTIQWLPRAEDSTE-QELLVGTHTSDS--EQNYLK 71
            Y  WK N  L+YD+++     WPSLT Q+ P  + +T+   +L+ ++TS    E   + 
Sbjct: 18  RYAYWKKNTKLLYDYLNTNTAKWPSLTCQFFPDVDANTDTHRILLSSYTSCQLPEDENVY 77

Query: 72  IAEINLPQEILSNEGPVLQNDNNGSDEQVPSKIKIIKKFKHENEVT------------RA 119
           +A I+    +   +   L N +    E  P +     KF  +N  T            RA
Sbjct: 78  VASISTLAHL---DWASLNNFDMDEMEFKPDRTT---KFPPKNLATNVSITFPRGDCNRA 131

Query: 120 RYAPFDSNLIATISGTGTVFLYDRTKDDENALRGKYAYHKENGYG--------------- 164
           RY P + ++IA  S  G V++++RTK     ++   A   E  YG               
Sbjct: 132 RYMPQNPDVIAAASSNGAVYVFNRTKHGTRRIQKHAASDAEQDYGPYEARFYNEETDEAR 191

Query: 165 ----------LNFSVASPGELISCSDDGSIAIWDIKSGKTVPTSVN-------SLHSDIV 207
                     L ++    G L      G++ +WD++      T+++       +  S  V
Sbjct: 192 RTPVDNEAVSLAWNHHREGTLAVAYSHGAVKVWDLQRFNVDNTTISETEWECSNFDSRGV 251

Query: 208 NECKWHESDPNIYGSVSEDS-FLMIHDKRSEKPLQKL---LQKEPFNTIAFSKHSSNLFA 263
           N+  W     +I  +  E S  L + D R++  + K+    + E  N   F+  ++ L A
Sbjct: 252 NDVSWMSQHDSILAACGERSDSLALFDTRAQNAVAKIRNQFKSEGINACKFNWENNLLLA 311

Query: 264 AAGTDAMVYLFDSRKPTEALHSMSGHQEAVTSLEFAHHKDGILCSGG-SDRRVLLWDLFQ 322
           +  +     L+D RK +        H  +V++LE+  H   +L + G SD  + +WD   
Sbjct: 312 STDSTGRTNLWDVRKLSAEPIVHFDHGGSVSTLEWNPHDHSVLATAGQSDGLIKIWD--- 368

Query: 323 IGTEQQEEDADDGGPELLMMHAGHKSAINDFSFSPNVPWLMASVEEENIVQIWKPSRKL 381
             T  + ED      + + +H+GH   +ND ++  + PWLM SV  +N V +WKP+  L
Sbjct: 369 --TSLEIED------KTIFVHSGHMLGVNDIAWDLHDPWLMCSVSNDNSVHVWKPAANL 419

>Kpol_1060.24 s1060 complement(61507..62967) [1461 bp, 486 aa] {ON}
           complement(61507..62967) [1461 nt, 487 aa]
          Length = 486

 Score = 75.1 bits (183), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 84/322 (26%), Positives = 139/322 (43%), Gaps = 53/322 (16%)

Query: 25  LMYDFVSETRLLWPSLTIQWLPRAEDSTEQELLVGTHTSDSEQNYLKIAEINLPQEILS- 83
           L +D V+E  +++P   IQWLP    S +Q     T +SDS    L+I  +N     L+ 
Sbjct: 142 LSWDKVAEHNIIYPVSNIQWLP----SVQQPRKFAT-SSDS----LRIWSLNEEDSSLTE 192

Query: 84  --NEGPVLQNDNNGS-DEQVPSKIKIIKKFKHENEVTRARYAPFDSNLIATISGTGTVFL 140
             N      ND + S  +   S   I+ +F     VT   + P D+NL+ + S   T  +
Sbjct: 193 QVNLSLCKYNDQHHSLSKNTTSSSDILGQFP---PVTSFHWNPIDTNLLISSSIDTTCIV 249

Query: 141 YDRTKDDENALRGKYAYHKENGYGLNFSVASPGELISCSDDGSIAIWDIKSGKTVPTSVN 200
           +D      N +R +   H    + + F   S     SC  DGS+ ++D++S         
Sbjct: 250 WDL--QSSNYVRTQLIAHDSEVFDVKFLAHSTQLFASCGGDGSVRVFDLRSLA------- 300

Query: 201 SLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDKRSEKPLQKLLQKEPFNTIAFSKHSSN 260
             HS I+ E     SD N   +++++          EK    LL+ +P      S    N
Sbjct: 301 --HSTIIYE---SNSDQNGSDTLTDN----------EKSPSALLRLQP------SPSDPN 339

Query: 261 LFAAAGTDAM-VYLFDSRKPTEALHSMSGHQEAVTSLEFAHHKDGILCSGGSDRRVLLWD 319
           + A    D+  + + D R P   + ++ GH  AV  +++   K  +L S G D +VL WD
Sbjct: 340 VMATFALDSKSILILDMRNPGSPVLTLEGHSAAVNQIKWHPKKSNVLLSCGDDCQVLYWD 399

Query: 320 LFQ------IGTEQQEEDADDG 335
           L +      +   + + +A+DG
Sbjct: 400 LNEWLSPTSLSANENKVNANDG 421

>Smik_4.45 Chr4 (85422..89234) [3813 bp, 1270 aa] {ON} YDL195W
           (REAL)
          Length = 1270

 Score = 70.5 bits (171), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 53/214 (24%), Positives = 98/214 (45%), Gaps = 19/214 (8%)

Query: 125 DSNLIATISGTGTVFLYDRTK-DDENALRGKYAYHKENGYGLNFSVASPGELISCSDDGS 183
           ++ +IA     G++ LY   + +D  +   K++ H  +   + F+      L S  ++G 
Sbjct: 73  NNKIIAGALDNGSLELYSTNEVNDAISSMAKFSNHSSSVKTVKFNAKQDNVLASGGNNGE 132

Query: 184 IAIWDIKSGKTVPTSVNSLHS-------DIVNECKWHESDPNIYGSVSEDSFLMIHDKRS 236
           I IWD+      P +   L         D VN   W++S  +++ S    +F  I D ++
Sbjct: 133 IFIWDMNKCTESPANYTPLTPGQSMSSVDEVNSLAWNQSLAHVFASAGSSNFASIWDLKA 192

Query: 237 EKPLQKLLQKEPFNTIA--------FSKHSSNLFAAAGTD--AMVYLFDSRKPTEALHSM 286
           +K +  L    P + I           K+S+ +  A G+D    + ++D R     L ++
Sbjct: 193 KKEVIHLCYTSPNSGIKQQLSVVEWHPKNSTRVATATGSDNDPSILVWDLRNANTPLQTL 252

Query: 287 S-GHQEAVTSLEFAHHKDGILCSGGSDRRVLLWD 319
           + GHQ+ + SL++ H  + +L S G D  VLLW+
Sbjct: 253 NQGHQKGILSLDWCHQDENLLLSSGRDNTVLLWN 286

>Suva_4.53 Chr4 (95619..99434) [3816 bp, 1271 aa] {ON} YDL195W
           (REAL)
          Length = 1271

 Score = 69.7 bits (169), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 57/211 (27%), Positives = 95/211 (45%), Gaps = 22/211 (10%)

Query: 131 TISGT---GTVFLYD-RTKDDENALRGKYAYHKENGYGLNFSVASPGELISCSDDGSIAI 186
           TI+G    GT+ LY      D      K++ H  +   + F+      L S  ++G I I
Sbjct: 76  TIAGALDNGTLELYSIGDAHDTIVSTAKFSNHSSSVKTVKFNSKQDNVLASGGNNGEIFI 135

Query: 187 WDIKSGKTVPTSVNSLHS-------DIVNECKWHESDPNIYGSVSEDSFLMIHDKRSEKP 239
           WD+      P+S   L         D VN   W++S  +++ S    +F  I D +++K 
Sbjct: 136 WDMNKCTESPSSYTPLTPGQSMSSVDEVNSLAWNQSLAHVFASAGSSNFASIWDLKAKKE 195

Query: 240 LQKLLQKEPFNTIA--------FSKHSSNLFAAAGTD--AMVYLFDSRKPTEALHSMS-G 288
           +  L    P + I           K+S+ +  A G+D    + ++D R     L ++S G
Sbjct: 196 VIHLSYTSPNSGIKQQLSVVEWHPKNSTRVATATGSDNDPSILVWDLRNANTPLQTLSQG 255

Query: 289 HQEAVTSLEFAHHKDGILCSGGSDRRVLLWD 319
           HQ+ + SL++ H  + +L S G D  VLLW+
Sbjct: 256 HQKGILSLDWCHQDENLLLSSGRDNTVLLWN 286

>Suva_13.311 Chr13 complement(511812..513344) [1533 bp, 510 aa] {ON}
           YMR131C (REAL)
          Length = 510

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 88/412 (21%), Positives = 167/412 (40%), Gaps = 78/412 (18%)

Query: 24  PLMYDFVSETRLLWPSLTIQWLPRAEDSTE----QELLVGTHTSDS---EQNYLKIAEIN 76
           P +Y+ +    + WP LT+  +P    +      Q +L+ T T  S   E   + +A  N
Sbjct: 114 PTVYEMLHNVNMPWPCLTLDVIPDTLGTERRNYPQSILLTTATQSSRKKENELMVLALSN 173

Query: 77  LPQEILSNEG--------------PVLQNDNNGSDEQVPSKIKIIKKFKHENEVTRARYA 122
           L + +L ++               PV++N+N      +P +          +   R + +
Sbjct: 174 LTKTLLKDDNEEDDEEGEDEEDVDPVIENEN------IPLR----------DTTNRLKVS 217

Query: 123 PFDSN----LIATISGTGTVFLYDRTKDDENALRGKYAYHKE--------------NGYG 164
           PF  +    L AT+S  G V++YD     +      Y   K                GYG
Sbjct: 218 PFAVSNQEVLTATMSENGDVYIYDLAAQSKAFSTPGYQIPKSAKRPIHTVKNHGNVEGYG 277

Query: 165 LNFS-VASPGELISCSDDGSIAIWDIKSGKTV--PTSVNSLHSDIVNECKWHESDPNIYG 221
           L++S +   G L+S    G I +    + + V    S    +++ + + +W  ++  ++ 
Sbjct: 278 LDWSPLIKTGALLSGDCSGQIYLTQRHTSRWVTDKQSFTVSNNESIEDIQWSRTESTVFA 337

Query: 222 SVSEDSFLMIHDKRSEKPLQKLLQKEP---FNTIAFSKHSSNLFAAAGTDAMVYLFDSRK 278
           + + D ++ I D RS+K    +  K      N I++S     L A+   +    ++D R+
Sbjct: 338 TAACDGYIRIWDTRSKKHKPAISVKASNTDVNVISWSDKIGYLLASGDDNGTWGVWDLRQ 397

Query: 279 PT-------EALHSMSGHQEAVTSLEFAHHKDGILCSGGSDRRVLLWDL-FQIGTEQQEE 330
            T       + +     H+ A+TS+ F    + I+  G  D  V LWDL  +   E+ ++
Sbjct: 398 FTPSNADTVQPVAQYDFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVEADDEEIKQ 457

Query: 331 DA------DDGGPELLMMHAGHKSAINDFSFSPNVPWLMASVEEENIVQIWK 376
            A       D  P+LL +H   +  + D  +   +P  + S   + +  +WK
Sbjct: 458 QAAETKELQDIPPQLLFVH--WQREVKDVKWHKQIPGCLVSTGTDGL-NVWK 506

>Skud_4.63 Chr4 (104587..108408) [3822 bp, 1273 aa] {ON} YDL195W
           (REAL)
          Length = 1273

 Score = 67.0 bits (162), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 52/211 (24%), Positives = 95/211 (45%), Gaps = 19/211 (9%)

Query: 128 LIATISGTGTVFLYDRTK-DDENALRGKYAYHKENGYGLNFSVASPGELISCSDDGSIAI 186
           +IA     GT+ LY   + +D  +   K+  H  +   + F+      L S  ++G I I
Sbjct: 76  IIAGALDNGTLELYSTNEANDTISSTAKFGSHSSSVKTVKFNARQDNVLASGGNNGEIFI 135

Query: 187 WDIKSGKTVPTSVNSLHS-------DIVNECKWHESDPNIYGSVSEDSFLMIHDKRSEKP 239
           WD+      P++   L         D VN   W++S  +++ S    +F  I D +++K 
Sbjct: 136 WDMNKCTESPSTYTPLTPGQSMSSVDEVNSLAWNQSLAHVFASAGSSNFASIWDLKAKKE 195

Query: 240 LQKLLQKEPFNTIA--------FSKHSSNLFAAAGTD--AMVYLFDSRKPTEALHSMS-G 288
           +  L    P + I           K+S+ +  A G+D    + ++D R     + +++ G
Sbjct: 196 VIHLSYTSPSSGIKQQLSVVEWHPKNSTRVATATGSDNDPSILVWDLRNANTPMQTLNQG 255

Query: 289 HQEAVTSLEFAHHKDGILCSGGSDRRVLLWD 319
           HQ+ + SL++    + +L S G D  VLLW+
Sbjct: 256 HQKGILSLDWCDQDENLLLSSGRDNTVLLWN 286

 Score = 35.0 bits (79), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 26/110 (23%), Positives = 52/110 (47%), Gaps = 10/110 (9%)

Query: 180 DDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDKRSEKP 239
           +D SI +WD+++  T   ++N  H   +    W + D N+  S   D+ +++ +  S + 
Sbjct: 233 NDPSILVWDLRNANTPMQTLNQGHQKGILSLDWCDQDENLLLSSGRDNTVLLWNPESAEQ 292

Query: 240 LQKLLQKE--PFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMS 287
           L +   +    F T  F+  + +LFA A        FD+R   + L +++
Sbjct: 293 LSQFPARGNWCFKT-KFAPEAPDLFACAS-------FDNRIEVQTLQNLT 334

>YDL195W Chr4 (107208..111029) [3822 bp, 1273 aa] {ON}
           SEC31Component of the Sec13p-Sec31p complex of the COPII
           vesicle coat, required for vesicle formation in ER to
           Golgi transport; mutant has increased aneuploidy
           tolerance
          Length = 1273

 Score = 66.2 bits (160), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 53/215 (24%), Positives = 99/215 (46%), Gaps = 21/215 (9%)

Query: 125 DSNLIATISGTGTVFLYDRTKDDENALR--GKYAYHKENGYGLNFSVASPGELISCSDDG 182
           ++ +IA     G++ LY  T +  NA+    +++ H  +   + F+      L S  ++G
Sbjct: 73  NNKIIAGALDNGSLELYS-TNEANNAINSMARFSNHSSSVKTVKFNAKQDNVLASGGNNG 131

Query: 183 SIAIWDIKSGKTVPTSVNSLHS-------DIVNECKWHESDPNIYGSVSEDSFLMIHDKR 235
            I IWD+      P++   L         D V    W++S  +++ S    +F  I D +
Sbjct: 132 EIFIWDMNKCTESPSNYTPLTPGQSMSSVDEVISLAWNQSLAHVFASAGSSNFASIWDLK 191

Query: 236 SEKPLQKLLQKEPFNTIA--------FSKHSSNLFAAAGTD--AMVYLFDSRKPTEALHS 285
           ++K +  L    P + I           K+S+ +  A G+D    + ++D R     L +
Sbjct: 192 AKKEVIHLSYTSPNSGIKQQLSVVEWHPKNSTRVATATGSDNDPSILIWDLRNANTPLQT 251

Query: 286 MS-GHQEAVTSLEFAHHKDGILCSGGSDRRVLLWD 319
           ++ GHQ+ + SL++ H  + +L S G D  VLLW+
Sbjct: 252 LNQGHQKGILSLDWCHQDEHLLLSSGRDNTVLLWN 286

>Skud_13.291 Chr13 complement(506764..508293) [1530 bp, 509 aa] {ON}
           YMR131C (REAL)
          Length = 509

 Score = 65.5 bits (158), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 89/413 (21%), Positives = 170/413 (41%), Gaps = 81/413 (19%)

Query: 24  PLMYDFVSETRLLWPSLTIQWLPRAEDSTE----QELLVGTHTSDS---EQNYLKIAEIN 76
           P +Y+ +    + WP LT+  +P    S      Q +L+ T T  S   E   + +A  N
Sbjct: 114 PSVYEMLHNVNMPWPCLTLDVIPDTLGSERRNYPQSILLATATQSSRKRENELMVLALSN 173

Query: 77  LPQEILSNEG-------------PVLQNDNNGSDEQVPSKIKIIKKFKHENEVTRARYAP 123
           L + +L ++               V++N+N      +P K          +   R + +P
Sbjct: 174 LTKTLLKDDNEEDDDEEEEDDVDAVIENEN------MPLK----------DTTNRLKVSP 217

Query: 124 FDSN----LIATISGTGTVFLYDR--------------TKDDENALRGKYAYHKENGYGL 165
           F ++    L AT+S  G V++YD               +K  +  +    ++    GYGL
Sbjct: 218 FAASNQEVLTATMSENGDVYIYDLAPQSKAFSTPGYQISKSAKRPIHTVKSHGNVEGYGL 277

Query: 166 NFS-VASPGELISCSDDGSIAIWDIKSGKTV----PTSVNSLHSDIVNECKWHESDPNIY 220
           ++S +   G L+S    G I      + + V    P +V++  S  + + +W  ++  ++
Sbjct: 278 DWSPLIKTGALLSGDCSGQIYFTQRHTSRWVTDKQPFTVSNNKS--IEDIQWSRTESTVF 335

Query: 221 GSVSEDSFLMIHDKRSEKPLQKLLQKEP---FNTIAFSKHSSNLFAAAGTDAMVYLFDSR 277
            +   D ++ I D RS+K    +  K      N I++S     L A+   +    ++D R
Sbjct: 336 ATAGCDGYIRIWDTRSKKHKPAISVKASNTDVNVISWSDKIGYLLASGDDNGTWGVWDLR 395

Query: 278 KPT-------EALHSMSGHQEAVTSLEFAHHKDGILCSGGSDRRVLLWDLF------QIG 324
           + T       + +     H+ A+TS+ F    + I+  G  D  V LWDL       +I 
Sbjct: 396 QFTPSNADTVQPVAQYDFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVEADDEEIK 455

Query: 325 TEQQE-EDADDGGPELLMMHAGHKSAINDFSFSPNVPWLMASVEEENIVQIWK 376
            +  E ++  +  P+LL +H   +  + D  +   +P  + S   + +  +WK
Sbjct: 456 QQTAETKELQEIPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDGL-NVWK 505

>YMR131C Chr13 complement(533163..534698) [1536 bp, 511 aa] {ON}
           RRB1Essential nuclear protein involved in early steps of
           ribosome biogenesis; physically interacts with the
           ribosomal protein Rpl3p
          Length = 511

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 92/414 (22%), Positives = 171/414 (41%), Gaps = 82/414 (19%)

Query: 24  PLMYDFVSETRLLWPSLTIQWLPRAEDSTE----QELLVGTHTSDS---EQNYLKIAEIN 76
           P +Y+ +    + WP LT+  +P    S      Q +L+ T T  S   E   + +A  N
Sbjct: 115 PTVYEMLHNVNMPWPCLTLDVIPDTLGSERRNYPQSILLTTATQSSRKKENELMVLALSN 174

Query: 77  LPQEILSNEG--------------PVLQNDNNGSDEQVPSKIKIIKKFKHENEVTRARYA 122
           L + +L ++               PV++N+N      +P +          +   R + +
Sbjct: 175 LAKTLLKDDNEGEDDEEDDEDDVDPVIENEN------IPLR----------DTTNRLKVS 218

Query: 123 PFD-SN---LIATISGTGTVFLYDRTKDDENALRGKYAYHKE--------------NGYG 164
           PF  SN   L AT+S  G V++Y+     +      Y   K                GYG
Sbjct: 219 PFAISNQEVLTATMSENGDVYIYNLAPQSKAFSTPGYQIPKSAKRPIHTVKNHGNVEGYG 278

Query: 165 LNFS-VASPGELISCSDDGSIAIWDIKSGKTV----PTSVNSLHSDIVNECKWHESDPNI 219
           L++S +   G L+S    G I      + + V    P +V++  S  + + +W  ++  +
Sbjct: 279 LDWSPLIKTGALLSGDCSGQIYFTQRHTSRWVTDKQPFTVSNNKS--IEDIQWSRTESTV 336

Query: 220 YGSVSEDSFLMIHDKRSEKPLQKLLQKEP---FNTIAFSKHSSNLFAAAGTDAMVYLFDS 276
           + +   D ++ I D RS+K    +  K      N I++S     L A+   +    ++D 
Sbjct: 337 FATAGCDGYIRIWDTRSKKHKPAISVKASNTDVNVISWSDKIGYLLASGDDNGTWGVWDL 396

Query: 277 RKPT----EALHSMSG---HQEAVTSLEFAHHKDGILCSGGSDRRVLLWDL-FQIGTEQQ 328
           R+ T    +A+  ++    H+ A+TS+ F    + I+  G  D  V LWDL  +   E+ 
Sbjct: 397 RQFTPSNADAVQPVAQYDFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVEADDEEI 456

Query: 329 EEDADDGG------PELLMMHAGHKSAINDFSFSPNVPWLMASVEEENIVQIWK 376
           ++ A +        P+LL +H   +  + D  +   +P  + S   + +  +WK
Sbjct: 457 KQQAAETKELQEIPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDGL-NVWK 507

>CAGL0K03861g Chr11 complement(360277..361818) [1542 bp, 513 aa]
           {ON} highly similar to uniprot|Q04225 Saccharomyces
           cerevisiae YMR131c Ribosome assembly protein
          Length = 513

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 87/411 (21%), Positives = 171/411 (41%), Gaps = 78/411 (18%)

Query: 24  PLMYDFVSETRLLWPSLTIQWLPRAEDSTE----QELLVGTHT--SDSEQNYLKIAEI-N 76
           P +Y+ +    + WP L++  +P    S      Q +L+ T T  S  ++N L +  + N
Sbjct: 119 PTVYEMLHNVNMPWPCLSLDIIPDTLGSERRNYPQSILMTTATQASKKKENELMVLSLSN 178

Query: 77  LPQEILSNEG------------PVLQNDNNGSDEQVPSKIKIIKKFKHENEVTRARYAPF 124
           L + +L +E             P+++N+N                    +   R + +PF
Sbjct: 179 LTKTLLKDEEEEEEEEDDDDVEPIIENEN----------------IALRDTTNRIKVSPF 222

Query: 125 DSN----LIATISGTGTVFLYDRTKDDENALRGKYAYHKEN--------------GYGLN 166
            S     L AT+S  G V+++D     +      Y   K++              GYGL+
Sbjct: 223 ASQSQEVLTATMSENGEVYIFDIGAQAKCFNSPGYQIPKQSKRPVHTIRNHGNVEGYGLD 282

Query: 167 FS-VASPGELISCSDDGSIAIWDIKSGKTV--PTSVNSLHSDIVNECKWHESDPNIYGSV 223
           +S +   G L+S    G I +    + K V    + +  ++  + + +W +++  ++ + 
Sbjct: 283 WSPLIKSGALLSGDCSGQIYLTQRHTSKWVTDKQAYSVGNNKSIEDIQWSKTESTVFATA 342

Query: 224 SEDSFLMIHDKRSEKPLQKLLQKEP---FNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPT 280
             D ++ + D RS+K    +  K      N I++++    L A+   +    ++D R+ T
Sbjct: 343 GCDGYIRVWDTRSKKHKPAISVKASNTDVNVISWNEKIGYLLASGDDNGSWGVWDLRQFT 402

Query: 281 -------EALHSMSGHQEAVTSLEFAHHKDGILCSGGSDRRVLLWDL--------FQIGT 325
                  + +   + H+ A+TS+ F   ++ I+  G  D  V LWDL         +  T
Sbjct: 403 PDNAANIQPVAQYNFHKGAITSIAFNPLEESIVAVGSEDNTVTLWDLSVEADDEEIKQQT 462

Query: 326 EQQEEDADDGGPELLMMHAGHKSAINDFSFSPNVPWLMASVEEENIVQIWK 376
           E+ +E   +  P+LL +H   +  I D  +   +P  + S   + +  IWK
Sbjct: 463 EETKE-LKEIPPQLLFVH--WQKEIKDVKWHKQIPGCLVSTGTDGL-NIWK 509

>TPHA0D03590 Chr4 (752790..754586) [1797 bp, 598 aa] {ON} Anc_6.276
           YPL247C
          Length = 598

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 74/331 (22%), Positives = 132/331 (39%), Gaps = 63/331 (19%)

Query: 21  SNVPLMYDFVSETRLLWPSLTIQWLPRA-------------------EDSTEQELLVGTH 61
           SN  L ++ V+E  + +P   IQWLP                     ++S +   +   +
Sbjct: 190 SNDLLTWEKVAECNVTYPVSNIQWLPSVPNPRKLATSSECLRIWSLDDNSMDNSSVFNNN 249

Query: 62  TSD-----------SEQNYLKIAEINLPQEILSNEGPVLQNDNNGSDEQVPSKIKIIKKF 110
            S+           +EQ  L + + N   +I++N    + N +N          +++ + 
Sbjct: 250 ISNNSRHNTYKKSLTEQVNLSLCKYNEQHQIINNSTNSVSNKSNA---------RLLGQL 300

Query: 111 KHENEVTRARYAPFDSNLIATISGTGTVFLYDRTKDDENALRGKYAYHKENGYGLNFSVA 170
                VT   +   D+NL+ + S   T  ++D      N ++ +   H    + + F + 
Sbjct: 301 P---PVTSFHWNSIDTNLLISSSIDTTCIVWDLQS--SNYVKTQLIAHDSEVFDVKFLIQ 355

Query: 171 SPGELISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLM 230
           S     SC  DGSI ++D+++ +         HS I+ E     +D     + + D    
Sbjct: 356 STQLFASCGGDGSIRVFDLRALQ---------HSTIIYETA---NDLQGNNTFNNDVTTK 403

Query: 231 IHDKRSEKPLQKLLQKEPFNTIAFSKHSSNLFAAAGTDA-MVYLFDSRKPTEALHSMSGH 289
           I +  +      LL+ EP      S    NL A  G D   + + D R P   +  +SGH
Sbjct: 404 IDNSSANSLSHALLRLEP------SPTDPNLIATFGLDKKAILILDMRNPGVPVLVLSGH 457

Query: 290 QEAVTSLEFAHHKDGILCSGGSDRRVLLWDL 320
             +V  +++   K  +L S G D +VL WDL
Sbjct: 458 SPSVNQIKWHPSKPYVLLSCGDDCQVLYWDL 488

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 39/152 (25%), Positives = 67/152 (44%), Gaps = 25/152 (16%)

Query: 110 FKHENEVTRARYAPFDSNLIATISGTGTVFLYDRTK--------DDENALRGKYAYHKEN 161
             H++EV   ++    + L A+  G G++ ++D           +  N L+G   ++ + 
Sbjct: 341 IAHDSEVFDVKFLIQSTQLFASCGGDGSIRVFDLRALQHSTIIYETANDLQGNNTFNNDV 400

Query: 162 GYGLNFSVA------------SPGE--LISCS--DDGSIAIWDIKSGKTVPTSVNSLHSD 205
              ++ S A            SP +  LI+    D  +I I D+++   VP  V S HS 
Sbjct: 401 TTKIDNSSANSLSHALLRLEPSPTDPNLIATFGLDKKAILILDMRN-PGVPVLVLSGHSP 459

Query: 206 IVNECKWHESDPNIYGSVSEDSFLMIHDKRSE 237
            VN+ KWH S P +  S  +D  ++  D  SE
Sbjct: 460 SVNQIKWHPSKPYVLLSCGDDCQVLYWDLNSE 491

>KAFR0A00380 Chr1 (70400..71950) [1551 bp, 516 aa] {ON} Anc_2.401
           YMR131C
          Length = 516

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 88/399 (22%), Positives = 163/399 (40%), Gaps = 51/399 (12%)

Query: 24  PLMYDFVSETRLLWPSLTIQWLPRAEDSTE----QELLVGTHT--SDSEQNYLKIAEINL 77
           P +YD +    + WP LT+  +P    S      Q LL+ T T  S  ++N L +  ++ 
Sbjct: 119 PTVYDMLHNVTMPWPCLTLDIIPDNLGSQRRNYPQSLLMTTATQASRKKENELMVLSLSQ 178

Query: 78  PQEILSNEGPVLQNDNNGSDEQVPSKIKIIKKFKHENEVTRARYAPFDSN----LIATIS 133
             + L  +   + +D    D      I   +     +   R R +PF  +    L AT+S
Sbjct: 179 LAKTLVKDDDEVNSDEEDEDRDETDPIIENENISLRDTTNRLRVSPFAQSNKEVLTATMS 238

Query: 134 GTGTVFLYDRTKDDENALRGKYAYHKEN--------------GYGLNFS-VASPGELISC 178
             G V+++D     +      Y   K +              GY L++S +   G L++ 
Sbjct: 239 ENGEVYIFDLGPQSKAFSSPGYQVPKSSKRPVHTIKNHGNVEGYALDWSPLIKTGALLTG 298

Query: 179 SDDGSIAIWDIKSGKTV----PTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDK 234
              G I +    + K V    P +V +  S  V + +W  ++  ++ S   D ++ I D 
Sbjct: 299 DCSGQIYLTQRNTSKWVTDKQPFTVGNNKS--VEDIQWSRTEATVFASCGCDGYVRIWDT 356

Query: 235 RSEKPLQKLLQKEP---FNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPT-------EALH 284
           RS++    L  K      N I++++    L A+   +    ++D R+ T       + + 
Sbjct: 357 RSKQHKPALSVKASNTDVNVISWNEKIGYLLASGDDNGSWGVWDLRQFTPDNINNVQPVA 416

Query: 285 SMSGHQEAVTSLEFAHHKDGILCSGGSDRRVLLWDL-FQIGTEQQEEDADDGG------P 337
               H+ A+TS+ F   ++ I+     D  V LWDL  +   E+ ++ A +        P
Sbjct: 417 QYDFHKGAITSISFNPLEESIIAVASEDNTVTLWDLSVEADDEEIKQQAAETKELESIPP 476

Query: 338 ELLMMHAGHKSAINDFSFSPNVPWLMASVEEENIVQIWK 376
           +LL +H   +  + D  +   +P  + S   + +  IWK
Sbjct: 477 QLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDGL-NIWK 512

>Kwal_33.15136 s33 (974095..975516) [1422 bp, 473 aa] {ON} YLL011W
           (SOF1) - 56 kDa nucleolar snRNP protein that shows
           homology to beta subunits of G-proteins and the splicing
           factor Prp4 [contig 94] FULL
          Length = 473

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 37/137 (27%), Positives = 73/137 (53%), Gaps = 3/137 (2%)

Query: 184 IAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDKRSEKPLQKL 243
           I +WD  S ++ P +  S  +D V+  K+++++ +I+ S   D+ ++++D R+  P QK 
Sbjct: 196 INLWD--STRSRPITNLSWGADNVSTVKFNQNETDIFASAGSDNSVVLYDLRTNSPTQKF 253

Query: 244 LQKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEAVTSLEFAHHKD 303
           +QK   N + ++   +  F  A  D   Y +D R  + ALH    H  AV  ++F+   D
Sbjct: 254 VQKMRTNALCWNPMEAYNFVVANEDHNAYYYDMRNLSRALHVFKDHVSAVMDVDFSPTGD 313

Query: 304 GILCSGGSDRRVLLWDL 320
            I+ +G  D+ + ++ +
Sbjct: 314 EIV-TGSYDKTIRIYQV 329

>NCAS0G01120 Chr7 complement(199561..201045) [1485 bp, 494 aa] {ON}
           Anc_6.276
          Length = 494

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 52/206 (25%), Positives = 83/206 (40%), Gaps = 37/206 (17%)

Query: 116 VTRARYAPFDSNLIATISGTGTVFLYDRTKDDENALRGKYAYHKENGYGLNFSVASPGEL 175
           +T   + P D+NL+ + S   T  ++D      N ++ +   H    Y + F   S    
Sbjct: 235 ITSFHWNPIDTNLLISSSIDTTCIVWDL--QSSNYVKTQLIAHDSEVYDVRFLTQSTQLF 292

Query: 176 ISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDKR 235
            SC  DGS+ ++D++S           HS I+ E                     + D  
Sbjct: 293 ASCGGDGSVRVFDLRSLA---------HSTIIYEPP-------------------VSDLN 324

Query: 236 SEKPLQKLLQKEPFNTIAFSKHSSNLFAAAGTDA-MVYLFDSRKPTEALHSMSGHQEAVT 294
            +     LL+ EP      S H  N+ A    D+  + + D R P   L  + GH  +V 
Sbjct: 325 PDTSQFALLRLEP------SPHDPNVMATFAADSNKILILDMRNPESPLMILEGHSASVN 378

Query: 295 SLEFAHHKDGILCSGGSDRRVLLWDL 320
            +++   K  +L SGG D +VL WDL
Sbjct: 379 QIKWHPIKRNVLLSGGDDCQVLYWDL 404

>Smik_13.329 Chr13 complement(515612..517141) [1530 bp, 509 aa] {ON}
           YMR131C (REAL)
          Length = 509

 Score = 63.2 bits (152), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 88/407 (21%), Positives = 164/407 (40%), Gaps = 69/407 (16%)

Query: 24  PLMYDFVSETRLLWPSLTIQWLPRAEDSTE----QELLVGTHTSDS---EQNYLKIAEIN 76
           P +Y+ +    + WP LT+  +P    S      Q +L+ T T  S   E   + +A  N
Sbjct: 114 PTVYEMLHNVNMPWPCLTLDVIPDTLGSERRNYPQSILLTTATQSSRKKENELMVLALSN 173

Query: 77  LPQEILSNEGPVLQNDNNGS-------DEQVPSKIKIIKKFKHENEVTRARYAPFDSN-- 127
           L + +L +E      + +         +E +P +          +   R + +PF  +  
Sbjct: 174 LTKTLLKDENEEEDEEEDDDDIDPIIENENIPLR----------DTTNRLKVSPFAVSNQ 223

Query: 128 --LIATISGTGTVFLYDRTKDDENALRGKYAYHKE--------------NGYGLNFS-VA 170
             L AT+S  G V++YD     +      Y   K                GYGL++S + 
Sbjct: 224 EVLTATMSENGDVYIYDLAPQSKAFATPGYQIPKSAKRPIHTVKNHGNVEGYGLDWSPLI 283

Query: 171 SPGELISCSDDGSIAIWDIKSGKTV----PTSVNSLHSDIVNECKWHESDPNIYGSVSED 226
             G L+S    G +      + + V    P +V++  S  + + +W  S+  ++ +   D
Sbjct: 284 KTGSLLSGDCSGQVYFTQRHTSRWVTDKQPFTVSNNKS--IEDIQWSRSESTVFATAGCD 341

Query: 227 SFLMIHDKRSEKPLQKLLQKEP---FNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPT--- 280
            ++ I D RS+K    +  K      N I++S     L A+   +    ++D R+ T   
Sbjct: 342 GYIRIWDTRSKKHKPAISVKASNTDVNVISWSDKIGYLLASGDDNGTWGVWDLRQFTPSN 401

Query: 281 ----EALHSMSGHQEAVTSLEFAHHKDGILCSGGSDRRVLLWDLF------QIGTEQQE- 329
               + +     H+ A+TS+ F    + I+  G  D  V LWDL       +I  +  E 
Sbjct: 402 ADSVQPVAQYDFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVEADDEEIKQQTAET 461

Query: 330 EDADDGGPELLMMHAGHKSAINDFSFSPNVPWLMASVEEENIVQIWK 376
           ++  +  P+LL +H   +  + D  +   +P  + S   + +  +WK
Sbjct: 462 KELQEIPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDGL-NVWK 505

>TDEL0A06890 Chr1 (1202790..1204133) [1344 bp, 447 aa] {ON}
           Anc_6.276 YPL247C Two N bases added to fix a frameshift
           that can't be corrected using the reads.
          Length = 447

 Score = 62.8 bits (151), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 79/357 (22%), Positives = 132/357 (36%), Gaps = 66/357 (18%)

Query: 25  LMYDFVSETRLLWPSLTIQWLP-RAEDSTEQEL---------LVGTHTSDSEQNYLKIAE 74
           L +D V+E  + +P  TIQW P RA+  T             L    T+  EQ  L + +
Sbjct: 129 LSWDRVAECNVTFPVSTIQWQPARAQPRTFATCSDSLXXFWSLTEDETAIQEQINLSLCK 188

Query: 75  INLPQEILSNEGPVLQNDNNGSDEQVPSKIKIIKKFKHENEVTRARYAPFDSNLIATISG 134
            N  Q   S +G  L   N    E  P              +T   + P D NL+ + S 
Sbjct: 189 HNKQQ---SEKGKELVGTNGVLGELPP--------------ITSFHWNPTDPNLLISSSI 231

Query: 135 TGTVFLYDRTKDDENALRGKYAYHKENGYGLNFSVASPGELISCSDDGSIAIWDIKSGKT 194
             T  ++D      N ++ +   H    + + F   S     SC  DGS+ ++D++    
Sbjct: 232 DTTCIVWDL--QSANYIKTQLIAHDSEVFDVRFLTQSTQLFASCGGDGSVRVFDLRCLA- 288

Query: 195 VPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDKRSEKPLQKLLQKEPFNTIAF 254
                   HS I+ E    +  P++       + L              L+  PF+    
Sbjct: 289 --------HSTIIYEPTIPDGAPDLPSPTVPPALLR-------------LEPSPFD---- 323

Query: 255 SKHSSNLFAAAGTDA-MVYLFDSRKPTEALHSMSGHQEAVTSLEFAHHKDGILCSGGSDR 313
                N+ A    D+  V + D R P   L ++  H   +  +++   +  +L S   D 
Sbjct: 324 ----PNVIATFAIDSSKVLILDMRSPGSPLLTLEAHTAPINQIKWHPTRRNVLLSASDDC 379

Query: 314 RVLLWDL-FQIGTEQQEEDADDGGPE-----LLMMHAGHKSAINDFSFSPNVPWLMA 364
           +VL WDL   + +E  ++   D  P+       M +A     +N+  + P   W  A
Sbjct: 380 QVLYWDLNTHLDSESTKDTTPDSQPDSTVQKPAMFYASGGQEVNNIVWRPQGDWFGA 436

>ZYRO0B10450g Chr2 complement(825240..826688) [1449 bp, 482 aa] {ON}
           highly similar to uniprot|P33750 Saccharomyces
           cerevisiae YLL011W
          Length = 482

 Score = 62.4 bits (150), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 38/137 (27%), Positives = 69/137 (50%), Gaps = 3/137 (2%)

Query: 182 GSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDKRSEKPLQ 241
             I +WD    K+  TS  S  +D +   K++++D NI  S   D+ ++++D R+  P Q
Sbjct: 192 AQIQLWDTSRSKS--TSNLSWGADNITSVKFNQNDSNILASTGSDNSIVLYDLRTNSPTQ 249

Query: 242 KLLQKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEAVTSLEFAHH 301
           K++Q+   N++ ++      F     D   Y +D RK   AL+    H  AV  ++FA  
Sbjct: 250 KIVQQMRTNSLCWNPMEPFNFVTGNEDHNAYYYDMRKMNRALNVFKDHVSAVMDVDFAPT 309

Query: 302 KDGILCSGGSDRRVLLW 318
            D I+ +G  D+ + ++
Sbjct: 310 GDEIV-TGSYDKTIRIF 325

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 46/200 (23%), Positives = 85/200 (42%), Gaps = 40/200 (20%)

Query: 125 DSNLIATISGTGTVFLYDRTKDDENALRGKYAYHKENGYGLNFSVASPGE----LISCSD 180
           D N +AT SG G V  ++ +  +E     K  Y    G  ++  +AS  +    ++SC D
Sbjct: 79  DLNKMATGSGDGVVKFWNMSSSEE-LCSFKAHYGIVTGLCVSPVLASKNKNLQYMLSCGD 137

Query: 181 DGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDKRSEKPL 240
           D ++ +W +                          D + Y  V +D  L      +   L
Sbjct: 138 DKTVKLWSV--------------------------DTDDYADVKDDQNL-----NTRGLL 166

Query: 241 QKLLQKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEAVTSLEFAH 300
           +       F  I   + S++ F   G  A + L+D+ + +++  ++S   + +TS++F  
Sbjct: 167 KTFYGDHSFQGIDHHR-SNSAFVTGG--AQIQLWDTSR-SKSTSNLSWGADNITSVKFNQ 222

Query: 301 HKDGILCSGGSDRRVLLWDL 320
           +   IL S GSD  ++L+DL
Sbjct: 223 NDSNILASTGSDNSIVLYDL 242

>KLLA0F15598g Chr6 (1439610..1441046) [1437 bp, 478 aa] {ON} highly
           similar to uniprot|P33750 Saccharomyces cerevisiae
           YLL011W
          Length = 478

 Score = 62.4 bits (150), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 36/139 (25%), Positives = 72/139 (51%), Gaps = 3/139 (2%)

Query: 182 GSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDKRSEKPLQ 241
             I +WD    K  P S  S  +D +N  ++++++ +I  S   D+ ++++D R+  P Q
Sbjct: 192 AQIELWDTNRSK--PISNLSWGADNINHVRFNQNEVDILASTGSDNSVVLYDLRTNSPTQ 249

Query: 242 KLLQKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEAVTSLEFAHH 301
           K++Q    N+I ++   +  F  A  D   Y +D R  ++ALH    H  AV  ++F+  
Sbjct: 250 KIVQTMRTNSICWNPVEAFNFVIANEDHNAYYYDMRNMSKALHVFKDHVSAVMDVDFSPT 309

Query: 302 KDGILCSGGSDRRVLLWDL 320
            D ++ +G  D+ + ++ +
Sbjct: 310 GDEVV-TGSYDKTIRIYQV 327

>KNAG0E02180 Chr5 (440039..441592) [1554 bp, 517 aa] {ON} Anc_2.401
           YMR131C
          Length = 517

 Score = 62.0 bits (149), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 84/400 (21%), Positives = 153/400 (38%), Gaps = 53/400 (13%)

Query: 24  PLMYDFVSETRLLWPSLTIQWLPRAEDSTEQE------LLVGTHTSDSEQNYLKIAEINL 77
           P +Y+ +    L WP +T+  +P    S  +       +   T  S  ++N L +  ++ 
Sbjct: 120 PTVYEMLHNVNLPWPCMTLDVIPDKLGSERRNYPQSILMTTATQASKKKENELMVLSLSQ 179

Query: 78  PQEILSNEGPVLQNDNNGSDEQVPSKIKIIKKFKHENEVTRARYAPFDSN----LIATIS 133
             + L         D +  +E     I   +  K  +   R + +PF S     L AT+S
Sbjct: 180 LNKTLVKSEEDEDEDEDSDEEDDSDPIIENENIKLNDTTNRLKVSPFASTDKEVLTATMS 239

Query: 134 GTGTVFLYDRTKDDENALRGKYAYHKE--------------NGYGLNFS-VASPGELISC 178
             G V+++D     +      Y   K                GY L++S +   G L++ 
Sbjct: 240 ENGEVYIFDLAPQSKAFSTPGYQIPKTARRPIHTVRNHGNVEGYALDWSPMIKNGALLTG 299

Query: 179 SDDGSIAIWDIKSGK--TVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDKRS 236
              G I      + K  T      + ++  V + +W  ++  ++ S   D ++ I D RS
Sbjct: 300 DCSGQIYFTQRHTSKWITDKQPFTAENNKSVEDIQWSRTESTVFASAGCDGYIRIWDTRS 359

Query: 237 EKPLQKLLQKEP---FNTIAFSKHSSNLFAAAGTDAMVYLFDSRK-------PTEALHSM 286
           +K    L  K      N I++S+    L A+   + +  ++D R+         + +   
Sbjct: 360 KKHKPALSVKASNTDVNVISWSEKIGYLLASGDDNGLWGVWDLRQFSPDNINDVQPVAQY 419

Query: 287 SGHQEAVTSLEFAHHKDGILCSGGSDRRVLLWDLF----------QIGTEQQEEDADDGG 336
             H+ A+TS+ F    D I+     D  V LWDL           QI   ++ E      
Sbjct: 420 DFHKGAITSINFNPLDDSIIAVASEDNTVTLWDLSVEADDEEIKQQIAETKELEKI---P 476

Query: 337 PELLMMHAGHKSAINDFSFSPNVPWLMASVEEENIVQIWK 376
           P+LL +H   +  + D  +   +P  + S   + +  IWK
Sbjct: 477 PQLLFVH--WQKDVKDVKWHKQIPGCLVSTGTDGL-NIWK 513

>YNL317W Chr14 (40619..42016) [1398 bp, 465 aa] {ON}  PFS2Integral
           subunit of the pre-mRNA cleavage and polyadenylation
           factor (CPF) complex; plays an essential role in mRNA
           3'-end formation by bridging different processing
           factors and thereby promoting the assembly of the
           processing complex
          Length = 465

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 65/281 (23%), Positives = 120/281 (42%), Gaps = 26/281 (9%)

Query: 112 HENEVTRARYAPFDSNLIATISGTGTVFLYDRTKDDENALRGKYAYHKENGYGLNFSVAS 171
           H++ VT  +Y+  DS+ + +    G + ++   + + + ++   A H E+   + FS ++
Sbjct: 134 HDSAVTTMKYS-HDSDWMISGDADGMIKIW---QPNFSMVKEIDAAHTESIRDMAFS-SN 188

Query: 172 PGELISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMI 231
             + ++CSDD  + IW+  +GK     V S H   V  C WH  +  +  S S+D+ + +
Sbjct: 189 DSKFVTCSDDNILKIWNFSNGKQ--ERVLSGHHWDVKSCDWHP-EMGLIASASKDNLVKL 245

Query: 232 HDKRSEKPLQKLLQ-KEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQ 290
            D RS   +  +L+ K       F     NL  A   D    +FD R   + L  +    
Sbjct: 246 WDPRSGNCISSILKFKHTVLKTRFQPTKGNLLMAISKDKSCRVFDIRYSMKELMCVRDET 305

Query: 291 EAVTSLEFAHHKDGILCSGGSDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGHKSAI 350
           + +T LE+    + +      D  +  +DL Q   E            +L +   H   I
Sbjct: 306 DYMT-LEWHPINESMFTLACYDGSLKHFDLLQNLNE-----------PILTIPYAHDKCI 353

Query: 351 NDFSFSPNVPWLMASVEEENIVQIWKPSRKLTNPYFPQGYD 391
              S++P V  + A+  ++  ++ W  +R    P  P  YD
Sbjct: 354 TSLSYNP-VGHIFATAAKDRTIRFWTRAR----PIDPNAYD 389

 Score = 35.0 bits (79), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 43/90 (47%), Gaps = 16/90 (17%)

Query: 286 MSGHQEAVTSLEFAHHKDGILCSGGSDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAG 345
           M  H  AVT+++++H  D ++ SG +D  + +W   Q      +E           + A 
Sbjct: 131 MQAHDSAVTTMKYSHDSDWMI-SGDADGMIKIW---QPNFSMVKE-----------IDAA 175

Query: 346 HKSAINDFSFSPNVPWLMASVEEENIVQIW 375
           H  +I D +FS N      +  ++NI++IW
Sbjct: 176 HTESIRDMAFSSNDS-KFVTCSDDNILKIW 204

>Smik_14.14 Chr14 (25114..26514) [1401 bp, 466 aa] {ON} YNL317W
           (REAL)
          Length = 466

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 65/281 (23%), Positives = 120/281 (42%), Gaps = 26/281 (9%)

Query: 112 HENEVTRARYAPFDSNLIATISGTGTVFLYDRTKDDENALRGKYAYHKENGYGLNFSVAS 171
           H++ VT  +Y+  DS+ + +    G + ++   + + + ++   A H E+   + FS ++
Sbjct: 134 HDSAVTTMKYS-HDSDWMISGDADGMIKIW---QPNFSMVKEIDAAHTESIRDMAFS-SN 188

Query: 172 PGELISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMI 231
             + ++CSDD  + IW+  +GK     V S H   V  C WH  +  +  S S+D+ + +
Sbjct: 189 DSKFVTCSDDNILKIWNFSNGKE--ERVLSGHHWDVKSCDWHP-EMGLIASASKDNLVKL 245

Query: 232 HDKRSEKPLQKLLQ-KEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQ 290
            D RS   +  +L+ K       F     NL  A   D    +FD R   + L  +    
Sbjct: 246 WDPRSGNCISSILKFKHTVLKTRFQPVKGNLLMAISKDKSCRVFDIRYSMKELMCVRDET 305

Query: 291 EAVTSLEFAHHKDGILCSGGSDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGHKSAI 350
           + +T LE+    + +      D  +  +DL Q           D    +L +   H   I
Sbjct: 306 DYMT-LEWHPINESMFTLACYDGSLKHFDLLQ-----------DLNEPVLTIPYAHDKCI 353

Query: 351 NDFSFSPNVPWLMASVEEENIVQIWKPSRKLTNPYFPQGYD 391
              S++P V  + A+  ++  ++ W  +R    P  P  YD
Sbjct: 354 TSLSYNP-VGHIFATAAKDRTIRFWTRAR----PVDPNAYD 389

 Score = 35.0 bits (79), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 24/93 (25%), Positives = 42/93 (45%), Gaps = 22/93 (23%)

Query: 286 MSGHQEAVTSLEFAHHKDGILCSGGSDRRVLLWDLFQIGTEQQEEDADDGGPELLMMH-- 343
           M  H  AVT+++++H  D ++ SG +D  + +W                  P   M+   
Sbjct: 131 MQAHDSAVTTMKYSHDSDWMI-SGDADGMIKIWQ-----------------PNFSMVKEI 172

Query: 344 -AGHKSAINDFSFSPNVPWLMASVEEENIVQIW 375
            A H  +I D +FS N      +  ++NI++IW
Sbjct: 173 DAAHTESIRDMAFSSNDS-KFVTCSDDNILKIW 204

>TPHA0G02650 Chr7 (558370..559920) [1551 bp, 516 aa] {ON} Anc_2.401
           YMR131C
          Length = 516

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 84/399 (21%), Positives = 170/399 (42%), Gaps = 51/399 (12%)

Query: 24  PLMYDFVSETRLLWPSLTIQWLPRAEDSTE----QELLVGTHTSDSEQ--NYLKIAEIN- 76
           P +Y+ +    L WP LT+  +P    S      Q +L+ T T  S++  N L + +++ 
Sbjct: 119 PTVYEMLHNVNLPWPCLTLDIIPDNLGSERRNYPQSILMTTATQASKKKDNELMVLKLSH 178

Query: 77  LPQEILSNEGPVLQNDNNGSDEQVPSKIKIIKKFKHENEVTRARYAPFDSN----LIATI 132
           L + ++ ++  V   D++  D++    I   +     +   R R +P+ +     L +T+
Sbjct: 179 LTKTLVKDDDNVDNEDDDEDDDEAGEPILENESLPLRDTTNRLRISPYATVQQEILTSTM 238

Query: 133 SGTGTVFLYDRT--------------KDDENALRGKYAYHKENGYGLNFS-VASPGELIS 177
           S  G VF+YD T              K  +  L     +    GYGL++S +   G L++
Sbjct: 239 SENGEVFIYDLTPQTRAFETPGYQIPKTAKRPLHTIRNHGNVEGYGLDWSPLIKTGALLT 298

Query: 178 CSDDGSIAIWDIKSGKTV----PTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHD 233
               G + +    + K V    P +V +  S  + + +W  ++  ++ +   D ++ I D
Sbjct: 299 GDCSGMVYLTQRHTSKWVTDKTPFTVGNNKS--IEDIQWSRTESTVFATAGCDGYIRIWD 356

Query: 234 KRSEK---PLQKLLQKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRK------PTEALH 284
            RS+K    +  ++     N I++++    L A+        ++D R+          + 
Sbjct: 357 TRSKKHKPVISTVVSNTDVNVISWNEKMGYLLASGDDKGTWGIWDLRQFSPNSEKALPVA 416

Query: 285 SMSGHQEAVTSLEFAHHKDGILCSGGSDRRVLLWDLF------QIGTEQQE-EDADDGGP 337
               H+ A+TS+ F    + I+     D  V LWDL       +I  ++ E ++ +   P
Sbjct: 417 QYDFHKGAITSISFNPLDESIVAVASEDNTVTLWDLSVEADDEEIKQQKAEIKELEQIPP 476

Query: 338 ELLMMHAGHKSAINDFSFSPNVPWLMASVEEENIVQIWK 376
           +LL +H   +  + D  +   +P  + S   + +  +WK
Sbjct: 477 QLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDGL-NVWK 512

>ZYRO0E08184g Chr5 (639823..641343) [1521 bp, 506 aa] {ON} similar
           to uniprot|Q12523 Saccharomyces cerevisiae YPL247C
           Hypothetical ORF
          Length = 506

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 70/303 (23%), Positives = 118/303 (38%), Gaps = 31/303 (10%)

Query: 25  LMYDFVSETRLLWPSLTIQWLP-----RAEDSTEQELLVGTHTSDSEQNYLKIAEINLPQ 79
           L +D V+E  + +P  TIQW P     R   +    L + +   + E+N  +   ++L +
Sbjct: 150 LSWDRVAECNVTFPVSTIQWQPSMTHPRRFATCSDSLRIWSFCEE-ERNLQEQINLSLCK 208

Query: 80  EILSNEGPVLQNDNNGSDEQVPSKIKIIKKFKHE-NEVTRARYAPFDSNLIATISGTGTV 138
                +G    N   G    + +  +  +    E   +T   + P D NL+ + S   T 
Sbjct: 209 YDKQQQGASRVNAAAGGSGSIRTNPQQQQGLIGELPPITSFHWNPVDPNLLISSSIDTTC 268

Query: 139 FLYDRTKDDENALRGKYAYHKENGYGLNFSVASPGELISCSDDGSIAIWDIKSGKTVPTS 198
            ++D      N +R +   H    Y + F   +     SC  DGS+ ++D++        
Sbjct: 269 IVWD--LQSSNYVRTQLIAHDSEVYDVRFLTQTTQLFSSCGGDGSVRVFDLRC------- 319

Query: 199 VNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDKRSEKPLQKLLQKEPFNTIAFSKHS 258
               HS I+ E     S P      +        D  +  PL +L +  PF+        
Sbjct: 320 --LAHSTIIYE---PPSSPATLQPTTAAGSSSAADSDTGVPLLRL-EPSPFD-------- 365

Query: 259 SNLFAAAGTDA-MVYLFDSRKPTEALHSMSGHQEAVTSLEFAHHKDGILCSGGSDRRVLL 317
            N+ A    D+  V + D R P   +  + GH  AV  + +   K  +L S   D +VL 
Sbjct: 366 PNVIATFAIDSPRVLILDMRNPGSPVLVLEGHSAAVNQMRWHPSKRNVLLSCADDCQVLY 425

Query: 318 WDL 320
           WDL
Sbjct: 426 WDL 428

>ZYRO0C03124g Chr3 complement(240321..241658) [1338 bp, 445 aa] {ON}
           highly similar to uniprot|Q75AV4 Ashbya gossypii ADL184W
           PSF2 Polyadenylation factor subunit 2 and similar to
           YNL317W uniprot|P42841 Saccharomyces cerevisiae YNL317W
           PFS2 Integral subunit of the pre-mRNA cleavage and
           polyadenylation factor (CPF) complex plays an essential
           role in mRNA 3'-end formation by bridging different
           processing factors and thereby promoting the assembly of
           the processing complex
          Length = 445

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 57/221 (25%), Positives = 95/221 (42%), Gaps = 25/221 (11%)

Query: 174 ELISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHD 233
           + ++CSDD  + IW+  +G+     V S H   V  C WH     +  S S+D+ + + D
Sbjct: 179 KFVTCSDDNILKIWNFSNGQQ--ERVLSGHHWDVKSCDWHPQ-MGLIASASKDNLVKLWD 235

Query: 234 KRSEKPLQKLLQ-KEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEA 292
            RS + +  LL+ K       F     NL AA   D    +FD R+  + L       + 
Sbjct: 236 PRSGQCVSTLLKFKHTVLKTKFQPTQGNLMAAISKDKSCRVFDLRQSMKELMVTRDEVDY 295

Query: 293 VTSLEFAHHKD--GILCSGGSDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGHKSAI 350
           +T L    ++    + C  GS +    +D+ Q          D  GP   + +A H   I
Sbjct: 296 MTLLWHPINETMFTVACYDGSLKN---FDILQ----------DTEGPTHTIPYA-HDKCI 341

Query: 351 NDFSFSPNVPWLMASVEEENIVQIWKPSRKLTNPYFPQGYD 391
              S++P V  ++AS  ++  ++ W  +R    PY P  +D
Sbjct: 342 TSLSYNP-VGHILASASKDRTIRFWTRAR----PYDPNAFD 377

 Score = 49.3 bits (116), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 40/149 (26%), Positives = 70/149 (46%), Gaps = 6/149 (4%)

Query: 173 GELISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIH 232
           G + S S D  + +WD +SG+ V T +   H+  V + K+  +  N+  ++S+D    + 
Sbjct: 220 GLIASASKDNLVKLWDPRSGQCVSTLLKFKHT--VLKTKFQPTQGNLMAAISKDKSCRVF 277

Query: 233 DKR-SEKPLQKLLQKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEA-LHSMS-GH 289
           D R S K L     +  + T+ +   +  +F  A  D  +  FD  + TE   H++   H
Sbjct: 278 DLRQSMKELMVTRDEVDYMTLLWHPINETMFTVACYDGSLKNFDILQDTEGPTHTIPYAH 337

Query: 290 QEAVTSLEFAHHKDGILCSGGSDRRVLLW 318
            + +TSL + +    IL S   DR +  W
Sbjct: 338 DKCITSLSY-NPVGHILASASKDRTIRFW 365

>Suva_14.22 Chr14 (36853..38262) [1410 bp, 469 aa] {ON} YNL317W
           (REAL)
          Length = 469

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 64/281 (22%), Positives = 119/281 (42%), Gaps = 26/281 (9%)

Query: 112 HENEVTRARYAPFDSNLIATISGTGTVFLYDRTKDDENALRGKYAYHKENGYGLNFSVAS 171
           H++ VT  +Y+  D + + +    G + ++   + + + ++   A H E+   + FS ++
Sbjct: 136 HDSAVTTMKYS-HDGDWMISGDADGMIKIW---QPNFSMVKEIDAAHTESIRDMAFS-SN 190

Query: 172 PGELISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMI 231
             + ++CSDD  + IW+  +GK     V S H   V  C WH  +  +  S S+D+ + +
Sbjct: 191 DSKFVTCSDDNILKIWNFSNGKQ--ERVLSGHHWDVKSCDWHP-EMGLIASASKDNLVKL 247

Query: 232 HDKRSEKPLQKLLQ-KEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQ 290
            D RS   +  +L+ K       F     NL  A   D    +FD R   + L  +    
Sbjct: 248 WDPRSGNCISSILKFKHTVLKTRFQPTKGNLLMAISKDKSCRVFDIRYSMKELMCVRDET 307

Query: 291 EAVTSLEFAHHKDGILCSGGSDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGHKSAI 350
           + +T LE+    + +      D  +  +DL Q           D    +L +   H   I
Sbjct: 308 DYMT-LEWHPINESMFTLACYDGSLKHFDLLQ-----------DLNEPILTIPYAHDKCI 355

Query: 351 NDFSFSPNVPWLMASVEEENIVQIWKPSRKLTNPYFPQGYD 391
              S++P V  + A+  ++  ++ W  +R    P  P  YD
Sbjct: 356 TSLSYNP-VGHIFATAAKDRTIRFWTRAR----PTDPNAYD 391

 Score = 34.7 bits (78), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 24/93 (25%), Positives = 42/93 (45%), Gaps = 22/93 (23%)

Query: 286 MSGHQEAVTSLEFAHHKDGILCSGGSDRRVLLWDLFQIGTEQQEEDADDGGPELLMMH-- 343
           M  H  AVT+++++H  D ++ SG +D  + +W                  P   M+   
Sbjct: 133 MQAHDSAVTTMKYSHDGDWMI-SGDADGMIKIWQ-----------------PNFSMVKEI 174

Query: 344 -AGHKSAINDFSFSPNVPWLMASVEEENIVQIW 375
            A H  +I D +FS N      +  ++NI++IW
Sbjct: 175 DAAHTESIRDMAFSSNDS-KFVTCSDDNILKIW 206

>NDAI0F01240 Chr6 complement(302631..304205) [1575 bp, 524 aa] {ON}
           Anc_6.276 YPL247C
          Length = 524

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 73/307 (23%), Positives = 125/307 (40%), Gaps = 53/307 (17%)

Query: 25  LMYDFVSETRLLWPSLTIQWLP-----RAEDSTEQELLVGTHTSDSEQNYLKIAEINLP- 78
           L +D ++E  + +    +QWLP     R   ++ + L + T   + E N L    INL  
Sbjct: 158 LTWDKITECNVTYSISKMQWLPSHPKPRKLATSSESLRIWT--LNDENNTLN-ETINLSL 214

Query: 79  ----QEILSNEGPVLQNDNNGSDEQVPSKIKIIKKFKHENEVTRARYAPFDSNLIATISG 134
               ++   N   V  N  N   + VP+ I  + +F     +T   + P D+NL+ + S 
Sbjct: 215 CKYKKQHHMNIKAVATNSGNPLSDAVPNDI--LGEFP---PITSFHWNPIDTNLLISSSI 269

Query: 135 TGTVFLYDRTKDDENALRGKYAYHKENGYGLNFSVASPGELISCSDDGSIAIWDIKSGKT 194
             T  ++D   +  N ++ +   H    + + F   S     SC  DGS+ ++D++S   
Sbjct: 270 DTTCIIWDL--ESSNYVKTQLIAHDSEVFDVRFLTQSTQLFASCGGDGSVRVFDLRSLA- 326

Query: 195 VPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDKRSEKPLQKLLQKEPFNTIAF 254
                   HS I+ E    + DP                  S      LL+ EP      
Sbjct: 327 --------HSTIIYEPP-AQMDP----------------SSSAAASNALLRLEP------ 355

Query: 255 SKHSSNLFAAAGTDA-MVYLFDSRKPTEALHSMSGHQEAVTSLEFAHHKDGILCSGGSDR 313
           S H  N+ A    D+  + + D R P   + ++ GH  ++  +++   +  IL S   D 
Sbjct: 356 SPHDPNIVATFAADSNKIIILDMRNPETPVLTLQGHSSSLNQIKWHPTERNILLSCADDC 415

Query: 314 RVLLWDL 320
           +VL WDL
Sbjct: 416 QVLYWDL 422

 Score = 31.6 bits (70), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 43/179 (24%), Positives = 75/179 (41%), Gaps = 29/179 (16%)

Query: 212 WHESDPNIYGSVSEDSFLMIHDKRSEKPLQKLL---QKEPFNTIAFSKHSSNLFAAAGTD 268
           W+  D N+  S S D+  +I D  S   ++  L     E F+ + F   S+ LFA+ G D
Sbjct: 256 WNPIDTNLLISSSIDTTCIIWDLESSNYVKTQLIAHDSEVFD-VRFLTQSTQLFASCGGD 314

Query: 269 AMVYLFDSR---------KPTEAL--HSMSGHQEAVTSLEFAHHKDGILCSGGSD-RRVL 316
             V +FD R         +P   +   S +    A+  LE + H   I+ +  +D  +++
Sbjct: 315 GSVRVFDLRSLAHSTIIYEPPAQMDPSSSAAASNALLRLEPSPHDPNIVATFAADSNKII 374

Query: 317 LWDLFQIGTEQQEEDADDGGPELLMMHAGHKSAINDFSFSPNVPWLMASVEEENIVQIW 375
           + D+    T           P L +   GH S++N   + P    ++ S  ++  V  W
Sbjct: 375 ILDMRNPET-----------PVLTLQ--GHSSSLNQIKWHPTERNILLSCADDCQVLYW 420

>NCAS0F01970 Chr6 complement(396326..397861) [1536 bp, 511 aa] {ON}
           Anc_2.401 YMR131C
          Length = 511

 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 87/417 (20%), Positives = 168/417 (40%), Gaps = 85/417 (20%)

Query: 24  PLMYDFVSETRLLWPSLTIQWLPRAEDSTE----QELLVGTHT--SDSEQNYLKIAEI-N 76
           P +Y+ +    + WP +T+  +P    S      Q LL+ T T  S  ++N L +  + N
Sbjct: 112 PSVYEMLHNVNVPWPCMTLDIIPDNLGSERRNYPQSLLMATATQASRKKENELMVLSLSN 171

Query: 77  LPQEILSNEG-----------------PVLQNDNNGSDEQVPSKIKIIKKFKHENEVTRA 119
           L + ++ ++                  P+++N+N      +P +          +   R 
Sbjct: 172 LVKTLVKDDEEEEEEDVDNEDDRDDSDPIIENEN------IPLR----------DTTNRL 215

Query: 120 RYAPFDSN----LIATISGTGTVFLYDRTKDDENALRGKYAYHKE--------------N 161
           + +PF S+    L AT+S  G V+++D     +      Y   K                
Sbjct: 216 KISPFASSKEEVLAATMSENGEVYIFDLGPQSKAFSTPGYKVPKAAKRPIHTVKNHGNVE 275

Query: 162 GYGLNFS-VASPGELISCSDDGSIAIWDIKSGKTV----PTSVNSLHSDIVNECKWHESD 216
           GY L++S +   G L++    G I      + K +    P +V +  S  + + +W  ++
Sbjct: 276 GYALDWSPLTKTGALLTGDCSGQIYFTQRHTSKWITDKQPFTVANNQS--IEDIQWSRTE 333

Query: 217 PNIYGSVSEDSFLMIHDKRSEKPLQKLLQKEP---FNTIAFSKHSSNLFAAAGTDAMVYL 273
             ++ S   D ++ I D RS+K    +  K      N I++S+    L A+   +    +
Sbjct: 334 STVFASAGCDGYIRIWDTRSKKHKPAISVKASNTDVNVISWSEKLGYLLASGDDNGTWGV 393

Query: 274 FDSRK-------PTEALHSMSGHQEAVTSLEFAHHKDGILCSGGSDRRVLLWDL-FQIGT 325
           +D R+         + +     H+ A+TS+ F    + I+  G  D  V LWDL  +   
Sbjct: 394 WDLRQFSPENAGSVQPVAQYDFHKGAITSISFNPLDESIIAVGSEDNTVTLWDLSVEADD 453

Query: 326 EQQEEDADDGG------PELLMMHAGHKSAINDFSFSPNVPWLMASVEEENIVQIWK 376
           E+ ++ A +        P+LL +H   +  + D  +   +P  + S   + +  IWK
Sbjct: 454 EEIKQQAAETKELQQIPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDGL-NIWK 507

>Skud_14.22 Chr14 (34087..35490) [1404 bp, 467 aa] {ON} YNL317W
           (REAL)
          Length = 467

 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 63/281 (22%), Positives = 118/281 (41%), Gaps = 26/281 (9%)

Query: 112 HENEVTRARYAPFDSNLIATISGTGTVFLYDRTKDDENALRGKYAYHKENGYGLNFSVAS 171
           H++ VT  +Y+  D + + +    G + ++   + + + ++   A H E+   + FS ++
Sbjct: 134 HDSAVTTMKYS-HDGDWMISGDADGMIKIW---QPNFSMVKEIDAAHTESIRDMAFS-SN 188

Query: 172 PGELISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMI 231
             + ++CSDD  + IW+  +GK     + S H   V  C WH  +  +  S S+D+ + +
Sbjct: 189 DSKFVTCSDDNILKIWNFSNGKQ--ERILSGHHWDVKSCDWHP-EMGLIASASKDNLVKL 245

Query: 232 HDKRSEKPLQKLLQ-KEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQ 290
            D RS   +  +L+ K       F     NL  A   D    +FD R     L  +    
Sbjct: 246 WDPRSGNCISSILKFKHTVLKTRFQPTKGNLLMAISKDKSCRVFDIRYSMRELMCVRDET 305

Query: 291 EAVTSLEFAHHKDGILCSGGSDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGHKSAI 350
           + +T LE+    + +      D  +  +DL Q           D    +L +   H   I
Sbjct: 306 DYMT-LEWHPINESMFTLACYDGSLKHFDLLQ-----------DLNEPILTIPYAHDKCI 353

Query: 351 NDFSFSPNVPWLMASVEEENIVQIWKPSRKLTNPYFPQGYD 391
              S++P V  + A+  ++  ++ W  +R    P  P  YD
Sbjct: 354 TSLSYNP-VGHIFATAAKDRTIRFWTRAR----PIDPNAYD 389

 Score = 34.7 bits (78), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 24/93 (25%), Positives = 42/93 (45%), Gaps = 22/93 (23%)

Query: 286 MSGHQEAVTSLEFAHHKDGILCSGGSDRRVLLWDLFQIGTEQQEEDADDGGPELLMMH-- 343
           M  H  AVT+++++H  D ++ SG +D  + +W                  P   M+   
Sbjct: 131 MQAHDSAVTTMKYSHDGDWMI-SGDADGMIKIWQ-----------------PNFSMVKEI 172

Query: 344 -AGHKSAINDFSFSPNVPWLMASVEEENIVQIW 375
            A H  +I D +FS N      +  ++NI++IW
Sbjct: 173 DAAHTESIRDMAFSSNDS-KFVTCSDDNILKIW 204

>Sklu_YGOB_Anc_2.401 Chr5 complement(385202..386764) [1563 bp, 520
           aa] {ON} ANNOTATED BY YGOB -
          Length = 520

 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 83/416 (19%), Positives = 168/416 (40%), Gaps = 84/416 (20%)

Query: 24  PLMYDFVSETRLLWPSLTIQWLPRAEDSTE----QELLVGTHTSDSEQ--NYLKIAEINL 77
           P +Y+ +    + WP +T+  +P +  S      Q +L+ T T  S++  N L + +++ 
Sbjct: 122 PTVYEMLHNVNMPWPCMTLDIIPDSLGSERRNYPQSILMTTATQASKKKDNELMVLKLSQ 181

Query: 78  PQEILSNEG---------------PVLQNDNNGSDEQVPSKIKIIKKFKHENEVTRARYA 122
             + L+ E                P+++N+N                 +  +   R + +
Sbjct: 182 LTKTLAKEDNGEDEEEEDDDDTVDPIIENEN----------------IQLRDTTNRLKVS 225

Query: 123 PFDSN------LIATISGTGTVFLYDRT--------------KDDENALRGKYAYHKENG 162
           PF S+      L AT+S  G V+++D                K  +  +    ++    G
Sbjct: 226 PFASSSNSQEILTATMSENGEVYIFDLASQVKAFKTPGYQIPKAAKKPIHTIKSHGNVEG 285

Query: 163 YGLNFS-VASPGELISCSDDGSIAIWDIKSGKTV----PTSVNSLHSDIVNECKWHESDP 217
           Y L++S +   G L++    G + +    + K +    P +V +  S  V + +W  ++ 
Sbjct: 286 YALDWSPLIKTGALLTGDCSGQVYLTQRHTSKWISDKEPFTVANNQS--VEDIQWSRTES 343

Query: 218 NIYGSVSEDSFLMIHDKRSEKPLQKLLQKEP---FNTIAFSKHSSNLFAAAGTDAMVYLF 274
            ++ S   D ++ + D RS+K    +  K      N I++S+    L A+   +    ++
Sbjct: 344 TVFASCGCDGYIRVWDTRSKKHKPAISVKASNTDVNVISWSEKIGYLLASGDDNGTWGVW 403

Query: 275 DSRK-------PTEALHSMSGHQEAVTSLEFAHHKDGILCSGGSDRRVLLWDL-FQIGTE 326
           D R+        T  +     H+ A+TS+ F    + I+     D  V LWDL  +   E
Sbjct: 404 DLRQFSPSNSNNTSPVAQYDFHKGAITSISFNPLDESIVAVASEDNTVTLWDLSVEADDE 463

Query: 327 QQEEDADDGG------PELLMMHAGHKSAINDFSFSPNVPWLMASVEEENIVQIWK 376
           + ++ A +        P+LL +H   +  + D  +   +P  + S   + +  IWK
Sbjct: 464 EIKQQAAETKELQQIPPQLLFVH--WQKEVKDVKWHRQIPGCLVSTGTDGL-NIWK 516

>Ecym_4249 Chr4 complement(516064..517188) [1125 bp, 374 aa] {ON}
           similar to Ashbya gossypii AGL190W
          Length = 374

 Score = 59.3 bits (142), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 64/300 (21%), Positives = 121/300 (40%), Gaps = 48/300 (16%)

Query: 119 ARYAPFDSNLIATISGT-------GTVFLYDRTKDDENALRGKYAYHKENGYGLNFSVAS 171
            +Y+PF  N +A  +G+       G +F+ D T   +      +   K+  + + ++   
Sbjct: 15  VQYSPFFDNKLAVATGSNFGLVGNGKLFILDITPQGKIVESNSFL-TKDGLFDVAWNELH 73

Query: 172 PGELISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMI 231
             ++++   DGS+ ++DI   K  P ++   H   V  C W+  D   + S S D  + I
Sbjct: 74  ENQVLAAQGDGSLRLFDINLQK-YPVAIFQEHEREVFSCNWNLIDKQTFLSSSWDGTVKI 132

Query: 232 HDKRSEKPLQKLLQKEPFNTIA--------------------------------FSKHSS 259
                ++ L+ LL     NT+                                 +S H S
Sbjct: 133 WSPARKQSLRTLLPTPTNNTVLVDSTVLKQDVPVSNQAQHKYSSNNKDCIYQALYSPHDS 192

Query: 260 NLFAAAGTDAMVYLFDSRKPTEA-LHSMSGHQ--EAVTSLEFAHHKDGILCSGGSDRRVL 316
           NL  +   ++ V +FD R+P      S   H+  EA+T  +F  ++  I+ +GG D+ + 
Sbjct: 193 NLVMSCSGNSYVSIFDIRQPVNTEQQSFIAHRGLEALTC-DFNKYRPHIVATGGVDKLIK 251

Query: 317 LWDLFQIGTEQQEEDADDGGPELLMMHAGHKSAINDFSFSPNVPWLMASVEEENIVQIWK 376
           +WDL  +   +Q        P  +    GH  A+    +SP+   ++ S   +   + W+
Sbjct: 252 VWDLRMV---RQSLLHTRSSPVSINEMQGHSLAVRRVFWSPHHSDMLLSTSYDMTCRTWQ 308

 Score = 38.9 bits (89), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 32/132 (24%), Positives = 57/132 (43%), Gaps = 13/132 (9%)

Query: 98  EQVPSKIKIIKKFKHENE--VTRARYAPFDSNLIATISGTGTVFLYDRTKDDENALRGKY 155
           + VP   +   K+   N+  + +A Y+P DSNL+ + SG   V ++D  +      +   
Sbjct: 162 QDVPVSNQAQHKYSSNNKDCIYQALYSPHDSNLVMSCSGNSYVSIFDIRQPVNTEQQSFI 221

Query: 156 AYHKENGYGLNFSVASPGELISCSDDGSIAIWDIK-------SGKTVPTSVNSL--HSDI 206
           A+        +F+   P  + +   D  I +WD++         ++ P S+N +  HS  
Sbjct: 222 AHRGLEALTCDFNKYRPHIVATGGVDKLIKVWDLRMVRQSLLHTRSSPVSINEMQGHSLA 281

Query: 207 VNECKW--HESD 216
           V    W  H SD
Sbjct: 282 VRRVFWSPHHSD 293

>TDEL0G03340 Chr7 (618276..619820) [1545 bp, 514 aa] {ON} Anc_2.401
           YMR131C
          Length = 514

 Score = 59.7 bits (143), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 79/398 (19%), Positives = 166/398 (41%), Gaps = 50/398 (12%)

Query: 24  PLMYDFVSETRLLWPSLTIQWLPRAEDSTE----QELLVGTHT--SDSEQNYLKIAEINL 77
           P +Y+ +    + WP LT+  +P    +      Q +L+ T T  S  ++N L + +++ 
Sbjct: 118 PTVYEMLHNVNMPWPCLTLDIIPDGLGTERRNYPQSILMATATQASKKKENELMVLKLSQ 177

Query: 78  PQEILSNEGPVLQNDNNGSDEQVPSKIKIIKKFKHENEVTRARYAPFDSN---LIATISG 134
             + L  +    + D+   ++     I   ++    +   R + +PF S+   L AT+S 
Sbjct: 178 LNKTLVKDDADEEEDDEDDEDNDSDPIIENEEISLRDTTNRLKISPFASSQEVLTATMSE 237

Query: 135 TGTVFLYDR--------------TKDDENALRGKYAYHKENGYGLNFS-VASPGELISCS 179
            G V+++D                K  +  L     +    GYGL++S +   G L++  
Sbjct: 238 NGEVYIHDLGPQTKAFETPGYQIPKSAKKPLHTIRNHGNVEGYGLDWSPLIKTGALLTGD 297

Query: 180 DDGSIAIWDIKSGKTV----PTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDKR 235
             G + +    + K V    P + ++  S  + + +W  ++  ++ +   D ++ I D R
Sbjct: 298 CSGQVYLTQRHTSKWVTDKQPFTFSNNKS--IEDIQWSRTESTVFATSGCDGYIRIWDTR 355

Query: 236 SEK---PLQKLLQKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPT-------EALHS 285
           S+K    +         N I++++    L A+   D    ++D R+ +       + +  
Sbjct: 356 SKKHKPAISTRASATDVNVISWNEKIGYLLASGDDDGRWGVWDLRQLSPNNSENVQPVAQ 415

Query: 286 MSGHQEAVTSLEFAHHKDGILCSGGSDRRVLLWDL-FQIGTEQQEEDADDGG------PE 338
              H+ A+TS+ F    + I+     D  V LWDL  +   E+ ++ A +        P+
Sbjct: 416 YDFHKGAITSISFNPLDESIIAVASEDNTVTLWDLSVEADDEEIKQQAAETKELQQIPPQ 475

Query: 339 LLMMHAGHKSAINDFSFSPNVPWLMASVEEENIVQIWK 376
           LL +H   +  + D  +   +P  + S   + +  +WK
Sbjct: 476 LLFVH--WQKEVKDVKWHRQIPGCLVSTGTDGL-NVWK 510

>CAGL0H00781g Chr8 complement(77292..78833) [1542 bp, 513 aa] {ON}
           similar to uniprot|Q12523 Saccharomyces cerevisiae
           YPL247c
          Length = 513

 Score = 59.7 bits (143), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 70/303 (23%), Positives = 126/303 (41%), Gaps = 41/303 (13%)

Query: 27  YDFVSETRLLWPSLTIQWLPRAEDSTEQELL---VGTHTSDSEQNYLKIAEINLPQEILS 83
           +D V+E  +++P   IQW+P A  S +       +   + ++E+N L+  ++NL      
Sbjct: 147 WDNVAECDVIYPVSNIQWMPSAFRSRKIATASDSLRIWSLNTEENKLE-EQLNLSLCKFH 205

Query: 84  NEGPVLQNDNNGSDEQVPSKIK-----IIKKFKHENEVTRARYAPFDSNLIATISGTGTV 138
            + P   N       Q+P+K       ++ +F     +T   + P D+N++ + S   T 
Sbjct: 206 KQHP--NNKAFVGLSQIPTKTSDVNPSVLGEFP---PITSFHWNPVDTNILISSSIDTTC 260

Query: 139 FLYDRTKDDENALRGKYAYHKENGYGLNFSVASPGELISCSDDGSIAIWDIKSGKTVPTS 198
            ++D      N ++ +   H    + + F   S     SC  DGS+ ++D++        
Sbjct: 261 IVWDL--QSSNYVKTQLIAHDSEVFDVRFLTQSTQLFASCGGDGSVRVFDLRCLA----- 313

Query: 199 VNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDKRSEKPLQKLLQKEPFNTIAFSKHS 258
               HS I+ E    E       S S+ +     D+ S      LL+ EP      S H 
Sbjct: 314 ----HSTIIYEPPASEPGTGNNSSRSDST-----DENS----HALLRLEP------SPHD 354

Query: 259 SNLFAA-AGTDAMVYLFDSRKPTEALHSMSGHQEAVTSLEFAHHKDGILCSGGSDRRVLL 317
            N+ A  A     + + D R P   L  ++GH  ++  +++   K   L S   D +VL 
Sbjct: 355 PNVLATFAIASNEILILDMRNPDSPLVVLNGHSASINQIKWHPTKKNTLISCSDDCQVLF 414

Query: 318 WDL 320
           WD+
Sbjct: 415 WDI 417

 Score = 30.4 bits (67), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 33/77 (42%), Gaps = 7/77 (9%)

Query: 118 RARYAPFDSNLIATIS-GTGTVFLYDRTKDDEN--ALRGKYAYHKENGYGLNFSVASPGE 174
           R   +P D N++AT +  +  + + D    D     L G    H  +   + +       
Sbjct: 347 RLEPSPHDPNVLATFAIASNEILILDMRNPDSPLVVLNG----HSASINQIKWHPTKKNT 402

Query: 175 LISCSDDGSIAIWDIKS 191
           LISCSDD  +  WDI S
Sbjct: 403 LISCSDDCQVLFWDISS 419

>Kpol_1041.20 s1041 complement(56019..57566) [1548 bp, 515 aa] {ON}
           complement(56019..57566) [1548 nt, 516 aa]
          Length = 515

 Score = 59.7 bits (143), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 89/413 (21%), Positives = 166/413 (40%), Gaps = 81/413 (19%)

Query: 24  PLMYDFVSETRLLWPSLTIQWLPRAEDSTE----QELLVGTHT-----SDSEQNYLKIAE 74
           P +Y+ +    L WP +T+  +P    S      Q +L+ T T      D+E   LK+++
Sbjct: 120 PTVYEMLHNVNLPWPCMTLDIIPDTYGSERRNYPQSILMTTATQAAKKKDNELMVLKLSQ 179

Query: 75  IN------------LPQEILSNEGPVLQNDNNGSDEQVPSKIKIIKKFKHENEVTRARYA 122
           ++                  +   P+L+      DE VP K          +   R R +
Sbjct: 180 LSKTLVKENEEEEEDEDNSDNESDPILE------DENVPLK----------DTTNRLRVS 223

Query: 123 PFDSN----LIATISGTGTVFLYD-----RTKDDENALRGKYA---------YHKENGYG 164
           PF S+    L AT+S  G V+++D     R  D       K A         +    GY 
Sbjct: 224 PFASSGQEVLTATMSENGEVYIFDIAPQSRAFDTPGYQIPKTAKRPIHTIRNHGNVEGYA 283

Query: 165 LNFS-VASPGELISCSDDGSIAIWDIKSGKTV----PTSVNSLHSDIVNECKWHESDPNI 219
           L++S +   G L++    G +      + K V    P +V++  S  + + +W  ++  +
Sbjct: 284 LDWSPLIRSGALLTGDCSGQVYFTQRHTSKWVTDKQPFTVSNNKS--IEDIQWSRTEATV 341

Query: 220 YGSVSEDSFLMIHDKRSEKPLQKLLQKEP---FNTIAFSKHSSNLFAAAGTDAMVYLFDS 276
           + +   D ++ + D RS+K    +  K      N I++++    L A+   +    ++D 
Sbjct: 342 FATAGCDGYIRVWDTRSKKHKPAISTKASNTDVNVISWNEKMGYLLASGDDNGTWGVWDL 401

Query: 277 RK--PT----EALHSMSGHQEAVTSLEFAHHKDGILCSGGSDRRVLLWDLFQIG----TE 326
           R+  P+    + +     H+ A+TS+ F    + I+     D  V LWDL         +
Sbjct: 402 RQFSPSNENAQPVAQYDFHKGAITSISFHPTDESIVAVASEDNTVTLWDLSVEADDEEIK 461

Query: 327 QQEEDADDGG---PELLMMHAGHKSAINDFSFSPNVPWLMASVEEENIVQIWK 376
           QQ  +  +     P+LL +H   +  + D  +   +P  + S   + +  IWK
Sbjct: 462 QQTAETKELAQIPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDGL-NIWK 511

>CAGL0D05588g Chr4 (533235..534668) [1434 bp, 477 aa] {ON} highly
           similar to uniprot|P33750 Saccharomyces cerevisiae
           YLL011w SOF1
          Length = 477

 Score = 59.3 bits (142), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 60/116 (51%), Gaps = 2/116 (1%)

Query: 184 IAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDKRSEKPLQKL 243
           I +WDI   K  P S  S  +D +N  K++++D N+ GS   D+ ++++D R+    QK+
Sbjct: 198 INLWDINRSK--PLSDLSWGADNINTVKFNQNDANVLGSAGSDNSIVLYDLRTNSATQKI 255

Query: 244 LQKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEAVTSLEFA 299
           +Q    N++ ++   +  F  A  D   Y +D R  + AL+    H  AV  ++ +
Sbjct: 256 VQTMRVNSMCWNPMEAFNFVVASEDHNAYYYDMRNMSRALNVFKDHVSAVMDVDIS 311

>KNAG0I00920 Chr9 (173033..174178) [1146 bp, 381 aa] {ON} Anc_8.316
           YDR142C
          Length = 381

 Score = 58.9 bits (141), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 62/299 (20%), Positives = 117/299 (39%), Gaps = 45/299 (15%)

Query: 119 ARYAPFDSNLIATISGT-------GTVFLYDRTKDDENALRGKYAYHKENGYGLNFSVAS 171
            +Y+PF  + +A  +GT       G +++ D + + +   R  Y   ++  + L +S  +
Sbjct: 14  VQYSPFLDSRLAVATGTNYGLIGNGKLWILDISPEGQMVTRRDY-LTQDCLFDLAWSELN 72

Query: 172 PGELISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMI 231
             + +    DGS+ ++D    K  P +V   H D V  C W     N + S   D  + +
Sbjct: 73  ENQCLVAQGDGSLRLFDTTLDK-YPVAVYQEHRDEVASCNWSLIGRNTFVSSGWDGLVKV 131

Query: 232 HDKRSEKPLQKLLQKEPFNTIA--------------------FSKHSSNLFAAAGTDAMV 271
                   +  L  +   NT                      FS H  +L      D+ V
Sbjct: 132 WSVGRPNSVMTLKPRTRSNTAVLDRPNGTGTTNGKDCVYQAKFSPHDDSLMVCCSGDSTV 191

Query: 272 YLFDSRK------PTEALHSMSGHQEAVTSLEFAHHKDGILCSGGSDRRVLLWDLFQIGT 325
            LFD R       PT    + SG +    S++F  ++  ++ +GG D ++ +WDL  + T
Sbjct: 192 SLFDLRASQPGQGPTHQFMAHSGSE--TLSVDFNKYRTNVIATGGVDNKIKIWDLRMLRT 249

Query: 326 -----EQQEEDADDGGPELLMMH---AGHKSAINDFSFSPNVPWLMASVEEENIVQIWK 376
                  +  +   G  ++   +    GH+ A+   ++SP+    + S   +    IW+
Sbjct: 250 GPLSIRGKWPEGPRGAKQVQCTNEIVGGHELAVRKVNWSPHSSNYLLSTSYDMTCCIWQ 308

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 59/313 (18%), Positives = 113/313 (36%), Gaps = 59/313 (18%)

Query: 121 YAPFDSNLIATISGTGTVFLYDRTKDDENALRGKYAYHKENGYGLNFSVASPGELISCSD 180
           ++  + N      G G++ L+D T D        Y  H++     N+S+      +S   
Sbjct: 68  WSELNENQCLVAQGDGSLRLFDTTLDKYPV--AVYQEHRDEVASCNWSLIGRNTFVSSGW 125

Query: 181 DGSIAIWDIKSGKTV----------------PTSVNSLHS-DIVNECKWHESDPNIYGSV 223
           DG + +W +    +V                P    + +  D V + K+   D ++    
Sbjct: 126 DGLVKVWSVGRPNSVMTLKPRTRSNTAVLDRPNGTGTTNGKDCVYQAKFSPHDDSLMVCC 185

Query: 224 SEDSFLMIHDKRSEKPLQ----KLLQKEPFNTIA--FSKHSSNLFAAAGTDAMVYLFDSR 277
           S DS + + D R+ +P Q    + +      T++  F+K+ +N+ A  G D  + ++D R
Sbjct: 186 SGDSTVSLFDLRASQPGQGPTHQFMAHSGSETLSVDFNKYRTNVIATGGVDNKIKIWDLR 245

Query: 278 --------------------KPTEALHSM-SGHQEAVTSLEFAHHKDGILCSGGSDRRVL 316
                               K  +  + +  GH+ AV  + ++ H    L S   D    
Sbjct: 246 MLRTGPLSIRGKWPEGPRGAKQVQCTNEIVGGHELAVRKVNWSPHSSNYLLSTSYDMTCC 305

Query: 317 LWDLFQIGTEQQ------------EEDADDGGPELLMMHAGHKSAINDFSFSP-NVPWLM 363
           +W      T++               +A D    L+     H   + D  +S    P  +
Sbjct: 306 IWQDMGYATDRTRGNNSGYGVTTGRTNASDLRNGLVSRFTAHTEFVFDGDWSLWGAPGFV 365

Query: 364 ASVEEENIVQIWK 376
           A+   +  V +WK
Sbjct: 366 ATTGWDGNVFVWK 378

 Score = 32.0 bits (71), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 21/86 (24%), Positives = 41/86 (47%), Gaps = 2/86 (2%)

Query: 116 VTRARYAPFDSNLIATISGTGTVFLYD--RTKDDENALRGKYAYHKENGYGLNFSVASPG 173
           V +A+++P D +L+   SG  TV L+D   ++  +       A+       ++F+     
Sbjct: 169 VYQAKFSPHDDSLMVCCSGDSTVSLFDLRASQPGQGPTHQFMAHSGSETLSVDFNKYRTN 228

Query: 174 ELISCSDDGSIAIWDIKSGKTVPTSV 199
            + +   D  I IWD++  +T P S+
Sbjct: 229 VIATGGVDNKIKIWDLRMLRTGPLSI 254

>TDEL0C02360 Chr3 (412482..416276) [3795 bp, 1264 aa] {ON} Anc_7.310
           YDL195W
          Length = 1264

 Score = 59.7 bits (143), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 62/268 (23%), Positives = 108/268 (40%), Gaps = 33/268 (12%)

Query: 125 DSNLIATISGTGTVFLYDRTKDDENALRGKYAYHKENGYGLNFSVASPGELISCSDDGSI 184
           D  +IA    +G V L+  T D   +   ++  H+     + F+      L S    G I
Sbjct: 73  DDKIIAGALDSGVVELFSSTGDSLKS-EARFQQHQGAAKTVKFNSKQNNVLASGGSKGEI 131

Query: 185 AIWDIKS------GKTVPT-SVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDKRSE 237
            IWD+ +      G T  T  V S   + V    W++S  +++ S    S+  I D +++
Sbjct: 132 YIWDLNTCLKNSEGYTPLTPGVASTPIEEVTSLAWNQSLAHVFASAGSTSYASIWDLKAK 191

Query: 238 KPLQKLLQKEPFNTIA--------FSKHSSNLFAAAGTDA--MVYLFDSRKPTEALHSMS 287
           K +  L    P   +           K+S+ +  A G+D   ++ ++D R     L  +S
Sbjct: 192 KEVIHLSYASPSTGLKSQLSVVEWHPKNSTRVATATGSDTEPLILVWDLRNANTPLQVLS 251

Query: 288 -GHQEAVTSLEFAHHKDGILCSGGSDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGH 346
            GH + + SL++    + +L S G D  ++LW+              + G EL       
Sbjct: 252 KGHSKGILSLDWCSQDEELLLSSGRDNTIVLWN-------------PESGQELTQFPTRG 298

Query: 347 KSAINDFSFSPNVPWLMASVEEENIVQI 374
                   F+P  P L AS   +N +Q+
Sbjct: 299 NWCFKT-KFAPEAPDLFASASFDNKIQV 325

 Score = 36.2 bits (82), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 41/86 (47%), Gaps = 6/86 (6%)

Query: 238 KPLQKLLQKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHS---MSGHQEAVT 294
           KP   L     FN + +S +   + A A    +V LF S    ++L S      HQ A  
Sbjct: 54  KPKASLAVDAKFNDLDWS-NDDKIIAGALDSGVVELFSSTG--DSLKSEARFQQHQGAAK 110

Query: 295 SLEFAHHKDGILCSGGSDRRVLLWDL 320
           +++F   ++ +L SGGS   + +WDL
Sbjct: 111 TVKFNSKQNNVLASGGSKGEIYIWDL 136

>KLTH0F19294g Chr6 complement(1560167..1561522) [1356 bp, 451 aa]
           {ON} similar to uniprot|P42841 Saccharomyces cerevisiae
           YNL317W PFS2 Integral subunit of the pre-mRNA cleavage
           and polyadenylation factor (CPF) complex plays an
           essential role in mRNA 3'-end formation by bridging
           different processing factors and thereby promoting the
           assembly of the processing complex
          Length = 451

 Score = 58.9 bits (141), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 54/225 (24%), Positives = 100/225 (44%), Gaps = 14/225 (6%)

Query: 158 HKENGYGLNFSVASPGELISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDP 217
           H +   G++FS  +  + ++CSDD  + IW+  +G+   T +   H D V  C WH +  
Sbjct: 166 HTQCIRGISFS-GTDSKFVTCSDDNILKIWNFSNGQQEST-LTGHHWD-VRSCDWHPT-M 221

Query: 218 NIYGSVSEDSFLMIHDKRSEKPLQKLLQ-KEPFNTIAFSKHSSNLFAAAGTDAMVYLFDS 276
            +  S S+D+ + + D RS + +  +L  K    +  F     N+ A    D    +FD 
Sbjct: 222 GLIASGSKDNLIKLWDPRSGQCISTILGCKHTIISTKFQPTKGNMLAVISKDKSCRVFDI 281

Query: 277 RKPTEALHSMSGHQEAVTSLEFAHHKDGILCSGGSDRRVLLWDLFQIGTEQQEEDADDGG 336
           R+  + L ++   +    SL +    + I   G  D  +  +DL      Q+ +D+  G 
Sbjct: 282 RQNMKEL-AVYRDESDYMSLTWHPINESIFTVGCYDGSMKHFDLM-----QEPQDSSSGC 335

Query: 337 PELLMMHAGHKSAINDFSFSPNVPWLMASVEEENIVQIWKPSRKL 381
                +   H   I   +++P V  ++AS  ++  ++ W  SR L
Sbjct: 336 --FHNIPYAHDKCITSLAYNP-VGHILASASKDRTIRFWTRSRPL 377

>KAFR0A06480 Chr1 complement(1312834..1314540) [1707 bp, 568 aa]
           {ON} Anc_4.122 YGL003C
          Length = 568

 Score = 58.9 bits (141), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 51/180 (28%), Positives = 83/180 (46%), Gaps = 14/180 (7%)

Query: 160 ENGY-GLNFSVASPGELISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPN 218
           EN Y  LN+ V S   L     +G + I+D+   K + T +   HSD V    W+     
Sbjct: 303 ENEYTSLNW-VGSGSHLAVGQSNGIVEIFDVNKKKCIRTMLG--HSDRVACLSWNSY--- 356

Query: 219 IYGSVSEDSFLMIHDKRSEKPLQKLLQKEPFNTIAFS-KHSSNLFAAAGTDAMVYLFDSR 277
           I  S S D  ++  D RS  P  + ++               N   + G D +V ++D R
Sbjct: 357 ILTSGSRDHNILHRDVRSPDPFFEKIESHSQEVCGLKWNVDENKLVSGGNDNIVNVYD-R 415

Query: 278 KPTEALHSMSGHQEAVTSLEFAHHKDGILCSGG--SDRRVLLWDLFQIGTEQQEEDADDG 335
             T+   +M+ H+ AV +L+++ HK GIL +GG  +DR + +W+   +    +  D D G
Sbjct: 416 TSTKPFMTMTEHKAAVKALDWSSHKRGILATGGGTADRHLKIWN---VNNMTKLNDVDTG 472

>KLLA0F17237g Chr6 (1577197..1578768) [1572 bp, 523 aa] {ON} highly
           similar to uniprot|Q04225 Saccharomyces cerevisiae
           YMR131C RRB1 essential nuclear protein involved in early
           steps of ribosome biogenesis
          Length = 523

 Score = 58.9 bits (141), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 81/412 (19%), Positives = 160/412 (38%), Gaps = 78/412 (18%)

Query: 24  PLMYDFVSETRLLWPSLTIQWLPRAEDSTE----QELLVGTHTSDSEQNYLKIAEINLPQ 79
           P +Y+ +    + WP +T+  +P    S      Q LL+ T T  S++N  ++  + + Q
Sbjct: 127 PTVYEMLHTVNVPWPCMTLDVIPDTLGSGRRNYPQSLLMATATQASKKNQNELMVLKMSQ 186

Query: 80  -----------------EILSNEGPVLQNDNNGSDEQVPSKIKIIKKFKHENEVTRARYA 122
                            E      PV++N+N                   ++   R + +
Sbjct: 187 LAKTLVKEDEDENEGEDEDEDGTDPVIENEN----------------ISLKDTTNRLKVS 230

Query: 123 PFDSN----LIATISGTGTVFLYDRTKDDENALRGKYAYHKE--------------NGYG 164
           PF +     L +T+S  G V+++D     +      Y   K+               GY 
Sbjct: 231 PFANAAQEVLCSTMSENGEVYIFDLASQVKAFETPGYQIPKQAKRPIHTVRNHGSVEGYA 290

Query: 165 LNFS-VASPGELISCSDDGSIAIWDIKSGK--TVPTSVNSLHSDIVNECKWHESDPNIYG 221
            ++S +   G ++S    G + +    + K  T   +    ++  + + +W  ++  ++ 
Sbjct: 291 NDWSPIIKTGAMLSGDCSGQVFLTQRHTSKWITDKQAFTVANNKSIEDLQWSRTESTVFA 350

Query: 222 SVSEDSFLMIHDKRSEKPLQKLLQKEP---FNTIAFSKHSSNLFAAAGTDAMVYLFDSRK 278
           S   D ++ I D RS+K    +  K      N I++S+    L A+   D    ++D R+
Sbjct: 351 SCGIDGYIRIWDTRSKKHKPAISVKASNTDVNVISWSEKIGYLLASGDDDGTWGVWDLRQ 410

Query: 279 PTEALHSMSG-------HQEAVTSLEFAHHKDGILCSGGSDRRVLLWDL-FQIGTEQQEE 330
            T    S +        H+ A+TS+ F    + I+     D  V LWDL  +   E+ ++
Sbjct: 411 FTPQNASTASPVAQYQFHKGAITSISFNPLDESIIAVASEDNTVTLWDLSVEADDEEIKQ 470

Query: 331 DADDGG------PELLMMHAGHKSAINDFSFSPNVPWLMASVEEENIVQIWK 376
            A +        P+LL +H   +  + D  +   +P  + S   + +  +WK
Sbjct: 471 QAAETKELQQIPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDGL-NVWK 519

>Kwal_55.22067 s55 complement(1094600..1095955) [1356 bp, 451 aa]
           {ON} YNL317W (PFS2) - Polyadenylation Factor I subunit
           [contig 124] FULL
          Length = 451

 Score = 58.9 bits (141), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 54/235 (22%), Positives = 105/235 (44%), Gaps = 18/235 (7%)

Query: 158 HKENGYGLNFSVASPGELISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDP 217
           H +   G++FS  +  + ++CSDD  + IW+  +G+   T ++  H D V  C WH +  
Sbjct: 166 HTQCIRGISFS-GTDSKFVTCSDDNILKIWNFSNGQQEST-LSGHHWD-VRSCDWHPT-M 221

Query: 218 NIYGSVSEDSFLMIHDKRSEKPLQKLLQ-KEPFNTIAFSKHSSNLFAAAGTDAMVYLFDS 276
            +  S S+D+ + + D R+ + +  +L  K    +  F     N+ A    D    +FD 
Sbjct: 222 GLIASGSKDNLVKLWDPRAGQCISTILGCKHTIISTKFQPTKGNMLAVISKDKSCRIFDI 281

Query: 277 RKPTEALHSMSGHQEAVTSLEFAHHKDGILCSGGSDRRVLLWDLFQIGTEQQEEDADDGG 336
           R+  + L ++   +    SL +    + +   G  D  +  +DL      Q+ +D+  G 
Sbjct: 282 RQNMKEL-AVYRDESDYMSLTWHPINESMFTVGCYDGSMKHFDLL-----QEPQDSSSGC 335

Query: 337 PELLMMHAGHKSAINDFSFSPNVPWLMASVEEENIVQIWKPSRKLTNPYFPQGYD 391
                +   H   I   +++P V  ++AS  ++  ++ W  +R    PY P  +D
Sbjct: 336 --FHNIPYAHDKCITSLAYNP-VGHILASASKDRTIRFWTRAR----PYDPNSFD 383

>SAKL0H15708g Chr8 (1370148..1371254) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|Q750X9 Ashbya gossypii AGL190W
           AGL190Wp and similar to YDR142C uniprot|P39108
           Saccharomyces cerevisiae YDR142C PEX7 May serve as
           intraperoxisomal receptor for type 2 peroxisomal
           proteins (such as thiolase) Member of
           beta-transducin-related (WD- 40) protein family
          Length = 368

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 63/297 (21%), Positives = 116/297 (39%), Gaps = 47/297 (15%)

Query: 119 ARYAPFDSNLIATISGT-------GTVFLYDRTKDDENALRGKYAYHKENG-YGLNFSVA 170
            +Y+PF  N +A  +G+       G +F+ D   D    +    ++  ++G + + ++  
Sbjct: 14  VQYSPFYDNKLAVATGSNFGLVGNGKLFILD--IDPHGRMVESNSFLTQDGLFDVAWNEG 71

Query: 171 SPGELISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLM 230
              ++++   DGS+ ++DI   +  P S+   H   V  C W+  +   + S S D  + 
Sbjct: 72  HANQVLAAQGDGSLRLFDINLPQ-YPISIFQEHQKEVFSCNWNLVNKQTFVSSSWDGTVK 130

Query: 231 IHDKRSEKPLQKLL------------------------------QKEPFNTIAFSKHSSN 260
           I     ++ L  L+                               K+      FS H  N
Sbjct: 131 IWSPMRQESLTTLVPIPMERSPLVEAKAGGIPLSNQQNHSIISKNKDCIYQAQFSPHDPN 190

Query: 261 LFAAAGTDAMVYLFDSRKPTEALHS--MSGHQEAVTSLEFAHHKDGILCSGGSDRRVLLW 318
           L      ++ V LFD R+PT       MS       + +F  ++  I+ +GG D+ V +W
Sbjct: 191 LIMCCAGNSYVTLFDLRQPTNTNQQNFMSHGGLETLTCDFNKYRPHIVATGGVDKLVKIW 250

Query: 319 DLFQIGTEQQEEDADDGGPELLMMHAGHKSAINDFSFSPNVPWLMASVEEENIVQIW 375
           DL  +             P  +    GH+ AI   S+SP+   L+ S   +   ++W
Sbjct: 251 DLRMVRKFSNPLQQ----PMSINEIPGHELAIRKVSWSPHHSNLVLSTSYDMTCRVW 303

 Score = 38.5 bits (88), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 35/167 (20%), Positives = 68/167 (40%), Gaps = 13/167 (7%)

Query: 111 KHENEVTRARYAPFDSNLIATISGTGTVFLYDRTKDDENALRGKYAYHKENGYGLNFSVA 170
           K+++ + +A+++P D NLI   +G   V L+D  +      +   ++        +F+  
Sbjct: 174 KNKDCIYQAQFSPHDPNLIMCCAGNSYVTLFDLRQPTNTNQQNFMSHGGLETLTCDFNKY 233

Query: 171 SPGELISCSDDGSIAIWDIKSGKTV------PTSVNSL--HSDIVNECKWHESDPNIYGS 222
            P  + +   D  + IWD++  +        P S+N +  H   + +  W     N+  S
Sbjct: 234 RPHIVATGGVDKLVKIWDLRMVRKFSNPLQQPMSINEIPGHELAIRKVSWSPHHSNLVLS 293

Query: 223 VSEDSFLMIHDKRSE---KPLQKLLQKEPFN--TIAFSKHSSNLFAA 264
            S D    + D  S+   +P  K    +P       F  H+  +F A
Sbjct: 294 TSYDMTCRVWDDLSDSNGRPTGKTNSIDPTKGCRFIFPHHTEFVFGA 340

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 41/90 (45%), Gaps = 14/90 (15%)

Query: 112 HENEVTRARYAPFDSNLIATISGTGTVFLYDRTKDDENALRGK-------------YAYH 158
           HE  + +  ++P  SNL+ + S   T  ++D   D      GK             + +H
Sbjct: 274 HELAIRKVSWSPHHSNLVLSTSYDMTCRVWDDLSDSNGRPTGKTNSIDPTKGCRFIFPHH 333

Query: 159 KENGYGLNFSV-ASPGELISCSDDGSIAIW 187
            E  +G ++S+   PG + S + DG++ IW
Sbjct: 334 TEFVFGADWSLWGQPGYVASTAWDGNVCIW 363

>ADL184W Chr4 (375530..376879) [1350 bp, 449 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL317W (PFS2)
          Length = 449

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 63/281 (22%), Positives = 120/281 (42%), Gaps = 23/281 (8%)

Query: 112 HENEVTRARYAPFDSNLIATISGTGTVFLYDRTKDDENALRGKYAYHKENGYGLNFSVAS 171
           H++ VT  +Y+     LI+     GT+ ++   + + N ++     H E    ++FS  S
Sbjct: 120 HDSAVTVMQYSHAGDWLISG-DADGTIKIW---QPNFNMVKVLDRAHTECMRDISFSY-S 174

Query: 172 PGELISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMI 231
             + ++CSDD  + IW+  +G+     V S H   V  C WH     +  S S+D+ + +
Sbjct: 175 DQKFVTCSDDNVLKIWNFSNGQQ--ERVLSGHHWDVKSCDWHPK-MGLIVSGSKDNLIKL 231

Query: 232 HDKRSEKPLQKLLQ-KEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQ 290
            D R+ + +  +L  K       F     NL A    D  + ++D R+    L ++    
Sbjct: 232 WDPRTGRNVSTILGLKHTVIKTKFQPTQGNLLAVVSKDKSIKIYDMRQHMRELQTIRDDM 291

Query: 291 EAVTSLEFAHHKDGILCSGGSDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGHKSAI 350
           + + SL +    + I   G  +  +  +DL          D  +  P    +   H+ ++
Sbjct: 292 DYM-SLSWHPINETIFSVGCYNGAIKHFDLLH--------DNSNSTPACHTIPYAHEKSV 342

Query: 351 NDFSFSPNVPWLMASVEEENIVQIWKPSRKLTNPYFPQGYD 391
              ++SP V  ++AS  ++  ++ W  SR    P  P  +D
Sbjct: 343 TSLAYSP-VGHILASAAKDRTIRFWARSR----PVDPNAFD 378

>NDAI0H02750 Chr8 (677299..678837) [1539 bp, 512 aa] {ON} Anc_2.401
           YMR131C
          Length = 512

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 87/417 (20%), Positives = 171/417 (41%), Gaps = 85/417 (20%)

Query: 24  PLMYDFVSETRLLWPSLTIQWLPRAEDSTE----QELLVGTHT--SDSEQNYLKIAEI-N 76
           P +Y+ +    + WP LT+  +P +  S      Q LL+ T T  S  ++N L +  + N
Sbjct: 113 PTVYEMLHNVNVPWPCLTLDIIPDSLGSERRNYPQSLLMTTATQASKKKENELMVLSLSN 172

Query: 77  LPQEILSNEG-----------------PVLQNDNNGSDEQVPSKIKIIKKFKHENEVTRA 119
           L + +++ +                  PV++N+N      +P +          +   R 
Sbjct: 173 LTKTLVNEDKEDDEDEDDEDNEDNDKDPVMENEN------IPLR----------DTTNRL 216

Query: 120 RYAPFDSN----LIATISGTGTVFLYDR--------------TKDDENALRGKYAYHKEN 161
           + +PF ++    L AT+S  G V+++D                K  +  +    ++    
Sbjct: 217 KVSPFANSSKEVLTATMSENGEVYIFDLGPQSKAFSTPGYKIPKTAKRPIHTIKSHGNVE 276

Query: 162 GYGLNFSVA-SPGELISCSDDGSIAIWDIKSGKTV----PTSVNSLHSDIVNECKWHESD 216
           GY L++S +   G L++    G I      + K V    P +V++  S  + + +W  ++
Sbjct: 277 GYALDWSPSIQTGALLTGDCSGQIYFTQRHTSKWVTDKQPFTVSNNKS--IEDIQWSRTE 334

Query: 217 PNIYGSVSEDSFLMIHDKRSEKPLQKLLQKEP---FNTIAFSKHSSNLFAAAGTDAMVYL 273
             ++ S   D ++ I D RS+K    +  K      N I++S     L A+   + +  +
Sbjct: 335 GTVFASAGCDGYIRIWDTRSKKHKPAISVKASNTDVNVISWSDKLGYLLASGDDNGVWGV 394

Query: 274 FDSRK-------PTEALHSMSGHQEAVTSLEFAHHKDGILCSGGSDRRVLLWDL-FQIGT 325
           +D R+         + +     H+ A+TS+ F    + I+     D  V LWDL  +   
Sbjct: 395 WDLRQFSPDTANSVQPVAQYDFHKGAITSISFNPLDESIVAVASEDNTVTLWDLSVEADD 454

Query: 326 EQQEEDADDGG------PELLMMHAGHKSAINDFSFSPNVPWLMASVEEENIVQIWK 376
           E+ ++ A +        P+LL +H   +  + D  +   +P  + S   + +  IWK
Sbjct: 455 EEIKQQAAETKELQQIPPQLLFVH--WQKEVKDVKWHKQIPGALVSTGTDGL-NIWK 508

>Kwal_47.17827 s47 complement(570622..572193) [1572 bp, 523 aa] {ON}
           YMR131C (RRB1) - RiboSome Assembly 2 [contig 204] FULL
          Length = 523

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 84/412 (20%), Positives = 170/412 (41%), Gaps = 78/412 (18%)

Query: 24  PLMYDFVSETRLLWPSLTIQWLPRAEDSTE----QELLVGTHT-----SDSEQNYLKIAE 74
           P +Y+ +    L WP L++  +P    S      Q LL+ T T      D+E   LK+++
Sbjct: 127 PTVYEMLHNVNLPWPCLSLDIVPDRLGSERRNYPQSLLLTTATQASKKKDNELLLLKMSQ 186

Query: 75  IN------------LPQEILSNEGPVLQNDNNGSDEQVPSKIKIIKKFKHENEVTRARYA 122
           +                +   ++ P+++N+N      +P +          +   R + +
Sbjct: 187 LTKTLVKEDEDDDEEDDDEDEDQDPIVENEN------IPLR----------DTTNRLKVS 230

Query: 123 PFDS----NLIATISGTGTVFLYDR--------------TKDDENALRGKYAYHKENGYG 164
           PF S     L A++S  G V+++D                K  +  +    A+    GY 
Sbjct: 231 PFASESPEKLTASMSENGEVYIFDLGPQVKGFETPGYQIPKTAKKPIHTVKAHGNVEGYA 290

Query: 165 LNFS-VASPGELISCSDDGSIAIWDIKSGK--TVPTSVNSLHSDIVNECKWHESDPNIYG 221
           L++S +   G L++    G + +    + K  T  T+ ++ ++  + + ++  ++  ++ 
Sbjct: 291 LDWSPLNKSGSLLTGDCSGRVYLTQRHTSKWITDKTAFSAGNNQSIEDIQFSRTEATVFA 350

Query: 222 SVSEDSFLMIHDKRSEKPLQKLLQKEP---FNTIAFSKHSSNLFAAAGTDAMVYLFDSRK 278
           +   D ++ I D RS+K    +  K      N I++++    L A+   +    ++D R+
Sbjct: 351 TCGCDGYIRIWDTRSKKHKPAISVKASSTDVNVISWNEKIGYLLASGDDNGTWGVWDLRQ 410

Query: 279 --PTEA-----LHSMSGHQEAVTSLEFAHHKDGILCSGGSDRRVLLWDL-FQIGTEQQEE 330
             P  A     +   S H+ A+TS+ F    D I+     D  V LWDL  +   E+ ++
Sbjct: 411 FSPNNAASVSPVAQYSFHKGAITSIAFNPLDDSIIAVASEDNTVTLWDLSVEADDEEIKQ 470

Query: 331 DADDGG------PELLMMHAGHKSAINDFSFSPNVPWLMASVEEENIVQIWK 376
            A +        P+LL +H   +  + D  +   +P  + S   + +  IWK
Sbjct: 471 QAAETKELQQIPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDGL-NIWK 519

>KLTH0G12430g Chr7 (1057236..1058339) [1104 bp, 367 aa] {ON} similar
           to uniprot|P39108 Saccharomyces cerevisiae YDR142C PEX7
           May serve as intraperoxisomal receptor for type 2
           peroxisomal proteins (such as thiolase) Member of
           beta-transducin-related (WD-40) protein family
          Length = 367

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 62/297 (20%), Positives = 123/297 (41%), Gaps = 46/297 (15%)

Query: 119 ARYAPFDSNLIATISGT-------GTVFLYDRTKDDENALRGKYAYHKENG-YGLNFSVA 170
            +Y+PF  N +A  +G+       G +F+ D   D++  +    ++  ++G + + ++  
Sbjct: 14  VQYSPFFDNKVAVATGSNFGLVGNGKLFIID--IDNQGRMLETKSFVTQDGLFDVAWNEL 71

Query: 171 SPGELISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLM 230
               ++    DGS+ ++DI+     P ++   H   V  C W+  +  ++ S S D  + 
Sbjct: 72  HENHVLVAQGDGSLRLFDIQLND-YPVAIFQEHEKEVFSCNWNLINKQLFVSSSWDGTVK 130

Query: 231 IHDKRSEKPLQKLLQK--------------------------EPFNTI---AFSKHSSNL 261
           +     +  L  L  K                          +  N I    FS H  N+
Sbjct: 131 VWTPMRQSSLTTLTPKPMTAHNSALSSKDIPMSNQKRHTSLSKNKNCIYQSQFSPHDPNI 190

Query: 262 FAAAGTDAMVYLFDSRKPTEA-LHSMSGHQEAVT-SLEFAHHKDGILCSGGSDRRVLLWD 319
             +   ++ V +FD R+P  A  +S   H    T + +F  ++  I+ +GG D  V +WD
Sbjct: 191 VMSCAGNSYVTMFDLRQPANANQYSFMAHNGMETLTCDFNKYRSHIIATGGVDNMVKVWD 250

Query: 320 LFQIGTEQQEEDADDGGPELLMMHAGHKSAINDFSFSPNVPWLMASVEEENIVQIWK 376
           L  +    ++  A+   P  +    GH  AI   S+SP+   ++ S   +   ++W+
Sbjct: 251 LRMV----RKMAANSRQPMSVNEICGHDLAIRKVSWSPHHSNMLLSTSYDMTCRVWQ 303

 Score = 37.7 bits (86), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 36/170 (21%), Positives = 75/170 (44%), Gaps = 19/170 (11%)

Query: 111 KHENEVTRARYAPFDSNLIATISGTGTVFLYDRTKDDENALRGKYAYHKENGY---GLNF 167
           K++N + +++++P D N++ + +G   V ++D  +   NA   +Y++   NG      +F
Sbjct: 173 KNKNCIYQSQFSPHDPNIVMSCAGNSYVTMFD-LRQPANA--NQYSFMAHNGMETLTCDF 229

Query: 168 SVASPGELISCSDDGSIAIWDIKSGKTV------PTSVNSL--HSDIVNECKWHESDPNI 219
           +      + +   D  + +WD++  + +      P SVN +  H   + +  W     N+
Sbjct: 230 NKYRSHIIATGGVDNMVKVWDLRMVRKMAANSRQPMSVNEICGHDLAIRKVSWSPHHSNM 289

Query: 220 YGSVSEDSFLMIHDKRSE---KPLQKLLQKEPFN--TIAFSKHSSNLFAA 264
             S S D    +    S+   +P  K    +P +     FS H+  +F A
Sbjct: 290 LLSTSYDMTCRVWQDLSDDGRRPTGKTNSIDPTHGCRFIFSHHTEFVFGA 339

 Score = 33.9 bits (76), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 22/90 (24%), Positives = 41/90 (45%), Gaps = 14/90 (15%)

Query: 112 HENEVTRARYAPFDSNLIATISGTGTVFLYDRTKDDENALRGK-------------YAYH 158
           H+  + +  ++P  SN++ + S   T  ++    DD     GK             +++H
Sbjct: 273 HDLAIRKVSWSPHHSNMLLSTSYDMTCRVWQDLSDDGRRPTGKTNSIDPTHGCRFIFSHH 332

Query: 159 KENGYGLNFSV-ASPGELISCSDDGSIAIW 187
            E  +G ++S+   PG + S S DG + IW
Sbjct: 333 TEFVFGADWSLWGQPGYVASTSWDGDVCIW 362

>KLTH0E09394g Chr5 complement(853592..855160) [1569 bp, 522 aa] {ON}
           highly similar to uniprot|Q04225 Saccharomyces
           cerevisiae YMR131C RRB1 RiboSome Assembly 2
          Length = 522

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 84/412 (20%), Positives = 169/412 (41%), Gaps = 78/412 (18%)

Query: 24  PLMYDFVSETRLLWPSLTIQWLPRAEDSTE----QELLVGTHTS-----DSEQNYLKIAE 74
           P +Y+ +    L WP L++  +P    S      Q LL+ T T      D+E   LK+++
Sbjct: 126 PTVYEMLHNVNLPWPCLSLDIVPDKLGSERRNYPQSLLLTTATQASKKKDNELLLLKMSQ 185

Query: 75  I------------NLPQEILSNEGPVLQNDNNGSDEQVPSKIKIIKKFKHENEVTRARYA 122
           +                +   ++ P+++N+N      +P K          +   R + +
Sbjct: 186 LAKTLVKDDNNEEEDDDDEDEDQDPIVENEN------IPLK----------DTTNRLKVS 229

Query: 123 PFDS----NLIATISGTGTVFLYDR--------------TKDDENALRGKYAYHKENGYG 164
           PF S     L AT+S  G V+++D                K  +  +    ++    GY 
Sbjct: 230 PFASESPEKLTATMSENGEVYIFDLGPQVKAFEIPGYQLPKTAKKPIHTVRSHGNVEGYA 289

Query: 165 LNFS-VASPGELISCSDDGSIAIWDIKSGK--TVPTSVNSLHSDIVNECKWHESDPNIYG 221
           L++S +   G L++    G + +    + K  T  T+ ++ ++  + + ++  ++  ++ 
Sbjct: 290 LDWSPLNKSGSLLTGDCSGRVYLTQRHTSKWITDKTAFSAGNNQSIEDIQFSRTEATVFA 349

Query: 222 SVSEDSFLMIHDKRSEKPLQKLLQKEP---FNTIAFSKHSSNLFAAAGTDAMVYLFDSRK 278
           S   D ++ I D RS+K    +  K      N I++++    L A+   +    ++D R+
Sbjct: 350 SCGCDGYIRIWDTRSKKHKPAISVKASATDVNVISWNEKIGYLLASGDDNGSWGVWDLRQ 409

Query: 279 -------PTEALHSMSGHQEAVTSLEFAHHKDGILCSGGSDRRVLLWDL-FQIGTEQQEE 330
                   T  +   + H+ A+TS+ F    D I+     D  V LWDL  +   E+ ++
Sbjct: 410 FSPNTAASTSPVAQYNFHKGAITSISFNPLDDSIIAVASEDNTVSLWDLSVEADDEEIKQ 469

Query: 331 DADDGG------PELLMMHAGHKSAINDFSFSPNVPWLMASVEEENIVQIWK 376
            A +        P+LL +H   +  + D  +   +P  + S   + +  IWK
Sbjct: 470 QAAETRELQEIPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDGL-NIWK 518

>ADR242C Chr4 complement(1126441..1128006) [1566 bp, 521 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR131C
           (RRB1)
          Length = 521

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 84/398 (21%), Positives = 166/398 (41%), Gaps = 50/398 (12%)

Query: 24  PLMYDFVSETRLLWPSLTIQWLPRAEDSTE----QELLVGTHTSDSEQ--NYLKIAEINL 77
           P +Y+ +    L WP +T+  +P    S      Q +L+ T T  S++  N L + +++ 
Sbjct: 125 PTVYEMLHNVNLPWPCMTLDLIPDNLGSERRNYPQSILMTTATQASKKKDNELLVLKLSQ 184

Query: 78  PQEILSNEGPVLQNDNNGSDEQVPSKIKIIKKFKHENEVTRARYAPFDSN----LIATIS 133
             + L+ +      D+   +++    I   +  K  +   R + +PF +     L AT+S
Sbjct: 185 LAKTLAKDEDDGAEDDEDDEDEDADPIIENENIKLRDTTNRMQVSPFAAESQEVLAATMS 244

Query: 134 GTGTVFLYDRTKD-----------DENALRGKYAYHKEN---GYGLNFS-VASPGELISC 178
             G   ++D                + A R +Y         GYGL++S +   G L++ 
Sbjct: 245 ENGEAHIFDLGPQVKAFSSPGYQVPKAAQRPQYTIKNHGNVEGYGLDWSPLIKTGALLTG 304

Query: 179 SDDGSIAIWDIKSGKTV----PTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDK 234
              G + +    S K +    P +V++  S  + + KW  S+  ++ +   D  + I D 
Sbjct: 305 DCSGRVFLTQRTSSKWITDKQPFTVDNNKS--IEDIKWSPSENTVFATCGVDGHVRIWDI 362

Query: 235 RSEK---PLQKLLQKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSG--- 288
           RS+K    L   +     N +++++  S L A    +    ++D R+ +     +S    
Sbjct: 363 RSKKHKPALSVKVSDTDVNVMSWNQKISYLLATGDDNGTWGVWDLRQFSNQQGGVSPVAQ 422

Query: 289 ---HQEAVTSLEFAHHKDGILCSGGSDRRVLLWDL-FQIGTEQQEEDADDGG------PE 338
              H+ A+TS+ F    + I+     D  V LWDL  +   E+ ++ A +        P+
Sbjct: 423 YDFHKGAITSISFNPLDESIIAVASEDNTVTLWDLSVEADDEEIKQQAAEVKELQQIPPQ 482

Query: 339 LLMMHAGHKSAINDFSFSPNVPWLMASVEEENIVQIWK 376
           LL +H   +  + D  +   +P  + S   + +  +WK
Sbjct: 483 LLFVH--WQKEVKDVKWHKQIPGCLVSTGTDGL-NVWK 517

>SAKL0C13266g Chr3 complement(1171961..1173340) [1380 bp, 459 aa]
           {ON} highly similar to uniprot|Q75AV4 Ashbya gossypii
           ADL184W PSF2 Polyadenylation factor subunit 2 and
           similar to YNL317W uniprot|P42841 Saccharomyces
           cerevisiae YNL317W PFS2 Integral subunit of the pre-mRNA
           cleavage and polyadenylation factor (CPF) complex plays
           an essential role in mRNA 3'-end formation by bridging
           different processing factors and thereby promoting the
           assembly of the processing complex
          Length = 459

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 60/236 (25%), Positives = 98/236 (41%), Gaps = 22/236 (9%)

Query: 158 HKENGYGLNFSVASPGELISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDP 217
           H E    ++FS  +  + ++CSDD  + IW+  +G+     V S H   V  C WH +  
Sbjct: 164 HMECVRDVSFS-GTDSKFVTCSDDNILKIWNFSNGQQ--ERVLSGHHWDVKSCDWHPTMG 220

Query: 218 NIYGSVSEDSFLMIHDKRSEKPLQKLLQ-KEPFNTIAFSKHSSNLFAAAGTDAMVYLFDS 276
            I  S S+D+ + + D RS + +  +L  K       F     NL A    D    +FD 
Sbjct: 221 LIV-SGSKDNLIKLWDPRSGQCISTILGFKHTIIKTKFQPTKGNLLAVVAKDKSCKIFDI 279

Query: 277 RKPTEALHSMSGHQEAVTSLEFAHHKDGILCSGGSDRRVLLWDLFQ-IGTEQQEEDADDG 335
           R+  + L S     + + SL +    + I   G  D  +  +DL Q  G+     D    
Sbjct: 280 RQNMKELKSFRDESDYM-SLTWHPINESIFTVGCYDGSLKHFDLLQDTGSSNSFHD---- 334

Query: 336 GPELLMMHAGHKSAINDFSFSPNVPWLMASVEEENIVQIWKPSRKLTNPYFPQGYD 391
                 +   H   I   S++P V  ++AS  ++  ++ W  SR    P  P  +D
Sbjct: 335 ------IPYAHDKCITSLSYNP-VGHILASASKDRTIRFWTRSR----PMDPNAFD 379

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 24/93 (25%), Positives = 39/93 (41%), Gaps = 22/93 (23%)

Query: 286 MSGHQEAVTSLEFAHHKDGILCSGGSDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHA- 344
           M  H  AVT++E++H  D ++ SG SD  + +W                  P   M+   
Sbjct: 119 MQAHDSAVTTMEYSHAGDWLI-SGDSDGIIKIWQ-----------------PNFNMVKVL 160

Query: 345 --GHKSAINDFSFSPNVPWLMASVEEENIVQIW 375
              H   + D SFS        +  ++NI++IW
Sbjct: 161 DQAHMECVRDVSFS-GTDSKFVTCSDDNILKIW 192

>TPHA0C00860 Chr3 (180116..181252) [1137 bp, 378 aa] {ON} Anc_8.316
           YDR142C
          Length = 378

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 56/257 (21%), Positives = 110/257 (42%), Gaps = 24/257 (9%)

Query: 127 NLIATISGTGTVFLYDRTKDDENALRGKYAYHKENGYGLNFSVASPGELISCSDDGSIAI 186
           N +    G G++ L+D T   +    G +  HK+     N+++ + G  +S S DG++ +
Sbjct: 75  NQVLVAQGDGSLRLFDTTL--QKYPIGIFKEHKKEVLSCNWNLITKGTFVSSSWDGAVKM 132

Query: 187 WDIKSGKTVPTSV--NSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDKRSEKPLQKLL 244
           W     +++ T +  +S  S  +N  +  +  P+            +++ +S   LQ   
Sbjct: 133 WSPLREQSLLTLLPKSSEQSSKINHNQIAKIPPH------------VNNNQSTPILQ--- 177

Query: 245 QKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEAL--HSMSGHQEAVT-SLEFAHH 301
            K+      FS H +NL A    ++ + LFD+R+       +S   H    T +L+F  +
Sbjct: 178 NKDCVYQAQFSPHDNNLIACCSGNSYITLFDTREQNNRFNNNSFIAHSGLETLTLDFNKY 237

Query: 302 KDGILCSGGSDRRVLLWDLFQIGTEQQEEDADDGGPELLM--MHAGHKSAINDFSFSPNV 359
           +  +L S G+D  + +WD+  I               + M  +   H  A+    +SP+ 
Sbjct: 238 RPTVLASSGADNSIKIWDMRMIRNNNSNNTVMPTSNPICMNEIRKAHDLAVRRVVWSPHQ 297

Query: 360 PWLMASVEEENIVQIWK 376
             L+ S   +   ++WK
Sbjct: 298 SNLLLSTSYDMTSKVWK 314

 Score = 49.7 bits (117), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 72/314 (22%), Positives = 119/314 (37%), Gaps = 79/314 (25%)

Query: 29  FVSETRLLWPSLTIQWLPRAEDSTEQELLVGTHTSDSEQNYLKIAEINLPQEILSNEG-P 87
           FVS +   W      W P  E S    LL  +    S+ N+ +IA+I  P  + +N+  P
Sbjct: 121 FVSSS---WDGAVKMWSPLREQSL-LTLLPKSSEQSSKINHNQIAKI--PPHVNNNQSTP 174

Query: 88  VLQNDNNGSDEQVPSKIKIIKKFKHENEVTRARYAPFDSNLIATISGTGTVFLYDRTKDD 147
           +LQN                     ++ V +A+++P D+NLIA  SG   + L+D T++ 
Sbjct: 175 ILQN---------------------KDCVYQAQFSPHDNNLIACCSGNSYITLFD-TREQ 212

Query: 148 ENALRGK--YAYHKENGYGLNFSVASPGELISCSDDGSIAIWDIKSGKTVPTSVNSLHSD 205
            N        A+       L+F+   P  L S   D SI IWD++           + ++
Sbjct: 213 NNRFNNNSFIAHSGLETLTLDFNKYRPTVLASSGADNSIKIWDMR----------MIRNN 262

Query: 206 IVNECKWHESDPNIYGSVSEDSFLMIHDKRSEKPLQKLLQKEPFNTIAFSKHSSNLFAAA 265
             N      S+P     +  +     HD    +             + +S H SNL  + 
Sbjct: 263 NSNNTVMPTSNP-----ICMNEIRKAHDLAVRR-------------VVWSPHQSNLLLST 304

Query: 266 GTDAMV-----YLFDSRKPTEALHSMSGHQEAVTSLEFAHHKD-------------GILC 307
             D        + FD  K T   +S+      + +  F HH +             G + 
Sbjct: 305 SYDMTSKVWKDFSFDGSKITGKTNSIDPGSGLIKT--FHHHTEFVFGADWSLWGQPGFIA 362

Query: 308 SGGSDRRVLLWDLF 321
           + G D +V +W+ F
Sbjct: 363 TTGWDSKVYIWNCF 376

>NCAS0C04450 Chr3 (912688..914073) [1386 bp, 461 aa] {ON} Anc_3.25
          Length = 461

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 59/252 (23%), Positives = 111/252 (44%), Gaps = 29/252 (11%)

Query: 141 YDRTKDDENALRGKYAYHKENGYGLNFSVASPGELISCSDDGSIAIWDIKSGKTVPTSVN 200
           ++  K+ ENA       H E    ++FS  +  + ++CSDD  + IW+  +G+ V  +++
Sbjct: 163 FNMVKEFENA-------HTECIRDISFS-NNDSKFVTCSDDNVLKIWNFSNGQ-VERTLS 213

Query: 201 SLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDKRSEKPLQKLLQ-KEPFNTIAFSKHSS 259
             H DI   C WH  +  +  S S+D+ + + D RS + +  +++ K       F     
Sbjct: 214 GHHWDI-KSCDWHP-EMGLIVSASKDNLVKLWDPRSGQCISTIIKFKHTVLKTRFQPTRG 271

Query: 260 NLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEAVTSLEFAHHKDGILCSGGSDRRVLLWD 319
           NL AA   D    +FD R   + L  +    + +T L +    + +   G  D  +  +D
Sbjct: 272 NLLAAISKDKSCRVFDIRHSMKELMCVRDEVDYMT-LTWNPINESMFTVGNYDGAMKYFD 330

Query: 320 LFQIGTEQQEEDADDGGPELLMMHAGHKSAINDFSFSPNVPWLMASVEEENIVQIWKPSR 379
           L Q          D  GP  ++ +A H   +   +++P    ++AS  ++  ++ W  ++
Sbjct: 331 LLQ----------DLEGPSHVIPYA-HDKCVTSMAYNP-AGNILASASKDRTIRFWTRAK 378

Query: 380 KLTNPYFPQGYD 391
               P  P  YD
Sbjct: 379 ----PVDPNAYD 386

>KAFR0L01320 Chr12 complement(244228..247950) [3723 bp, 1240 aa]
           {ON} Anc_7.310 YDL195W
          Length = 1240

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 47/212 (22%), Positives = 91/212 (42%), Gaps = 17/212 (8%)

Query: 124 FDSNLIATISGTGTVFLYDRTKDDENALRGKYAYHKENGYGLNFSVASPGELISCSDDGS 183
           +D+  IA     G + L+  + D   ++  K   H  +   L F+      L+S S+ G 
Sbjct: 72  YDNKTIAGALDNGIIELFYLSNDQLTSV-AKLTTHTSSVKTLKFNSKQENVLVSGSNKGE 130

Query: 184 IAIWDIKSGKT---VPTSVNSLHSDI--VNECKWHESDPNIYGSVSEDSFLMIHDKRSEK 238
           I +WD    K    VP +  +  + +  +    W++S  +++ S     +  I D +++K
Sbjct: 131 IFVWDTNKAKQTDYVPMTPGTAMTPLEEITSLSWNQSLAHVFASAGATVYASIWDLKAKK 190

Query: 239 PLQKLLQKEP-------FNTIAFSKHSSNLFAAAG---TDAMVYLFDSRKPTEALHSM-S 287
            +  L    P        + + +  ++S   A A     D  + ++D R     L  +  
Sbjct: 191 EVIHLSYTSPATGLKSQLSVVEWHPNNSTRVATATGNDNDPSILVWDLRNANTPLQVLDQ 250

Query: 288 GHQEAVTSLEFAHHKDGILCSGGSDRRVLLWD 319
           GH + + SL++ H  + ++ S G D  VLLW+
Sbjct: 251 GHSKGIISLDWCHEDESLMLSSGRDNTVLLWN 282

 Score = 32.7 bits (73), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 16/82 (19%), Positives = 37/82 (45%)

Query: 238 KPLQKLLQKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEAVTSLE 297
           KP+  +     FN + +S  +  +  A     +   + S     ++  ++ H  +V +L+
Sbjct: 54  KPVASISTDTKFNDLDWSYDNKTIAGALDNGIIELFYLSNDQLTSVAKLTTHTSSVKTLK 113

Query: 298 FAHHKDGILCSGGSDRRVLLWD 319
           F   ++ +L SG +   + +WD
Sbjct: 114 FNSKQENVLVSGSNKGEIFVWD 135

>YPL247C Chr16 complement(82625..84196) [1572 bp, 523 aa] {ON}
           Putative protein of unknown function; green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           and nucleus; similar to the petunia WD repeat protein
           an11; overexpression causes a cell cycle delay or arrest
          Length = 523

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 87/390 (22%), Positives = 154/390 (39%), Gaps = 75/390 (19%)

Query: 21  SNVPLMYDFVSETRLLWPSLTIQWLP-----RAEDSTEQELLVGTHTSDSEQNYLKIAEI 75
           SN  L ++ V +  +++P   IQW+P     R   +    L + +  S  E+ + +  +I
Sbjct: 160 SNDLLSWESVVDADVVYPVSKIQWVPSQLYPRKLATCSDSLRIWS-VSPEERQFQE--QI 216

Query: 76  NLPQEILSNEGPVLQNDNNGSDEQVPSKIKIIKKFKHENEVTRARYAPFDSNLIATISGT 135
           NL     + + P        ++      +K+I  F     +T   +   D+NLI + S  
Sbjct: 217 NLSLCKYNRQHP--------ANPAAADDMKVIGTFP---PITSFDWNTVDTNLIISSSID 265

Query: 136 GTVFLYDRTKDDENALRGKYAYHKENGYGLNFSVASPGELISCSDDGSIAIWDIKSGKTV 195
            T  ++D      + ++ +   H    + + F   S     SC  DGS+ ++D++S    
Sbjct: 266 TTCIVWDL--QSSHYVKTQLIAHDSEVFDVRFLTKSTQLFASCGGDGSVRVFDLRS---- 319

Query: 196 PTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDKRSEKPLQKLLQKEPFNTIAFS 255
                  HS I+ E           G+++           S K    LL+ EP      S
Sbjct: 320 -----LAHSTIIYEPPSSSVSGATAGTITP----------SSKGSDALLRLEP------S 358

Query: 256 KHSSNLFAAAGTDA-MVYLFDSRKPTEALHSMSGHQEAVTSLEFAHHKDGILCSGGSDRR 314
            +  N+ A    D+  + + D R P   + ++ GH  +V  +++   K  +L S G D +
Sbjct: 359 PYDPNVLATFAADSNKIIILDMRNPESPILNLQGHGSSVNGIKWHPTKRNVLLSCGDDCQ 418

Query: 315 VLLWDL----FQI-----------GTEQQEEDAD----DGGP------ELLMMHAGHKSA 349
           VL WDL     +I           GT  ++ D D    DGG       + L ++   K  
Sbjct: 419 VLYWDLNSSFMEINAAGSKSPSIHGTSLEDPDGDTEMTDGGAGSGLNEDPLSLNNNSKQV 478

Query: 350 INDFSFSPNVPWLMASVEEENIVQIWKPSR 379
                 +PN+ +   + E  NI   W+P R
Sbjct: 479 CKTLE-TPNMMYANKTQEINNIA--WRPQR 505

>SAKL0H22396g Chr8 complement(1949474..1951141) [1668 bp, 555 aa]
           {ON} similar to uniprot|P53197 Saccharomyces cerevisiae
           YGL003C CDH1 CDC20 homolog 1 protein required for Clb2
           and Ase1 degradation
          Length = 555

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 57/204 (27%), Positives = 93/204 (45%), Gaps = 21/204 (10%)

Query: 137 TVFLYDRTKDDENALRGKYAYHKENGYGLNFSVASPGELISCSDDGSIAIWDIKSGKTVP 196
           +VFL D   ++   L        EN Y     V +   L     +G + I+DI   K + 
Sbjct: 273 SVFLTDNATNEVVQL-----CDTENEYTSINWVGAGSHLAVGQGNGLVEIYDIVKRKCIR 327

Query: 197 TSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDKRSEKPLQKLLQKEPFNTIAFSK 256
           T   S H D V    W+    +I  S S D  ++  D R  +P  + ++           
Sbjct: 328 TL--SGHMDRVACLSWNN---HILTSGSRDRKILHRDVRMPEPYFEQVETHTQEVCGLKW 382

Query: 257 HS-SNLFAAAGTDAMVYLFD--SRKPTEALHSMSGHQEAVTSLEFAHHKDGILCSGG--S 311
           ++  N  A+ G D +VY++D  SRKPT  L   + H  AV ++ ++ HK GIL +GG  +
Sbjct: 383 NTDENRLASGGNDNVVYVYDGTSRKPTLKL---AEHTAAVKAIAWSPHKRGILATGGGTA 439

Query: 312 DRRVLLWDLFQIGTEQQEEDADDG 335
           D+++ +W+   + T  +  D D G
Sbjct: 440 DKKMKIWN---VNTSTKLRDIDTG 460

>TPHA0P01490 Chr16 complement(302996..304375) [1380 bp, 459 aa] {ON}
           Anc_3.25 YNL317W
          Length = 459

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 54/219 (24%), Positives = 93/219 (42%), Gaps = 21/219 (9%)

Query: 174 ELISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHD 233
           + ++CSDD  + IW+  +GK   T ++  H D V  C WH  +  +  S S+D+ + + D
Sbjct: 184 KFVTCSDDNILKIWNFSNGKQERT-LSGHHWD-VKSCDWHP-EMGLIVSASKDNLIKLWD 240

Query: 234 KRSEKPLQKLLQ-KEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEA 292
            RS + +  LL  K       F     NL AA   D    +FD R   + L  +    + 
Sbjct: 241 PRSGQCVSTLLNFKHTVLKTKFQPTKGNLLAAISKDKSCRVFDIRYHMKELTVIRDEVDY 300

Query: 293 VTSLEFAHHKDGILCSGGSDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGHKSAIND 352
           +T L +    + +      D  +  +D+ Q   E Q+           ++   H   I  
Sbjct: 301 MT-LLWHPTNESMFTIASYDGAIKHFDILQNLEEPQQ-----------VIPYAHDKCITS 348

Query: 353 FSFSPNVPWLMASVEEENIVQIWKPSRKLTNPYFPQGYD 391
            S++P V  ++AS  ++  ++ W  +R    P  P  YD
Sbjct: 349 LSYNP-VGHILASAAKDRTIRFWTRAR----PVDPNAYD 382

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 39/149 (26%), Positives = 70/149 (46%), Gaps = 6/149 (4%)

Query: 173 GELISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIH 232
           G ++S S D  I +WD +SG+ V T +N  H+  V + K+  +  N+  ++S+D    + 
Sbjct: 225 GLIVSASKDNLIKLWDPRSGQCVSTLLNFKHT--VLKTKFQPTKGNLLAAISKDKSCRVF 282

Query: 233 DKRSE-KPLQKLLQKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSM--SGH 289
           D R   K L  +  +  + T+ +   + ++F  A  D  +  FD  +  E    +    H
Sbjct: 283 DIRYHMKELTVIRDEVDYMTLLWHPTNESMFTIASYDGAIKHFDILQNLEEPQQVIPYAH 342

Query: 290 QEAVTSLEFAHHKDGILCSGGSDRRVLLW 318
            + +TSL + +    IL S   DR +  W
Sbjct: 343 DKCITSLSY-NPVGHILASAAKDRTIRFW 370

>Kpol_1036.65 s1036 complement(180839..181954) [1116 bp, 371 aa]
           {ON} complement(180839..181954) [1116 nt, 372 aa]
          Length = 371

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 59/297 (19%), Positives = 123/297 (41%), Gaps = 43/297 (14%)

Query: 119 ARYAPFDSNLIATISGT-------GTVFLYDRTKDDENALRGKYAYHKENG-YGLNFSVA 170
            +Y+PF  N +A  SG+       G +F+ D   D +  +    ++  ++  Y + ++  
Sbjct: 15  VQYSPFFDNRLAVASGSNFGLVGNGNLFILD--IDPQGRIHSMNSFMTQDCLYDVAWNEL 72

Query: 171 SPGELISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLM 230
              +++    DGS+ ++D  S +  P ++   HS  V  C W+  +   + S S D  + 
Sbjct: 73  HENQVLVAQGDGSLRLFD-TSLQKFPIAIFKEHSKEVLSCNWNLINKQTFVSSSWDGTVK 131

Query: 231 IHDKRSEKPLQKLLQKEPF-------NTIA--------------------FSKHSSNLFA 263
           I     ++ L + LQ +P        NTIA                    FS H  NL  
Sbjct: 132 IWTPNRKESL-RTLQVQPVMQSQLVDNTIAKTNGSRGTISANKNCIYQAQFSPHDENLVM 190

Query: 264 AAGTDAMVYLFDSRKP---TEALHSMSGHQEAVTSLEFAHHKDGILCSGGSDRRVLLWDL 320
               ++ V LFD R+P    +    ++ +     + +F  ++  ++ + G D  + +WD+
Sbjct: 191 CCSGNSYVTLFDLRQPNSNNKQQRFLAHNGSETLTCDFNKYRPTVVATSGVDSSIRIWDI 250

Query: 321 -FQIGTEQQEEDADDGGPELLMMHAGHKSAINDFSFSPNVPWLMASVEEENIVQIWK 376
              +    Q +  +     +  +   H+ A+   ++SP+ P ++ S   +    +W+
Sbjct: 251 RMLVNLGPQSQHINSSAACINEITRAHELAVRKVAWSPHHPNVLLSASYDMTCSVWQ 307

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/129 (24%), Positives = 55/129 (42%), Gaps = 14/129 (10%)

Query: 112 HENEVTRARYAPFDSNLIATISGTGTVFLYDRTKDDENALRGKY-AYHKENGYGLNFSVA 170
           ++N + +A+++P D NL+   SG   V L+D  + + N  + ++ A++       +F+  
Sbjct: 172 NKNCIYQAQFSPHDENLVMCCSGNSYVTLFDLRQPNSNNKQQRFLAHNGSETLTCDFNKY 231

Query: 171 SPGELISCSDDGSIAIWDIK-------------SGKTVPTSVNSLHSDIVNECKWHESDP 217
            P  + +   D SI IWDI+             S       +   H   V +  W    P
Sbjct: 232 RPTVVATSGVDSSIRIWDIRMLVNLGPQSQHINSSAACINEITRAHELAVRKVAWSPHHP 291

Query: 218 NIYGSVSED 226
           N+  S S D
Sbjct: 292 NVLLSASYD 300

>TBLA0A02310 Chr1 (557822..559417) [1596 bp, 531 aa] {ON} Anc_6.276
           YPL247C
          Length = 531

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 73/314 (23%), Positives = 127/314 (40%), Gaps = 46/314 (14%)

Query: 25  LMYDFVSETRLLWPSLTIQWLP---------RAEDSTEQELLVGTHTSDSEQNYLKIAEI 75
           L ++ V+E  + +P   IQW+P            DS     L    +S  E   L   + 
Sbjct: 155 LNWNRVAEYNVTYPVSNIQWIPAQLQPRKFATCSDSLRLWSLREDTSSIEEILNLSYCKY 214

Query: 76  NLPQEILSNEGPVLQNDNNGSDEQVPSKIKIIKKFKHENEVTRARYAPFDSNLIATISGT 135
           N  ++  +  G    ND+  S    PS   ++ +F     +T   + P D+N + + S  
Sbjct: 215 NKLRQNTTTNG---TNDSRTSVGVDPS---VLGQFP---PITSFHWNPIDTNFLISSSID 265

Query: 136 GTVFLYDRTKDDENALRGKYAYHKENGYGLNFSVASPGELISCSDDGSIAIWDIKSGKTV 195
            T  ++D   +  N ++ +   H    + + F   S     SC  DGS+ ++D++S    
Sbjct: 266 TTCIVWDLQSN--NYVKTQLIAHDSEVFDVRFLTQSTQLFASCGGDGSVRVFDLRSLA-- 321

Query: 196 PTSVNSLHSDIVNECKWHESDPNIY--------GSVSEDSFLMIHDKRSEKPLQKLLQKE 247
                  HS I+ E   + S  N+         GS++  S +   D  S+     LL+ E
Sbjct: 322 -------HSTIIYESAANTSMSNLSSGGMVDHPGSLNTSSRVGSVDLSSKS--NALLRLE 372

Query: 248 PFNTIAFSKHSSNLFAAAGTDA-MVYLFDSRKPTEALHSMSGHQEAVTSLEFAHHKDGIL 306
           P      S    N+ A  G D+  V + D R P   + ++ GH   +  +++   K   +
Sbjct: 373 P------SPTDPNVIATFGADSNSVLILDMRNPGTPVLTLDGHSAPINQIKWHPTKKNTI 426

Query: 307 CSGGSDRRVLLWDL 320
            S   D +VL W+L
Sbjct: 427 LSSSDDCQVLYWNL 440

>ZYRO0F05808g Chr6 complement(479060..482908) [3849 bp, 1282 aa]
           {ON} similar to uniprot|P38968 Saccharomyces cerevisiae
           YDL195W SEC31 involved in protein transport from
           endoplasmic reticulum to Golgi Component (p150) of COPII
           coat of secretory pathway vesicles
          Length = 1282

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 52/213 (24%), Positives = 93/213 (43%), Gaps = 19/213 (8%)

Query: 125 DSNLIATISGTGTVFLYDRTKDDENALRGKYAYHKENGYGLNFSVASPGELISCSDDGSI 184
           D+ +IA     G+V L+    D   +   K+  HK       F+      L +    G I
Sbjct: 73  DNKIIAGALDNGSVELFSYNADSLKS-EAKFQRHKTTAKVARFNAKQFNVLATGGTKGEI 131

Query: 185 AIWDIKSGKTVP------TSVNSLHS-DIVNECKWHESDPNIYGSVSEDSFLMIHDKRSE 237
            IWD+      P      T  NS+   + +    W++S  +++ S    S+  I D +++
Sbjct: 132 FIWDVNKCLENPNDYTPLTPGNSMTPVEEITSLAWNQSLAHVFASAGSTSYASIWDLKAK 191

Query: 238 KPLQKLLQ-------KEPFNTIAF-SKHSSNLFAAAGTD--AMVYLFDSRKPTEALHSMS 287
           K +  L         K P + + +  K+S+ +  A G+D    + ++D R     L  +S
Sbjct: 192 KEVIHLSYTSPNTGLKAPLSVVEWHPKNSTRVATATGSDNDPSILVWDLRNANTPLQVLS 251

Query: 288 -GHQEAVTSLEFAHHKDGILCSGGSDRRVLLWD 319
            GH + V SL++ +  + +L S G D  V+LW+
Sbjct: 252 QGHSKGVLSLDWCNQDENLLLSSGRDNTVVLWN 284

>Kpol_1061.36 s1061 (100800..102569) [1770 bp, 589 aa] {ON}
           (100800..102569) [1770 nt, 590 aa]
          Length = 589

 Score = 57.0 bits (136), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 47/170 (27%), Positives = 76/170 (44%), Gaps = 12/170 (7%)

Query: 169 VASPGELISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSF 228
           V +   L     +G + I+D+   K + T   S H+D V+   W+    NI  S S D  
Sbjct: 334 VGAGSHLAVGQGNGLMEIYDVVKKKCIRTL--SGHTDRVSCLSWNN---NILSSGSRDRR 388

Query: 229 LMIHDKRSEKPLQKLLQKEPFNTIAFS-KHSSNLFAAAGTDAMVYLFDSRKPTEALHSMS 287
           ++  D R   P    ++               N  A+ G D +V ++D    T  L +  
Sbjct: 389 ILHRDVRIADPFFAQIETHTQEVCGLKWNVEENKLASGGNDNIVCVYDGTSVTPTL-TFR 447

Query: 288 GHQEAVTSLEFAHHKDGILCSGG--SDRRVLLWDLFQIGTEQQEEDADDG 335
            H  AV ++ ++ HK GIL +GG  +DRR+ +W+   + T  +  DAD G
Sbjct: 448 EHTAAVKAIGWSPHKRGILATGGGTADRRLKIWN---VNTAMKLNDADTG 494

>NDAI0G03830 Chr7 (919944..921476) [1533 bp, 510 aa] {ON} Anc_3.25
          Length = 510

 Score = 56.2 bits (134), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 54/219 (24%), Positives = 94/219 (42%), Gaps = 21/219 (9%)

Query: 174 ELISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHD 233
           + +SCSDD  + IW+  +GK     V S H   V  C WH  +  +  S S+D+ + + D
Sbjct: 177 KFVSCSDDNILKIWNFSNGKL--ERVLSGHHWDVKSCDWHP-EMGLIISASKDNLIKLWD 233

Query: 234 KRSEKPLQKLLQ-KEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEA 292
            RS   +  +L+ K     + F     N+ AA   D    +FD R   + L  +    + 
Sbjct: 234 PRSGNCVSTILKFKHTVLKVKFQPTGGNMIAAISKDKSCRVFDIRHSMKELLCVRDEVDY 293

Query: 293 VTSLEFAHHKDGILCSGGSDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGHKSAIND 352
           +T L +    + +   G  D  +  +DL Q          D   P  ++ +A H   +  
Sbjct: 294 MT-LLWNPINESMFTVGNYDGSIKHFDLLQ----------DLTKPTHVIPYA-HDKCVTS 341

Query: 353 FSFSPNVPWLMASVEEENIVQIWKPSRKLTNPYFPQGYD 391
            S++P +  ++AS  ++  V+ W  +    +P  P  YD
Sbjct: 342 LSYNP-MGNILASASKDRTVRFWTRA----SPIDPNAYD 375

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 43/151 (28%), Positives = 70/151 (46%), Gaps = 10/151 (6%)

Query: 173 GELISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIH 232
           G +IS S D  I +WD +SG  V T +   H+  V + K+  +  N+  ++S+D    + 
Sbjct: 218 GLIISASKDNLIKLWDPRSGNCVSTILKFKHT--VLKVKFQPTGGNMIAAISKDKSCRVF 275

Query: 233 DKR-SEKPLQKLLQKEPFNTIAFSKHSSNLFAAAGTDAMVYLF----DSRKPTEALHSMS 287
           D R S K L  +  +  + T+ ++  + ++F     D  +  F    D  KPT  +    
Sbjct: 276 DIRHSMKELLCVRDEVDYMTLLWNPINESMFTVGNYDGSIKHFDLLQDLTKPTHVIP--Y 333

Query: 288 GHQEAVTSLEFAHHKDGILCSGGSDRRVLLW 318
            H + VTSL + +    IL S   DR V  W
Sbjct: 334 AHDKCVTSLSY-NPMGNILASASKDRTVRFW 363

>Kpol_1048.59 s1048 complement(166721..169273) [2553 bp, 850 aa]
           {ON} complement(166721..169273) [2553 nt, 851 aa]
          Length = 850

 Score = 56.2 bits (134), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 48/165 (29%), Positives = 72/165 (43%), Gaps = 20/165 (12%)

Query: 222 SVSEDSFLMIHDKRSEKPLQKLLQKE-PFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPT 280
           S SED  + +   + +KPL      E P   + FS   +NLFA A  D    L+   +  
Sbjct: 591 SASEDKTVRLWSVQDDKPLVSYKGHEKPVWDVEFSPSCNNLFATASNDQTARLWSCDR-V 649

Query: 281 EALHSMSGHQEAVTSLEFAHHKDGILCSGGSDRRVLLWDLFQIGTEQQEEDADDGGPELL 340
             L  M+GH   V  + F H     + +G SD+ V +WD+            + G    L
Sbjct: 650 YPLRVMAGHLNDVDCVSF-HSNGRYIFTGSSDKTVRMWDI------------NTGDSVRL 696

Query: 341 MMHAGHKSAINDFSFSPNVPWLMASVEEENIVQIWK--PSRKLTN 383
            M  GH S +   S SP+  W+ ++  ++ I+ IW     RKL N
Sbjct: 697 FM--GHNSTVTSLSVSPDGKWI-STGSDDGIITIWDIGSGRKLKN 738

 Score = 35.4 bits (80), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 23/97 (23%), Positives = 46/97 (47%), Gaps = 2/97 (2%)

Query: 279 PTEALHSMSGHQEAVTSLEFAHHKDGILCSGGSDRRVLLWDLFQIGTEQQEEDADDGGPE 338
           P+ ++++    Q+ +TSLEF+++   +  SG  D  + +W L      + +E  ++    
Sbjct: 507 PSVSIYTFHNTQKNMTSLEFSNNYK-LAASGFQDSYIKIWSLDGYPLSENDEMPNNPISS 565

Query: 339 LLMMHAGHKSAINDFSFSPNVPWLMASVEEENIVQIW 375
                 GH   +   SFS    +L+ S  E+  V++W
Sbjct: 566 TCKTFIGHSGTVYSTSFSAGDEYLL-SASEDKTVRLW 601

 Score = 34.7 bits (78), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 37/92 (40%), Gaps = 15/92 (16%)

Query: 288 GHQEAVTSLEFAHHKDGILCSGGSDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGHK 347
           GH   V S  F+   D  L S   D+ V LW +             D  P  L+ + GH+
Sbjct: 572 GHSGTVYSTSFSAG-DEYLLSASEDKTVRLWSV------------QDDKP--LVSYKGHE 616

Query: 348 SAINDFSFSPNVPWLMASVEEENIVQIWKPSR 379
             + D  FSP+   L A+   +   ++W   R
Sbjct: 617 KPVWDVEFSPSCNNLFATASNDQTARLWSCDR 648

 Score = 32.3 bits (72), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 34/167 (20%), Positives = 70/167 (41%), Gaps = 6/167 (3%)

Query: 155 YAYHKENGYGLNFSVASPGELISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHE 214
           Y  H++  + + FS +      + S+D +  +W     +  P  V + H + V+   +H 
Sbjct: 612 YKGHEKPVWDVEFSPSCNNLFATASNDQTARLWSC--DRVYPLRVMAGHLNDVDCVSFHS 669

Query: 215 SDPNIYGSVSEDSFLMIHDKRSEKPLQKLLQKEPFNTIAFSKHSSNLFAAAGTDAMVYLF 274
           +   I+   S+ +  M      +    +L         + S      + + G+D  +   
Sbjct: 670 NGRYIFTGSSDKTVRMWDINTGDS--VRLFMGHNSTVTSLSVSPDGKWISTGSDDGIITI 727

Query: 275 DSRKPTEALHSMSGH-QEAVTSLEFAHHKDGILCSGGSDRRVLLWDL 320
                   L +M GH + ++ SL + + +  +L SGG+D+ V +WDL
Sbjct: 728 WDIGSGRKLKNMRGHGKSSIHSLSY-NPEGTLLVSGGADQSVRVWDL 773

 Score = 32.0 bits (71), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 35/73 (47%), Gaps = 8/73 (10%)

Query: 124 FDSN--LIATISGTGTVFLYDRTKDDENALRGKYAYHKENGYGLNFSVASPGELISC-SD 180
           F SN   I T S   TV ++D    D   L     +   N    + SV+  G+ IS  SD
Sbjct: 667 FHSNGRYIFTGSSDKTVRMWDINTGDSVRL-----FMGHNSTVTSLSVSPDGKWISTGSD 721

Query: 181 DGSIAIWDIKSGK 193
           DG I IWDI SG+
Sbjct: 722 DGIITIWDIGSGR 734

>CAGL0M04081g Chr13 complement(450572..451939) [1368 bp, 455 aa]
           {ON} highly similar to uniprot|P42841 Saccharomyces
           cerevisiae YNL317w PFS2 polyadenylation factor I
          Length = 455

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 63/281 (22%), Positives = 120/281 (42%), Gaps = 26/281 (9%)

Query: 112 HENEVTRARYAPFDSNLIATISGTGTVFLYDRTKDDENALRGKYAYHKENGYGLNFSVAS 171
           H+  VT  +Y+     +I+     GT+ ++   + + N ++     H E    + FS  +
Sbjct: 123 HDTSVTTMKYSHAGDWMISG-DADGTIKIW---QPNFNMVKELDRIHTEGIRDVAFS-NN 177

Query: 172 PGELISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMI 231
             + ++CSDD  + IW+  +G+     V S H   V  C WH  +  +  S S+D+ + +
Sbjct: 178 DSKFVTCSDDNILKIWNFSNGQQ--ERVLSGHHWDVRSCDWHP-ELGLIVSGSKDNLVKL 234

Query: 232 HDKRSEKPLQKLLQ-KEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQ 290
            D RS + +  LL+ K       F     NL AA   D    +FD R     L  +    
Sbjct: 235 WDPRSGQCVSTLLKFKHTVLKTRFQPTKGNLLAAISKDKSCRVFDLRASMNELMCVRDEV 294

Query: 291 EAVTSLEFAHHKDGILCSGGSDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGHKSAI 350
           + +  LE++   + +   G  D  +  +DL Q           D    + ++   H+  I
Sbjct: 295 DFM-ELEWSTINESMFTVGCYDGSLKHFDLGQ-----------DTEKPIHIIPFAHEKCI 342

Query: 351 NDFSFSPNVPWLMASVEEENIVQIWKPSRKLTNPYFPQGYD 391
           +  +++P V  ++A+  ++  ++ W  +R    P  P  +D
Sbjct: 343 SAIAYNP-VGHILATAAKDRTIRFWTRAR----PVDPNAFD 378

>TBLA0C05010 Chr3 complement(1217846..1219564) [1719 bp, 572 aa]
           {ON} Anc_7.356 YLR196W
          Length = 572

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 46/153 (30%), Positives = 75/153 (49%), Gaps = 13/153 (8%)

Query: 175 LISCSDDGSIAIWDIKSGKTVPTSVNSL-HSDIVNECKWHESDPNIYGSVSEDSFLMIHD 233
           L S S D ++ +WD+ SG T   S+N + H   V+  +WH++D +I  +   DS + + D
Sbjct: 309 LASTSADSTVKLWDLNSG-TAARSLNQVHHGSRVSSSQWHQTDGSILLTAGYDSKIALTD 367

Query: 234 KR--SEKPLQK---LLQKEPFNTIAFSKHSSNLFAAAGTD-AMVYLFDSRK-PTEALHSM 286
            R   EK + K   ++  E   T +F    + L   AGTD   VY FD R   ++ L ++
Sbjct: 368 VRISDEKNMSKYWNVMSGEEIETASFINDYTVL---AGTDNGNVYSFDVRSVESKPLWTL 424

Query: 287 SGHQEAVTSLEFAHHKDGILCSGGSDRRVL-LW 318
             H   +  L    +  G+L +G    +V+ LW
Sbjct: 425 KAHDAGIAGLSVPKNIPGMLLTGAMGEKVIKLW 457

>TPHA0F00770 Chr6 (175091..176986) [1896 bp, 631 aa] {ON} Anc_4.122
           YGL003C
          Length = 631

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 49/179 (27%), Positives = 81/179 (45%), Gaps = 16/179 (8%)

Query: 169 VASPGELISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSF 228
           V +   L     +G + I+DI   K + T   S HSD V+   W+    +I  S S D  
Sbjct: 376 VGTGSHLAVGQSNGLVEIYDIIKRKCIRTL--SGHSDRVSCLSWNN---HILSSGSRDRK 430

Query: 229 LMIHDKRSEKPLQKLLQKEPFNTIAFSKH-SSNLFAAAGTDAMVYLFD--SRKPTEALHS 285
           ++  D RS       ++           +   N  A+ G D +VY++D  + KPT     
Sbjct: 431 ILHRDVRSPDSYFTQIETHTQEVCGLKWNIEDNRLASGGNDNIVYVYDGVNSKPTLMF-- 488

Query: 286 MSGHQEAVTSLEFAHHKDGILCSGG--SDRRVLLWDLFQIGTEQQEEDADDGGPELLMM 342
            + H  AV ++ ++ H+ GIL +GG  +DRR+ +W+   + T  +  D D G     M+
Sbjct: 489 -TEHTAAVKAMTWSPHRRGILATGGGTADRRLKIWN---VNTSAKLNDVDSGSQICNMI 543

>CAGL0A00605g Chr1 complement(67281..69203) [1923 bp, 640 aa] {ON}
           similar to uniprot|P53197 Saccharomyces cerevisiae
           YGL003c CDH1 substrate-specific activator of
           APC-dependent proteolysis
          Length = 640

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 44/158 (27%), Positives = 77/158 (48%), Gaps = 12/158 (7%)

Query: 181 DGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDKRSEKPL 240
           +G + I+D+   K + T   S H D V    W+    +I  S S D  ++  D R   P 
Sbjct: 397 NGIVEIYDVTKEKCIRTL--SGHLDRVACLSWNN---HILSSGSRDRTILHRDVRMADPF 451

Query: 241 QKLLQKEPFNTIAFSKHSS-NLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEAVTSLEFA 299
            + ++           +++ N  A+ G D MV+++D    T  L S++ H+ AV ++ ++
Sbjct: 452 FEKIETHEQEICGLKWNTNDNKLASGGNDNMVFVYDGTSRTPFL-SINEHKAAVKAMAWS 510

Query: 300 HHKDGILCSGG--SDRRVLLWDLFQIGTEQQEEDADDG 335
            HK GIL +GG  +DR + +W+   + T  +  D D G
Sbjct: 511 PHKQGILATGGGTADRTLKMWN---VNTSVKLNDVDTG 545

>KLLA0E07085g Chr5 (645766..647124) [1359 bp, 452 aa] {ON} similar
           to uniprot|P42841 Saccharomyces cerevisiae YNL317W PFS2
           Integral subunit of the pre-mRNA cleavage and
           polyadenylation factor (CPF) complex plays an essential
           role in mRNA 3'-end formation by bridging different
           processing factors and thereby promoting the assembly of
           the processing complex
          Length = 452

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 50/209 (23%), Positives = 88/209 (42%), Gaps = 15/209 (7%)

Query: 174 ELISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHD 233
           + +SCSDD  + IW+  +G+     V S H   V  C WH     +  S S+D+ +   D
Sbjct: 179 KFVSCSDDNVLKIWNFSNGQQ--ERVLSGHHWDVKSCDWHPK-MGLIVSGSKDNLIKFWD 235

Query: 234 KRSEKPLQKLLQ-KEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEA 292
            RS   +  +L  K    +  F     NL +    D    ++D R+  + L S+    + 
Sbjct: 236 PRSGSCVSTMLGFKHTIISTKFQPKQGNLLSVISKDKTCKVYDIRQQAKELFSVRDDVDY 295

Query: 293 VTSLEFAHHKDGILCSGGSDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGHKSAIND 352
           +T L++    + +   G  D  +  +DL Q   E Q        P        H+  +  
Sbjct: 296 MT-LQWHPIDETVFTVGCYDGSIKHFDLSQ---ENQPNKPTHNIP------YAHEKCVTS 345

Query: 353 FSFSPNVPWLMASVEEENIVQIWKPSRKL 381
            ++SP +  +MAS  ++  ++ W  SR +
Sbjct: 346 LAYSP-IGHIMASASKDRTIRFWTRSRAV 373

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 38/151 (25%), Positives = 66/151 (43%), Gaps = 8/151 (5%)

Query: 173 GELISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIH 232
           G ++S S D  I  WD +SG  V T +   H+ I    K+     N+   +S+D    ++
Sbjct: 220 GLIVSGSKDNLIKFWDPRSGSCVSTMLGFKHTII--STKFQPKQGNLLSVISKDKTCKVY 277

Query: 233 DKRSE-KPLQKLLQKEPFNTIAFSKHSSNLFAAAGTDAMVYLFD---SRKPTEALHSMS- 287
           D R + K L  +     + T+ +      +F     D  +  FD     +P +  H++  
Sbjct: 278 DIRQQAKELFSVRDDVDYMTLQWHPIDETVFTVGCYDGSIKHFDLSQENQPNKPTHNIPY 337

Query: 288 GHQEAVTSLEFAHHKDGILCSGGSDRRVLLW 318
            H++ VTSL ++     I+ S   DR +  W
Sbjct: 338 AHEKCVTSLAYS-PIGHIMASASKDRTIRFW 367

>ZYRO0A08690g Chr1 (691253..692803) [1551 bp, 516 aa] {ON} highly
           similar to uniprot|Q04225 Saccharomyces cerevisiae
           YMR131C RRB1 RiboSome Assembly 2
          Length = 516

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 79/401 (19%), Positives = 162/401 (40%), Gaps = 54/401 (13%)

Query: 24  PLMYDFVSETRLLWPSLTIQWLPRA----EDSTEQELLVGTHTS-----DSEQNYLKIAE 74
           P +Y+ +    + WP +T+  +P        S  Q LL+ T T      D+E   LK+++
Sbjct: 118 PSVYEMLHNVNMPWPCMTLDVIPDTLGSERRSYPQSLLLTTATQATRKKDNELMVLKLSQ 177

Query: 75  INLPQEILSNEGPVLQNDNNGSDEQVPSKIKIIKKFKHENEVTRARYAPFDSN----LIA 130
             L + ++ ++      D+   ++     I   +    ++   R + +PF ++    L A
Sbjct: 178 --LSKTLVKDDTEENDEDDEDDEDADSDPIIENENIALKDTTNRLKVSPFATHGQEVLTA 235

Query: 131 TISGTGTVFLYDR--------------TKDDENALRGKYAYHKENGYGLNFS-VASPGEL 175
           T+   G V+++D                K    A+     +    GYGL++S +   G L
Sbjct: 236 TMCENGEVYVFDLGAQTKAFETPGYQVPKTSRKAIHTIRNHGNVEGYGLDWSPLIKTGAL 295

Query: 176 ISCSDDGSIAIWDIKSGK--TVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHD 233
           ++    G I +    + K  T      + ++  V + +W  ++  ++ +   D ++ I D
Sbjct: 296 LTGDCSGQIFLTQRHTSKWITDKQPFTAANNQSVEDIQWSPTESTVFATSGTDGYVRIWD 355

Query: 234 KRSEK---PLQKLLQKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEA-------L 283
            RS+K    +         N I++++    L A+   +    ++D R+ + A       +
Sbjct: 356 TRSKKHKPAISTRASNTDVNVISWNEKLGYLLASGDDNGSWGVWDLRQFSPANSEGVQPV 415

Query: 284 HSMSGHQEAVTSLEFAHHKDGILCSGGSDRRVLLWDL--------FQIGTEQQEEDADDG 335
                H+  +TS+ F    D ++     D  V LWDL         Q  T++ +E     
Sbjct: 416 AQYDFHRGPITSISFNPLDDSVVAVASEDNTVTLWDLSVEADDDEIQQQTKEYKE-LQKI 474

Query: 336 GPELLMMHAGHKSAINDFSFSPNVPWLMASVEEENIVQIWK 376
            P+LL +H   +  + D  +   +P  + S   + +  +WK
Sbjct: 475 PPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDGL-NVWK 512

>ZYRO0D05852g Chr4 (498219..499334) [1116 bp, 371 aa] {ON} similar
           to uniprot|P39108 Saccharomyces cerevisiae YDR142C PEX7
           May serve as intraperoxisomal receptor for type 2
           peroxisomal proteins (such as thiolase) Member of
           beta-transducin-related (WD-40) protein family
          Length = 371

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 58/256 (22%), Positives = 107/256 (41%), Gaps = 27/256 (10%)

Query: 127 NLIATISGTGTVFLYDRTKDDENALRGKYAYHKENGYGLNFSVASPGELISCSDDGSIAI 186
           N +    G GT+ L+D TK  +  +   +  H++  +  N+++      +S S DG++ I
Sbjct: 74  NQVLVAQGDGTLRLFD-TKLKQYPI-AIFNEHQKEVFSCNWNLVGKQNFVSSSWDGAVKI 131

Query: 187 WDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDKRSEKPLQKLLQK 246
           W  +  +++ T V          C    + P +           + +++    + K   K
Sbjct: 132 WSPQRKESLLTVVPRPMDVSTMAC----AGPQV----------PMSNQKGHADIAK--NK 175

Query: 247 EPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALH--SMSGHQ--EAVTSLEFAHHK 302
                  FS H  NL      ++ V LFDSR+P    +  S   H   EA+T  +F  ++
Sbjct: 176 NCIYQALFSPHDPNLVMCCSGNSYVTLFDSRQPPTPANQKSFLAHSGLEALT-CDFNKYR 234

Query: 303 DGILCSGGSDRRVLLWDLFQIGTEQQEEDADDGGPELLM--MHAGHKSAINDFSFSPNVP 360
              L +GG D  + +WDL  +G         +  P +    +  GH+ A+   S+SP+  
Sbjct: 235 PHSLVTGGVDNCIRIWDLRMVGPSAASR--ANASPAVCTNEIVGGHELAVRKVSWSPHHS 292

Query: 361 WLMASVEEENIVQIWK 376
            ++ S   +    IW+
Sbjct: 293 NILLSTSYDMTCCIWQ 308

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 49/230 (21%), Positives = 87/230 (37%), Gaps = 49/230 (21%)

Query: 111 KHENEVTRARYAPFDSNLIATISGTGTVFLYDRTKDDENALRGKYAYHKE-NGYGLNFSV 169
           K++N + +A ++P D NL+   SG   V L+D  +    A +  +  H        +F+ 
Sbjct: 173 KNKNCIYQALFSPHDPNLVMCCSGNSYVTLFDSRQPPTPANQKSFLAHSGLEALTCDFNK 232

Query: 170 ASPGELISCSDDGSIAIWDIKS-GKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSF 228
             P  L++   D  I IWD++  G +  +  N+  +   NE         I G       
Sbjct: 233 YRPHSLVTGGVDNCIRIWDLRMVGPSAASRANASPAVCTNE---------IVGG------ 277

Query: 229 LMIHDKRSEKPLQKLLQKEPFNTIAFSKHSSNLFAAAGTDAMVYL-----FDSRKPTEAL 283
              H+    K             +++S H SN+  +   D    +     FD R+ T   
Sbjct: 278 ---HELAVRK-------------VSWSPHHSNILLSTSYDMTCCIWQDLGFDGRRSTGRT 321

Query: 284 HSMSGHQEAVTSL----EFAHHKD-------GILCSGGSDRRVLLWDLFQ 322
           +S+   +   +      EF +  D       G + S   D  V +W+ F+
Sbjct: 322 NSVDPRRGCRSRFAQHTEFVYSADWCLWGQPGHIASTAWDGNVFIWNAFR 371

>Kpol_1013.37 s1013
           complement(88637..88936,88986..88994,89037..90134) [1407
           bp, 468 aa] {ON}
           complement(88637..88936,88986..88994,89037..90134) [1407
           nt, 469 aa]
          Length = 468

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 54/211 (25%), Positives = 94/211 (44%), Gaps = 14/211 (6%)

Query: 112 HENEVTRARYAPFDSNLIATISGTGTVFLYDRTKDDENALRGKYAYHKENGYGLNFSVAS 171
           H+  VT  ++ P     I + S   T  L+D   + E  L+     H +  Y L+F   +
Sbjct: 267 HDARVTNVKFHP-SQKYIGSASFDTTWRLWDIVTNSELLLQ---EGHSKEIYSLSFQ--T 320

Query: 172 PGELISCSDDGSIAI-WDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLM 230
            G LI+ +    + I WD++SGK + + V   H+  +    W  S        S D  + 
Sbjct: 321 DGSLIATAGADKVGIIWDLRSGKNILSLVG--HAKPIYCSDW--SQNGYQXXXSGDGTIK 376

Query: 231 IHDKRSEKPLQKLL-QKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGH 289
           I D R    ++ +L  K     + F K +S    ++  D  + +F S    + +H++ GH
Sbjct: 377 IWDLRKVDDVETILAHKNVVTDLKFEKENSKFLISSSYDKDINVFSSDSWVK-IHTLQGH 435

Query: 290 QEAVTSLEFAHHKDGILCSGGSDRRVLLWDL 320
            + + S++ +     I+ SGG DR V LW +
Sbjct: 436 NDKILSIDISSDYQTIV-SGGWDRSVKLWSM 465

>Kpol_1014.19 s1014 complement(30466..31824) [1359 bp, 452 aa] {ON}
           complement(30466..31824) [1359 nt, 453 aa]
          Length = 452

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 53/219 (24%), Positives = 90/219 (41%), Gaps = 21/219 (9%)

Query: 174 ELISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHD 233
           + ++C+DD  + IW+  +G+     V S H   V  C WH  +  +  S S+D+ + + D
Sbjct: 180 KFVTCADDNVLKIWNFSNGQQ--ERVLSGHHWDVKSCDWHP-EMGLIVSASKDNLIRLWD 236

Query: 234 KRSEKPLQKLLQ-KEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEA 292
            RS + +  LL  K       F     NL  A   D    +FD R     L       + 
Sbjct: 237 PRSGQCISSLLNFKHTVLKTRFQPTKGNLLTAISKDKSCRVFDIRHSMRELMVYRDEVDY 296

Query: 293 VTSLEFAHHKDGILCSGGSDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGHKSAIND 352
           +T LE+    + +      D  +  +D+ Q          D   P  ++ +A H   I  
Sbjct: 297 MT-LEWHPTNETMFTVASYDGSLKHFDILQ----------DLEKPTHVVPYA-HDKCITS 344

Query: 353 FSFSPNVPWLMASVEEENIVQIWKPSRKLTNPYFPQGYD 391
            S++P V  ++AS  ++  ++ W  +R    P  P  YD
Sbjct: 345 LSYNP-VGHILASAAKDRTIRFWTRAR----PVDPNAYD 378

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 38/151 (25%), Positives = 70/151 (46%), Gaps = 10/151 (6%)

Query: 173 GELISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIH 232
           G ++S S D  I +WD +SG+ + + +N  H+  V + ++  +  N+  ++S+D    + 
Sbjct: 221 GLIVSASKDNLIRLWDPRSGQCISSLLNFKHT--VLKTRFQPTKGNLLTAISKDKSCRVF 278

Query: 233 DKR-SEKPLQKLLQKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDS----RKPTEALHSMS 287
           D R S + L     +  + T+ +   +  +F  A  D  +  FD      KPT  +    
Sbjct: 279 DIRHSMRELMVYRDEVDYMTLEWHPTNETMFTVASYDGSLKHFDILQDLEKPTHVVP--Y 336

Query: 288 GHQEAVTSLEFAHHKDGILCSGGSDRRVLLW 318
            H + +TSL + +    IL S   DR +  W
Sbjct: 337 AHDKCITSLSY-NPVGHILASAAKDRTIRFW 366

>Kwal_56.23895 s56 complement(763257..764360) [1104 bp, 367 aa] {ON}
           YDR142C (PEX7) - Member of beta-transducin-related
           (WD-40) protein family [contig 171] FULL
          Length = 367

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 60/297 (20%), Positives = 123/297 (41%), Gaps = 46/297 (15%)

Query: 119 ARYAPFDSNLIATISGT-------GTVFLYDRTKDDENALRGKYAYHKENG-YGLNFSVA 170
            +Y+PF  N +A  +G+       G +F+ D   +++  +    ++  ++G + + ++  
Sbjct: 14  VQYSPFFDNRLAVATGSNFGLVGNGKLFIVD--INNQGIMTEAKSFLTQDGLFDVAWNEL 71

Query: 171 SPGELISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLM 230
              +++    DGS+ ++D +     P ++   H   V  C W+  +  ++ S S D  + 
Sbjct: 72  HENQVLVAQGDGSLRLFDTQL-TDYPIAIFHEHEKEVFSCNWNLINKQLFVSSSWDGTVK 130

Query: 231 IHDKRSEKPLQKLLQK-----EPF---------------------NTI---AFSKHSSNL 261
           +      K L  L  K      P                      N I    FS H  N+
Sbjct: 131 VWSPTRPKSLATLTPKPMAAQNPLMPSKDIPMSNQQNHTSLSKNKNCIYQSQFSPHDPNV 190

Query: 262 FAAAGTDAMVYLFDSRKPTEA-LHSMSGHQEAVT-SLEFAHHKDGILCSGGSDRRVLLWD 319
             +   ++ V +FD R+P  A  +S   H    T + +F  ++  I+ +GG D  + +WD
Sbjct: 191 IMSCAGNSYVTMFDLRQPPGANQYSFLAHNGMETLTCDFNKYRSHIVATGGVDNMIKVWD 250

Query: 320 LFQIGTEQQEEDADDGGPELLMMHAGHKSAINDFSFSPNVPWLMASVEEENIVQIWK 376
           L  +    ++  ++   P  +    GH  AI   S+SP+   ++ S   +   ++W+
Sbjct: 251 LRMV----RKAASNSRQPMSVNEICGHDLAIRKVSWSPHHSNMLLSTSYDMTCRVWQ 303

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 47/251 (18%), Positives = 101/251 (40%), Gaps = 43/251 (17%)

Query: 108 KKFKHENEVTRARYAPFDSNLIATISGTGTVFLYDRTKDDENALRGKYAYHKENGYGLNF 167
           K F  ++ +    +     N +    G G++ L+D    D       +  H++  +  N+
Sbjct: 55  KSFLTQDGLFDVAWNELHENQVLVAQGDGSLRLFDTQLTDYPI--AIFHEHEKEVFSCNW 112

Query: 168 SVASPGELISCSDDGSIAIWD--------------------IKSGKTVPTSVNSLHSDI- 206
           ++ +    +S S DG++ +W                     +   K +P S    H+ + 
Sbjct: 113 NLINKQLFVSSSWDGTVKVWSPTRPKSLATLTPKPMAAQNPLMPSKDIPMSNQQNHTSLS 172

Query: 207 -----VNECKWHESDPNIYGSVSEDSFLMIHDKRSEKPLQK--LLQKEPFNTIA--FSKH 257
                + + ++   DPN+  S + +S++ + D R      +   L      T+   F+K+
Sbjct: 173 KNKNCIYQSQFSPHDPNVIMSCAGNSYVTMFDLRQPPGANQYSFLAHNGMETLTCDFNKY 232

Query: 258 SSNLFAAAGTDAMVYLFD----------SRKPTEALHSMSGHQEAVTSLEFAHHKDGILC 307
            S++ A  G D M+ ++D          SR+P  +++ + GH  A+  + ++ H   +L 
Sbjct: 233 RSHIVATGGVDNMIKVWDLRMVRKAASNSRQPM-SVNEICGHDLAIRKVSWSPHHSNMLL 291

Query: 308 SGGSDRRVLLW 318
           S   D    +W
Sbjct: 292 STSYDMTCRVW 302

 Score = 35.4 bits (80), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 38/171 (22%), Positives = 71/171 (41%), Gaps = 21/171 (12%)

Query: 111 KHENEVTRARYAPFDSNLIATISGTGTVFLYD-RTKDDENALRGKYAYHKENGY---GLN 166
           K++N + +++++P D N+I + +G   V ++D R     N    +Y++   NG      +
Sbjct: 173 KNKNCIYQSQFSPHDPNVIMSCAGNSYVTMFDLRQPPGAN----QYSFLAHNGMETLTCD 228

Query: 167 FSVASPGELISCSDDGSIAIWDIK------SGKTVPTSVNSL--HSDIVNECKWHESDPN 218
           F+      + +   D  I +WD++      S    P SVN +  H   + +  W     N
Sbjct: 229 FNKYRSHIVATGGVDNMIKVWDLRMVRKAASNSRQPMSVNEICGHDLAIRKVSWSPHHSN 288

Query: 219 IYGSVSEDSFLMIHDKRSE---KPLQKLLQKEPFN--TIAFSKHSSNLFAA 264
           +  S S D    +    S+   +P  K    +P       F  H+  +F A
Sbjct: 289 MLLSTSYDMTCRVWQDLSDDGRRPTGKTNSVDPARGCRFVFPHHTEFVFGA 339

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 21/90 (23%), Positives = 40/90 (44%), Gaps = 14/90 (15%)

Query: 112 HENEVTRARYAPFDSNLIATISGTGTVFLYDRTKDDENALRGK-------------YAYH 158
           H+  + +  ++P  SN++ + S   T  ++    DD     GK             + +H
Sbjct: 273 HDLAIRKVSWSPHHSNMLLSTSYDMTCRVWQDLSDDGRRPTGKTNSVDPARGCRFVFPHH 332

Query: 159 KENGYGLNFSV-ASPGELISCSDDGSIAIW 187
            E  +G ++S+   PG + S S DG + +W
Sbjct: 333 TEFVFGADWSLWGKPGYIASTSWDGDVCVW 362

>ADR090W Chr4 (868742..872443) [3702 bp, 1233 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL195W (SEC31)
          Length = 1233

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 55/238 (23%), Positives = 96/238 (40%), Gaps = 30/238 (12%)

Query: 153 GKYAYHKENGYGLNFSVASPGELISCSDDGSIAIWD---IKSGKTVPTSVNSLHSDI--V 207
            + A H      + F+       +S    G I +WD   I +    P    +  + I  V
Sbjct: 97  ARVARHTTGVRAVRFNAKQANVAVSGGSQGEIFVWDTNKISAAGYSPFGPGTAMTPIDEV 156

Query: 208 NECKWHESDPNIYGSVSEDSFLMIHDKRSEKPLQKLLQKEPF----NTIAFSK-HSSN-- 260
               W++S  +++ S     F  I D +++K +  L    P     N +A  + H SN  
Sbjct: 157 QSLAWNQSLAHVFASAGSSGFASIWDLKAKKEVIHLSYTSPHSGLKNQLAVVEWHPSNST 216

Query: 261 -LFAAAGTD--AMVYLFDSRKPTEALHSMS-GHQEAVTSLEFAHHKDGILCSGGSDRRVL 316
            +  A G D   ++ ++D R     L  MS GH + + SL++  H + ++ S G D   +
Sbjct: 217 RVATATGNDNEPVILVWDLRNANMPLQVMSQGHSKGILSLDWCKHDEKLMLSSGRDNTCI 276

Query: 317 LWDLFQIGTEQQEEDADDGGPELLMMHAGHKSAINDFSFSPNVPWLMASVEEENIVQI 374
           LW+          E+A     + L  +    +      F+P  P L AS   +N +Q+
Sbjct: 277 LWN---------PEEA-----QKLTQYPTRGNWCFKTKFAPEAPDLFASASFDNKIQV 320

 Score = 32.0 bits (71), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 31/142 (21%), Positives = 63/142 (44%), Gaps = 22/142 (15%)

Query: 251 TIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALH-----SMSGHQEAVTSLEF-AHHKDG 304
           ++A+++  +++FA+AG+     ++D +   E +H       SG +  +  +E+   +   
Sbjct: 158 SLAWNQSLAHVFASAGSSGFASIWDLKAKKEVIHLSYTSPHSGLKNQLAVVEWHPSNSTR 217

Query: 305 ILCSGGSDRR--VLLWDLFQIGTEQQEEDADDGGPELLMMHAGHKSAINDFSFSPNVPWL 362
           +  + G+D    +L+WDL             +    L +M  GH   I    +  +   L
Sbjct: 218 VATATGNDNEPVILVWDL------------RNANMPLQVMSQGHSKGILSLDWCKHDEKL 265

Query: 363 MASVEEENIVQIWKP--SRKLT 382
           M S   +N   +W P  ++KLT
Sbjct: 266 MLSSGRDNTCILWNPEEAQKLT 287

>TBLA0G01490 Chr7 (389958..392156) [2199 bp, 732 aa] {ON} Anc_4.122
           YGL003C
          Length = 732

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 40/143 (27%), Positives = 68/143 (47%), Gaps = 9/143 (6%)

Query: 181 DGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDKRSEKPL 240
           +G I I+D+   K + T   S H+D      W+    +I  S S D  ++  D R + P 
Sbjct: 489 NGIIEIYDVTKRKCIRTL--SGHTDRTACLSWNS---HILTSGSRDRTILHRDVRMKDPF 543

Query: 241 QKLLQKEPFNTIAFS-KHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEAVTSLEFA 299
            + ++             S N   + G D  V ++D   PT  L ++  H  AV +L ++
Sbjct: 544 FERIKSHTQEVCGLKWNESDNKLVSGGNDNTVNIYDGCMPTPLL-TLDEHTAAVKALAWS 602

Query: 300 HHKDGILCSGG--SDRRVLLWDL 320
            HK GIL +GG  +DR++ +W++
Sbjct: 603 PHKRGILATGGGTADRKLKIWNI 625

>KAFR0B05700 Chr2 complement(1176020..1177138) [1119 bp, 372 aa]
           {ON} Anc_8.316 YDR142C
          Length = 372

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 75/336 (22%), Positives = 127/336 (37%), Gaps = 77/336 (22%)

Query: 119 ARYAPFDSNLIATISGT-------GTVFLYDRTKDDENALRGKYAYHKENGYGLN---FS 168
            +Y+PF  N +A  +G        G V+L +        +  K   H+ N +      F 
Sbjct: 14  VQYSPFFDNKLAVATGANFGLVGNGKVYLLE--------IDSKGQIHETNSFLTQDCLFD 65

Query: 169 VA----SPGELISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVS 224
           VA       +++    DGS+ ++D  + K  P  + + H   V  C W+    N + S S
Sbjct: 66  VAWNELHENQVLVAQGDGSLRLFDT-TLKDYPIEIFNEHEREVFSCSWNLITKNTFTSSS 124

Query: 225 EDSFLMIHDKRSEKPLQKLL----------------------------QKEPFNTIAFSK 256
            D  + I     +  L  L+                             K       FS 
Sbjct: 125 WDGTVKIWSPLRKASLLTLVPHPLKVMKNFDQVDIPISNQKAHTAISKNKNCIYQAQFSP 184

Query: 257 HSSNLFAAAGTDAMVYLFDSRKPTEA-----LHSMSGHQEAVTSLEFAHHKDGILCSGGS 311
           H  NL      ++   LFD R+P+ +       S SG  EA+T  +F  ++  I+ +GG 
Sbjct: 185 HDPNLVICCAGNSYTTLFDLRQPSTSNNQQNFFSHSG-LEALTC-DFNKYRPNIVATGGV 242

Query: 312 DRRVLLWDL------FQIGTEQQEEDADDGGPELLMMHAGHKSAINDFSFSPNVPWLMAS 365
           D  + +WDL      FQ GT++     D+    +  +  GH+ A+   S+SP+    + S
Sbjct: 243 DNTIRIWDLRMLSKQFQAGTQR-----DNSIMCVNEIKKGHELAVRKVSWSPHSSTTLLS 297

Query: 366 VEEENIVQIWK--------PSRKLTNPYFPQGYDIR 393
              +    +W+        P+ K  +  F +G   R
Sbjct: 298 TSYDMTCCVWQDLSSNGKAPTGKTNSTDFRRGCITR 333

 Score = 37.7 bits (86), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 24/109 (22%), Positives = 48/109 (44%), Gaps = 18/109 (16%)

Query: 100 VPSKIKIIKKF-----------------KHENEVTRARYAPFDSNLIATISGTGTVFLYD 142
           VP  +K++K F                 K++N + +A+++P D NL+   +G     L+D
Sbjct: 144 VPHPLKVMKNFDQVDIPISNQKAHTAISKNKNCIYQAQFSPHDPNLVICCAGNSYTTLFD 203

Query: 143 -RTKDDENALRGKYAYHKENGYGLNFSVASPGELISCSDDGSIAIWDIK 190
            R     N  +  +++        +F+   P  + +   D +I IWD++
Sbjct: 204 LRQPSTSNNQQNFFSHSGLEALTCDFNKYRPNIVATGGVDNTIRIWDLR 252

>YPR178W Chr16 (892332..893729) [1398 bp, 465 aa] {ON}  PRP4Splicing
           factor, component of the U4/U6-U5 snRNP complex
          Length = 465

 Score = 53.5 bits (127), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 57/215 (26%), Positives = 96/215 (44%), Gaps = 20/215 (9%)

Query: 112 HENEVTRARYAPFDSNLIATISGTGTVFLYDRTKDDENALRGKYAYHKENGYGLNFSVAS 171
           HE  ++  +Y P     I + S   T  L+D +   E  L+     H +  + L+F    
Sbjct: 264 HERRISDVKYHP-SGKFIGSASHDMTWRLWDASTHQELLLQ---EGHDKGVFSLSFQC-- 317

Query: 172 PGELISCSDDGSIA-IWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIY--GSVSEDSF 228
            G L+      S++ +WDI+SG  V T     HS  +    W    PN Y   +   D  
Sbjct: 318 DGSLVCSGGMDSLSMLWDIRSGSKVMTLAG--HSKPIYTVAW---SPNGYQVATGGGDGI 372

Query: 229 LMIHD--KRSEKPLQKLLQKEPFNT-IAFSKH-SSNLFAAAGTDAMVYLFDSRKPTEALH 284
           + + D  KR E  L ++L      T + FSK        + G D ++ ++ S    + + 
Sbjct: 373 INVWDIRKRDEGQLNQILAHRNIVTQVRFSKEDGGKKLVSCGYDNLINVYSSDTWLK-MG 431

Query: 285 SMSGHQEAVTSLEFAHHKDGILCSGGSDRRVLLWD 319
           S++GH + + SL+ +++    L SGG DR + LW+
Sbjct: 432 SLAGHTDKIISLDISNNSH-FLVSGGWDRSIKLWN 465

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 46/185 (24%), Positives = 80/185 (43%), Gaps = 27/185 (14%)

Query: 203 HSDIVNECKWHESDPNIYGSVSEDSFLMIHDKRSEKPLQKLL-----QKEPFNTIAFSKH 257
           H   +    WH    N   S +ED  +      +E+   +LL      +   + + +  H
Sbjct: 217 HVGKIGAIDWHPDSNNQMISCAEDGLIKNFQYSNEEGGLRLLGDLVGHERRISDVKY--H 274

Query: 258 SSNLFAAAGTDAMVY-LFDSRKPTEALHSMSGHQEAVTSLEFAHHKDG-ILCSGGSDRRV 315
            S  F  + +  M + L+D+    E L    GH + V SL F    DG ++CSGG D   
Sbjct: 275 PSGKFIGSASHDMTWRLWDASTHQELLLQ-EGHDKGVFSLSF--QCDGSLVCSGGMDSLS 331

Query: 316 LLWDLFQIGTEQQEEDADDGGPELLMMHAGHKSAINDFSFSPNVPWLMASVEEENIVQIW 375
           +LWD+ + G++             +M  AGH   I   ++SPN  + +A+   + I+ +W
Sbjct: 332 MLWDI-RSGSK-------------VMTLAGHSKPIYTVAWSPN-GYQVATGGGDGIINVW 376

Query: 376 KPSRK 380
              ++
Sbjct: 377 DIRKR 381

>KNAG0A01230 Chr1 complement(17341..21306) [3966 bp, 1321 aa] {ON}
           Anc_3.22 YOL138C
          Length = 1321

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 48/194 (24%), Positives = 78/194 (40%), Gaps = 24/194 (12%)

Query: 127 NLIATISGTGTVFLYD--RTKDDENALRGKYAYHKENGYGLNFSVASPGELISCSDDGSI 184
           N +A  + + TV L+D  R    ++AL    A H  +    +F++     LIS   DG +
Sbjct: 205 NYVAVCTNSTTVSLFDINRANQTDSALVSSLAEHTRSVNSFDFNMMQTNLLISGGQDGCV 264

Query: 185 AIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDKRSEKPLQKLL 244
            IWDI++    PT        IVN C    +    +GS+ +  ++  ++           
Sbjct: 265 KIWDIRTNN--PTK-------IVNTCDVRIN--TTFGSIRDIKWMPGYN----------F 303

Query: 245 QKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEAVTSLEFAHHKDG 304
                N      H    FA+      +  FD R+P +    ++ H      L +  H+D 
Sbjct: 304 SGNDRNYTDLRSHGGYKFASIHDSGALLKFDMRQPNQPEKRINAHTGPGLCLNWHPHQDY 363

Query: 305 ILCSGGSDRRVLLW 318
           I  SGG D +  LW
Sbjct: 364 I-ASGGRDGKCCLW 376

 Score = 35.4 bits (80), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 30/65 (46%), Gaps = 4/65 (6%)

Query: 260 NLFAAAGTDAMVYLFDSRKPTEA----LHSMSGHQEAVTSLEFAHHKDGILCSGGSDRRV 315
           N  A       V LFD  +  +     + S++ H  +V S +F   +  +L SGG D  V
Sbjct: 205 NYVAVCTNSTTVSLFDINRANQTDSALVSSLAEHTRSVNSFDFNMMQTNLLISGGQDGCV 264

Query: 316 LLWDL 320
            +WD+
Sbjct: 265 KIWDI 269

>KAFR0I02840 Chr9 complement(570039..571409) [1371 bp, 456 aa] {ON}
           Anc_3.25 YNL317W
          Length = 456

 Score = 53.1 bits (126), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 60/252 (23%), Positives = 104/252 (41%), Gaps = 29/252 (11%)

Query: 141 YDRTKDDENALRGKYAYHKENGYGLNFSVASPGELISCSDDGSIAIWDIKSGKTVPTSVN 200
           ++  K+ ENA       H E    ++F+ A   + ++CSDD  + IW+  +G+     V 
Sbjct: 154 FNMVKELENA-------HTECIRDISFNNAD-SKFVTCSDDNILKIWNFSNGQQ--ERVL 203

Query: 201 SLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDKRSEKPLQKLLQ-KEPFNTIAFSKHSS 259
           S H   V  C WH +   +  S S+D+ + + D RS   +  +L+ K       F     
Sbjct: 204 SGHHWDVKSCDWHPT-MGLIASASKDNLIKLWDPRSGNCVSTILKFKHTVLKTRFQPTKG 262

Query: 260 NLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEAVTSLEFAHHKDGILCSGGSDRRVLLWD 319
           NL  A   D    +FD R   + L  +    + +T L +    + +   G  D  +  +D
Sbjct: 263 NLLVAISKDKSCRVFDIRHSMKELMVVRDEVDYMT-LLWHPINESVFTVGNYDGSLKHFD 321

Query: 320 LFQIGTEQQEEDADDGGPELLMMHAGHKSAINDFSFSPNVPWLMASVEEENIVQIWKPSR 379
           + Q          D   P   +  A H   I   S++  +  ++AS  ++  V+ W  +R
Sbjct: 322 ILQ----------DLSNPTHSIPFA-HDKCITSMSYNA-MGTVLASASKDRTVRFWTRAR 369

Query: 380 KLTNPYFPQGYD 391
               P+ P  YD
Sbjct: 370 ----PFDPNAYD 377

>Kpol_2001.65 s2001 (178299..181919) [3621 bp, 1206 aa] {ON}
           (178299..181919) [3621 nt, 1207 aa]
          Length = 1206

 Score = 53.5 bits (127), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 69/279 (24%), Positives = 115/279 (41%), Gaps = 40/279 (14%)

Query: 104 IKIIKKFKHENEVTRARYAPFDSN----LIATISGTGTVFLYDRTKDDENALRGKYAYHK 159
           +K++ KF  E++ TRA+   F  +    L+A  S T  ++ Y         L  +Y  H+
Sbjct: 1   MKLLTKF--ESKSTRAKGIAFHPSRPWVLVALFSSTIQLWDYRM-----GTLLHRYEDHE 53

Query: 160 ENGYGLNFSVASPGELISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNI 219
               G++F    P   +S  DD +I +W +++ K + T     H D V    +H+  P I
Sbjct: 54  GPVRGIDFHPTQP-LFVSAGDDYTIKVWSLETNKCLYTLDG--HLDYVRTVFFHKELPWI 110

Query: 220 YGSVSEDSFLMIHDKRSEKPLQKLLQKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKP 279
             S S+D  + I + ++ K +  +     F   A    + +L  +A  D  V ++D  K 
Sbjct: 111 I-SASDDQTIRIWNWQNRKEIACITGHNHFVMCAQFHPTEDLIVSASLDETVRVWDISKL 169

Query: 280 TEALHSMSGHQEAVTSLEFAHHKDGILCSGGSDRRVLLWDLFQIGTEQQEEDADDGGPEL 339
            E  HS  G     TS E                        +I  +Q   D   G   +
Sbjct: 170 REK-HSAPGRSAMPTSFEE-----------------------KIAAQQNLLDGGFGDCTV 205

Query: 340 LMMHAGHKSAINDFSFSPNVPWLMASVEEENIVQIWKPS 378
             +  GH   +N  SF P +P L+ S  ++  V++WK S
Sbjct: 206 KFILEGHTRGVNWASFHPTLP-LIVSGGDDRQVKLWKMS 243

 Score = 38.1 bits (87), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 26/111 (23%), Positives = 52/111 (46%), Gaps = 2/111 (1%)

Query: 175 LISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDK 234
           ++S  DD  + +W + + K         H++ V+   +H +  N+  SV ED  L + D 
Sbjct: 228 IVSGGDDRQVKLWKMSATKAWELDSCRGHTNNVDSVIFHPTQ-NLILSVGEDKTLRVWDL 286

Query: 235 RSEKPLQKLLQKEPFNTIAFSKHSSNLFAAA-GTDAMVYLFDSRKPTEALH 284
               P+++  ++     +  +  + NLF AA  +  M++  D  +P  A+H
Sbjct: 287 DKRTPVKQFKRENDRFWLIAAHPNINLFGAAHDSGIMIFKLDRERPPFAIH 337

 Score = 31.6 bits (70), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 43/107 (40%), Gaps = 8/107 (7%)

Query: 261 LFAAAGTDAMVYLFD-SRKPTEALHSMSGHQEAVTSLEFAHHKDGILCSGGSDRRVLLWD 319
           L  + G D  V L+  S      L S  GH   V S+ F H    ++ S G D+ + +WD
Sbjct: 227 LIVSGGDDRQVKLWKMSATKAWELDSCRGHTNNVDSVIF-HPTQNLILSVGEDKTLRVWD 285

Query: 320 LFQIGTEQQEEDADD------GGPELLMMHAGHKSAINDFSFSPNVP 360
           L +    +Q +  +D        P + +  A H S I  F      P
Sbjct: 286 LDKRTPVKQFKRENDRFWLIAAHPNINLFGAAHDSGIMIFKLDRERP 332

>AAR078W Chr1 (483989..485677) [1689 bp, 562 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR196W (PWP1)
          Length = 562

 Score = 53.1 bits (126), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 48/194 (24%), Positives = 86/194 (44%), Gaps = 18/194 (9%)

Query: 175 LISCSDDGSIAIWDIKSGKTVPTSVNSLHS-DIVNECKWHESDPNIYGSVSEDSFLMIHD 233
           L S S D ++ +WD+  G+    S++++HS   V+  +WH SD +I  +   DS + + D
Sbjct: 287 LASTSADHTVKLWDLNHGRAA-RSLDAVHSATAVSSSQWHPSDGSILLTAGYDSRVALSD 345

Query: 234 KR-----SEKPLQKLLQKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEA--LHSM 286
            R           K+++ E   +  F   S  +F A      VY FD R   ++  L ++
Sbjct: 346 VRIANDAGMSKYWKVMKGEEIESATFV--SETVFLAGTDSGNVYSFDLRNGEDSAPLWTL 403

Query: 287 SGHQEAVTSLEFAHHKDGILCSGGSDRRVL-LWDLFQIGTEQQEEDADDGGPELLMMHAG 345
           + H   ++SL  +     +L +     +V+ LW     G   QE      GP +++    
Sbjct: 404 NAHDSGISSLSVSPSIPNMLVTSAMGEKVIKLWKTPAEGASAQE------GPRMVLSRDF 457

Query: 346 HKSAINDFSFSPNV 359
               +   SF+P+V
Sbjct: 458 GVGNVLSTSFAPDV 471

 Score = 35.4 bits (80), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 43/169 (25%), Positives = 73/169 (43%), Gaps = 50/169 (29%)

Query: 251 TIAFSKHSSNLFAAAGTDAMVYLFD-----SRKPTEALHSMSGHQEAVTSLEFAHHKDG- 304
           ++A ++H   + A+   D  V L+D     + +  +A+HS +    AV+S ++ H  DG 
Sbjct: 276 SLAHNRHFRAVLASTSADHTVKLWDLNHGRAARSLDAVHSAT----AVSSSQW-HPSDGS 330

Query: 305 ILCSGGSDRRVLLWDL------------------------------FQIGTEQQE----- 329
           IL + G D RV L D+                              F  GT+        
Sbjct: 331 ILLTAGYDSRVALSDVRIANDAGMSKYWKVMKGEEIESATFVSETVFLAGTDSGNVYSFD 390

Query: 330 -EDADDGGPELLMMHAGHKSAINDFSFSPNVP-WLMASVEEENIVQIWK 376
             + +D  P L  ++A H S I+  S SP++P  L+ S   E ++++WK
Sbjct: 391 LRNGEDSAP-LWTLNA-HDSGISSLSVSPSIPNMLVTSAMGEKVIKLWK 437

>KLLA0E04093g Chr5 (371642..372760) [1119 bp, 372 aa] {ON} similar
           to uniprot|P39108 Saccharomyces cerevisiae YDR142C PEX7
           May serve as intraperoxisomal receptor for type 2
           peroxisomal proteins (such as thiolase) Member of
           beta-transducin-related (WD-40) protein family
          Length = 372

 Score = 52.8 bits (125), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 60/259 (23%), Positives = 107/259 (41%), Gaps = 34/259 (13%)

Query: 127 NLIATISGTGTVFLYD-RTKDDENALRGKYAYHKENGYGLNFSVASPGELISCSDDGSIA 185
           N      G G++ L+D + KD   A+   Y  H+   +  N+++      +S S DG + 
Sbjct: 74  NQCLVAQGDGSLRLFDIKLKDYPIAI---YKEHQREVFSCNWNMIQKQMFVSSSWDGKVK 130

Query: 186 IWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDKRSEKPLQKLLQ 245
           +W +      P S+ ++  +          D N   ++S  S   +   R     QK  Q
Sbjct: 131 LWSLMR----PQSLMTMSPN----------DTNAASTLSRTS--AVAPVRVPMSNQKEHQ 174

Query: 246 -----KEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEAL--HSMSGHQ--EAVTSL 296
                KE      FS H  NL   +  ++ + L+D R P   L  H   GH   EA+T  
Sbjct: 175 HADGNKECIYQATFSPHDPNLVLCSSGNSFISLYDLRVPNNGLPQHQFLGHGGFEALTC- 233

Query: 297 EFAHHKDGILCSGGSDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGHKSAINDFSFS 356
           +F  ++  I+ +GG D+ + +WDL        +        E+     GH+ A+   ++S
Sbjct: 234 DFNKYRPHIIATGGVDKMIKVWDLRMCRKMLSQGHQPININEI----QGHELAVRKVTWS 289

Query: 357 PNVPWLMASVEEENIVQIW 375
           P+   ++ S   +   ++W
Sbjct: 290 PHHSNMLLSTSYDMTCRVW 308

 Score = 37.0 bits (84), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 42/91 (46%), Gaps = 14/91 (15%)

Query: 112 HENEVTRARYAPFDSNLIATISGTGTVFLYDRTKDDENALRGK-------------YAYH 158
           HE  V +  ++P  SN++ + S   T  ++    DD + L GK             +  H
Sbjct: 279 HELAVRKVTWSPHHSNMLLSTSYDMTCRVWTDLSDDGHGLTGKTNSIDPAHGCRFIFMEH 338

Query: 159 KENGYGLNFSV-ASPGELISCSDDGSIAIWD 188
            E  +G ++S+  +PG + S   DG + IW+
Sbjct: 339 SEFVFGADWSLWGTPGFVASTGWDGQVCIWN 369

 Score = 33.5 bits (75), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 36/186 (19%), Positives = 75/186 (40%), Gaps = 25/186 (13%)

Query: 62  TSDSEQNYLKIAEINLPQEILSNEGPVLQNDNNG------SDEQVPSKIKIIKKFKHENE 115
            S S    +K+  +  PQ +++    +  ND N       +    P ++ +  + +H++ 
Sbjct: 121 VSSSWDGKVKLWSLMRPQSLMT----MSPNDTNAASTLSRTSAVAPVRVPMSNQKEHQHA 176

Query: 116 ------VTRARYAPFDSNLIATISGTGTVFLYDRTKDDENALRGKYAYHKE-NGYGLNFS 168
                 + +A ++P D NL+   SG   + LYD    +    + ++  H        +F+
Sbjct: 177 DGNKECIYQATFSPHDPNLVLCSSGNSFISLYDLRVPNNGLPQHQFLGHGGFEALTCDFN 236

Query: 169 VASPGELISCSDDGSIAIWDIKSGKTV------PTSVNSL--HSDIVNECKWHESDPNIY 220
              P  + +   D  I +WD++  + +      P ++N +  H   V +  W     N+ 
Sbjct: 237 KYRPHIIATGGVDKMIKVWDLRMCRKMLSQGHQPININEIQGHELAVRKVTWSPHHSNML 296

Query: 221 GSVSED 226
            S S D
Sbjct: 297 LSTSYD 302

>Smik_6.451 Chr6 (740074..741645) [1572 bp, 523 aa] {ON} YPL247C
           (REAL)
          Length = 523

 Score = 53.1 bits (126), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 71/304 (23%), Positives = 122/304 (40%), Gaps = 43/304 (14%)

Query: 21  SNVPLMYDFVSETRLLWPSLTIQWLPRAEDSTEQELLVGTHTSDSEQNYLKIAEINLPQE 80
           SN  L ++ V +  +++P   IQW+P    S      + T  SDS    L+I  +N  + 
Sbjct: 160 SNDLLSWENVVDADVVYPVSKIQWVP----SQLHPRKLAT-CSDS----LRIWNVNHEER 210

Query: 81  ILS---NEGPVLQNDNNGSDEQVPSKIKIIKKFKHENEVTRARYAPFDSNLIATISGTGT 137
                 N      N  + ++      +K+I  F     +T   +   D+NLI + S   T
Sbjct: 211 QFQEQINLSLCKYNRQHPANPAATDDMKVIGTFP---PITSFDWNMVDTNLIISSSIDTT 267

Query: 138 VFLYDRTKDDENALRGKYAYHKENGYGLNFSVASPGELISCSDDGSIAIWDIKSGKTVPT 197
             ++D      + ++ +   H    + + F   S     SC  DGS+ ++D++S      
Sbjct: 268 CIVWDLQS--SHYVKTQLIAHDSEVFDVRFLTKSTQLFASCGGDGSVRVFDLRSLA---- 321

Query: 198 SVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDKRSEKPLQKLLQKEPFNTIAFSKH 257
                HS I+ E     S P +    +  +          K    LL+ EP      S +
Sbjct: 322 -----HSTIIYEPP-ASSAPGLNADTTTPA---------SKGSDALLRLEP------SPY 360

Query: 258 SSNLFAA-AGTDAMVYLFDSRKPTEALHSMSGHQEAVTSLEFAHHKDGILCSGGSDRRVL 316
             N+ A  A     + + D R P   + ++ GH  +V  +++   K  +L S G D +VL
Sbjct: 361 DPNVLATFAAESNKIIILDMRNPESPILNLEGHSSSVNEIKWHPTKRNVLLSCGDDCQVL 420

Query: 317 LWDL 320
            WDL
Sbjct: 421 YWDL 424

 Score = 35.4 bits (80), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 44/176 (25%), Positives = 76/176 (43%), Gaps = 16/176 (9%)

Query: 212 WHESDPNIYGSVSEDSFLMIHDKRSEKPLQKLL---QKEPFNTIAFSKHSSNLFAAAGTD 268
           W+  D N+  S S D+  ++ D +S   ++  L     E F+ + F   S+ LFA+ G D
Sbjct: 251 WNMVDTNLIISSSIDTTCIVWDLQSSHYVKTQLIAHDSEVFD-VRFLTKSTQLFASCGGD 309

Query: 269 AMVYLFDSRKPTEALHSMSGHQEAVTSLEFAHHKDGILCSGGSDRRVLL----WDLFQIG 324
             V +FD R      HS   ++   +S    +       S GSD  + L    +D   + 
Sbjct: 310 GSVRVFDLR---SLAHSTIIYEPPASSAPGLNADTTTPASKGSDALLRLEPSPYDPNVLA 366

Query: 325 TEQQEEDA----DDGGPELLMMHA-GHKSAINDFSFSPNVPWLMASVEEENIVQIW 375
           T   E +     D   PE  +++  GH S++N+  + P    ++ S  ++  V  W
Sbjct: 367 TFAAESNKIIILDMRNPESPILNLEGHSSSVNEIKWHPTKRNVLLSCGDDCQVLYW 422

>Ecym_8044 Chr8 (97649..98584) [936 bp, 311 aa] {ON} similar to
           Ashbya gossypii ADR108C
          Length = 311

 Score = 52.4 bits (124), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 42/169 (24%), Positives = 80/169 (47%), Gaps = 17/169 (10%)

Query: 174 ELISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNE----CKWHESDPNIYGSVSEDSFL 229
           +L++   +G + I+D+++G+ +       H  +VNE    C+ H     ++GSVS+D  L
Sbjct: 68  QLLAGCANGKVCIYDVETGRKMR-QWGGGHKRVVNEIVGLCEEH-----LFGSVSDDGTL 121

Query: 230 MIHDKRSEKPLQKLLQKEPFNTIAFSKHS-----SNLFAAAGTDAMVYLFDSRKPTEALH 284
              D R  KP+ +++ + P  T+A  +       S     +G + +V  +D RK T+ + 
Sbjct: 122 CWWDSRVRKPVGRVVGEFPLLTLALGRRGDGDERSPFLYTSGVEPVVRCYDLRKNTDLIA 181

Query: 285 SM-SGHQEAVTSLEFAHHKDGILCSGGSDRRVLLWDLFQIGTEQQEEDA 332
              + H   V+SL  + +   + CS G D  +   D+   G  +  +D 
Sbjct: 182 ECETTHATGVSSLCVSSNGSRV-CSLGFDDNLQFHDIDASGKLKNRQDG 229

>CAGL0B01529g Chr2 (137174..138283) [1110 bp, 369 aa] {ON} highly
           similar to uniprot|P39108 Saccharomyces cerevisiae
           YDR142c PAS7 peroxisomal import protein -peroxin
          Length = 369

 Score = 52.4 bits (124), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 59/291 (20%), Positives = 113/291 (38%), Gaps = 28/291 (9%)

Query: 88  VLQNDNNGSDEQVPSKIKIIKKFKHENEVTRARYAPFDSNLIATISGTGTVFLYDRTKDD 147
           +L+ DNNG        +K    F  ++ +  + +     N +    G G++ L+D T   
Sbjct: 42  ILEIDNNGV-------VKEKNSFLTKDCLFDSAWNELKPNQVVVAQGDGSLRLFDTTL-- 92

Query: 148 ENALRGKYAYHKENGYGLNFSVASPGELISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIV 207
           +      +  H +  Y  N+++ S    +S S DG + IW      ++ T          
Sbjct: 93  QKFPIAMFHEHSKEVYSCNWNLVSKSNFVSSSWDGQVKIWSPNRKASLITF--------- 143

Query: 208 NECKWHESDPNIYGSVSEDSFLMIHDKRSEKPLQKLLQKEPFNTIAFSKHSSNLFAAAGT 267
                  S   I  S + D+   +  +    P Q    +       FS H  NL      
Sbjct: 144 -------SPHPIDVSRALDNLPEVSQRDKLSPNQVAQNRNCIYQATFSPHDDNLILCCAG 196

Query: 268 DAMVYLFDSRK-PTEALHSMSGHQ-EAVTSLEFAHHKDGILCSGGSDRRVLLWDLFQIGT 325
           ++ V LFD R+ P     +   H+ +   S +F  ++  I+ + G D  + +WD+  +  
Sbjct: 197 NSYVTLFDLRQNPGNNQKNFIAHRGKGALSCDFNKYRPNIIATSGVDNSIGIWDIRMLPN 256

Query: 326 EQQEEDADDGGPELLMMHAGHKSAINDFSFSPNVPWLMASVEEENIVQIWK 376
              ++    G     +++A H  A+    +SP+   ++ S   +   +IWK
Sbjct: 257 SSNQQGFQTGTLVNEIVNA-HDLAVKKVCWSPHHSDILLSTSYDMSCKIWK 306

>KLLA0C08547g Chr3 (749737..751284) [1548 bp, 515 aa] {ON} highly
           similar to uniprot|P25382 Saccharomyces cerevisiae
           YCR072C Protein required for cell viability,
          Length = 515

 Score = 52.8 bits (125), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 81/337 (24%), Positives = 136/337 (40%), Gaps = 66/337 (19%)

Query: 91  NDNNGSDEQVPSKIKIIKKFKHENEVTRARYAPFDSNLIATISGTGTVFLYDRTKDDE-- 148
            DN        ++ ++     H N V    ++P D  LIAT S   T+ L++ +K     
Sbjct: 164 GDNTACIWDCDTQTRMCTLQGHHNWVLCCSWSP-DGELIATGSMDNTIRLWESSKGKPYG 222

Query: 149 NALRGKYAYHKENGYGLNFSVASPGE---LISCSDDGSIAIWDIKSGKTVPTSVNSLHSD 205
           +ALRG   +     +     +  PG+   L + S DG+I IWD      + T     H+ 
Sbjct: 223 DALRGHSKWITSLSWE-PIHLVKPGDKPRLATASKDGTIKIWDTTRRVCLLTLCG--HTS 279

Query: 206 IVNECKW----------HES-----DPNIYG----------------SVSEDSFLMI--H 232
            V+  KW          H+      D N+ G                S+S D  L +   
Sbjct: 280 SVSCVKWGGKNVLYSGSHDKTIRCWDMNLNGKCINILKSHAHWVNHLSLSTDYALRLGAF 339

Query: 233 DKRSEKPL--QKLLQKEPFNTIAFSKHSSN---LFAAAGTDAMVYLFDSRKPTEALHSMS 287
           D + E P   ++  QK   N    +K   +   L   A  D  +YL++  K T+ +  M+
Sbjct: 340 DHKGETPASPEEAQQKALKNYEKVAKRKGDFEELMVTASDDFTMYLWNPLKSTKPITRMT 399

Query: 288 GHQEAVTSLEFAHHKDG-ILCSGGSDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGH 346
           GHQ+ V  + F+   DG  + S   D  + LW            D  DG  + L    GH
Sbjct: 400 GHQKLVNHVAFS--PDGRYIVSASFDNSIKLW------------DGRDG--KFLSTFRGH 443

Query: 347 KSAINDFSFSPNVPWLMASVEEENIVQIWK-PSRKLT 382
            +++   ++S +   L+ S  ++  +++W   +RKL+
Sbjct: 444 VASVYQVAWSSDCR-LLVSCSKDTTLKVWDVKTRKLS 479

 Score = 35.8 bits (81), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 37/147 (25%), Positives = 71/147 (48%), Gaps = 10/147 (6%)

Query: 175 LISCSDDGSIAIWD-IKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHD 233
           +++ SDD ++ +W+ +KS K  P +  + H  +VN   +   D     S S D+ + + D
Sbjct: 374 MVTASDDFTMYLWNPLKSTK--PITRMTGHQKLVNHVAF-SPDGRYIVSASFDNSIKLWD 430

Query: 234 KRSEKPLQKLL-QKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEA 292
            R  K L            +A+S     L  +   D  + ++D +    ++  + GHQ+ 
Sbjct: 431 GRDGKFLSTFRGHVASVYQVAWSS-DCRLLVSCSKDTTLKVWDVKTRKLSV-DLPGHQDE 488

Query: 293 VTSLEFAHHKDGI-LCSGGSDRRVLLW 318
           V +++++   DG  +CSGG D+ V +W
Sbjct: 489 VYTVDWS--VDGKRVCSGGKDKMVRIW 513

>KLLA0A08822g Chr1 (772565..774313) [1749 bp, 582 aa] {ON} similar
           to uniprot|P53197 Saccharomyces cerevisiae YGL003C CDH1
           CDC20 homolog 1 protein required for Clb2 and Ase1
           degradation
          Length = 582

 Score = 52.8 bits (125), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 49/189 (25%), Positives = 89/189 (47%), Gaps = 18/189 (9%)

Query: 137 TVFLYDRTKDDENALRGKYAYHKENGYGLNFSVASPGELISCSDDGSIAIWDIKSGKTVP 196
           ++FL D T +D   L    A  + +   L++ V S   L      G + I+D+   K + 
Sbjct: 300 SIFLSDNTTNDVTHL----ATSESDFTSLSW-VDSGSHLAVGLSSGIVEIYDVLKNKCIR 354

Query: 197 TSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDKRSEKPLQKLLQKEPFNTIAFSK 256
           T   S H D V    W+    ++  S S D  ++  D R+ +P  + +            
Sbjct: 355 TL--SGHVDRVACLSWNN---HVLSSGSRDRKILHRDVRAPEPFFEQIDTHSQEVCGLKW 409

Query: 257 H-SSNLFAAAGTDAMVYLFDS--RKPTEALHSMSGHQEAVTSLEFAHHKDGILCSGG--S 311
           + + N  A+ G D MVY++D   R+P   + SM  H  AV ++ ++ H  G+L +GG  +
Sbjct: 410 NVNENKLASGGNDNMVYVYDGTLRQP---MLSMEEHTAAVKAMAWSPHTRGVLATGGGTA 466

Query: 312 DRRVLLWDL 320
           D+++ +W++
Sbjct: 467 DKKLKIWNI 475

>Suva_16.60 Chr16 complement(91552..93132) [1581 bp, 526 aa] {ON}
           YPL247C (REAL)
          Length = 526

 Score = 52.8 bits (125), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 95/394 (24%), Positives = 150/394 (38%), Gaps = 80/394 (20%)

Query: 21  SNVPLMYDFVSETRLLWPSLTIQWLPRAEDSTEQELLVGTHTSDSEQNYLKIAEINLPQE 80
           SN  L +D V E  +++P   IQW P    S      + T  SDS    L+I  +N P+E
Sbjct: 160 SNDLLSWDSVVEADVVYPVSRIQWAP----SQLHPRKLAT-CSDS----LRIWNVN-PEE 209

Query: 81  ILSNEGPVLQ----NDNNGSDEQVPSKIKIIKKFKHENEVTRARYAPFDSNLIATISGTG 136
               E   L     N  + +       +K+I  F     +T   +   D+NLI + S   
Sbjct: 210 RQFQEQINLSLCKYNRQHPTSTATTEDMKVIGTFP---PITSFDWNTVDTNLIISSSIDT 266

Query: 137 TVFLYDRTKDDENALRGKYAYHKENGYGLNFSVASPGELISCSDDGSIAIWDIKSGKTVP 196
           T  ++D      + ++ +   H    + + F   S     SC  DGS+ ++D++S     
Sbjct: 267 TCIVWDL--QSSHYVKTQLIAHDSEVFDVRFLTKSTQLFASCGGDGSVRVFDLRS----- 319

Query: 197 TSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDKRSEKPLQ----KLLQKEPFNTI 252
                 HS I            IY   S  S        +  P       LL+ EP    
Sbjct: 320 ----LAHSTI------------IYEPPSSSSSSSAPAAGTTTPSSDGSYALLRLEP---- 359

Query: 253 AFSKHSSNLFAAAGTDA-MVYLFDSRKPTEALHSMSGHQEAVTSLEFAHHKDGILCSGGS 311
             S +  N+ A    D+  + + D R P   + ++ GH  +V  +++   K  +L S   
Sbjct: 360 --SPYDPNVLATFAADSNKIIILDMRNPESPILTLEGHSSSVNEIKWHPTKRNVLLSCSD 417

Query: 312 DRRVLLWDL----FQI-----------GTEQQEEDAD----DGGP-------ELLMMHAG 345
           D +VL WDL     +I           GT  ++ D D    DGG         L +  + 
Sbjct: 418 DCQVLYWDLNNSFMEINGGSVKSPGASGTPLEDTDGDTVMADGGEGSNPHEDPLSLTSSN 477

Query: 346 HKSAINDFSFSPNVPWLMASVEEENIVQIWKPSR 379
            K A      +PN+ +   + E  NI   W+P R
Sbjct: 478 EKQACKTLE-TPNMVYANRAQEINNIA--WRPQR 508

>KAFR0J00980 Chr10 (176984..178426) [1443 bp, 480 aa] {ON} Anc_5.201
           YLL011W
          Length = 480

 Score = 52.8 bits (125), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 46/253 (18%), Positives = 97/253 (38%), Gaps = 66/253 (26%)

Query: 175 LISCSDDGSIAIWDIK-------------------------------------------- 190
           ++SC DD ++ +W +                                             
Sbjct: 132 MLSCGDDKTVKLWSVNNDDFSNVKSDAELNTEGLLKTFYGEHAFQGIDHHREASTFVTGG 191

Query: 191 -------SGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDKRSEKPLQKL 243
                  S ++ P S  S  +D +   K+++++ +I  S   D+ ++++D R+  P QK+
Sbjct: 192 AQIHLWDSNRSKPISNLSWGADNITSVKFNQNEVDILASTGSDNAIVLYDLRTNSPTQKI 251

Query: 244 LQKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEAVTSLEFAHHKD 303
           +Q    N I ++   +  F  A  D   Y +D R  + ALH    H  AV  ++F+   D
Sbjct: 252 IQTMRTNAICWNPMEAFNFVIANEDHNAYYYDMRNMSRALHVFKDHVSAVMDVDFSPTGD 311

Query: 304 GILCSGGSDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGHKSAINDFSFSPNVPWLM 363
            I+ +G  D+ + ++               + G    + H      +    FS +  +++
Sbjct: 312 EIV-TGSYDKTIRIFKT-------------NHGHAREVYHTKRMQHVFQVKFSMDSKYII 357

Query: 364 ASVEEENIVQIWK 376
           +  ++ N V++W+
Sbjct: 358 SGSDDGN-VRLWR 369

>Kwal_56.24332 s56 (959476..960732) [1257 bp, 418 aa] {ON} YPL247C -
           Hypothetical ORF [contig 164] FULL
          Length = 418

 Score = 52.4 bits (124), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 58/216 (26%), Positives = 90/216 (41%), Gaps = 40/216 (18%)

Query: 116 VTRARYAPFDSNLIATISGTGTVFLYDRTKDDENALRGKYAYHKENGYGLNFSVASPGEL 175
           V+   +   D NLI + S   T  ++D      N ++ +   H    Y + F   S    
Sbjct: 168 VSSFHWNKIDPNLIISSSIDTTCTVWDL--QSPNYVKTQLIAHDSEVYDVKFLAQSTQLF 225

Query: 176 ISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYG----SVSEDSFLMI 231
            SC  DGS+ ++D++S           HS I+ E       PN       S S+DS    
Sbjct: 226 ASCGGDGSVRVFDLRSLA---------HSTIIYE-------PNGQSAATLSQSQDSGGAS 269

Query: 232 HDKR----SEKPLQKLLQKEPF--NTIA-FSKHSSNLFAAAGTDAMVYLFDSRKPTEALH 284
              R    S+  L +L +  PF  N +A F+  SSN          V + D R P  A+ 
Sbjct: 270 GTSRDGSNSDNALLRL-EPSPFDPNVVATFAHDSSN----------VLILDMRYPGAAVL 318

Query: 285 SMSGHQEAVTSLEFAHHKDGILCSGGSDRRVLLWDL 320
           ++ GH  AV  +++   +  +L +   D + LLWDL
Sbjct: 319 TLEGHSGAVNQIQWHQSRQNVLITCADDCQALLWDL 354

>AFL157C Chr6 complement(140404..141720) [1317 bp, 438 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL247C
          Length = 438

 Score = 52.4 bits (124), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 71/331 (21%), Positives = 125/331 (37%), Gaps = 74/331 (22%)

Query: 27  YDFVSETRLLWPSLTIQWLPRAEDSTEQELLVGTHTSDSEQNYLKIAEINLPQEI---LS 83
           +D V++  +++P   IQW+P+           G   + S+   ++  E  L +++   L 
Sbjct: 96  WDSVAQASVIYPLSKIQWMPKG---------TGKLATCSDSLRIRSVEEQLHEQLNLSLV 146

Query: 84  NEGPVLQNDNNGSDEQVPSKIKIIKKFKHENEVTRARYAPFDSNLIATISGTGTVFLYDR 143
             G  L   +NG            +       VT   +   D+NLI   S   T  ++D 
Sbjct: 147 KYGKSLGEVSNG------------RMLGQLPPVTSFDWNALDTNLILFSSIDTTCTVWDL 194

Query: 144 TKDDENALRGKYAYHKENGYGLNFSVASPGELISCSDDGSIAIWDIKSGKTVPTSVNSLH 203
                N ++ +   H    +   F   S     SC  DGS+ ++D++            H
Sbjct: 195 QA--SNYVKTQLIAHDSEVFDAKFLTQSSNLFASCGGDGSVRVFDLRCLA---------H 243

Query: 204 SDIVNECKWHESDPNIYG---SVSEDSFLMIHDKRSEKPLQK------------------ 242
           S I+     +E    + G   S ++   L  H++  +  LQK                  
Sbjct: 244 STII-----YEPQQQVQGQTPSQTQVHTLAAHEQDGQ--LQKNSQSSALSSSASSSLGAL 296

Query: 243 ----LLQKEPFNTIAFSKHSSNLFAAAGTDA-MVYLFDSRKPTEALHSMSGHQEAVTSLE 297
               LL+ EP      S    N+ A    D+ +V + D R P   +  + GH   V  L+
Sbjct: 297 DNCALLRLEP------SPFDPNILATIQQDSNVVIILDMRYPGSPMLLLEGHAAPVNQLK 350

Query: 298 FAHHKDGILCSGGSDRRVLLWDLFQIGTEQQ 328
           +   K  +L + G D ++L WDL ++ +  Q
Sbjct: 351 WHPSKPNVLATCGDDCQILYWDLLELLSASQ 381

>TBLA0H00230 Chr8 complement(31016..35017) [4002 bp, 1333 aa] {ON}
           Anc_3.22 YOL138C
          Length = 1333

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 46/197 (23%), Positives = 80/197 (40%), Gaps = 28/197 (14%)

Query: 127 NLIATISGTGTVFLYD--RTKDDENALRGKYAYHKENGYGLNFSVASPGELISCSDDGSI 184
           N +A  S +  + +YD  R+K   N L   +  H  +    +F++     +IS   DG I
Sbjct: 193 NYVAVSSNSTVISIYDINRSKSTNNPLVSSFQQHTRSINSFDFNMVHTNLIISGGQDGCI 252

Query: 185 AIWDIKSGKTVPTSVN-SLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDKRSEKPLQKL 243
            IWD++S       V+ S  SD V + KW                 M +   S  P    
Sbjct: 253 KIWDLRSNNPNRCDVSISTSSDSVRDVKW-----------------MPYHNFSSTPTGG- 294

Query: 244 LQKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEAVTSLEFAHHKD 303
           L+    N++ +       FA+     ++  FD R+P +    ++ H      L + H   
Sbjct: 295 LEASSENSMGYK------FASIHDSGLLLKFDIRQPNQVEQKINAHTGPGLCLNW-HPNL 347

Query: 304 GILCSGGSDRRVLLWDL 320
             + +GG D ++ +W+L
Sbjct: 348 NYITTGGRDGKLCVWNL 364

 Score = 30.8 bits (68), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 24/111 (21%), Positives = 48/111 (43%), Gaps = 12/111 (10%)

Query: 222 SVSEDSFLMIHD----KRSEKPLQKLLQKEPFNTIAFSK----HSSNLFAAAGTDAMVYL 273
           S  + S  ++HD     +S + + K  ++   +TIA  K    +  N  A +    ++ +
Sbjct: 147 SPQKKSISLVHDFMSTNQSSQGIIKRNKQVKLSTIADVKTGYYNYKNYVAVSSNSTVISI 206

Query: 274 FDSRKPTEA----LHSMSGHQEAVTSLEFAHHKDGILCSGGSDRRVLLWDL 320
           +D  +        + S   H  ++ S +F      ++ SGG D  + +WDL
Sbjct: 207 YDINRSKSTNNPLVSSFQQHTRSINSFDFNMVHTNLIISGGQDGCIKIWDL 257

>TBLA0B09250 Chr2 (2194005..2195585) [1581 bp, 526 aa] {ON}
           Anc_2.401 YMR131C
          Length = 526

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 75/397 (18%), Positives = 164/397 (41%), Gaps = 49/397 (12%)

Query: 26  MYDFVSETRLLWPSLTIQWLPRAEDSTEQE------LLVGTHTSDSEQNYLKIAEINLPQ 79
           +Y+ +    L WP +++  +P +  +  +       L   T  S  + N L I +++   
Sbjct: 129 VYEMLHNVNLSWPCMSLDIIPDSLGNERRNYPQSILLTTATQASKKKDNELMILQLSQLT 188

Query: 80  EILSNEGPVLQNDNNGSDEQVPSKIKIIK--KFKHENEVTRARYAPFDSN-----LIATI 132
           + L  E     +D +  D++      I++       +   R +  PF +N     L AT+
Sbjct: 189 KTLLKEDDDDNDDEDDEDDEDRESDPILEDANVALRDTTNRLKVTPFATNNNQEILTATM 248

Query: 133 SGTGTVFLYD--------------RTKDDENALRGKYAYHKENGYGLNFS-VASPGELIS 177
           S  G V+++D               +K  +  +    ++    G+GL++S +   G L++
Sbjct: 249 SENGEVYIFDIINQVKSFQIPGYQVSKQSKRPIHTIRSHGNVEGFGLDWSPLIKSGALLT 308

Query: 178 CSDDGSIAIWDIKSGK--TVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDKR 235
               G I +    + K  T   S +  ++  + + +W +++  ++ +   D ++ I D R
Sbjct: 309 GDCSGEIFLTSRHTSKWITEKQSFSVGNNKSIEDIQWSKTEQTVFATAGCDGYIRIWDTR 368

Query: 236 SEK---PLQKLLQKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSG---- 288
           S+K    +         N I++++    L A+     +  ++D R+ + +  + S     
Sbjct: 369 SKKHKPAISTRASNVDVNVISWNEKMEYLLASGDDKGVWGVWDLRQFSPSQENASPVAQY 428

Query: 289 --HQEAVTSLEFAHHKDGILCSGGSDRRVLLWDLF------QIGTEQQE-EDADDGGPEL 339
             H+ A+TS+ F    +  +     D  V LWDL       +I  +  E ++ +   P+L
Sbjct: 429 DFHKGAITSISFNPLDESTVAVASEDNTVTLWDLSVEADDEEIKQQTHETKELEQIPPQL 488

Query: 340 LMMHAGHKSAINDFSFSPNVPWLMASVEEENIVQIWK 376
           L +H   +  + D  +   +P  + S   + +  +WK
Sbjct: 489 LFVH--WQKEVKDVKWHRQIPGCLVSTGTDGL-NVWK 522

>TDEL0F04430 Chr6 complement(831678..832781) [1104 bp, 367 aa] {ON}
           Anc_8.316 YDR142C
          Length = 367

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 59/302 (19%), Positives = 121/302 (40%), Gaps = 56/302 (18%)

Query: 119 ARYAPFDSNLIATISGT-------GTVFLYDRTKDDENALRGKYAYHKENG-YGLNFSVA 170
            +Y+PF  N +A +SG+       G +F+ D   D +  +    ++  ++  + + ++  
Sbjct: 14  VQYSPFFDNRLAVVSGSNFGLVGNGKLFILD--IDPQGKIHESNSFLTQDCLFDVAWNEL 71

Query: 171 SPGELISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLM 230
              +++    DGS+ ++D K  +  P ++   H   V  C W+  + N + S S D  + 
Sbjct: 72  HENQVLVAQGDGSLRLFDTKLAQ-YPIAIFKEHQKEVFSCNWNLLNKNTFVSSSWDGTVK 130

Query: 231 IHDKRSEKPLQKLLQKEPFNTI------------------------------AFSKHSSN 260
           I     +  L  L   +P  T+                               FS H  N
Sbjct: 131 IWSPTRKDSLLTL-TPQPLKTVNRVDHSMNIPMSNQRNHADITRNKNCIYQAQFSPHDPN 189

Query: 261 LFAAAGTDAMVYLFDSRKPTEALHSMS--GHQ--EAVTSLEFAHHKDGILCSGGSDRRVL 316
           L      ++ + +FD R+P    +  +  GH   EA+T  +F  ++   + +GG D  + 
Sbjct: 190 LVMCCSGNSYITIFDLRQPPSPTNQRNFLGHSGLEALTC-DFNKYRPHTIATGGVDNVIR 248

Query: 317 LWDLFQIGTEQQEEDADDGGPELLM--MHAGHKSAINDFSFSPNVPWLMASVEEENIVQI 374
           +WDL       +    ++  P + +  +  GH+ A+    +SP+   +  S   +    +
Sbjct: 249 IWDL-------RMTSKNNSSPSICVNEVVGGHELAVRKVCWSPHHSNIFLSTSYDMTCCV 301

Query: 375 WK 376
           W+
Sbjct: 302 WQ 303

 Score = 37.0 bits (84), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 36/168 (21%), Positives = 66/168 (39%), Gaps = 15/168 (8%)

Query: 111 KHENEVTRARYAPFDSNLIATISGTGTVFLYD-RTKDDENALRGKYAYHKENGYGLNFSV 169
           +++N + +A+++P D NL+   SG   + ++D R        R    +        +F+ 
Sbjct: 173 RNKNCIYQAQFSPHDPNLVMCCSGNSYITIFDLRQPPSPTNQRNFLGHSGLEALTCDFNK 232

Query: 170 ASPGELISCSDDGSIAIWDI----KSGKTVPTSVNSL---HSDIVNECKWHESDPNIYGS 222
             P  + +   D  I IWD+    K+  +    VN +   H   V +  W     NI+ S
Sbjct: 233 YRPHTIATGGVDNVIRIWDLRMTSKNNSSPSICVNEVVGGHELAVRKVCWSPHHSNIFLS 292

Query: 223 VSEDSFLMI------HDKRSEKPLQKLLQKEPFNTIAFSKHSSNLFAA 264
            S D    +       D+RS      +          F++HS  ++ A
Sbjct: 293 TSYDMTCCVWQDVSYTDRRSTGKTNSIDPNRGCR-FKFTQHSEFVYGA 339

 Score = 34.3 bits (77), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 42/91 (46%), Gaps = 14/91 (15%)

Query: 112 HENEVTRARYAPFDSNLIATISGTGTVFLY------DR-------TKDDENALRGKYAYH 158
           HE  V +  ++P  SN+  + S   T  ++      DR       + D     R K+  H
Sbjct: 273 HELAVRKVCWSPHHSNIFLSTSYDMTCCVWQDVSYTDRRSTGKTNSIDPNRGCRFKFTQH 332

Query: 159 KENGYGLNFSV-ASPGELISCSDDGSIAIWD 188
            E  YG ++S+   PG + S + DG++ IW+
Sbjct: 333 SEFVYGADWSLWGQPGYIASTAWDGNVFIWN 363

>NDAI0J00330 Chr10 (54580..55998) [1419 bp, 472 aa] {ON} Anc_7.534
          Length = 472

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 56/206 (27%), Positives = 91/206 (44%), Gaps = 23/206 (11%)

Query: 182 GSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHD-KRSEKPL 240
           G + I + KS KT+  S+ S+H   +    W+ S  ++  S +ED+ + +H  K      
Sbjct: 208 GDVKILEPKSLKTIA-SLPSVHDGKIGGLDWNTS-YDLIVSGAEDALVKLHTYKEGRLET 265

Query: 241 QKLLQKEPFNTIAFSKHSSNLF-AAAGTDAMVYLFDSRKPTEALHSMSGHQEAVTSLEFA 299
             +LQ      +    H SN F A+A  D    L+D     E +    GH + V +L F 
Sbjct: 266 AAVLQGHEGRVVNVKFHPSNKFIASASFDQTWRLWDVETGAE-IQLQEGHAKEVYALGF- 323

Query: 300 HHKDG-ILCSGGSDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGHKSAINDFSFSPN 358
             +DG +LCSGG D   ++WDL               G  ++ ++ GH   I    +SPN
Sbjct: 324 -QQDGALLCSGGLDNTAIIWDL-------------RSGKSIMTLN-GHAKPIYCLDWSPN 368

Query: 359 VPWLMASVEEENIVQIWKPSRKLTNP 384
               +A+   + ++ IW   +  T P
Sbjct: 369 -GHEVATGGGDGLINIWDLRKAQTPP 393

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 51/211 (24%), Positives = 89/211 (42%), Gaps = 16/211 (7%)

Query: 112 HENEVTRARYAPFDSNLIATISGTGTVFLYDRTKDDENALRGKYAYHKENGYGLNFSVAS 171
           HE  V   ++ P  +  IA+ S   T  L+D     E  L+     H +  Y L F    
Sbjct: 272 HEGRVVNVKFHP-SNKFIASASFDQTWRLWDVETGAEIQLQ---EGHAKEVYALGFQ--Q 325

Query: 172 PGELISCSD--DGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFL 229
            G L+ CS   D +  IWD++SGK++ T +N  H+  +    W  +   +  +   D  +
Sbjct: 326 DGALL-CSGGLDNTAIIWDLRSGKSIMT-LNG-HAKPIYCLDWSPNGHEV-ATGGGDGLI 381

Query: 230 MIHDKRSEKPLQKLL--QKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMS 287
            I D R  +    +L       + + + +       + G D  +  F S      + S  
Sbjct: 382 NIWDLRKAQTPPNILPAHSNIVSDLHYERSQGRYLVSCGYDRCINFFSS-DSWRKICSKE 440

Query: 288 GHQEAVTSLEFAHHKDGILCSGGSDRRVLLW 318
           GH + + S++ + + D +L SG  +R + LW
Sbjct: 441 GHTDKILSVDSSDNADYMLSSGW-NRSIKLW 470

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 36/153 (23%), Positives = 73/153 (47%), Gaps = 7/153 (4%)

Query: 175 LISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDK 234
           ++S ++D  + +   K G+    +V   H   V   K+H S+  I  S S D    + D 
Sbjct: 244 IVSGAEDALVKLHTYKEGRLETAAVLQGHEGRVVNVKFHPSNKFI-ASASFDQTWRLWDV 302

Query: 235 RS--EKPLQKLLQKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEA 292
            +  E  LQ+   KE +  + F +  + L  + G D    ++D R   +++ +++GH + 
Sbjct: 303 ETGAEIQLQEGHAKEVY-ALGFQQDGA-LLCSGGLDNTAIIWDLR-SGKSIMTLNGHAKP 359

Query: 293 VTSLEFAHHKDGILCSGGSDRRVLLWDLFQIGT 325
           +  L+++ +   +  +GG D  + +WDL +  T
Sbjct: 360 IYCLDWSPNGHEV-ATGGGDGLINIWDLRKAQT 391

>KNAG0I01050 Chr9 complement(200338..203817) [3480 bp, 1159 aa] {ON}
           Anc_8.288 YDR128W
          Length = 1159

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 41/164 (25%), Positives = 83/164 (50%), Gaps = 9/164 (5%)

Query: 170 ASPGELISCSDDGSIAIWDIK--SGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDS 227
           A P  ++S S+  +I IW++   S   +  +++  HS  + +  ++   P+I  + S D+
Sbjct: 81  AKPHWIVSTSNQKAI-IWNLNKPSSNAIEYALHG-HSRAITDINFNSQHPDILATCSIDT 138

Query: 228 FLMIHDKRS-EKPLQKLLQ-KEPFNTIAFSKHSSNLFAAA-GTDAMVYLFDSRKPTEALH 284
           ++   D RS  +P       +   + + ++   SN+ A++ G D  V+++D R  +  LH
Sbjct: 139 YVHAWDMRSPHRPFYTTSSWRSSASQVKWNFKDSNILASSHGND--VFIWDLRHGSTPLH 196

Query: 285 SMSGHQEAVTSLEFAHHKDGILCSGGSDRRVLLWDLFQIGTEQQ 328
            ++GH   V S++F+  ++  + S  +D  V  WDL +    QQ
Sbjct: 197 KLTGHNSGVNSIDFSRFEENKIMSSSNDGTVKFWDLSKEEKCQQ 240

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 54/228 (23%), Positives = 91/228 (39%), Gaps = 21/228 (9%)

Query: 138 VFLYDRTKDDENALRGKYAYHKENGYGLNFSVASPGELISCSDDGSIAIWDIKSGKTVPT 197
             +++  K   NA+      H      +NF+   P  L +CS D  +  WD++S      
Sbjct: 94  AIIWNLNKPSSNAIEYALHGHSRAITDINFNSQHPDILATCSIDTYVHAWDMRSPHRPFY 153

Query: 198 SVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDKRSEKPLQKLL-QKEPFNTIAFSK 256
           + +S  S   ++ KW+  D NI  S   +   +   +    PL KL       N+I FS+
Sbjct: 154 TTSSWRSS-ASQVKWNFKDSNILASSHGNDVFIWDLRHGSTPLHKLTGHNSGVNSIDFSR 212

Query: 257 HSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEAVTS---------LEFAHHKDGILC 307
              N   ++  D  V  +D  K  +        Q+A+T+         L F H    +  
Sbjct: 213 FEENKIMSSSNDGTVKFWDLSKEEKC-------QQAITTEFPIWRGRYLPFGHGYCVMPM 265

Query: 308 SGGSDRRVLLWDLFQIGTEQQEEDADDGGPEL--LMMHAGHKSAINDF 353
            GG++  V L DL     E++ E+ +    +L  +    GH   + DF
Sbjct: 266 IGGNN-SVYLMDLDVYDEEKELENPESRIEKLKPVQTFKGHSDRVIDF 312

 Score = 37.4 bits (85), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 30/130 (23%), Positives = 51/130 (39%), Gaps = 16/130 (12%)

Query: 252 IAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEAVTSLEFAHHKDGILCSG-G 310
           I F+    ++ A    D  V+ +D R P    ++ S  + + + +++      IL S  G
Sbjct: 121 INFNSQHPDILATCSIDTYVHAWDMRSPHRPFYTTSSWRSSASQVKWNFKDSNILASSHG 180

Query: 311 SDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGHKSAINDFSFSPNVPWLMASVEEEN 370
           +D  V +WDL               G   L    GH S +N   FS      + S   + 
Sbjct: 181 ND--VFIWDLRH-------------GSTPLHKLTGHNSGVNSIDFSRFEENKIMSSSNDG 225

Query: 371 IVQIWKPSRK 380
            V+ W  S++
Sbjct: 226 TVKFWDLSKE 235

>Ecym_6067 Chr6 (124870..126438) [1569 bp, 522 aa] {ON} similar to
           Ashbya gossypii ADR242C
          Length = 522

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 77/399 (19%), Positives = 162/399 (40%), Gaps = 51/399 (12%)

Query: 24  PLMYDFVSETRLLWPSLTIQWLPRAEDSTE----QELLVGTHTSDSEQ--NYLKIAEINL 77
           P +Y+ +    L W  +T+  +P    S      Q +L+ T T  S++  N L + +++ 
Sbjct: 125 PTVYEMLHNVNLPWSCMTLDIIPDLLGSERRNYPQSILMTTATQASKKKDNELLVLKMSQ 184

Query: 78  PQEILSNEGPVLQNDNNGSDEQVPSKIKIIKKFKHENEVTRARYAPFDSN----LIATIS 133
             + L  E     ++   +++     I   +    ++   R + +PF +     L AT+S
Sbjct: 185 LTKTLVKEEEDENDEEEDNEDNDLDPIIENESISLKDTTNRIKISPFAAESPEVLAATMS 244

Query: 134 GTGTVFLYDR--------------TKDDENALRGKYAYHKENGYGLNFS-VASPGELISC 178
             G  ++YD                K  +  L     +    GYGL++S +   G +++ 
Sbjct: 245 ENGEAYIYDLGPQVKAFTSPGYQIPKTAQKPLHSIRNHGNVEGYGLDWSPLIKTGSILTG 304

Query: 179 SDDGSIAIWDIKSGKTV----PTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDK 234
              G + +    + + V    P +V +  S  + + +W  ++  ++ +   D  + I D 
Sbjct: 305 DCSGRVYLTQRTASRWVTDKQPFTVGNNKS--IEDIQWSRAEMTVFATCGVDGHIRIWDT 362

Query: 235 RSEK---PLQKLLQKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRK-------PTEALH 284
           RS+K    L  ++     N +++++    L A+        ++D R+        T  + 
Sbjct: 363 RSKKHKPALSVMVSDTDVNVMSWNEKIGYLLASGDDSGTWGVWDLRQFSAQNTEKTTPVA 422

Query: 285 SMSGHQEAVTSLEFAHHKDGILCSGGSDRRVLLWDL-FQIGTEQQEEDADDGG------P 337
             + H+ A+TS+ F    + I+     D  V LWDL  +   E+ ++   +        P
Sbjct: 423 QYNFHKAAITSISFNPLDESIIAVASEDNTVTLWDLSVEADDEEIKQQTAETAELQQIPP 482

Query: 338 ELLMMHAGHKSAINDFSFSPNVPWLMASVEEENIVQIWK 376
           +LL +H   +  + D  +   +P  + S   + +  IWK
Sbjct: 483 QLLFVH--WQRDVKDVKWHRQIPGCLVSTGTDGL-NIWK 518

>Skud_7.284 Chr7 complement(495549..497249) [1701 bp, 566 aa] {ON}
           YGL003C (REAL)
          Length = 566

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 44/179 (24%), Positives = 82/179 (45%), Gaps = 12/179 (6%)

Query: 160 ENGYGLNFSVASPGELISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNI 219
           EN Y     + +   L    ++G + I+D+   K + T   S H D V    W+    ++
Sbjct: 302 ENEYTSLSWIGAGSHLAVGQENGLVEIYDVIKRKCIRTL--SGHVDRVACLSWNN---HV 356

Query: 220 YGSVSEDSFLMIHDKRSEKPLQKLLQKEPFNTIAFSKH-SSNLFAAAGTDAMVYLFDSRK 278
             S S D  ++  D R   P  + ++           + + N  A+ G D MV++++   
Sbjct: 357 LTSGSRDHRILHRDVRMPDPFFETIESHTQEVCGLKWNVADNKLASGGNDNMVHVYEGTS 416

Query: 279 PTEALHSMSGHQEAVTSLEFAHHKDGILCSGG--SDRRVLLWDLFQIGTEQQEEDADDG 335
            +  L +   H+ AV ++ ++ HK GIL +GG  +DR++ +W+   + T  +  D D G
Sbjct: 417 KSPIL-TFDEHKAAVKAMAWSPHKRGILATGGGTADRKLKIWN---VNTSTKMSDIDSG 471

>Kpol_1028.41 s1028 (100720..102258) [1539 bp, 512 aa] {ON}
           (100720..102258) [1539 nt, 513 aa]
          Length = 512

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 77/317 (24%), Positives = 129/317 (40%), Gaps = 68/317 (21%)

Query: 112 HENEVTRARYAPFDSNLIATISGTGTVFLYDRT--KDDENALRGKYAYHKENGYGLNFSV 169
           H N V    ++P D  LIAT S   TV L++    K   +ALRG   +     +     +
Sbjct: 182 HHNWVLCVSWSP-DGELIATGSMDNTVRLWESKTGKPFGDALRGHGKWITSLSWE-PIHL 239

Query: 170 ASPGE---LISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSED 226
            +PGE   L + S DG+I IWD  + + V T   S H+  V+  KW     N   S S D
Sbjct: 240 VTPGERPRLATSSKDGTIKIWD--TTRRVCTMTLSGHTSSVSCVKW--GGQNFLYSGSHD 295

Query: 227 SFLMIHDKRSEKPLQKLLQKE------------------PFN---------TIAFSKHSS 259
             + + D ++      +L+                    PF+          IA +K   
Sbjct: 296 KTVRVWDMKNSGRCINILKNHAHWVNHLSLSTDYALRVGPFDYTGEQPATPEIAKAKALK 355

Query: 260 N-------------LFAAAGTDAMVYLFDSRKPTEALHSMSGHQEAVTSLEFAHHKDGIL 306
           N             L   A  D  ++L+D  + T+ +  M+GHQ+ V  + F+     I+
Sbjct: 356 NYEKVAKRNGKETELMVTASDDFTMFLWDPLRTTKPIARMTGHQKLVNHVAFSPDGRHIV 415

Query: 307 CSGGSDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGHKSAINDFSFSPNVPWLMASV 366
            S   D  + LW            D+ DG  + +    GH +++   ++S +   L+ S 
Sbjct: 416 -SASFDNSIKLW------------DSRDG--KFITTFRGHVASVYQVAWSSDCR-LLVSC 459

Query: 367 EEENIVQIWK-PSRKLT 382
            ++  +++W   +RKL+
Sbjct: 460 SKDTTLKVWDIRTRKLS 476

 Score = 35.4 bits (80), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 35/147 (23%), Positives = 72/147 (48%), Gaps = 10/147 (6%)

Query: 175 LISCSDDGSIAIWD-IKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHD 233
           +++ SDD ++ +WD +++ K  P +  + H  +VN   +     +I  S S D+ + + D
Sbjct: 371 MVTASDDFTMFLWDPLRTTK--PIARMTGHQKLVNHVAFSPDGRHIV-SASFDNSIKLWD 427

Query: 234 KRSEKPLQKLL-QKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEA 292
            R  K +            +A+S     L  +   D  + ++D R    ++  + GH++ 
Sbjct: 428 SRDGKFITTFRGHVASVYQVAWSS-DCRLLVSCSKDTTLKVWDIRTRKLSV-DLPGHKDE 485

Query: 293 VTSLEFAHHKDGI-LCSGGSDRRVLLW 318
           V +++++   DG  +CSGG D+ V +W
Sbjct: 486 VYTVDWS--VDGKRVCSGGKDKMVRIW 510

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 23/104 (22%), Positives = 44/104 (42%), Gaps = 15/104 (14%)

Query: 273 LFDSRKPTEALHSMSGHQEAVTSLEFAHHKDGILCSGGSDRRVLLWDLFQIGTEQQEEDA 332
           +F  +  T +  +++GH   +    FA H    + +G  D    +W            D 
Sbjct: 123 VFKVKPVTRSSSAIAGHGSTILCSAFAPHTSSRMVTGAGDNTARIW------------DC 170

Query: 333 DDGGPELLMMHAGHKSAINDFSFSPNVPWLMASVEEENIVQIWK 376
           D   P   +   GH + +   S+SP+   L+A+   +N V++W+
Sbjct: 171 DTQTPMATL--TGHHNWVLCVSWSPDGE-LIATGSMDNTVRLWE 211

>Ecym_4717 Chr4 (1407391..1409202) [1812 bp, 603 aa] {ON} similar to
           Ashbya gossypii AAR078W
          Length = 603

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 47/193 (24%), Positives = 92/193 (47%), Gaps = 15/193 (7%)

Query: 175 LISCSDDGSIAIWDIKSGKTVPTSVNSLHS-DIVNECKWHESDPNIYGSVSEDSFLMIHD 233
           L S S D +I +WD+  G  V  S+ S+H+   V+  +WH SD +I  + + DS + + D
Sbjct: 326 LASTSADQTIKLWDLNQGTAV-RSIASIHNGTTVSSSQWHPSDGSIILTGAYDSRVALSD 384

Query: 234 KR--SEKPLQK---LLQKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSR--KPTEALHSM 286
            R  ++  + K   ++  E    ++F   + N F A      +Y FD R  + +  L ++
Sbjct: 385 VRISNDSEMSKYWSVMTGEEVECVSFV--NDNEFLAGTDSGNIYSFDLRNGEKSSPLWTL 442

Query: 287 SGHQEAVTSLEFAHHKDGILCSGGSDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGH 346
             H   ++S+        ++ S     +V+   L++I T+Q  E++   GP +++     
Sbjct: 443 KAHDSGISSMNVNSFIPNMMVSSAMGEKVI--KLWKIPTDQ--ENSTQKGPSMVLSRDFG 498

Query: 347 KSAINDFSFSPNV 359
              +   SF+P++
Sbjct: 499 VGNVLTTSFAPDI 511

>NDAI0J01850 Chr10 (461283..463010) [1728 bp, 575 aa] {ON} Anc_4.122
          Length = 575

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 42/170 (24%), Positives = 75/170 (44%), Gaps = 12/170 (7%)

Query: 169 VASPGELISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSF 228
           V +   L     +G + I+D+   K + T     H D  +   W+    +I  S S D  
Sbjct: 316 VGAGSHLAVGQGNGIVEIYDVVKRKCIRTLPG--HVDRTSCLSWNN---HILSSGSRDHT 370

Query: 229 LMIHDKRSEKPLQKLLQKEPFNTIAFS-KHSSNLFAAAGTDAMVYLFDSRKPTEALHSMS 287
           ++  D R  +P  + ++               N  A+ G D MVY++D    +  +  ++
Sbjct: 371 ILHRDVRMAEPFFERIKTHSQEVCGLKWNVDENKLASGGNDNMVYVYDGTS-SSPVFKIT 429

Query: 288 GHQEAVTSLEFAHHKDGILCSGGS--DRRVLLWDLFQIGTEQQEEDADDG 335
            H+ AV ++ ++ HK G L +GG   DR++ +W+   I T  +  D D G
Sbjct: 430 EHKAAVKAMAWSPHKRGTLATGGGTVDRKLKIWN---INTSTKTSDIDTG 476

>Smik_7.287 Chr7 complement(484376..486076) [1701 bp, 566 aa] {ON}
           YGL003C (REAL)
          Length = 566

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 50/202 (24%), Positives = 87/202 (43%), Gaps = 17/202 (8%)

Query: 137 TVFLYDRTKDDENALRGKYAYHKENGYGLNFSVASPGELISCSDDGSIAIWDIKSGKTVP 196
           ++FL D    D   L        EN Y     + +   L     +G + I+D+   K + 
Sbjct: 284 SIFLTDNNTGDVVHL-----CDTENEYTSLSWIGAGSHLAVGQGNGLVEIYDVMKRKCIR 338

Query: 197 TSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDKRSEKPLQKLLQKEPFNTIAFSK 256
           T   S H D V    W+    ++  S S D  ++  D R   P  + ++           
Sbjct: 339 TL--SGHVDRVACLSWNN---HVLTSGSRDHRILHRDVRMPDPFFETIESHTQEVCGLKW 393

Query: 257 HS-SNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEAVTSLEFAHHKDGILCSGG--SDR 313
           +   N  A+ G D MV++++    +  L +   H+ AV ++ ++ HK GIL +GG  +DR
Sbjct: 394 NVIDNKLASGGNDNMVHVYEGTSKSPIL-TFDEHKAAVKAMAWSPHKRGILATGGGTADR 452

Query: 314 RVLLWDLFQIGTEQQEEDADDG 335
           R+ +W+   + T  +  D D G
Sbjct: 453 RLKIWN---VNTSTKLSDIDSG 471

>KLLA0F19734g Chr6 (1826828..1830229) [3402 bp, 1133 aa] {ON}
           similar to uniprot|Q03897 Saccharomyces cerevisiae
           YDR128W Hypothetical ORF
          Length = 1133

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 41/157 (26%), Positives = 78/157 (49%), Gaps = 5/157 (3%)

Query: 175 LISCSDDGSIAIWDI-KSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHD 233
           +IS S+  +I +W++ +S       V   H   + +  +H   P I  + S D++ +  D
Sbjct: 85  VISTSNQKAI-VWNLSRSSSKAVEHVLHGHFRAITDINFHPLQPEILATSSIDTYALAWD 143

Query: 234 KRS-EKPLQKLLQ-KEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQE 291
            RS +KP  +    +     + ++  +SN+ A + ++ +VY++D RK T  L  + GH  
Sbjct: 144 MRSPKKPYFRTSNWRSGAAQVKWNHKNSNVLATSHSN-IVYVWDVRKGTSPLSVLEGHSG 202

Query: 292 AVTSLEFAHHKDGILCSGGSDRRVLLWDLFQIGTEQQ 328
           +V S++F    +  + S G+D  V  WD  ++  E Q
Sbjct: 203 SVNSIDFNPFNETEIMSSGNDGTVKFWDYNKVEDELQ 239

 Score = 30.8 bits (68), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 24/124 (19%), Positives = 45/124 (36%), Gaps = 14/124 (11%)

Query: 252 IAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEAVTSLEFAHHKDGILCSGGS 311
           I F      + A +  D     +D R P +     S  +     +++ H    +L +  S
Sbjct: 120 INFHPLQPEILATSSIDTYALAWDMRSPKKPYFRTSNWRSGAAQVKWNHKNSNVLATSHS 179

Query: 312 DRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGHKSAINDFSFSPNVPWLMASVEEENI 371
           +  V +WD+ +             G   L +  GH  ++N   F+P     + S   +  
Sbjct: 180 NI-VYVWDVRK-------------GTSPLSVLEGHSGSVNSIDFNPFNETEIMSSGNDGT 225

Query: 372 VQIW 375
           V+ W
Sbjct: 226 VKFW 229

>KAFR0B05580 Chr2 (1142731..1146093) [3363 bp, 1120 aa] {ON}
           Anc_8.288 YDR128W
          Length = 1120

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 45/175 (25%), Positives = 77/175 (44%), Gaps = 4/175 (2%)

Query: 115 EVTRARYAPFDSNLIATISGTG-TVFLYDRTKDDENALRGKYAYHKENGYGLNFSVASPG 173
           +V   +++P  +     +S +     +++ TK   NA+      H      +NFS   P 
Sbjct: 69  QVADVQWSPHPAKPYWVVSTSNQKAIIWNLTKTSSNAIEYVLHGHSRAITDINFSPQHPD 128

Query: 174 ELISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHD 233
            L +CS D  +  WD++S +    S +S  S    + KW+ SD NI  S   D   +   
Sbjct: 129 ILATCSIDTYVHAWDMRSPQRPFYSTSSWKSSAA-QVKWNHSDVNIMASSHGDDVFIWDL 187

Query: 234 KRSEKPLQKLLQKE-PFNTIAFSKHSSNLFAAAGTDAMVYLFD-SRKPTEALHSM 286
           +    PL KL   E   N+I F++  S    ++  D  V  +D SR   ++L ++
Sbjct: 188 RNGSTPLFKLSSHESSVNSIDFNRFRSTEIMSSSNDGTVKFWDYSRNVEDSLRTI 242

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 30/130 (23%), Positives = 51/130 (39%), Gaps = 14/130 (10%)

Query: 252 IAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEAVTSLEFAHHKDGILCSGGS 311
           I FS    ++ A    D  V+ +D R P    +S S  + +   +++ H    I+ S   
Sbjct: 120 INFSPQHPDILATCSIDTYVHAWDMRSPQRPFYSTSSWKSSAAQVKWNHSDVNIMASSHG 179

Query: 312 DRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGHKSAINDFSFSPNVPWLMASVEEENI 371
           D  V +WDL               G   L   + H+S++N   F+      + S   +  
Sbjct: 180 DD-VFIWDL-------------RNGSTPLFKLSSHESSVNSIDFNRFRSTEIMSSSNDGT 225

Query: 372 VQIWKPSRKL 381
           V+ W  SR +
Sbjct: 226 VKFWDYSRNV 235

 Score = 32.0 bits (71), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 19/76 (25%), Positives = 36/76 (47%), Gaps = 12/76 (15%)

Query: 311 SDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGHKSAINDFSFSPNVPWLMASVEEEN 370
           S+++ ++W+L +  +   E           ++H GH  AI D +FSP  P ++A+   + 
Sbjct: 89  SNQKAIIWNLTKTSSNAIE----------YVLH-GHSRAITDINFSPQHPDILATCSIDT 137

Query: 371 IVQIWKPSRKLTNPYF 386
            V  W   R    P++
Sbjct: 138 YVHAWD-MRSPQRPFY 152

>NCAS0B03690 Chr2 complement(657488..660925) [3438 bp, 1145 aa] {ON}
           Anc_8.288
          Length = 1145

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 37/156 (23%), Positives = 80/156 (51%), Gaps = 9/156 (5%)

Query: 170 ASPGELISCSDDGSIAIWDIKSGKTVPTSVNSL---HSDIVNECKWHESDPNIYGSVSED 226
           A P  ++S S+  ++ IW++   +T   +++ +   HS  + +  ++  +P+I  + S D
Sbjct: 83  AKPYWVVSTSNQKAL-IWNL--ARTSSDAIDHVLHGHSRAITDINFNPENPDILATCSVD 139

Query: 227 SFLMIHDKRS-EKPLQKL-LQKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALH 284
           +++   D RS  +P       +   + + ++   SN+ A+A ++  +Y++D R  +  LH
Sbjct: 140 TYVHAWDMRSPHRPFYTTSAWRSGASQVKWNYKDSNILASAHSND-IYIWDLRMGSTPLH 198

Query: 285 SMSGHQEAVTSLEFAHHKDGILCSGGSDRRVLLWDL 320
            + GH  +V S++F   K   + S  +D  V  WD+
Sbjct: 199 KLVGHDSSVNSIDFNRFKSSEIMSSSNDGTVKFWDI 234

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 38/161 (23%), Positives = 69/161 (42%), Gaps = 8/161 (4%)

Query: 128 LIATISGTGTVFLYDRTKDD--ENALRGKYAYHKENGYGLNFSVASPGELISCSDDGSIA 185
           +++T +    ++   RT  D  ++ L G    H      +NF+  +P  L +CS D  + 
Sbjct: 88  VVSTSNQKALIWNLARTSSDAIDHVLHG----HSRAITDINFNPENPDILATCSVDTYVH 143

Query: 186 IWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDKRSEKPLQKLL- 244
            WD++S    P    S      ++ KW+  D NI  S   +   +   +    PL KL+ 
Sbjct: 144 AWDMRSPHR-PFYTTSAWRSGASQVKWNYKDSNILASAHSNDIYIWDLRMGSTPLHKLVG 202

Query: 245 QKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHS 285
                N+I F++  S+   ++  D  V  +D  K ++   S
Sbjct: 203 HDSSVNSIDFNRFKSSEIMSSSNDGTVKFWDISKGSDNCTS 243

 Score = 37.4 bits (85), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 27/128 (21%), Positives = 51/128 (39%), Gaps = 14/128 (10%)

Query: 252 IAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEAVTSLEFAHHKDGILCSGGS 311
           I F+  + ++ A    D  V+ +D R P    ++ S  +   + +++ +    IL S  S
Sbjct: 123 INFNPENPDILATCSVDTYVHAWDMRSPHRPFYTTSAWRSGASQVKWNYKDSNILASAHS 182

Query: 312 DRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGHKSAINDFSFSPNVPWLMASVEEENI 371
           +  + +WDL               G   L    GH S++N   F+      + S   +  
Sbjct: 183 ND-IYIWDLRM-------------GSTPLHKLVGHDSSVNSIDFNRFKSSEIMSSSNDGT 228

Query: 372 VQIWKPSR 379
           V+ W  S+
Sbjct: 229 VKFWDISK 236

 Score = 31.2 bits (69), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 34/65 (52%), Gaps = 11/65 (16%)

Query: 311 SDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGHKSAINDFSFSPNVPWLMASVEEEN 370
           S+++ L+W+L +  +     DA D      ++H GH  AI D +F+P  P ++A+   + 
Sbjct: 92  SNQKALIWNLARTSS-----DAIDH-----VLH-GHSRAITDINFNPENPDILATCSVDT 140

Query: 371 IVQIW 375
            V  W
Sbjct: 141 YVHAW 145

 Score = 31.2 bits (69), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 42/83 (50%), Gaps = 15/83 (18%)

Query: 125 DSNLIATISGTGTVFLYDRTKDDENALR-GKYAYHKENGY-----GLNFSVASPGELISC 178
           DSN++A+ + +  ++++D        LR G    HK  G+      ++F+     E++S 
Sbjct: 173 DSNILAS-AHSNDIYIWD--------LRMGSTPLHKLVGHDSSVNSIDFNRFKSSEIMSS 223

Query: 179 SDDGSIAIWDIKSGKTVPTSVNS 201
           S+DG++  WDI  G    TS  S
Sbjct: 224 SNDGTVKFWDISKGSDNCTSTVS 246

>AGL190W Chr7 (341382..342494) [1113 bp, 370 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR142C (PEX7)
          Length = 370

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 59/297 (19%), Positives = 115/297 (38%), Gaps = 48/297 (16%)

Query: 120 RYAPFDSNLIATISGT-------GTVFLYDRTKDDENALRGKYAYHKENGYGLNFSVASP 172
           +Y+PF  N +A  SG+       G +F+ D T          +   K+  + + ++    
Sbjct: 15  QYSPFFDNKLAVASGSNFGLVGNGRLFIMDLTAQGTMVESNSF-LTKDGLFDVAWNELHE 73

Query: 173 GELISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIH 232
            ++++   DGS+ ++DI + +  P ++   H   V  C W+    + + S S D  + + 
Sbjct: 74  NQVLAAQGDGSLRLFDI-TLQQYPIALFQEHQREVFSCNWNLLHKDTFVSSSWDGTVKVW 132

Query: 233 DKRSEKPLQKLL------------------------------QKEPFNTIAFSKHSSNLF 262
                + +  LL                               K+      FS H  NL 
Sbjct: 133 TPARPQSMLTLLPAPANRSVMVEPGARGLPLSNQQQHKDAADNKDCIYQAQFSPHDPNLV 192

Query: 263 AAAGTDAMVYLFDSRKPT----EALHSMSGHQEAVTSLEFAHHKDGILCSGGSDRRVLLW 318
            +   ++ V LFD R+P     +   + SG +    S +F  ++  ++ +GG D+ V +W
Sbjct: 193 MSCSGNSYVSLFDLRQPAASNQQRFIAHSGLE--ALSCDFNKYRPHVIATGGVDKMVKVW 250

Query: 319 DLFQIGTEQQEEDADDGGPELLMMHAGHKSAINDFSFSPNVPWLMASVEEENIVQIW 375
           DL  +   +Q        P  +    GH  A+    +SP+   ++ S   +   + W
Sbjct: 251 DLRMV---RQTLTTSRTAPVSINEMQGHSLAVRKVVWSPHHSNILLSTSYDMTCRAW 304

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 37/164 (22%), Positives = 69/164 (42%), Gaps = 15/164 (9%)

Query: 116 VTRARYAPFDSNLIATISGTGTVFLYDRTKDDENALRGKYAYHKENGYGLNFSVASPGEL 175
           + +A+++P D NL+ + SG   V L+D  +   +  +   A+        +F+   P  +
Sbjct: 179 IYQAQFSPHDPNLVMSCSGNSYVSLFDLRQPAASNQQRFIAHSGLEALSCDFNKYRPHVI 238

Query: 176 ISCSDDGSIAIWDIK-------SGKTVPTSVNSL--HSDIVNECKWHESDPNIYGSVSED 226
            +   D  + +WD++       + +T P S+N +  HS  V +  W     NI  S S D
Sbjct: 239 ATGGVDKMVKVWDLRMVRQTLTTSRTAPVSINEMQGHSLAVRKVVWSPHHSNILLSTSYD 298

Query: 227 SFLMIHDKRSEKPLQKLLQK------EPFNTIAFSKHSSNLFAA 264
                    ++ P  +   +      +   +  FSKHS  +F A
Sbjct: 299 MTCRAWHDLADGPGGQHSGRTNNSDPQRGCSYVFSKHSEFVFGA 342

>KLTH0H02772g Chr8 complement(248747..250009) [1263 bp, 420 aa] {ON}
           similar to uniprot|Q12523 Saccharomyces cerevisiae
           YPL247C Hypothetical ORF
          Length = 420

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 50/209 (23%), Positives = 83/209 (39%), Gaps = 24/209 (11%)

Query: 116 VTRARYAPFDSNLIATISGTGTVFLYDRTKDDENALRGKYAYHKENGYGLNFSVASPGEL 175
           V+   +   D NLI + S   T  ++D      N ++ +   H    + + F   S    
Sbjct: 168 VSSFHWNAVDPNLIISSSIDTTCTVWDLQA--TNYVKTQLIAHDSEVFDVKFLTQSTQLF 225

Query: 176 ISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDKR 235
            SC  DGS+ ++D++S           HS I+ E     +  +   S +           
Sbjct: 226 ASCGGDGSVRVFDLRSLA---------HSTIIYEPSSQPTAGSSGDSSAASGGSGSGSNS 276

Query: 236 SEKPLQKLLQKEPF----NTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQE 291
           +      LL+ EP     N +A   H SN          V + D R P  A+ ++ GH  
Sbjct: 277 ASSGSNALLRLEPSPFDPNVVATFAHDSN---------SVLILDMRYPGAAILTLEGHVG 327

Query: 292 AVTSLEFAHHKDGILCSGGSDRRVLLWDL 320
           AV  +++   +  +L + G D + LLWDL
Sbjct: 328 AVNQIQWHPSRHNVLLTCGDDCQALLWDL 356

>Skud_16.482 Chr16 (834842..836239) [1398 bp, 465 aa] {ON} YPR178W
           (REAL)
          Length = 465

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 58/214 (27%), Positives = 92/214 (42%), Gaps = 18/214 (8%)

Query: 112 HENEVTRARYAPFDSNLIATISGTGTVFLYDRTKDDENALRGKYAYHKENGYGLNFSVAS 171
           HE  V+  +Y P    LI + S   T  L+D +   E  L+     H E  + L+F    
Sbjct: 264 HERRVSDVKYHP-SGKLIGSASHDMTWRLWDASTYQELLLQ---EGHTEGVFSLSFQC-- 317

Query: 172 PGELISCSD--DGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFL 229
            G L+ CS   D    IWDI+SG  V T     HS  V    W  +   +  +   D  +
Sbjct: 318 DGSLV-CSGGMDTLSMIWDIRSGNKVMTLTG--HSKPVYTVAWSTNGYQV-ATGGGDGLI 373

Query: 230 MIHDKRSE---KPLQKLLQKEPFNTIAFSK-HSSNLFAAAGTDAMVYLFDSRKPTEALHS 285
            + D R     +  Q L  +     + FSK        ++G D ++ ++ S    + + S
Sbjct: 374 NVWDIRQRDGGQVSQILAHRNIVTQVQFSKGDGGKKLVSSGYDNLINVYSSDTWLK-VAS 432

Query: 286 MSGHQEAVTSLEFAHHKDGILCSGGSDRRVLLWD 319
           + GH + + SL+ ++     L SGG DR + LW+
Sbjct: 433 LEGHTDKIISLDVSNDSQ-FLVSGGWDRSIKLWN 465

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 51/216 (23%), Positives = 97/216 (44%), Gaps = 28/216 (12%)

Query: 158 HKENGYGLNFSVASPGELISCSDDGSIAIWDIKSGKTVPTSVNSL--HSDIVNECKWHES 215
           HK     + +   S  ++ISC++DG I  +     +     +  L  H   V++ K+H S
Sbjct: 217 HKGKIGAVQWHPESNNQIISCAEDGHIKNFQYSKEEGEIKLLGDLVGHERRVSDVKYHPS 276

Query: 216 DPNIYGSVSEDSFLMIHDKRSEKPLQKLLQKEPFNTIAFS---KHSSNLFAAAGTDAMVY 272
              + GS S D    + D  +    Q+LL +E      FS   +   +L  + G D +  
Sbjct: 277 G-KLIGSASHDMTWRLWDAST---YQELLLQEGHTEGVFSLSFQCDGSLVCSGGMDTLSM 332

Query: 273 LFDSRKPTEALHSMSGHQEAVTSLEFAHHKDGILCSGGSDRRVLLWDLFQ---------- 322
           ++D R   + + +++GH + V ++ ++ +   +  +GG D  + +WD+ Q          
Sbjct: 333 IWDIRSGNKVM-TLTGHSKPVYTVAWSTNGYQV-ATGGGDGLINVWDIRQRDGGQVSQIL 390

Query: 323 ----IGTEQQEEDADDGGPELLMMHAGHKSAINDFS 354
               I T+ Q     DGG +L+   +G+ + IN +S
Sbjct: 391 AHRNIVTQVQFSKG-DGGKKLV--SSGYDNLINVYS 423

 Score = 38.5 bits (88), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 44/178 (24%), Positives = 73/178 (41%), Gaps = 23/178 (12%)

Query: 203 HSDIVNECKWHESDPNIYGSVSED----SFLMIHDKRSEKPLQKLLQKEPFNTIAFSKHS 258
           H   +   +WH    N   S +ED    +F    ++   K L  L+  E   +      S
Sbjct: 217 HKGKIGAVQWHPESNNQIISCAEDGHIKNFQYSKEEGEIKLLGDLVGHERRVSDVKYHPS 276

Query: 259 SNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEAVTSLEFAHHKDG-ILCSGGSDRRVLL 317
             L  +A  D    L+D+    E L    GH E V SL F    DG ++CSGG D   ++
Sbjct: 277 GKLIGSASHDMTWRLWDASTYQELLLQ-EGHTEGVFSLSF--QCDGSLVCSGGMDTLSMI 333

Query: 318 WDLFQIGTEQQEEDADDGGPELLMMHAGHKSAINDFSFSPNVPWLMASVEEENIVQIW 375
           WD+ + G +             +M   GH   +   ++S N  + +A+   + ++ +W
Sbjct: 334 WDI-RSGNK-------------VMTLTGHSKPVYTVAWSTN-GYQVATGGGDGLINVW 376

>Skud_16.32 Chr16 complement(56168..57736) [1569 bp, 522 aa] {ON}
           YPL247C (REAL)
          Length = 522

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 90/388 (23%), Positives = 151/388 (38%), Gaps = 72/388 (18%)

Query: 21  SNVPLMYDFVSETRLLWPSLTIQWLPRAEDSTEQELLVGTHTSDSEQNYLKIAEINLPQE 80
           SN  L ++ V +  +++P   IQW+P    S      + T  SDS    L+I  +N P+E
Sbjct: 160 SNDLLSWENVVDANVVYPVSKIQWVP----SQLHPRKLAT-CSDS----LRIWNVN-PEE 209

Query: 81  ILSNEGPVLQ----NDNNGSDEQVPSKIKIIKKFKHENEVTRARYAPFDSNLIATISGTG 136
               E   L     N  + +       +K+I  F     +T   +   D+NLI + S   
Sbjct: 210 RHLQEQVNLSLCKYNRQHPTSPATADDMKVIGTFP---PITSFDWNTVDTNLIISSSIDT 266

Query: 137 TVFLYDRTKDDENALRGKYAYHKENGYGLNFSVASPGELISCSDDGSIAIWDIKSGKTVP 196
           T  ++D      + ++ +   H    + + F   S     SC  DGS+ ++D++S     
Sbjct: 267 TCIVWDLQS--SHYVKTQLIAHDSEVFDVRFLTKSTQLFASCGGDGSVRVFDLRSLA--- 321

Query: 197 TSVNSLHSDIVNECKWH-ESDPNIYGSVSEDSFLMIHDKRSEKPLQKLLQKEPFNTIAFS 255
                 HS I+ E      S PN   +             S K    LL+ EP      S
Sbjct: 322 ------HSTIIYEPPSSPASGPNAGATTP-----------SLKGSDALLRLEP------S 358

Query: 256 KHSSNLFAAAGTDA-MVYLFDSRKPTEALHSMSGHQEAVTSLEFAHHKDGILCSGGSDRR 314
            +  N+ A    D+  + + D R P   + ++ GH  +V  +++   K  +L S   D +
Sbjct: 359 PYDPNVLATFAADSNKIIILDMRNPESPILNLEGHTCSVNEIKWHPTKRNVLLSCSDDCQ 418

Query: 315 VLLWDLFQIGTEQQEEDA----------DDGGPELLMMHAGHKS--------AINDFSF- 355
            L WDL     E    D+          +D   + +M   G K+        + ND    
Sbjct: 419 ALYWDLNNSFMEINGSDSKSPTASGASLEDSDGDTVMADGGAKANQQEDPLNSNNDKQVC 478

Query: 356 ----SPNVPWLMASVEEENIVQIWKPSR 379
               +PN+ ++  + E  NI   W+P R
Sbjct: 479 RTLDTPNMMYVNKTQEINNIA--WRPQR 504

>TDEL0F02230 Chr6 (407699..409369) [1671 bp, 556 aa] {ON} Anc_4.122
           YGL003C
          Length = 556

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 55/200 (27%), Positives = 85/200 (42%), Gaps = 19/200 (9%)

Query: 126 SNLIATISGTGTVFLYDRTKDDENALRGKYAYHKENGYGLNFSVASPGELISCSDDGSIA 185
           ++++A   G  ++FL D    D   L        EN Y     V +   L     +G + 
Sbjct: 264 TDMLAVALGK-SIFLTDNASGDVVHL-----CDTENEYTSLSWVGAGSHLAIGQANGLVE 317

Query: 186 IWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDKRSEKPLQKLLQ 245
           I+D+   K + T   S H D V    W+    +I  S S D  ++  D R      + ++
Sbjct: 318 IYDVVKRKCIRTL--SGHKDRVACLSWNN---HILTSGSRDRRILHRDVRVPDSFFERIE 372

Query: 246 KEPFNTIAFS-KHSSNLFAAAGTDAMVYLFD--SRKPTEALHSMSGHQEAVTSLEFAHHK 302
                         SN  A+ G D MVY++D  SR P         H  AV +L ++ HK
Sbjct: 373 THSQEVCGLKWNPESNKLASGGNDNMVYVYDGTSRSPVLKFEE---HTAAVKALAWSPHK 429

Query: 303 DGILCSGG--SDRRVLLWDL 320
            GIL SGG  +DR++  W++
Sbjct: 430 RGILASGGGTADRKLKTWNV 449

>Ecym_2026 Chr2 (42179..43534) [1356 bp, 451 aa] {ON} similar to
           Ashbya gossypii ADL184W
          Length = 451

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 53/237 (22%), Positives = 95/237 (40%), Gaps = 23/237 (9%)

Query: 158 HKENGYGLNFSVASPGELISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDP 217
           H E    + FS     + ++CSDD  + IW+  +G+     V S H   V  C WH    
Sbjct: 162 HMECMRDIAFSCGD-QKFVTCSDDNVLKIWNFSNGQQ--ERVLSGHHWDVKSCDWHPRFG 218

Query: 218 NIYGSVSEDSFLMIHDKRSEKPLQKLLQ-KEPFNTIAFSKHSSNLFAAAGTDAMVYLFDS 276
            I  S S+D+ +   D R+ + +  +L  K       F     NL A    D    ++D 
Sbjct: 219 LIV-SGSKDNLIKFWDPRTGRNVSTILGLKHTIIKTKFQPTQGNLLAVVAKDKSTKIYDI 277

Query: 277 RKPTEALHSMSGHQEAVTSLEFAHH--KDGILCSGGSDRRVLLWDLFQIGTEQQEEDADD 334
           R+    L ++   ++ V  +    H   + +   G  +  +  +DL          D + 
Sbjct: 278 RQNMRELQTI---RDDVDYMSLVWHPINETMFSVGCYNGAIKHFDLLH--------DNNS 326

Query: 335 GGPELLMMHAGHKSAINDFSFSPNVPWLMASVEEENIVQIWKPSRKLTNPYFPQGYD 391
             P    +   H+ ++   ++SP V  ++AS  ++  ++ W  SR    P  P  +D
Sbjct: 327 PVPSSHTITYAHEKSVTSLAYSP-VGHILASAAKDRTIRFWARSR----PVDPNAFD 378

>KLLA0E20967g Chr5 (1872227..1876192) [3966 bp, 1321 aa] {ON}
           similar to uniprot|Q92271 Saccharomyces cerevisiae
           YOL138C Hypothetical ORF
          Length = 1321

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 49/198 (24%), Positives = 81/198 (40%), Gaps = 38/198 (19%)

Query: 127 NLIATISGTGTVFLYD--RTKDDENALRGKYAYHKENGYGLNFSVASPGELISCSDDGSI 184
           N +A    + +V +YD  +T   +N +    + H  +   ++F++     LIS   DG I
Sbjct: 191 NYVAICGTSTSVAIYDINKTSAIDNPVVTSLSEHTRSINSVDFNMVQTSLLISGGQDGCI 250

Query: 185 AIWDIKSGKTVPT----SVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDKRSEKPL 240
            IWD++S K   T    S+N+  SD + + KW    P+   S   +     H K      
Sbjct: 251 KIWDLRSPKISTTRSDVSINT-GSDSIRDVKWM---PSYEFSNDTNGLSNRHFK------ 300

Query: 241 QKLLQKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEAVTSLEFAH 300
                                FA+     ++  FD R+P +A   ++ H      L +  
Sbjct: 301 ---------------------FASVHDSGLLLKFDLRQPNQAEKKINAHSGPALCLNWHP 339

Query: 301 HKDGILCSGGSDRRVLLW 318
           H+D I+ SGG D +  LW
Sbjct: 340 HQDYII-SGGRDGKCCLW 356

 Score = 38.5 bits (88), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 33/65 (50%), Gaps = 4/65 (6%)

Query: 260 NLFAAAGTDAMVYLFDSRKPTE----ALHSMSGHQEAVTSLEFAHHKDGILCSGGSDRRV 315
           N  A  GT   V ++D  K +      + S+S H  ++ S++F   +  +L SGG D  +
Sbjct: 191 NYVAICGTSTSVAIYDINKTSAIDNPVVTSLSEHTRSINSVDFNMVQTSLLISGGQDGCI 250

Query: 316 LLWDL 320
            +WDL
Sbjct: 251 KIWDL 255

>Smik_10.126 Chr10 (196821..198959) [2139 bp, 712 aa] {ON} YJL112W
           (REAL)
          Length = 712

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 45/150 (30%), Positives = 75/150 (50%), Gaps = 29/150 (19%)

Query: 172 PGELISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMI 231
           P  L+S S D +I  WD++SGK + T ++   ++++       +  N+   +S+ + L  
Sbjct: 510 PSFLVSGSQDRTIRQWDLRSGKCMQT-IDLSFANVLT------AATNV--DLSKSTLLT- 559

Query: 232 HDKRSEKPLQKLLQKEPFNTIAFSKHSSNLFAAAGT-DAMVYLFDSRKPTEALHSMSGHQ 290
             +RSE+P    LQ            S +   A GT D +V L+D R   + + ++ GH 
Sbjct: 560 --QRSERPSIGALQ------------SFDAALATGTKDGIVRLWDLRSG-KVIRTLKGHT 604

Query: 291 EAVTSLEFAHHKDGILCSGGSDRRVLLWDL 320
           +A+TSL+F       L +G  DR V +WDL
Sbjct: 605 DAITSLKFGSE---CLVTGSYDRTVRVWDL 631

>KAFR0F01060 Chr6 complement(201465..203126) [1662 bp, 553 aa] {ON}
           Anc_6.276 YPL247C
          Length = 553

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 72/304 (23%), Positives = 125/304 (41%), Gaps = 55/304 (18%)

Query: 25  LMYDFVSETRLLWPSLTIQWLPRAEDSTEQELLVGTHTSDSEQNYLKIAEINLPQEILSN 84
           L ++ ++ET + +P   I+WLP      +      T +SDS    L+I  +N     L  
Sbjct: 199 LTWEKLTETNVTYPVSNIKWLPNQLHPRQL-----TTSSDS----LRIWSLNDEVGTLDE 249

Query: 85  EGPV-------LQNDNNGSDEQVPSKIKIIKKFKHENEVTRARYAPFDSNLIATISGTGT 137
           +  +       L N  NG+   V S  +I+ +F     VT   +   D+NL+ + S   T
Sbjct: 250 QINLSLCKYNKLHNITNGT--SVTSTSQILGEFP---PVTSFDWNQTDTNLLISSSIDTT 304

Query: 138 VFLYDRTKDDENALRGKYAYHKENGYGLNFSVASPGELISCSDDGSIAIWDIKSGKTVPT 197
             ++D      N ++ +   H    Y + F   S     SC  DGS+ ++D++S      
Sbjct: 305 CIVWDL--QSSNYVKTQLIAHDSEVYDVRFLTKSTQLFASCGGDGSVRVFDLRSLA---- 358

Query: 198 SVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDKRSEKPLQKLLQKEPFNTIAFSKH 257
                HS I+ E     ++P     +S+                 LL+ EP      S  
Sbjct: 359 -----HSTIIYE---PPTNPVSNADLSQQQ-------------NALLRLEP------SPT 391

Query: 258 SSNLFAAAGTDA-MVYLFDSRKPTEALHSMSGHQEAVTSLEFAHHKDGILCSGGSDRRVL 316
            +N+ A   +++  + + D R     +  + GH+ A+  +++   K  IL S   D +VL
Sbjct: 392 DANVIATFVSESNKILILDMRNSESPVLVLEGHKSAINQIKWHPTKRYILLSCSDDCQVL 451

Query: 317 LWDL 320
            WDL
Sbjct: 452 YWDL 455

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 55/230 (23%), Positives = 101/230 (43%), Gaps = 31/230 (13%)

Query: 163 YGLNFSVASPGELISCSDDGSIAIWDIKSGKTVPTSVNSLHSDI--VNECKWHESDPNIY 220
           + LN  V +  E I+ S      + +I +G +V TS + +  +   V    W+++D N+ 
Sbjct: 238 WSLNDEVGTLDEQINLSLCKYNKLHNITNGTSV-TSTSQILGEFPPVTSFDWNQTDTNLL 296

Query: 221 GSVSEDSFLMIHDKRSEKPL--QKLLQKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRK 278
            S S D+  ++ D +S   +  Q +        + F   S+ LFA+ G D  V +FD R 
Sbjct: 297 ISSSIDTTCIVWDLQSSNYVKTQLIAHDSEVYDVRFLTKSTQLFASCGGDGSVRVFDLRS 356

Query: 279 ----------PTEALHS--MSGHQEAVTSLEFAHHKDGILCSGGSD-RRVLLWDLFQIGT 325
                     PT  + +  +S  Q A+  LE +     ++ +  S+  ++L+ D+     
Sbjct: 357 LAHSTIIYEPPTNPVSNADLSQQQNALLRLEPSPTDANVIATFVSESNKILILDM----- 411

Query: 326 EQQEEDADDGGPELLMMHAGHKSAINDFSFSPNVPWLMASVEEENIVQIW 375
                  +   P L++   GHKSAIN   + P   +++ S  ++  V  W
Sbjct: 412 ------RNSESPVLVL--EGHKSAINQIKWHPTKRYILLSCSDDCQVLYW 453

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 43/94 (45%), Gaps = 6/94 (6%)

Query: 111 KHENEVTRARYAPFDSNLIAT-ISGTGTVFLYDRTKDDENALRGKYAYHKENGYGLNFSV 169
           + +N + R   +P D+N+IAT +S +  + + D    +   L      HK     + +  
Sbjct: 378 QQQNALLRLEPSPTDANVIATFVSESNKILILDMRNSESPVL--VLEGHKSAINQIKWHP 435

Query: 170 ASPGELISCSDDGSIAIWDIK---SGKTVPTSVN 200
                L+SCSDD  +  WD+    SG TV +  N
Sbjct: 436 TKRYILLSCSDDCQVLYWDLNSTFSGNTVASPSN 469

>KNAG0B05550 Chr2 (1080707..1082560) [1854 bp, 617 aa] {ON}
           Anc_4.122 YGL003C
          Length = 617

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 44/166 (26%), Positives = 78/166 (46%), Gaps = 10/166 (6%)

Query: 169 VASPGELISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSF 228
           V +   L     +G + I+D   GK + T   S H D V    W+    +I  S S D  
Sbjct: 362 VGAGSHLAVGQRNGLVEIYDAVKGKCIRTL--SGHVDRVACLSWNN---HILSSGSRDHR 416

Query: 229 LMIHDKRSEKPLQKLLQKEPFNTIAFS-KHSSNLFAAAGTDAMVYLFDSRKPTEALHSMS 287
           ++  D R   P  + ++               N  A+ G D +V+++D    T  L +++
Sbjct: 417 ILHRDVRMPDPFFERIESHTQEVCGLKWNVDENKLASGGNDNIVHVYDGTSRTPML-TLN 475

Query: 288 GHQEAVTSLEFAHHKDGILCSGG--SDRRVLLWDLFQIGTEQQEED 331
            H+ AV ++ ++ HK GIL +GG  +DR + +W++  + T+ +E D
Sbjct: 476 EHKAAVKAIAWSPHKRGILATGGGTADRCLKIWNINNL-TKVREVD 520

>Kpol_1028.23 s1028 (63032..65266) [2235 bp, 744 aa] {ON}
           (63032..65266) [2235 nt, 745 aa]
          Length = 744

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 58/246 (23%), Positives = 107/246 (43%), Gaps = 45/246 (18%)

Query: 158 HKENGYGLNFSVASPGELISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDP 217
           H+++ Y L++   S  +L+S S D ++ IWD+++G+    S+     D V        D 
Sbjct: 503 HEQDIYSLDY-FPSGDKLVSGSGDRTVRIWDLRNGQ---CSLTLSIEDGVTTVAVSPGDG 558

Query: 218 NIYGSVSEDSFLMIHDKRSEKPLQKL--------LQKEPFNTIAFSKHSSNLFAAAGTDA 269
               + S D  + + D  +   +++L          K+   ++ F++  +N+ + +  D 
Sbjct: 559 KYIAAGSLDRAVRVWDSETGFLVERLDSENELGTGHKDSVYSVVFTRDGNNVVSGS-LDR 617

Query: 270 MVYLFDSRK----------PTEALHSMSGHQEAVTSLEFAHHKDGILCSGGSDRRVLLWD 319
            V L++ R           P     + +GH++ V S+    + + IL SG  DR VL W 
Sbjct: 618 SVKLWNLRGDNNQDVKPNVPGTCEVTYTGHKDFVLSVATTQNDEYIL-SGSKDRGVLFW- 675

Query: 320 LFQIGTEQQEEDADDGGPELLMMHAGHKSAI------NDFSFSPNVPWLMASVEEENIVQ 373
                      D   G P  L+M  GH++++      N F   PNV  + A+   +   +
Sbjct: 676 -----------DTKSGNP--LLMLQGHRNSVISVAVANGFPLGPNV-GVFATGSGDCKAR 721

Query: 374 IWKPSR 379
           IWK +R
Sbjct: 722 IWKYTR 727

>Suva_2.291 Chr2 (504722..508177) [3456 bp, 1151 aa] {ON} YDR128W
           (REAL)
          Length = 1151

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 43/164 (26%), Positives = 79/164 (48%), Gaps = 7/164 (4%)

Query: 170 ASPGELISCSDDGSIAIWDI-KSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSF 228
           A P  ++S S+  +I IW++ KS       V   HS  + +  ++   P++  + S D++
Sbjct: 79  AKPYWIVSTSNQKAI-IWNLAKSSSNAIEFVLHGHSRAITDINFNPQHPDVLATCSVDTY 137

Query: 229 LMIHDKRS-EKPLQKLLQ-KEPFNTIAFSKHSSNLFAAA-GTDAMVYLFDSRKPTEALHS 285
           +   D RS  +P       +   + + ++    N+ A++ G D  V+++D RK +  L S
Sbjct: 138 VHAWDMRSPHRPFYSTSSWRSAASQVKWNYKDPNVLASSHGND--VFVWDLRKGSTPLCS 195

Query: 286 MSGHQEAVTSLEFAHHKDGILCSGGSDRRVLLWDLFQIGTEQQE 329
           + GH  +V S++F   K   L S  +D  V  WD  +  TE + 
Sbjct: 196 LKGHVSSVNSIDFNRFKSTELMSSSNDGTVKFWDYSKSTTESKR 239

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 35/144 (24%), Positives = 60/144 (41%), Gaps = 2/144 (1%)

Query: 138 VFLYDRTKDDENALRGKYAYHKENGYGLNFSVASPGELISCSDDGSIAIWDIKSGKTVPT 197
             +++  K   NA+      H      +NF+   P  L +CS D  +  WD++S      
Sbjct: 92  AIIWNLAKSSSNAIEFVLHGHSRAITDINFNPQHPDVLATCSVDTYVHAWDMRSPHRPFY 151

Query: 198 SVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDKRSEKPLQKLL-QKEPFNTIAFSK 256
           S +S  S   ++ KW+  DPN+  S   +   +   ++   PL  L       N+I F++
Sbjct: 152 STSSWRS-AASQVKWNYKDPNVLASSHGNDVFVWDLRKGSTPLCSLKGHVSSVNSIDFNR 210

Query: 257 HSSNLFAAAGTDAMVYLFDSRKPT 280
             S    ++  D  V  +D  K T
Sbjct: 211 FKSTELMSSSNDGTVKFWDYSKST 234

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 31/132 (23%), Positives = 54/132 (40%), Gaps = 16/132 (12%)

Query: 252 IAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEAVTSLEFAHHKDGILCSG-G 310
           I F+    ++ A    D  V+ +D R P    +S S  + A + +++ +    +L S  G
Sbjct: 119 INFNPQHPDVLATCSVDTYVHAWDMRSPHRPFYSTSSWRSAASQVKWNYKDPNVLASSHG 178

Query: 311 SDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGHKSAINDFSFSPNVPWLMASVEEEN 370
           +D  V +WDL +             G   L    GH S++N   F+      + S   + 
Sbjct: 179 ND--VFVWDLRK-------------GSTPLCSLKGHVSSVNSIDFNRFKSTELMSSSNDG 223

Query: 371 IVQIWKPSRKLT 382
            V+ W  S+  T
Sbjct: 224 TVKFWDYSKSTT 235

>KLLA0F05159g Chr6 (506007..509702) [3696 bp, 1231 aa] {ON} similar
           to uniprot|P38968 Saccharomyces cerevisiae YDL195W SEC31
           involved in protein transport from endoplasmic reticulum
           to Golgi Component (p150) of COPII coat of secretory
           pathway vesicles
          Length = 1231

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 55/213 (25%), Positives = 90/213 (42%), Gaps = 23/213 (10%)

Query: 125 DSNLIATISGTGTVFLYDRTKDDENALRGKYAYHKENG--YGLNFSVASPGELISCSDDG 182
           D  +IA     G V  +D       AL+     HK  G    L F+      L+S    G
Sbjct: 73  DDKIIAGALENGVVEFFD-----PKALKSVAKIHKHQGPVKTLKFNAKQNNVLVSGGTQG 127

Query: 183 SIAIWD---IKSGKTVPTS--VNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDKRSE 237
            I +WD   I S    P S  +++   D V+   W++S  +++ S S   +  + D +++
Sbjct: 128 EIFVWDSNKIGSSDYSPFSAGISNTPIDEVSSLSWNQSLAHVFASASSSGYASVWDLKAK 187

Query: 238 KPLQKLLQ-------KEPFNTIAFSKHSSNLFAAAG---TDAMVYLFDSRKPTEALHSMS 287
           K +  L         K P   + +   SS + A A    T+ +V  +D R     L  +S
Sbjct: 188 KQVLHLNHSSSTTGIKVPLTVVDWHPTSSTIIATASSSDTEPLVLTWDLRNAHVPLKVLS 247

Query: 288 -GHQEAVTSLEFAHHKDGILCSGGSDRRVLLWD 319
            GH + V SL++    + +L S G D   +LW+
Sbjct: 248 QGHSKGVLSLDWCKQDENLLLSSGRDNTSVLWN 280

 Score = 39.7 bits (91), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 36/65 (55%), Gaps = 1/65 (1%)

Query: 261 LFAAAGTDAMVYLFDSRKPTEALHSMSGHQEAVTSLEFAHHKDGILCSGGSDRRVLLWDL 320
           + A A  + +V  FD  K  +++  +  HQ  V +L+F   ++ +L SGG+   + +WD 
Sbjct: 76  IIAGALENGVVEFFDP-KALKSVAKIHKHQGPVKTLKFNAKQNNVLVSGGTQGEIFVWDS 134

Query: 321 FQIGT 325
            +IG+
Sbjct: 135 NKIGS 139

>KNAG0D00740 Chr4 complement(115399..116913) [1515 bp, 504 aa] {ON}
           Anc_6.276 YPL247C
          Length = 504

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 86/380 (22%), Positives = 142/380 (37%), Gaps = 73/380 (19%)

Query: 25  LMYDFVSETRLLWPSLTIQWLPR---------AEDSTEQELLVGTHTSDSEQNYLKIAEI 75
           L ++ V++  +++P   +QWLP          A DS     L     S  EQ  L + + 
Sbjct: 155 LSWNNVAQADVVYPISKVQWLPSHLHPRQFATASDSLRIWSLNEDTNSLQEQINLSLCKY 214

Query: 76  NLPQEI-------LSNEGPVLQNDNNGSDEQVPSKIKIIKKFKHENEVTRARYAPFDSNL 128
              +         L+  G  L+N       ++P              VT   +   D+NL
Sbjct: 215 KKQRNNTAGNKVNLAAAGGCLKNTTTAILGELP-------------PVTSFDWNTVDTNL 261

Query: 129 IATISGTGTVFLYDRTKDDENALRGKYAYHKENGYGLNFSVASPGELISCSDDGSIAIWD 188
           + + S   T  ++D      N ++ +   H    Y + F   S     SC  DGS+ ++D
Sbjct: 262 LVSSSIDTTCIVWDL--QSPNYVKTQLIAHDSEVYDVRFLSQSTHLFASCGGDGSVRVFD 319

Query: 189 IKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDKRSEKPLQKLLQKEP 248
           ++S           HS IV E    E                ++D  ++     LL+ EP
Sbjct: 320 LRS---------LAHSTIVYEPPAGEG--------------TVNDVTAQN--NALLRLEP 354

Query: 249 FNTIAFSKHSSNLFAAAGTDAM-VYLFDSRKPTEALHSMSGHQEAVTSLEFAHHKDGILC 307
                 S    N+ A    D+  + + D R P     ++ GH   V  +++   K  +L 
Sbjct: 355 ------SLMDPNIIATLVADSKDILILDMRNPESPALTLKGHSSLVNQIKWHPTKRNVLL 408

Query: 308 SGGSDRRVLLWDL---FQIGTEQQEEDADDGGPELLMMHAGHKSAINDFSF-----SPNV 359
           S   D +VL WDL       T      +  G  ++ M   G++ AI D +      +PN+
Sbjct: 409 SCSDDCQVLYWDLNTALDGSTPTSSSTSITGDTDISMAGTGYEHAIADDTRGKVLDTPNL 468

Query: 360 PWLMASVEEENIVQIWKPSR 379
            +   S E  NI   W+P R
Sbjct: 469 FYANESQEINNIA--WRPQR 486

>ZYRO0G10472g Chr7 complement(844939..846621) [1683 bp, 560 aa] {ON}
           similar to uniprot|P53197 Saccharomyces cerevisiae
           YGL003C CDH1 CDC20 homolog 1 protein required for Clb2
           and Ase1 degradation
          Length = 560

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 47/179 (26%), Positives = 78/179 (43%), Gaps = 12/179 (6%)

Query: 160 ENGYGLNFSVASPGELISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNI 219
           EN Y     V +   L     +G + I+D+   K + T   S H D V    W+     +
Sbjct: 296 ENEYTSLSWVGAGSHLAVGQGNGLVEIYDVVKKKCIRTL--SGHMDRVACLSWNNY---V 350

Query: 220 YGSVSEDSFLMIHDKRSEKPLQKLLQKEPFNTIAFS-KHSSNLFAAAGTDAMVYLFDSRK 278
             S S D  ++  D R      + ++               N  A+ G D M++++DS  
Sbjct: 351 LTSGSRDRRILHRDVRIPDSYFERIEAHTQEVCGLKWNVDDNKLASGGNDNMLFVYDSTA 410

Query: 279 PTEALHSMSGHQEAVTSLEFAHHKDGILCSGG--SDRRVLLWDLFQIGTEQQEEDADDG 335
               L + + H  AV ++ ++ HK G+L SGG  +DRR+ +W+   + T Q+  D D G
Sbjct: 411 RNPVL-TFNEHTAAVKAMAWSPHKRGVLGSGGGTADRRLKVWN---VNTSQKISDVDTG 465

>Smik_16.442 Chr16 (754983..756395) [1413 bp, 470 aa] {ON} YPR178W
           (REAL)
          Length = 470

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 58/216 (26%), Positives = 94/216 (43%), Gaps = 22/216 (10%)

Query: 112 HENEVTRARYAPFDSNLIATISGTGTVFLYDRTKDDENALRGKYAYHKENGYGLNFSVAS 171
           HE  V+  +Y P     I + S   T  L+D +   E  L+     H +  + L+F    
Sbjct: 269 HERRVSDVKYHP-SGKFIGSASHDMTWRLWDASTHQELLLQ---EGHSKGVFSLSFQC-- 322

Query: 172 PGELISCSD--DGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIY--GSVSEDS 227
            G L+ CS   D    +WDI+SG  V T     HS  V    W    PN Y   +   D 
Sbjct: 323 DGSLV-CSGGMDSLTMLWDIRSGSKVMTLAG--HSKPVYTVAW---SPNGYQVATGGGDG 376

Query: 228 FLMIHD--KRSEKPLQKLLQKEPFNT-IAFSK-HSSNLFAAAGTDAMVYLFDSRKPTEAL 283
            + + D  +R E  L ++L      T + FS         + G D ++ ++ S    + +
Sbjct: 377 LINVWDIRQRDEGQLNQILAHRNIVTQVKFSNDDGGKKLVSCGYDNLINIYSSDTWLK-V 435

Query: 284 HSMSGHQEAVTSLEFAHHKDGILCSGGSDRRVLLWD 319
            S+ GH + + SL+ +++    L +GG DR + LW+
Sbjct: 436 QSLEGHTDKIISLDISNNSH-FLVTGGWDRSIKLWN 470

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 45/178 (25%), Positives = 74/178 (41%), Gaps = 23/178 (12%)

Query: 203 HSDIVNECKWHESDPNIYGSVSEDSFL---MIHDKRSEKPLQKLLQKEPFNTIAFSKHSS 259
           H   +   +WH S  N   S +ED  +      +K  E  L                H S
Sbjct: 222 HVGKIGAVEWHPSSNNQMVSCAEDGLIKNFQYLNKEGELRLLGDFVGHERRVSDVKYHPS 281

Query: 260 NLFAAAGTDAMVY-LFDSRKPTEALHSMSGHQEAVTSLEFAHHKDG-ILCSGGSDRRVLL 317
             F  + +  M + L+D+    E L    GH + V SL F    DG ++CSGG D   +L
Sbjct: 282 GKFIGSASHDMTWRLWDASTHQELLLQ-EGHSKGVFSLSF--QCDGSLVCSGGMDSLTML 338

Query: 318 WDLFQIGTEQQEEDADDGGPELLMMHAGHKSAINDFSFSPNVPWLMASVEEENIVQIW 375
           WD+ + G++             +M  AGH   +   ++SPN  + +A+   + ++ +W
Sbjct: 339 WDI-RSGSK-------------VMTLAGHSKPVYTVAWSPN-GYQVATGGGDGLINVW 381

>KLTH0E08162g Chr5 complement(749584..751254) [1671 bp, 556 aa] {ON}
           similar to uniprot|P53197 Saccharomyces cerevisiae
           YGL003C CDH1 CDC20 homolog 1 protein required for Clb2
           and Ase1 degradation
          Length = 556

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 36/145 (24%), Positives = 74/145 (51%), Gaps = 13/145 (8%)

Query: 181 DGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDKRSEKPL 240
           +G + I+D++  + + T     H D V    W+    +I  S S D  ++  D R+ +P 
Sbjct: 313 NGLVKIFDVEKKRCIRTIPG--HIDRVACLSWNN---HILTSGSRDRRILHRDVRTPEPC 367

Query: 241 QKLLQKEPFNTIAFS-KHSSNLFAAAGTDAMVYLFD--SRKPTEALHSMSGHQEAVTSLE 297
            + ++               N  A+ G D +V+++D  SRKP   + +++ H  AV ++ 
Sbjct: 368 FEEIRTHKQEVCGLKWNVDENQLASGGNDNVVFVYDGTSRKP---ILTLAEHTAAVKAMA 424

Query: 298 FAHHKDGILCSGG--SDRRVLLWDL 320
           ++ H+ G+L +GG  +D+R+ +W++
Sbjct: 425 WSPHRRGVLATGGGTADKRLKIWNV 449

>TDEL0A00440 Chr1 (78820..80175) [1356 bp, 451 aa] {ON} Anc_3.25
           YNL317W
          Length = 451

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 52/219 (23%), Positives = 92/219 (42%), Gaps = 21/219 (9%)

Query: 174 ELISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHD 233
           + ++CSDD  + IW+  +G+     V S H   V  C WH  +  +  S S+D+ + + D
Sbjct: 179 KFVTCSDDNILKIWNFSNGQQ--ERVLSGHHWDVKSCDWHP-EMGLIASASKDNLVKLWD 235

Query: 234 KRSEKPLQKLLQ-KEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEA 292
            R  + +  +L+ K       F     NL AA   D    +FD R   + L  +    + 
Sbjct: 236 PRVGQCISTILKFKHTVLKTRFQPTGGNLLAAISKDKSCRVFDIRHSLKELMVVRDEVDY 295

Query: 293 VTSLEFAHHKDGILCSGGSDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGHKSAIND 352
           +T L +    + +L     D  +  +D+ Q          D   P   + +A H   I  
Sbjct: 296 MT-LLWNPINESMLTVACYDGSLKDFDVVQ----------DLKKPVHTIPYA-HDKCITS 343

Query: 353 FSFSPNVPWLMASVEEENIVQIWKPSRKLTNPYFPQGYD 391
            S++P V  ++AS  ++  ++ W  +R    P  P  +D
Sbjct: 344 LSYNP-VGHILASASKDRTIRFWTRAR----PSDPNAFD 377

 Score = 34.7 bits (78), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 41/90 (45%), Gaps = 16/90 (17%)

Query: 286 MSGHQEAVTSLEFAHHKDGILCSGGSDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAG 345
           M  H  AVT++E++H  D ++ SG SD  + +W   Q      +E           +   
Sbjct: 119 MQAHDSAVTTMEYSHAGDWMV-SGDSDGTIKIW---QPNFNMVKE-----------LDRA 163

Query: 346 HKSAINDFSFSPNVPWLMASVEEENIVQIW 375
           H   I D +FS N      +  ++NI++IW
Sbjct: 164 HTECIRDVAFSGNDS-KFVTCSDDNILKIW 192

>NCAS0E03750 Chr5 complement(736672..740502) [3831 bp, 1276 aa] {ON}
           Anc_7.310
          Length = 1276

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 51/218 (23%), Positives = 99/218 (45%), Gaps = 22/218 (10%)

Query: 124 FDSNLIA-TISGTGTVFLYDRTKDDEN-ALR--GKYAYHKENGYGLNFSVASPGELISCS 179
           FD+  IA  +   G + L+ + ++D   +L+  GK+  H      L F+      L S  
Sbjct: 74  FDNKFIAGALDDNGKIELFSKEENDTKISLKSLGKFKKHTTAVNTLRFNPKQQNVLASAG 133

Query: 180 DDGSIAIWDIK----SGKTVPTSVNSLHS--DIVNECKWHESDPNIYGSVSEDS-FLMIH 232
           ++G I IWDI     S    P++     S  D +    W++S  +++ S  + + +  I 
Sbjct: 134 NNGEILIWDINKTLSSTDYSPSAPGIAMSTQDEIKSVSWNKSLAHVFASAGDTTTYASIW 193

Query: 233 DKRSEKPLQKLLQKEPFNTIA--------FSKHSSNLFAAAGTDA--MVYLFDSRKPTEA 282
           D +++K +  L    P   +           K ++ +  A+G+D+  ++ ++D R     
Sbjct: 194 DLKAKKEVIHLNYTSPKTGLKPNLAVVEWHPKVTTYVATASGSDSDPVILIWDLRNSNMP 253

Query: 283 LHSMSG-HQEAVTSLEFAHHKDGILCSGGSDRRVLLWD 319
           + ++ G H + + SL++    + +L S G D  V LWD
Sbjct: 254 MTTLEGPHTKGIMSLDWCTKDESLLLSSGRDGIVALWD 291

>Kwal_56.23685 s56 complement(656691..659999) [3309 bp, 1102 aa]
           {ON} YDR128W - Hypothetical ORF [contig 174] FULL
          Length = 1102

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 37/153 (24%), Positives = 76/153 (49%), Gaps = 5/153 (3%)

Query: 170 ASPGELISCSDDGSIAIWDI-KSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSF 228
           + P  +IS S+  ++ +W++ ++       V   HS  + +  +H + P I  + S D++
Sbjct: 80  SKPSWVISTSNQKAL-LWNLSRNSSDAIEHVLHGHSRAITDINFHPTHPEILATCSIDAY 138

Query: 229 LMIHDKRSEKP--LQKLLQKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSM 286
           +   D RS +       +     + + ++  +SN+ A+A ++  VY++D RK    LH +
Sbjct: 139 VHAWDMRSPRRAYYSASVWSAGASQVKWNYKNSNVMASAHSND-VYIWDLRKGCTPLHVL 197

Query: 287 SGHQEAVTSLEFAHHKDGILCSGGSDRRVLLWD 319
            GH  +V S++F+   +  + S  +D  V  WD
Sbjct: 198 QGHVNSVNSIDFSKFDETEIMSSSNDGTVKFWD 230

 Score = 30.8 bits (68), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 32/65 (49%), Gaps = 11/65 (16%)

Query: 311 SDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGHKSAINDFSFSPNVPWLMASVEEEN 370
           S+++ LLW+L +  ++  E           ++H GH  AI D +F P  P ++A+   + 
Sbjct: 89  SNQKALLWNLSRNSSDAIEH----------VLH-GHSRAITDINFHPTHPEILATCSIDA 137

Query: 371 IVQIW 375
            V  W
Sbjct: 138 YVHAW 142

>SAKL0F11506g Chr6 complement(894080..895786) [1707 bp, 568 aa] {ON}
           similar to uniprot|P21304 Saccharomyces cerevisiae
           YLR196W PWP1
          Length = 568

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 45/193 (23%), Positives = 90/193 (46%), Gaps = 17/193 (8%)

Query: 175 LISCSDDGSIAIWDIKSGKTVPTSVNSLHSDI-VNECKWHESDPNIYGSVSEDSFLMIHD 233
           L S S D ++ +WD+ +G     S+ S+H++  V+  +WH +D +I  +   DS + + D
Sbjct: 295 LASTSADHTVKLWDLNNG-IAARSIASIHNNKNVSSSQWHSTDGSILLTGGYDSRVAVSD 353

Query: 234 KR--SEKPLQK---LLQKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSR--KPTEALHSM 286
            R   +  + K   ++  E   ++ F+  S N+         VY FD R  + ++ L ++
Sbjct: 354 VRIADDSAMSKYWSVMAGEEIESVRFA--SENVIMCGTDSGNVYSFDIRNGEGSKPLWTL 411

Query: 287 SGHQEAVTSLEFAHHKDGILCSGGSDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGH 346
             H   ++SL+   H   +L +     +V+   L++  TE      D  GP +++     
Sbjct: 412 KAHDAGISSLDVNQHVPNMLATSAMGEKVV--KLWKCPTEA----GDAKGPGMVLSRDFG 465

Query: 347 KSAINDFSFSPNV 359
              +   SF+P++
Sbjct: 466 VGNVLSTSFAPDI 478

>NCAS0J01110 Chr10 (189535..191322) [1788 bp, 595 aa] {ON} 
          Length = 595

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 53/188 (28%), Positives = 80/188 (42%), Gaps = 16/188 (8%)

Query: 160 ENGYGLNFSVASPGELISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNI 219
           EN Y     V +   L     +G + I+D+   K V T   S H D V    W   + +I
Sbjct: 331 ENEYTSLSWVGAGSHLAVGQGNGLVEIYDVVKRKCVRTL--SGHVDRVACLSW---NGHI 385

Query: 220 YGSVSEDSFLMIHDKRSEKPLQKLLQKEPFNTIAFSKHSS-NLFAAAGTDAMVYLFD--S 276
             S S D  ++  D R   P  + L            ++  N  A+ G D +V ++D  S
Sbjct: 386 LTSGSRDHNILHRDVRMPDPFFERLNTHSQEVCGLQWNTEENKLASGGNDNVVCVYDGTS 445

Query: 277 RKPTEALHSMSGHQEAVTSLEFAHHKDGILCSGGS--DRRVLLWDLFQIGTEQQEEDADD 334
           R P   +     H+ AV +L ++ HK GIL +GG   DRR+  W+   + T  +  D D 
Sbjct: 446 RNP---MIKFIEHKAAVKALAWSPHKRGILATGGGTVDRRLKTWN---VNTSMKLSDVDT 499

Query: 335 GGPELLMM 342
           G     M+
Sbjct: 500 GSQVCNMI 507

>TPHA0E03080 Chr5 complement(646691..648157) [1467 bp, 488 aa] {ON}
           Anc_5.201 YLL011W
          Length = 488

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 46/254 (18%), Positives = 96/254 (37%), Gaps = 67/254 (26%)

Query: 175 LISCSDDGSIAIWDIKS------------------------------------------- 191
           +ISC DD ++ +W + S                                           
Sbjct: 132 MISCGDDKTVKLWSVDSNDFSNNKKDDTIHKGDGLLKTYYGDHAFFGLDHHRNNSTFVTG 191

Query: 192 ---------GKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDKRSEKPLQK 242
                     ++ P S  +  +D V   K+++++ +I  S   D+ ++++D R+  P QK
Sbjct: 192 GAQIQLWDANRSKPISNLTWGADNVTSVKFNQTETDILASTGSDNSIVLYDLRTNSPTQK 251

Query: 243 LLQKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEAVTSLEFAHHK 302
           + Q    N I ++   +  F  A  D   Y +D R  + AL+    H  AV  ++F+   
Sbjct: 252 IRQSMRTNAICWNPMEAFNFVIANEDHNAYYYDMRNMSRALNVFKDHVSAVMDVDFSPTG 311

Query: 303 DGILCSGGSDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGHKSAINDFSFSPNVPWL 362
           D I+ +G  D+ + ++   Q             G    + H      +    +S +  ++
Sbjct: 312 DEIV-TGSYDKTIRIYKTNQ-------------GHSREVYHTKRMQHVFQVKYSMDSKYI 357

Query: 363 MASVEEENIVQIWK 376
           ++  ++ N V++W+
Sbjct: 358 ISGSDDGN-VRLWR 370

>YJL112W Chr10 (205305..207449) [2145 bp, 714 aa] {ON}
           MDV1Peripheral protein of the cytosolic face of the
           mitochondrial outer membrane, required for mitochondrial
           fission; interacts with Fis1p and with the
           dynamin-related GTPase Dnm1p; contains WD repeats
          Length = 714

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 44/150 (29%), Positives = 75/150 (50%), Gaps = 29/150 (19%)

Query: 172 PGELISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMI 231
           P  L+S S D +I  WD++SGK + T ++   ++++       +  N+   +S+ + L  
Sbjct: 512 PSFLVSGSQDRTIRQWDLRSGKCLQT-IDLSFANVLT------TSTNV--DLSKSTLLT- 561

Query: 232 HDKRSEKPLQKLLQKEPFNTIAFSKHSSNLFAAAGT-DAMVYLFDSRKPTEALHSMSGHQ 290
             +R+E+P    LQ            S +   A GT D +V L+D R   + + ++ GH 
Sbjct: 562 --QRNERPSIGALQ------------SFDAALATGTKDGVVRLWDLRSG-KVIRTLKGHT 606

Query: 291 EAVTSLEFAHHKDGILCSGGSDRRVLLWDL 320
           +A+TSL+F       L +G  DR V +WDL
Sbjct: 607 DAITSLKF---DSACLVTGSYDRTVRIWDL 633

>Ecym_8061 Chr8 complement(131761..135447) [3687 bp, 1228 aa] {ON}
           similar to Ashbya gossypii ADR090W
          Length = 1228

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 58/266 (21%), Positives = 102/266 (38%), Gaps = 33/266 (12%)

Query: 125 DSNLIATISGTGTVFLYDRTKDDENALRGKYAYHKENGYGLNFSVASPGELISCSDDGSI 184
           D +++A     G V  +   K +E     K   H      L F+      L+S    G I
Sbjct: 73  DGSILAGALDNGVVEFF---KPEELRSVAKVKKHTTAVQTLRFNAKQSNVLVSGGSQGEI 129

Query: 185 AIWD---IKSGKTVPTSVNSLHSDI--VNECKWHESDPNIYGSVSEDSFLMIHDKRSEKP 239
            +WD   I +    P       + I  V    W+++  +++ S     F  I D +++K 
Sbjct: 130 YVWDTNKIATQGYSPFGPGVAMTPIEEVQSLAWNQTLAHVFASAGSSGFASIWDLKAKKE 189

Query: 240 LQKLLQKEPFNTIA--------FSKHSSNLFAAAGTD--AMVYLFDSRKPTEALHSMS-G 288
           +  L    P + +            +S+ +  A G D   ++ ++D R     L  +S G
Sbjct: 190 VIHLSYTSPTSGLKNQLSVVEWHPSNSTKVATATGNDNEPVILVWDLRNSNAPLKVLSQG 249

Query: 289 HQEAVTSLEFAHHKDGILCSGGSDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGHKS 348
           H + + SL++    D ++ S G D   +LW+          E+A     + L       +
Sbjct: 250 HSKGILSLDWCQQDDKLMISSGRDNTCILWN---------PEEA-----QKLTQFPTRGN 295

Query: 349 AINDFSFSPNVPWLMASVEEENIVQI 374
                 F+P  P L AS   +N VQ+
Sbjct: 296 WCFKTKFAPEAPDLFASASFDNKVQV 321

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 50/109 (45%), Gaps = 6/109 (5%)

Query: 220 YGSVSEDSFLMIHDKRSEKPLQKLLQKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKP 279
           + S S      +  + +  P   ++    FN + +SK  S + A A  + +V  F   KP
Sbjct: 36  FSSASTLELWSVLSRDARTPQGMIVADAKFNDLEWSKDGS-ILAGALDNGVVEFF---KP 91

Query: 280 TE--ALHSMSGHQEAVTSLEFAHHKDGILCSGGSDRRVLLWDLFQIGTE 326
            E  ++  +  H  AV +L F   +  +L SGGS   + +WD  +I T+
Sbjct: 92  EELRSVAKVKKHTTAVQTLRFNAKQSNVLVSGGSQGEIYVWDTNKIATQ 140

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 33/151 (21%), Positives = 66/151 (43%), Gaps = 24/151 (15%)

Query: 247 EPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALH-----SMSGHQEAVTSLEF-AH 300
           E   ++A+++  +++FA+AG+     ++D +   E +H       SG +  ++ +E+   
Sbjct: 155 EEVQSLAWNQTLAHVFASAGSSGFASIWDLKAKKEVIHLSYTSPTSGLKNQLSVVEWHPS 214

Query: 301 HKDGILCSGGSDRR--VLLWDLFQIGTEQQEEDADDGGPELLMMHAGHKSAINDFSFSPN 358
           +   +  + G+D    +L+WDL             +    L ++  GH   I    +   
Sbjct: 215 NSTKVATATGNDNEPVILVWDL------------RNSNAPLKVLSQGHSKGILSLDWCQQ 262

Query: 359 VPWLMASVEEENIVQIWKP--SRKLTNPYFP 387
              LM S   +N   +W P  ++KLT   FP
Sbjct: 263 DDKLMISSGRDNTCILWNPEEAQKLTQ--FP 291

>KAFR0L01520 Chr12 complement(278754..280508) [1755 bp, 584 aa] {ON}
           Anc_7.356 YLR196W
          Length = 584

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 47/194 (24%), Positives = 89/194 (45%), Gaps = 15/194 (7%)

Query: 175 LISCSDDGSIAIWDIKSGKTVPTSVNSLHSDI-VNECKWHESDPNIYGSVSEDSFLMIHD 233
           L S S D ++ +WD+ SG     S+ S+H++  V+  +WH  + +I  +   DS + + D
Sbjct: 305 LASTSADHTVKLWDLNSGNAA-RSMASIHNNKNVSSSQWHHGNGSILLTGGYDSRIALTD 363

Query: 234 KR--SEKPLQK---LLQKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRK--PTEALHSM 286
            R  +E  + K   +   E   T+ F+    N+  A      +Y FD R    ++ + ++
Sbjct: 364 VRISNENEMSKYWSVSNGEEVETVIFADE--NIILAGTDSGNIYSFDIRNNAGSKPVWTL 421

Query: 287 SGHQEAVTSLEFAHHKDGILCSGG-SDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAG 345
             H   ++SL   +   G++ +G   ++ V LW  F  G  Q   D    GP +++    
Sbjct: 422 KAHDAGISSLSVNNFIPGLMSTGAMGEKAVKLWK-FPTGDSQA--DGSMKGPNMVLSRDF 478

Query: 346 HKSAINDFSFSPNV 359
               +   SF+P++
Sbjct: 479 DVGNVLTTSFAPDI 492

>KNAG0B02800 Chr2 (537056..540979) [3924 bp, 1307 aa] {ON} Anc_7.310
           YDL195W gene spans a gap in the genome sequence
          Length = 1307

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 49/220 (22%), Positives = 86/220 (39%), Gaps = 44/220 (20%)

Query: 111 KHENEVTRARYAPFDSNLIATISGTGTVFLYDRTKDDENALRGKYAYHKENGYGLNFSVA 170
           KH   VT+AR+    SN++AT    G + ++D  K             K  G G+  S  
Sbjct: 108 KHAGAVTQARFHSLQSNILATGDSKGGILIWDTNK----------CLTKAQGGGV-VSTY 156

Query: 171 SPGELISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLM 230
           +P                      +P + N    + V    W++   +I+ S +  SF  
Sbjct: 157 TP---------------------MLP-AANKSSEEPVQCLAWNKKQAHIFASTNSTSFAS 194

Query: 231 IHDKRSEKPLQKLLQKEPFNTIA--------FSKHSSNLFAAAGTDA--MVYLFDSRKPT 280
           I D +++K +  L    P   +             S+ +    G D   +V ++D R   
Sbjct: 195 IWDLKAKKDVLHLSYTSPLTGLKPQLSVVEWHPDQSTYVATGTGNDTGPVVVVWDLRNAN 254

Query: 281 EALHSMSG-HQEAVTSLEFAHHKDGILCSGGSDRRVLLWD 319
             L  ++G H + + SL++    + +L S G D  V+LW+
Sbjct: 255 TPLQELTGGHSKGILSLDWCQQDETLLLSSGRDNSVVLWN 294

 Score = 38.9 bits (89), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 42/214 (19%), Positives = 83/214 (38%), Gaps = 36/214 (16%)

Query: 198 SVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDKR-------------SEKPLQKLL 244
           S+   H+  V + ++H    NI  +      ++I D               +  P+    
Sbjct: 104 SIEGKHAGAVTQARFHSLQSNILATGDSKGGILIWDTNKCLTKAQGGGVVSTYTPMLPAA 163

Query: 245 QK---EPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALH-----SMSGHQEAVTSL 296
            K   EP   +A++K  +++FA+  + +   ++D +   + LH      ++G +  ++ +
Sbjct: 164 NKSSEEPVQCLAWNKKQAHIFASTNSTSFASIWDLKAKKDVLHLSYTSPLTGLKPQLSVV 223

Query: 297 EFAHHKDGILCSG-GSDRR--VLLWDLFQIGTEQQEEDADDGGPELLMMHAGHKSAINDF 353
           E+   +   + +G G+D    V++WDL    T  QE            +  GH   I   
Sbjct: 224 EWHPDQSTYVATGTGNDTGPVVVVWDLRNANTPLQE------------LTGGHSKGILSL 271

Query: 354 SFSPNVPWLMASVEEENIVQIWKPSRKLTNPYFP 387
            +      L+ S   +N V +W P        FP
Sbjct: 272 DWCQQDETLLLSSGRDNSVVLWNPIEGAALTKFP 305

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 44/96 (45%), Gaps = 4/96 (4%)

Query: 237 EKPLQKLLQKEPFNTIAFSKHSSNLFAAAGTDAMVYL---FDSRKPTEALHSMSG-HQEA 292
           EKP   L+    FN + +S  +  +  A  +  + +     D+    ++L S+ G H  A
Sbjct: 53  EKPASSLVVDAKFNDLDWSVDNEIIVGALDSGCLEFYSAGADNGNELKSLGSIEGKHAGA 112

Query: 293 VTSLEFAHHKDGILCSGGSDRRVLLWDLFQIGTEQQ 328
           VT   F   +  IL +G S   +L+WD  +  T+ Q
Sbjct: 113 VTQARFHSLQSNILATGDSKGGILIWDTNKCLTKAQ 148

>CAGL0A04037g Chr1 complement(404063..405814) [1752 bp, 583 aa] {ON}
           highly similar to uniprot|P21304 Saccharomyces
           cerevisiae YLR196w PWP1
          Length = 583

 Score = 49.7 bits (117), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 47/192 (24%), Positives = 86/192 (44%), Gaps = 14/192 (7%)

Query: 175 LISCSDDGSIAIWDIKSGKTVPTSVNSLHSDI-VNECKWHESDPNIYGSVSEDSFLMIHD 233
           L S S D ++ +WD+ +  T   S+ ++HS+  V+  +WH  + +I  +   DS   + D
Sbjct: 306 LASTSADHTVKLWDLNNA-TAARSMANIHSNKNVSSSQWHMQNASILLTAGYDSRAALTD 364

Query: 234 KR--SEKPLQKLLQKEPFNTIAFSKHSSNLFAAAGTDA-MVYLFDSR--KPTEALHSMSG 288
            R   E  + K     P   I  +  +S      GTDA  VY FD R  + ++ + ++  
Sbjct: 365 VRISDEAQMSKYWSVLPGEEIETATFASENIILCGTDAGNVYSFDIRNNEGSKPVWTLKA 424

Query: 289 HQEAVTSLEFAHHKDGILCSGG-SDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGHK 347
           H   ++SL       G++ +G   +++V LW          E  A   GP +++      
Sbjct: 425 HDAGISSLSCNRFISGMMATGAMGEKQVKLWKF------PTEATAGSSGPGMVLSRDFDV 478

Query: 348 SAINDFSFSPNV 359
             +   SF+P++
Sbjct: 479 GNVLTSSFAPDI 490

>AEL269C Chr5 complement(134760..136127) [1368 bp, 455 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR178W
           (PRP4)
          Length = 455

 Score = 49.3 bits (116), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 57/206 (27%), Positives = 94/206 (45%), Gaps = 30/206 (14%)

Query: 175 LISCSDDGSIAIWDIKSGKTVPTSVNSL--HSDIVNECKWHESDPNIYGSVSEDSFLMIH 232
           L+S   D  + +WD+ S      S   L  H+  V+  K H S   +  S S D   ++ 
Sbjct: 230 LLSGGGDNLVKLWDMTS-----NSFEELRGHAGRVSRVKVHPS-GRLAASASFDLTWILW 283

Query: 233 D--KRSEKPLQKLLQKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQ 290
           D  ++ E  LQ+   K  + TIAF    + L A+AG DA+  ++D R   E +  + GH 
Sbjct: 284 DLERKVELQLQEGHSKAVY-TIAFQSDGA-LLASAGLDAVCAIWDLR-SGEPIMKLEGHA 340

Query: 291 EAVTSLEFAHHKDGI-LCSGGSDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGHKSA 349
            A++ ++++   +G  L + G+D  V +WD+  +GTE            LL     H+ A
Sbjct: 341 GAISGVDWS--PNGYQLATAGADGTVRVWDIRNVGTE----------SALL----AHQVA 384

Query: 350 INDFSFSPNVPWLMASVEEENIVQIW 375
             D  F  N    + S   + +V I+
Sbjct: 385 ALDVKFKKNNGTFLVSCGHDRLVNIF 410

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 67/251 (26%), Positives = 106/251 (42%), Gaps = 20/251 (7%)

Query: 72  IAEINLPQEILSNEGPVLQNDNNGSDEQVPS--KIKIIKKF--KHENEVTRARYAPFDSN 127
           +A+ ++ Q  +  +G  L     G   +V S   + I K     HE ++    + P D N
Sbjct: 170 VADKHVSQVAVHRDGQQLATGCWGGSIKVVSCETLGIAKSIDAAHEGKIGGLDWHP-DGN 228

Query: 128 LIATISGTGTVFLYDRTKDDENALRGKYAYHKENGYGLNFSVASPGELI-SCSDDGSIAI 186
            + +  G   V L+D T +    LRG        G      V   G L  S S D +  +
Sbjct: 229 HLLSGGGDNLVKLWDMTSNSFEELRG------HAGRVSRVKVHPSGRLAASASFDLTWIL 282

Query: 187 WDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDKRSEKPLQKL-LQ 245
           WD++  + V   +   HS  V    + +SD  +  S   D+   I D RS +P+ KL   
Sbjct: 283 WDLE--RKVELQLQEGHSKAVYTIAF-QSDGALLASAGLDAVCAIWDLRSGEPIMKLEGH 339

Query: 246 KEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRK-PTEALHSMSGHQEAVTSLEFAHHKDG 304
               + + +S +   L A AG D  V ++D R   TE+  ++  HQ A   ++F  +   
Sbjct: 340 AGAISGVDWSPNGYQL-ATAGADGTVRVWDIRNVGTES--ALLAHQVAALDVKFKKNNGT 396

Query: 305 ILCSGGSDRRV 315
            L S G DR V
Sbjct: 397 FLVSCGHDRLV 407

>YGL003C Chr7 complement(492474..494174) [1701 bp, 566 aa] {ON}
           CDH1Cell-cycle regulated activator of the
           anaphase-promoting complex/cyclosome (APC/C), which
           directs ubiquitination of cyclins resulting in mitotic
           exit; targets the APC/C to specific substrates including
           Cdc20p, Ase1p, Cin8p and Fin1p
          Length = 566

 Score = 49.7 bits (117), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 39/158 (24%), Positives = 74/158 (46%), Gaps = 12/158 (7%)

Query: 181 DGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDKRSEKPL 240
           +G + I+D+   K + T   S H D V    W+    ++  S S D  ++  D R   P 
Sbjct: 323 NGLVEIYDVMKRKCIRTL--SGHIDRVACLSWNN---HVLTSGSRDHRILHRDVRMPDPF 377

Query: 241 QKLLQKEPFNTIAFS-KHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEAVTSLEFA 299
            + ++             + N  A+ G D +V++++    +  L +   H+ AV ++ ++
Sbjct: 378 FETIESHTQEVCGLKWNVADNKLASGGNDNVVHVYEGTSKSPIL-TFDEHKAAVKAMAWS 436

Query: 300 HHKDGILCSGG--SDRRVLLWDLFQIGTEQQEEDADDG 335
            HK G+L +GG  +DRR+ +W+   + T  +  D D G
Sbjct: 437 PHKRGVLATGGGTADRRLKIWN---VNTSIKMSDIDSG 471

>TBLA0E00760 Chr5 (158338..159492) [1155 bp, 384 aa] {ON} 
          Length = 384

 Score = 49.3 bits (116), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 56/213 (26%), Positives = 95/213 (44%), Gaps = 21/213 (9%)

Query: 112 HENEVTRARYAPFDSNLIATISGTGTVFLYDRTKDDENALRGKYAYHKENGYG---LNFS 168
           HE  +T  +Y    S L+AT S   T  L+D  K  E        Y +E G+     N  
Sbjct: 184 HEARITAVKYHGCAS-LLATSSFDSTWKLWDLAKMTE-------LYLQEGGHSTEIFNLD 235

Query: 169 VASPGELIS-CSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDS 227
               G L+S    DG+  +WD++SG  +  ++      + N C W  +   I  +   D 
Sbjct: 236 FHPDGSLLSSVGGDGNCVLWDLRSGNRI-LNIRGHVGQLYNGC-WSPNGSEI-ATAGVDG 292

Query: 228 FLMIHDKRSE-KPLQKL-LQKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHS 285
            + I D R++ K L  + L K   + + +         ++G D  + + ++    + ++S
Sbjct: 293 VIKIWDIRAKGKELSSIYLHKGVISDLRWENMYGRYLISSGYDGKIGIINA-DTWKVINS 351

Query: 286 MSGHQEAVTSLEFAHHKDGILCSGGSDRRVLLW 318
           MSGH    ++L+ AH +  I+ SGG DR +  W
Sbjct: 352 MSGHTGKASTLD-AHGE--IIISGGWDRSIRKW 381

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 52/215 (24%), Positives = 93/215 (43%), Gaps = 25/215 (11%)

Query: 181 DGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDKRSEKPL 240
           DG + + D +  + V   +NS+H   +    W+  D   + S  ED  + +    +EK  
Sbjct: 119 DGDVKLLDYEQMQ-VKDQLNSIHRGKITGLDWN-VDGKSFASGGEDGIVKLFSFENEKIQ 176

Query: 241 Q-KLLQKEPFNTIAFSKH-SSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEAVTSLEF 298
           +   ++       A   H  ++L A +  D+   L+D  K TE      GH   + +L+F
Sbjct: 177 ESNSIEAHEARITAVKYHGCASLLATSSFDSTWKLWDLAKMTELYLQEGGHSTEIFNLDF 236

Query: 299 AHHKDG-ILCSGGSDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGHKSAINDFSFSP 357
             H DG +L S G D   +LWDL               G  +L +  GH   + +  +SP
Sbjct: 237 --HPDGSLLSSVGGDGNCVLWDLRS-------------GNRILNIR-GHVGQLYNGCWSP 280

Query: 358 NVPWLMASVEEENIVQIW---KPSRKLTNPYFPQG 389
           N    +A+   + +++IW      ++L++ Y  +G
Sbjct: 281 NGS-EIATAGVDGVIKIWDIRAKGKELSSIYLHKG 314

>TBLA0F02140 Chr6 complement(526982..530884) [3903 bp, 1300 aa] {ON}
           Anc_7.310 YDL195W
          Length = 1300

 Score = 49.7 bits (117), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 47/217 (21%), Positives = 92/217 (42%), Gaps = 23/217 (10%)

Query: 124 FDSNLIATISGTGTVFLYDRTKDDENALRGKYAYHKENGYGLNFSVASPGELISCSDDGS 183
            D+  IA     G V L+     D      K + H  +   +NF+      L S S +G 
Sbjct: 72  IDNKYIAGALDNGMVELFKTNSKDTLKSIKKLSKHGTSVTTVNFNAKQENVLASGSKNGE 131

Query: 184 IAIWDIKSGKTVPTSVNSLHS----------DIVNECKWHESDPNIYGSVSEDSFLMIHD 233
           I IWD+   K +  S +S             + +    W++S  +++ S    S+  I D
Sbjct: 132 IFIWDL--NKCIDQSNDSYSPLTPGMAMTPVEEITSLAWNQSLSHVFASAGNTSYASIWD 189

Query: 234 KRSEKPLQKLLQKEPFNTIA--------FSKHSSNLFAAAGTD--AMVYLFDSRKPTEAL 283
            +++K +  L    P +++           ++S+ +  A+ +D   ++ ++D R     L
Sbjct: 190 LKAKKEVIHLSYTSPSSSLKPQLSVVEWHPENSTRVATASNSDNEPIILIWDLRNANTPL 249

Query: 284 HSM-SGHQEAVTSLEFAHHKDGILCSGGSDRRVLLWD 319
             + +G+ + + SL++  H   +L S G D   +LW+
Sbjct: 250 QILENGNSKGILSLDWCKHDSNLLLSSGRDNTAVLWN 286

>SAKL0A02970g Chr1 complement(275095..276342) [1248 bp, 415 aa] {ON}
           similar to uniprot|Q12523 Saccharomyces cerevisiae
           YPL247C Hypothetical ORF
          Length = 415

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 66/300 (22%), Positives = 112/300 (37%), Gaps = 46/300 (15%)

Query: 25  LMYDFVSETRLLWPSLTIQWLPRAED--STEQELLVGTHTSDSEQNYLKIAEINLPQEIL 82
           + +D + E  + +P    QWLP+     +T  + L      DS Q  L ++     ++  
Sbjct: 97  VTWDKLFECNVTYPVTRCQWLPKGGGKLATCSDSLRIWSVGDSLQEQLNLSLCKYSKQ-- 154

Query: 83  SNEGPVLQNDNNGSDEQVPSKIKIIKKFKHENEVTRARYAPFDSNLIATISGTGTVFLYD 142
                     +NGS                   VT   +   D+NLI + S   T  ++D
Sbjct: 155 ----------SNGSTASA--------ALGSLPPVTSFDWNSVDTNLIISSSIDTTCTVWD 196

Query: 143 RTKDDENALRGKYAYHKENGYGLNFSVASPGELISCSDDGSIAIWDIKSGKTVPTSVNSL 202
                 N ++ +   H    Y + F   S     SC  DGS+ ++D++            
Sbjct: 197 L--QSSNYVKTQLIAHDSEVYDVKFLTNSTQLFASCGGDGSVRVFDLRCLA--------- 245

Query: 203 HSDIVNECKWHESDPNIYGSVSEDSFLMIHDKRSEKPLQKLLQKEPF--NTIAFSKHSSN 260
           HS I+ E     +   +  S  E +     D  +   L +L +  PF  N +A     SN
Sbjct: 246 HSTIIYEPLAGLTSGTVKSS-GEGNVGGNEDGTNHTALLRL-EPSPFDPNVVATFTQDSN 303

Query: 261 LFAAAGTDAMVYLFDSRKPTEALHSMSGHQEAVTSLEFAHHKDGILCSGGSDRRVLLWDL 320
                     V + D R P   + ++ GH  AV  + +   +  +L + G D +VL WD+
Sbjct: 304 ---------AVLILDMRYPGSPILTLEGHSSAVNQMRWHPTQRNVLLTCGDDCQVLYWDI 354

>NDAI0J01040 Chr10 (238940..240136) [1197 bp, 398 aa] {ON} Anc_8.316
           YDR142C
          Length = 398

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 41/177 (23%), Positives = 81/177 (45%), Gaps = 23/177 (12%)

Query: 158 HKENGYGLNFSVASPGELISCSDDGSIAIWDIKSGKTVPTSVNSLHSD---IVNECKWHE 214
           HK+     N+++ +    +S S DG + +W      ++ T ++ +H+D   IVN      
Sbjct: 103 HKKEVLSCNWNLINKNLFLSSSWDGDVKVWSTARQASLIT-LSPIHTDPTAIVN------ 155

Query: 215 SDPNIYGSVSEDSFLMIHDKRS-------EKPLQKLLQKEPFNTIAFSKHSSNLFAAAGT 267
           +  NI  S++  S  ++H + +          +Q    K       FS H  N+ A    
Sbjct: 156 TKSNINPSLNNVSQPILHPRSTAIRQPVTSASMQGNDNKNCIYQAQFSPHDPNIVACCSG 215

Query: 268 DAMVYLFDSRKPT----EALHSMSGHQEAVTSLEFAHHKDGILCSGGSDRRVLLWDL 320
            + + LFD R+PT      + + SG++    +L+F  ++  I+ + G D+ + +WD+
Sbjct: 216 TSYLTLFDLRQPTPNVQRGILTQSGYE--TLTLDFNKYRSHIIATSGVDKAIKMWDM 270

 Score = 46.2 bits (108), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 45/231 (19%), Positives = 89/231 (38%), Gaps = 45/231 (19%)

Query: 112 HENEVTRARYAPFDSNLIATISGTGTVFLYDRTKDDENALRGKYAYHKENGYGLNFSVAS 171
           ++N + +A+++P D N++A  SGT  + L+D  +   N  RG           L+F+   
Sbjct: 193 NKNCIYQAQFSPHDPNIVACCSGTSYLTLFDLRQPTPNVQRGILTQSGYETLTLDFNKYR 252

Query: 172 PGELISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMI 231
              + +   D +I +WD+   + +P++                       S    S   I
Sbjct: 253 SHIIATSGVDKAIKMWDM---RFIPSTF----------------------SPQSTSTTPI 287

Query: 232 HDKRSEKPLQKLLQKE--PFNTIAFSKHSSNLFAAAGTDAMVYLF--------------- 274
             +R ++P+ +++        TI +S H SNL  +   D     +               
Sbjct: 288 LSRRQQEPINEIINAHDLAVKTIKWSPHHSNLMVSTSYDMTCKTWMDISYQNGTSNGRTN 347

Query: 275 --DSRKPTEALHSMSGHQEAVTSLEFA-HHKDGILCSGGSDRRVLLWDLFQ 322
             D ++    L  M  H E    ++++   + G + S G D  V +W+  +
Sbjct: 348 SLDPQRRNGCLAIMDKHSEFAFGVDWSLWGQPGFIASTGWDGNVFIWNTLR 398

>Suva_7.279 Chr7 complement(484066..485766) [1701 bp, 566 aa] {ON}
           YGL003C (REAL)
          Length = 566

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 40/158 (25%), Positives = 73/158 (46%), Gaps = 12/158 (7%)

Query: 181 DGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDKRSEKPL 240
           +G + I+D+   K + T   S H D V    W+    ++  S S D  ++  D R   P 
Sbjct: 323 NGLVEIYDVIKRKCIRTL--SGHVDRVACLSWNN---HVLTSGSRDHRILHRDVRMPDPF 377

Query: 241 QKLLQKEPFNTIAFS-KHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEAVTSLEFA 299
            + ++             + N  A+ G D MV +++    +  L +   H+ AV ++ ++
Sbjct: 378 FETIESHTQEVCGLKWNVADNKLASGGNDNMVNVYEGTSKSPIL-TFDEHKAAVKAMAWS 436

Query: 300 HHKDGILCSGG--SDRRVLLWDLFQIGTEQQEEDADDG 335
            HK GIL +GG  +DR++ +W+   + T  +  D D G
Sbjct: 437 PHKRGILATGGGTADRKLKIWN---VNTSTKISDIDSG 471

>CAGL0A02772g Chr1 complement(293966..295291) [1326 bp, 441 aa] {ON}
           similar to uniprot|P40968 Saccharomyces cerevisiae
           YDR364c CDC40
          Length = 441

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 67/263 (25%), Positives = 102/263 (38%), Gaps = 52/263 (19%)

Query: 105 KIIKKFK-HENEVTRARYAPFDSNLIATISGTGTVFLYDRTKDDENALRGKYAYHKENGY 163
           K+I ++K H N  T  R  P   +LI +     TV L+D   D    LR  +  H +   
Sbjct: 139 KVIYRYKGHHNGTTSLRLLPGTGHLILSGGNDNTVKLWDFYHD-RKCLR-DFVGHSKPIK 196

Query: 164 GLNFSVASPGELISCSDDGSIAIWDIKSGKTV---------------PTSVNSL------ 202
            L+F+  S  + +S S D  + IWD ++GK                 PTS N        
Sbjct: 197 TLDFTSDS-SQFLSGSYDQQVKIWDTETGKVTKRLNTYSTPNSAEFRPTSGNEFVVGLSS 255

Query: 203 ----HSD--------IVNECKWHES---------DPNIYGSVSEDSFLMIHDKRSEKPLQ 241
               H D        +V     H S         D + + S SED  L I + +   P++
Sbjct: 256 SKIKHYDTRVSEKDGLVQVYDHHLSSILAIKYFPDGSKFISSSEDKTLRIWNNQVNIPIK 315

Query: 242 KLLQKEPFNTIAFSKH-SSNLFAAAGTDAMVYLFDSRKPTEALH---SMSGHQEAVTSLE 297
           ++      +      H   N F+    D+++Y + S KP   +H      GH  A   + 
Sbjct: 316 QISDTTQHSMPYIGIHPEHNYFSTQSMDSVIYSY-SMKPKYKMHPNKKFKGHNSAGYGIG 374

Query: 298 FAHHKDG-ILCSGGSDRRVLLWD 319
                DG  LCSG +  ++ LWD
Sbjct: 375 LTFSPDGRFLCSGDARGQLFLWD 397

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 23/102 (22%), Positives = 38/102 (37%), Gaps = 14/102 (13%)

Query: 274 FDSRKPTEALHSMSGHQEAVTSLEFAHHKDGILCSGGSDRRVLLWDLFQIGTEQQEEDAD 333
           F    P + ++   GH    TSL        ++ SGG+D  V LWD +            
Sbjct: 132 FKCYLPKKVIYRYKGHHNGTTSLRLLPGTGHLILSGGNDNTVKLWDFYH----------- 180

Query: 334 DGGPELLMMHAGHKSAINDFSFSPNVPWLMASVEEENIVQIW 375
               + L    GH   I    F+ +    ++   ++  V+IW
Sbjct: 181 --DRKCLRDFVGHSKPIKTLDFTSDSSQFLSGSYDQQ-VKIW 219

>Skud_10.102 Chr10 (173179..175305) [2127 bp, 708 aa] {ON} YJL112W
           (REAL)
          Length = 708

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 45/150 (30%), Positives = 74/150 (49%), Gaps = 29/150 (19%)

Query: 172 PGELISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMI 231
           P  L+S S D +I  WD+ SGK + T ++   ++++       +  N+   +S+ + L  
Sbjct: 506 PNFLVSGSQDRTIRQWDLCSGKCMQT-IDLSFANVLT------TATNV--DLSKSTLLT- 555

Query: 232 HDKRSEKPLQKLLQKEPFNTIAFSKHSSNLFAAAGT-DAMVYLFDSRKPTEALHSMSGHQ 290
             +RSE+P    LQ            S +   A GT D +V L+D R   + + ++ GH 
Sbjct: 556 --QRSERPTIGALQ------------SFDAALATGTKDGIVRLWDLRSG-KVIRTLEGHT 600

Query: 291 EAVTSLEFAHHKDGILCSGGSDRRVLLWDL 320
           +A+TSL+F       L +G  DR V +WDL
Sbjct: 601 DAITSLKF---DSACLVTGSYDRTVRVWDL 627

 Score = 32.0 bits (71), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 31/144 (21%), Positives = 65/144 (45%), Gaps = 10/144 (6%)

Query: 175 LISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDK 234
           L + + DG + +WD++SGK + T     H+D +   K+   D     + S D  + + D 
Sbjct: 573 LATGTKDGIVRLWDLRSGKVIRTLEG--HTDAITSLKF---DSACLVTGSYDRTVRVWDL 627

Query: 235 RSEKPLQKLLQKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEAVT 294
           R+    +      P  ++ F + ++ +  +  T   ++++DS K         G +  VT
Sbjct: 628 RTGLLSKFHAYNAPVLSLDFFQDNAAVVVSNATS--IHIYDSNKDESWPCVEKGDEVNVT 685

Query: 295 SLEFAHHKDGILCSGGSDRRVLLW 318
           ++++   KD  +  G  +  V +W
Sbjct: 686 AVKY---KDNYMLEGRGNGDVHIW 706

>NCAS0E02840 Chr5 (558336..560159) [1824 bp, 607 aa] {ON} Anc_7.356
           YLR196W
          Length = 607

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 48/192 (25%), Positives = 90/192 (46%), Gaps = 13/192 (6%)

Query: 175 LISCSDDGSIAIWDIKSGKTVPTSVNSLHSDI-VNECKWHESDPNIYGSVSEDSFLMIHD 233
           L S S D ++ +WD+ +  T   S+ S+H++  V+  +WH S+ +I  +   DS + + D
Sbjct: 339 LASTSADHTVKLWDLNTA-TAARSLASIHNNKNVSSSEWHVSNGSILLTGGYDSRIALSD 397

Query: 234 KR--SEKPLQKLLQKEPFNTIAFSKHSSNLFAAAGTDA-MVYLFDSR--KPTEALHSMSG 288
            R   EK + K     P   I  +  +       GTDA  +Y FD R  + ++ + ++  
Sbjct: 398 VRISDEKQMSKYWSVMPGEEIECTTFADENIILCGTDAGNIYSFDIRNNENSKPVWTLKA 457

Query: 289 HQEAVTSLEFAHHKDGILCSGG-SDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGHK 347
           H   ++SL       G++ +G   ++ V LW  F +G +     A   GP +++      
Sbjct: 458 HDAGISSLSCNKFIPGLMSTGAMGEKTVKLWK-FPLGGDL----AVGKGPNMVLSRDFDV 512

Query: 348 SAINDFSFSPNV 359
             +   SF+P++
Sbjct: 513 GNVLTTSFAPDL 524

>Kpol_1019.30 s1019 (56367..60125) [3759 bp, 1252 aa] {ON}
           (56367..60125) [3759 nt, 1253 aa]
          Length = 1252

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 45/180 (25%), Positives = 83/180 (46%), Gaps = 18/180 (10%)

Query: 158 HKENGYGLNFSVASPGELISCSD-DGSIAIWDIKSGKTVPTS--VNSLHSDIVNECKWHE 214
           HK +   L F+      L+S SD +G I IWD+ +    P +  +    ++ +    W++
Sbjct: 110 HKGSVKTLKFNTKQSNLLVSGSDKNGEILIWDLNNLDKTPLTPGMPMTPTNEITSLAWNK 169

Query: 215 SDPNIYGSVSEDSFLMIHDKRSEKPLQKLLQKEPFNTIA--FS------KHSSNLFAAA- 265
           S  +++   S  S + I D +++K +  L    P N +   FS      K+S+ +  A  
Sbjct: 170 SLSHVFSCSSNTSNVSIFDLKAKKEVIHLNYTNPVNNVKSLFSVVEWHPKNSTRIATATL 229

Query: 266 GTDAM----VYLFDSRKPTEALHSMS--GHQEAVTSLEFAHHKDGILCSGGSDRRVLLWD 319
             D+     ++++D R     L  +S  GH   + SL++    + +L S G D  V+LW+
Sbjct: 230 NNDSTESDSIFIWDLRNSHTPLQILSKDGHSNGILSLDWCSTDENLLLSSGRDNSVMLWN 289

>KLLA0E08449g Chr5 (759718..760986) [1269 bp, 422 aa] {ON} similar
           to uniprot|P53962 Saccharomyces cerevisiae YNL035C
           Hypothetical ORF
          Length = 422

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 52/190 (27%), Positives = 90/190 (47%), Gaps = 22/190 (11%)

Query: 154 KYAYHKENGYGLNFSVASPGELISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWH 213
           K  Y +EN + L         L++   DGS+ + D  + KT+  S    H+  +N+ K  
Sbjct: 7   KCRYFEENNWCLKLQPLYQHGLMTSISDGSVHLLDWGNLKTI--SSIQCHTTSINDMKVI 64

Query: 214 ESDPN---IYGSVSEDSFLMIHDKRSEKPLQKLL--QKEPFNTIAFSKHSSNLFAAAGT- 267
            SD +   ++ + +ED  + + D R+   +  L   +  PF    FS  S +   A GT 
Sbjct: 65  NSDFDTGAVFATAAEDG-VKVWDIRARNNVASLQNDKASPF----FSLDSRHNMLACGTE 119

Query: 268 ----DAMVYLFDSRKPTEALHS-MSGHQEAVTSLEFAHHKDGILCSGGSDRRVLLWDLFQ 322
               DA ++++D R  T+ + S +  H + +T ++F      +L SG +D  V ++DL  
Sbjct: 120 LKDYDAELHIYDIRNWTKPVRSFVDSHHDDITDIKFHPCDSNLLMSGSTDGYVNIYDL-- 177

Query: 323 IGTEQQEEDA 332
             T+  EEDA
Sbjct: 178 --TQDDEEDA 185

 Score = 37.0 bits (84), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 29/46 (63%), Gaps = 2/46 (4%)

Query: 105 KIIKKF--KHENEVTRARYAPFDSNLIATISGTGTVFLYDRTKDDE 148
           K ++ F   H +++T  ++ P DSNL+ + S  G V +YD T+DDE
Sbjct: 137 KPVRSFVDSHHDDITDIKFHPCDSNLLMSGSTDGYVNIYDLTQDDE 182

 Score = 35.4 bits (80), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 54/237 (22%), Positives = 91/237 (38%), Gaps = 34/237 (14%)

Query: 167 FSVASPGELISCSD-----DGSIAIWDIKS-GKTVPTSVNSLHSDIVNECKWHESDPNIY 220
           FS+ S   +++C       D  + I+DI++  K V + V+S H DI  + K+H  D N+ 
Sbjct: 105 FSLDSRHNMLACGTELKDYDAELHIYDIRNWTKPVRSFVDSHHDDIT-DIKFHPCDSNLL 163

Query: 221 GSVSEDSFLMIHDKRSEKPLQKLLQKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPT 280
            S S D ++ I+D   +     L Q   F +I    HS          ++     S   T
Sbjct: 164 MSGSTDGYVNIYDLTQDDEEDALHQVINFASI----HSCGWLGPKRIWSL-----SHMET 214

Query: 281 EALHSMSGHQEAVTS---LEFAHHKDGILCSGGSDRRVLLWDLFQIGTEQQEEDAD---- 333
             +H ++   + +     LEF   +D      G D  + ++  F    +  E   +    
Sbjct: 215 FGIHELNDKSDEMIEPKPLEFGDVRD----KWGCDYVIDIYPSFIATGKTHESQGELKII 270

Query: 334 -------DGGPELLMMHAGHKSAINDFSFSPNVPWLMASVEEENIVQIWKPSRKLTN 383
                  D    L++  A     I D     N   L+ S  E+  V +WK +    N
Sbjct: 271 PFQNEQVDVSSALVIPDAHGNEVIRDVLIPKNQTSLLYSCGEDGYVNVWKDTTNSLN 327

>SAKL0A01276g Chr1 (124778..126325) [1548 bp, 515 aa] {ON} highly
           similar to uniprot|P25382 Saccharomyces cerevisiae
           YCR072C Protein required for cell viability
          Length = 515

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 77/307 (25%), Positives = 122/307 (39%), Gaps = 63/307 (20%)

Query: 112 HENEVTRARYAPFDSNLIATISGTGTVFLYDRTKDDE--NALRGKYAYHKENGYGLNFSV 169
           H N V    ++P D  LIAT S   T+ L++  K     +ALRG   +     +     +
Sbjct: 185 HFNWVLCVSWSP-DGELIATGSMDNTIRLWEGNKGQPVGDALRGHGKWITSLSWE-PIHL 242

Query: 170 ASPGE---LISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKW----------HES- 215
             PG+   L S S DG+I IWD  + + V     S H+  V+  KW          H+  
Sbjct: 243 VKPGQKPRLASASKDGTIKIWD--TTRRVCLITLSGHTSSVSCIKWGGQGVLYSGSHDKT 300

Query: 216 ----DPNIYG----------------SVSEDSFLMI--HDKRSEKP-----LQKLLQKEP 248
               D N+ G                S+S D  L I   D  SEKP      QK   K  
Sbjct: 301 IRAWDMNLGGKCINILKSHAHWVNHLSLSTDYALRIGAFDHTSEKPSTPEEAQKRALKNY 360

Query: 249 FNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEAVTSLEFAHHKDGILCS 308
                 +     L   A  D  +YL++  K T+ +  M+GHQ+ V  + F+     I+ S
Sbjct: 361 EKIAKRNGEVEELMVTASDDFTMYLWNPLKSTKPITRMTGHQKLVNHVAFSPDGRHIV-S 419

Query: 309 GGSDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGHKSAINDFSFSPNVPWLMASVEE 368
              D  + LW            +  DG  + +    GH +++   ++S +   L+ S  +
Sbjct: 420 ASFDNSIKLW------------NGRDG--KFISTFRGHVASVYQVAWSSDCR-LLVSCSK 464

Query: 369 ENIVQIW 375
           +  +++W
Sbjct: 465 DTTLKVW 471

 Score = 35.0 bits (79), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 36/147 (24%), Positives = 72/147 (48%), Gaps = 10/147 (6%)

Query: 175 LISCSDDGSIAIWD-IKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHD 233
           +++ SDD ++ +W+ +KS K  P +  + H  +VN   +     +I  S S D+ + + +
Sbjct: 374 MVTASDDFTMYLWNPLKSTK--PITRMTGHQKLVNHVAFSPDGRHIV-SASFDNSIKLWN 430

Query: 234 KRSEKPLQKLL-QKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEA 292
            R  K +            +A+S     L  +   D  + ++D +    A+  + GH++ 
Sbjct: 431 GRDGKFISTFRGHVASVYQVAWSS-DCRLLVSCSKDTTLKVWDVKTKKLAV-DLPGHKDE 488

Query: 293 VTSLEFAHHKDGI-LCSGGSDRRVLLW 318
           V +++++   DG  +CSGG D+ V LW
Sbjct: 489 VYTVDWS--VDGKRVCSGGKDKMVRLW 513

>SAKL0F10384g Chr6 complement(799553..803338) [3786 bp, 1261 aa]
           {ON} similar to uniprot|P38968 Saccharomyces cerevisiae
           YDL195W SEC31 involved in protein transport from
           endoplasmic reticulum to Golgi Component (p150) of COPII
           coat of secretory pathway vesicles
          Length = 1261

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 45/183 (24%), Positives = 74/183 (40%), Gaps = 16/183 (8%)

Query: 153 GKYAYHKENGYGLNFSVASPGELISCSDDGSIAIWDIK---SGKTVPTSVNSLHSDI--V 207
            K + H      L F+      L S    G I IWDI    S   VP S     + I  V
Sbjct: 98  AKISKHTTPVNTLKFNAKQDNVLCSGDSRGEIFIWDINKITSSGYVPFSPGVAMTPIDEV 157

Query: 208 NECKWHESDPNIYGSVSEDSFLMIHDKRSEKPLQKLLQKEP-------FNTIAFSKHSSN 260
               W++S  +++ S     +  I D +++K +  L    P        + + +   +S 
Sbjct: 158 YSLAWNQSLAHVFASAGSSGYTSIWDLKAKKEVLHLSYTSPSTGAKNHLSVVEWHPSNST 217

Query: 261 LFAAAG---TDAMVYLFDSRKPTEALHSMS-GHQEAVTSLEFAHHKDGILCSGGSDRRVL 316
             A A     D ++ ++D R     L +MS GH + + SL++    + +L S G D    
Sbjct: 218 KIATATGNDNDPVILVWDLRNAKAPLQAMSQGHSKGILSLDWCKQDENLLLSSGRDNTCA 277

Query: 317 LWD 319
           LW+
Sbjct: 278 LWN 280

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 44/87 (50%), Gaps = 2/87 (2%)

Query: 237 EKPLQKLLQKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEAVTSL 296
           EKP   +     FN + +S  +S L  A   D  +  F S K  +++  +S H   V +L
Sbjct: 53  EKPQGSITASAKFNDLDWSPDNSIL--AGALDNGIVEFFSPKELKSVAKISKHTTPVNTL 110

Query: 297 EFAHHKDGILCSGGSDRRVLLWDLFQI 323
           +F   +D +LCSG S   + +WD+ +I
Sbjct: 111 KFNAKQDNVLCSGDSRGEIFIWDINKI 137

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 62/296 (20%), Positives = 116/296 (39%), Gaps = 45/296 (15%)

Query: 101 PSKIKIIKKF-KHENEVTRARYAPFDSNLIATISGTGTVFLYDRTKDDENAL----RGKY 155
           P ++K + K  KH   V   ++     N++ +    G +F++D  K   +       G  
Sbjct: 91  PKELKSVAKISKHTTPVNTLKFNAKQDNVLCSGDSRGEIFIWDINKITSSGYVPFSPGVA 150

Query: 156 AYHKENGYGLNFSVASPGELISCSDDGSIAIWDIKSGK-------TVPTSVNSLHSDIVN 208
               +  Y L ++ +      S    G  +IWD+K+ K       T P++    H  +V 
Sbjct: 151 MTPIDEVYSLAWNQSLAHVFASAGSSGYTSIWDLKAKKEVLHLSYTSPSTGAKNHLSVV- 209

Query: 209 ECKWHESDPNIYGSVS---EDSFLMIHDKRSEK-PLQKLLQKEPFNTIAF--SKHSSNLF 262
             +WH S+     + +    D  +++ D R+ K PLQ + Q      ++    K   NL 
Sbjct: 210 --EWHPSNSTKIATATGNDNDPVILVWDLRNAKAPLQAMSQGHSKGILSLDWCKQDENLL 267

Query: 263 AAAGTDAMVYLFDSRKPTEALHSMSGHQEAVTSLEFAHHKDGILCSGGSDRRVLL----- 317
            ++G D    L++ +   + L             +FA     +  S   D ++ +     
Sbjct: 268 LSSGRDNTCALWNPQT-AQKLSQFPTRGNWCFKTKFAPEAPDLFASASLDNKIQVQTLQN 326

Query: 318 ----WDLFQIGTEQQEEDAD----------DGGPELLMMHA----GHKSAINDFSF 355
                DL  I ++QQE +AD          +  P ++ M A    G++SA   ++F
Sbjct: 327 LTNKLDLEDIVSKQQESEADFWNNVSEQGCNEKPTVIKMQAPSWYGNRSAGAQWAF 382

 Score = 32.0 bits (71), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 47/229 (20%), Positives = 88/229 (38%), Gaps = 30/229 (13%)

Query: 175 LISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHD- 233
           L    D+G +  +  K  K+V  +  S H+  VN  K++    N+  S      + I D 
Sbjct: 77  LAGALDNGIVEFFSPKELKSV--AKISKHTTPVNTLKFNAKQDNVLCSGDSRGEIFIWDI 134

Query: 234 ----KRSEKPLQKLLQKEPFN---TIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALH-- 284
                    P    +   P +   ++A+++  +++FA+AG+     ++D +   E LH  
Sbjct: 135 NKITSSGYVPFSPGVAMTPIDEVYSLAWNQSLAHVFASAGSSGYTSIWDLKAKKEVLHLS 194

Query: 285 ---SMSGHQEAVTSLEF-AHHKDGILCSGGSDRR--VLLWDLFQIGTEQQEEDADDGGPE 338
                +G +  ++ +E+   +   I  + G+D    +L+WDL             +    
Sbjct: 195 YTSPSTGAKNHLSVVEWHPSNSTKIATATGNDNDPVILVWDL------------RNAKAP 242

Query: 339 LLMMHAGHKSAINDFSFSPNVPWLMASVEEENIVQIWKPSRKLTNPYFP 387
           L  M  GH   I    +      L+ S   +N   +W P        FP
Sbjct: 243 LQAMSQGHSKGILSLDWCKQDENLLLSSGRDNTCALWNPQTAQKLSQFP 291

>Kpol_1028.54 s1028 (125940..128657) [2718 bp, 905 aa] {ON}
           (125940..128657) [2718 nt, 906 aa]
          Length = 905

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 39/169 (23%), Positives = 79/169 (46%), Gaps = 14/169 (8%)

Query: 158 HKENGYGLNFSVASPGELISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDP 217
           H ++  GL +S      +++ ++DG I +WD+ SG  + T   S H+  V   ++ +   
Sbjct: 337 HFDSLNGLTYS-PDGARVVTAANDGKIKVWDVVSGFCLATF--SEHTSSVTAVQFAKRGQ 393

Query: 218 NIY-----GSVSEDSFLMIHDKRSEKPLQKLLQKEPFNTIAFSKHSSNLFAAAGTDAMVY 272
            ++     G+V     +   + R+    Q++    PFN +A    S  +  A  +D+   
Sbjct: 394 VLFSSSLDGTVRAWDLIRFRNFRTFTSTQRI----PFNCLAVDP-SGEVVCAGSSDSFEI 448

Query: 273 LFDSRKPTEALHSMSGHQEAVTSLEFAHHKDGILCSGGSDRRVLLWDLF 321
              S +  + L S+ GH+  V+ L F+  ++ +L S   D+ + +W +F
Sbjct: 449 HVWSVQTGQLLDSLDGHEGPVSCLAFS-QENSVLASASWDKTIRIWSIF 496

 Score = 31.6 bits (70), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 24/99 (24%), Positives = 46/99 (46%), Gaps = 2/99 (2%)

Query: 93  NNGSDEQVPSKIKIIKKFKHENEVTRARYAPFDSNLIATISGTGTVFLYDRTKDDENALR 152
           N   D Q    ++   +  H  ++T   ++ +DS  I + S   T  L+    +D+    
Sbjct: 126 NATEDRQFAPFVRHRIQAGHFEDITSITWS-YDSRFIVSSSKDLTARLWSVYSEDKELAA 184

Query: 153 GKYAYHKENGYGLNFSVASPGELISCSDDGSIAIWDIKS 191
             +A H++N  G  F+ A   ++ + S DG++ IW+  S
Sbjct: 185 TTFAGHRDNVLGAFFT-ADQEKIYTVSKDGALFIWEYSS 222

>NDAI0J01180 Chr10 complement(273472..276876) [3405 bp, 1134 aa]
           {ON} Anc_8.288 YDR128W
          Length = 1134

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 40/154 (25%), Positives = 77/154 (50%), Gaps = 7/154 (4%)

Query: 170 ASPGELISCSDDGSIAIWDI-KSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSF 228
           A P  ++S S+  ++ IW++ KS       V   HS  + +  ++  +P+I  + S D++
Sbjct: 79  AKPYWVVSTSNQKAL-IWNLAKSSSDAIEHVLHGHSRAITDINFNPENPDILATCSIDTY 137

Query: 229 LMIHDKRS-EKPLQKL-LQKEPFNTIAFSKHSSNLFAAA-GTDAMVYLFDSRKPTEALHS 285
           +   D RS  KP       +   + + ++   SN+ A++ G D  V+++D R  +  L  
Sbjct: 138 VHAWDMRSPHKPFYSTSAWRSSASQVKWNFKDSNILASSHGND--VFIWDLRNGSTPLCQ 195

Query: 286 MSGHQEAVTSLEFAHHKDGILCSGGSDRRVLLWD 319
           + GH+ +V S++F+  K   + S  +D  V  WD
Sbjct: 196 LVGHESSVNSIDFSRFKSTEIMSSSNDGTVKFWD 229

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 47/219 (21%), Positives = 85/219 (38%), Gaps = 9/219 (4%)

Query: 138 VFLYDRTKDDENALRGKYAYHKENGYGLNFSVASPGELISCSDDGSIAIWDIKSGKTVPT 197
             +++  K   +A+      H      +NF+  +P  L +CS D  +  WD++S      
Sbjct: 92  ALIWNLAKSSSDAIEHVLHGHSRAITDINFNPENPDILATCSIDTYVHAWDMRSPHKPFY 151

Query: 198 SVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDKRSEKPLQKLLQKE-PFNTIAFSK 256
           S ++  S   ++ KW+  D NI  S   +   +   +    PL +L+  E   N+I FS+
Sbjct: 152 STSAWRSS-ASQVKWNFKDSNILASSHGNDVFIWDLRNGSTPLCQLVGHESSVNSIDFSR 210

Query: 257 HSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEAVTSLEFAHHKDG--ILCSGGSDRR 314
             S    ++  D  V  +D     E L         +    +    +G  I+   G +  
Sbjct: 211 FKSTEIMSSSNDGTVKFWDYSVNNEDLTRTVTTDFPIWRGRYLPFGNGYCIMPQVGGNNS 270

Query: 315 VLLWDLFQIGTEQQEEDADDGGPELLMMHAGHKSAINDF 353
           V + +L     + +E D      + +    GH   I DF
Sbjct: 271 VYMMNL-----KSEEPDTKTAKLQPIYAFKGHTDRIIDF 304

 Score = 39.7 bits (91), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 30/125 (24%), Positives = 52/125 (41%), Gaps = 16/125 (12%)

Query: 252 IAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEAVTSLEFAHHKDGILCSG-G 310
           I F+  + ++ A    D  V+ +D R P +  +S S  + + + +++      IL S  G
Sbjct: 119 INFNPENPDILATCSIDTYVHAWDMRSPHKPFYSTSAWRSSASQVKWNFKDSNILASSHG 178

Query: 311 SDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGHKSAINDFSFSPNVPWLMASVEEEN 370
           +D  V +WDL               G   L    GH+S++N   FS      + S   + 
Sbjct: 179 ND--VFIWDL-------------RNGSTPLCQLVGHESSVNSIDFSRFKSTEIMSSSNDG 223

Query: 371 IVQIW 375
            V+ W
Sbjct: 224 TVKFW 228

 Score = 31.2 bits (69), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 17/65 (26%), Positives = 33/65 (50%), Gaps = 11/65 (16%)

Query: 311 SDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGHKSAINDFSFSPNVPWLMASVEEEN 370
           S+++ L+W+L +  ++  E           ++H GH  AI D +F+P  P ++A+   + 
Sbjct: 88  SNQKALIWNLAKSSSDAIEH----------VLH-GHSRAITDINFNPENPDILATCSIDT 136

Query: 371 IVQIW 375
            V  W
Sbjct: 137 YVHAW 141

>KLTH0G13068g Chr7 complement(1118964..1122269) [3306 bp, 1101 aa]
           {ON} similar to uniprot|Q03897 Saccharomyces cerevisiae
           YDR128W Hypothetical ORF
          Length = 1101

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 44/206 (21%), Positives = 80/206 (38%), Gaps = 45/206 (21%)

Query: 115 EVTRARYAPFDSNLIATISGTG-TVFLYDRTKDDENALRGKYAYHKENGYGLNFSVASPG 173
           EV   +++P  S     +S +     +++ ++   NA+      H      +NF   +P 
Sbjct: 69  EVADVQWSPHPSKPSWVVSTSNQKALVWNLSRSSSNAVEHVLHGHSRAITDINFHPTNPE 128

Query: 174 ELISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHD 233
            L +CS D  +  WD++S +    S  S+ S    + KW+  +PN+  S           
Sbjct: 129 ILATCSIDAYVHAWDMRSSRRAFYSA-SVWSAGAAQVKWNFKNPNVMASA---------- 177

Query: 234 KRSEKPLQKLLQKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEAV 293
                                  HS+++F          ++D RK    LH + GH  +V
Sbjct: 178 -----------------------HSNDIF----------IWDLRKGCMPLHILKGHANSV 204

Query: 294 TSLEFAHHKDGILCSGGSDRRVLLWD 319
            S++F+   +  + S  +D  V  WD
Sbjct: 205 NSIDFSRFNETEIMSSSNDGTVKFWD 230

>SAKL0H16390g Chr8 complement(1437966..1441388) [3423 bp, 1140 aa]
           {ON} similar to uniprot|Q03897 Saccharomyces cerevisiae
           YDR128W Hypothetical ORF
          Length = 1140

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 35/153 (22%), Positives = 78/153 (50%), Gaps = 5/153 (3%)

Query: 170 ASPGELISCSDDGSIAIWDIKSGKTVPTS-VNSLHSDIVNECKWHESDPNIYGSVSEDSF 228
           A P  ++S S+  ++ +W++    T     +   H   + +  +H   P I  + S D++
Sbjct: 80  AKPYWVVSTSNQKAM-VWNLSRNSTNAIEHILHGHFRAITDINFHPHHPEILATCSVDTY 138

Query: 229 LMIHDKRS-EKPLQKLLQ-KEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSM 286
           ++  D RS ++P     + +   + + ++  +SN+ A++ +D  V ++D RK    L+++
Sbjct: 139 VLAWDMRSPQRPYYSTSEWRAGASQVKWNFRNSNIMASSHSD-HVCIWDLRKGCTPLYTL 197

Query: 287 SGHQEAVTSLEFAHHKDGILCSGGSDRRVLLWD 319
            GH+ +V +++F   K+  + S  +D  V  WD
Sbjct: 198 QGHEGSVNNIDFNKAKETEIMSSSNDGTVKFWD 230

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 31/133 (23%), Positives = 50/133 (37%), Gaps = 14/133 (10%)

Query: 252 IAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEAVTSLEFAHHKDGILCSGGS 311
           I F  H   + A    D  V  +D R P    +S S  +   + +++      I+ S  S
Sbjct: 120 INFHPHHPEILATCSVDTYVLAWDMRSPQRPYYSTSEWRAGASQVKWNFRNSNIMASSHS 179

Query: 312 DRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGHKSAINDFSFSPNVPWLMASVEEENI 371
           D  V +WDL +             G   L    GH+ ++N+  F+      + S   +  
Sbjct: 180 DH-VCIWDLRK-------------GCTPLYTLQGHEGSVNNIDFNKAKETEIMSSSNDGT 225

Query: 372 VQIWKPSRKLTNP 384
           V+ W  S   T P
Sbjct: 226 VKFWDYSVSDTKP 238

 Score = 38.1 bits (87), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 35/163 (21%), Positives = 67/163 (41%), Gaps = 3/163 (1%)

Query: 115 EVTRARYAPFDSNLIATISGTG-TVFLYDRTKDDENALRGKYAYHKENGYGLNFSVASPG 173
           EV   +++P  +     +S +     +++ +++  NA+      H      +NF    P 
Sbjct: 69  EVADVQWSPHPAKPYWVVSTSNQKAMVWNLSRNSTNAIEHILHGHFRAITDINFHPHHPE 128

Query: 174 ELISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHD 233
            L +CS D  +  WD++S +    S +   +   ++ KW+  + NI  S   D   +   
Sbjct: 129 ILATCSVDTYVLAWDMRSPQRPYYSTSEWRAG-ASQVKWNFRNSNIMASSHSDHVCIWDL 187

Query: 234 KRSEKPLQKLLQKE-PFNTIAFSKHSSNLFAAAGTDAMVYLFD 275
           ++   PL  L   E   N I F+K       ++  D  V  +D
Sbjct: 188 RKGCTPLYTLQGHEGSVNNIDFNKAKETEIMSSSNDGTVKFWD 230

 Score = 35.8 bits (81), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 31/61 (50%), Gaps = 2/61 (3%)

Query: 261 LFAAAGTDAMVYLFDSRKPTEAL-HSMSGHQEAVTSLEFAHHKDGILCSGGSDRRVLLWD 319
           + + +   AMV+   SR  T A+ H + GH  A+T + F  H   IL +   D  VL WD
Sbjct: 85  VVSTSNQKAMVWNL-SRNSTNAIEHILHGHFRAITDINFHPHHPEILATCSVDTYVLAWD 143

Query: 320 L 320
           +
Sbjct: 144 M 144

 Score = 30.8 bits (68), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 36/76 (47%), Gaps = 12/76 (15%)

Query: 311 SDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGHKSAINDFSFSPNVPWLMASVEEEN 370
           S+++ ++W+L +  T   E           ++H GH  AI D +F P+ P ++A+   + 
Sbjct: 89  SNQKAMVWNLSRNSTNAIEH----------ILH-GHFRAITDINFHPHHPEILATCSVDT 137

Query: 371 IVQIWKPSRKLTNPYF 386
            V  W   R    PY+
Sbjct: 138 YVLAWD-MRSPQRPYY 152

>YDR128W Chr4 (709549..712995) [3447 bp, 1148 aa] {ON}  MTC5Subunit
           of the SEA (Seh1-associated) complex, a coatomer-related
           complex that associates dynamically with the vacuole;
           has N-terminal WD-40 repeats and a C-terminal RING
           motif; mtc5 is synthetically sick with cdc13-1
          Length = 1148

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 41/164 (25%), Positives = 79/164 (48%), Gaps = 7/164 (4%)

Query: 170 ASPGELISCSDDGSIAIWDI-KSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSF 228
           A P  ++S S+  +I IW++ KS       V   HS  + +  ++   P++  + S D++
Sbjct: 80  AKPYWIVSTSNQKAI-IWNLAKSSSNAIEFVLHGHSRAITDINFNPQHPDVLATCSVDTY 138

Query: 229 LMIHDKRS-EKPLQKLLQ-KEPFNTIAFSKHSSNLFAAA-GTDAMVYLFDSRKPTEALHS 285
           +   D RS  +P       +   + + ++    N+ A++ G D  ++++D RK +  L S
Sbjct: 139 VHAWDMRSPHRPFYSTSSWRSAASQVKWNYKDPNVLASSHGND--IFVWDLRKGSTPLCS 196

Query: 286 MSGHQEAVTSLEFAHHKDGILCSGGSDRRVLLWDLFQIGTEQQE 329
           + GH  +V S++F   K   + S  +D  V  WD  +  TE + 
Sbjct: 197 LKGHVSSVNSIDFNRFKYSEIMSSSNDGTVKFWDYSKSTTESKR 240

 Score = 30.8 bits (68), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 27/129 (20%), Positives = 56/129 (43%), Gaps = 15/129 (11%)

Query: 249 FNTIAFSKHSSNLFAAAGTDAMVY-LFDSRKPTEALHSMSGHQEAVTSLEFAHH-KDGIL 306
           FN ++ +    ++  A+     +  L D   P   LH ++  Q  V  ++++ H      
Sbjct: 27  FNAVSINPSGRDIVLASRQGLYIIDLDDPFTPPRWLHHITPWQ--VADVQWSPHPAKPYW 84

Query: 307 CSGGSDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGHKSAINDFSFSPNVPWLMASV 366
               S+++ ++W+L +  +   E           ++H GH  AI D +F+P  P ++A+ 
Sbjct: 85  IVSTSNQKAIIWNLAKSSSNAIE----------FVLH-GHSRAITDINFNPQHPDVLATC 133

Query: 367 EEENIVQIW 375
             +  V  W
Sbjct: 134 SVDTYVHAW 142

>KLTH0F16192g Chr6 (1312331..1313719) [1389 bp, 462 aa] {ON} similar
           to uniprot|P40968 Saccharomyces cerevisiae YDR364C CDC40
           Pre-mRNA splicing factor important for catalytic step II
           of pre-mRNA splicing and plays a role in cell cycle
           progression required for DNA synthesis during mitosis
           and meiosis has WD repeats
          Length = 462

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 46/102 (45%), Gaps = 14/102 (13%)

Query: 274 FDSRKPTEALHSMSGHQEAVTSLEFAHHKDGILCSGGSDRRVLLWDLFQIGTEQQEEDAD 333
           F    P + +HS  GH    T+++       +  SGG+D +V LWD++            
Sbjct: 153 FRCYLPKKMIHSYRGHHNGTTTIKMLPKSGHLFLSGGNDNKVKLWDVYH----------- 201

Query: 334 DGGPELLMMHAGHKSAINDFSFSPNVPWLMASVEEENIVQIW 375
               ELL  + GH  A+ D SFS +    + SV  +  ++IW
Sbjct: 202 --KRELLRDYCGHSKAVRDVSFSGSGTSFL-SVSYDQHMKIW 240

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 31/69 (44%), Gaps = 1/69 (1%)

Query: 251 TIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEAVTSLEFAHHKDGILCSGG 310
           TI     S +LF + G D  V L+D     E L    GH +AV  + F+      L S  
Sbjct: 174 TIKMLPKSGHLFLSGGNDNKVKLWDVYHKRELLRDYCGHSKAVRDVSFSGSGTSFL-SVS 232

Query: 311 SDRRVLLWD 319
            D+ + +W+
Sbjct: 233 YDQHMKIWN 241

>Smik_4.374 Chr4 (670748..674206) [3459 bp, 1152 aa] {ON} YDR128W
           (REAL)
          Length = 1152

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 41/164 (25%), Positives = 78/164 (47%), Gaps = 7/164 (4%)

Query: 170 ASPGELISCSDDGSIAIWDI-KSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSF 228
           A P  ++S S+  +I IW++ KS       V   HS  + +  ++   P++  + S D++
Sbjct: 80  AKPYWIVSTSNQKAI-IWNLAKSSANAIEFVLHGHSRAITDINFNPQHPDVLATCSVDTY 138

Query: 229 LMIHDKRS-EKPLQKLLQ-KEPFNTIAFSKHSSNLFAAA-GTDAMVYLFDSRKPTEALHS 285
           +   D RS  +P       +   + + ++    N+ A++ G D  ++++D RK +  L S
Sbjct: 139 VHAWDMRSPHRPFYSTSSWRSAASQVKWNYKDPNVLASSHGND--IFVWDLRKGSTPLCS 196

Query: 286 MSGHQEAVTSLEFAHHKDGILCSGGSDRRVLLWDLFQIGTEQQE 329
           + GH  +V S++F   K   + S  +D  V  WD     TE + 
Sbjct: 197 LKGHVSSVNSIDFNRFKSTEIMSSSNDGTVKFWDYSTSTTESKR 240

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 36/152 (23%), Positives = 65/152 (42%), Gaps = 3/152 (1%)

Query: 138 VFLYDRTKDDENALRGKYAYHKENGYGLNFSVASPGELISCSDDGSIAIWDIKSGKTVPT 197
             +++  K   NA+      H      +NF+   P  L +CS D  +  WD++S      
Sbjct: 93  AIIWNLAKSSANAIEFVLHGHSRAITDINFNPQHPDVLATCSVDTYVHAWDMRSPHRPFY 152

Query: 198 SVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDKRSEKPLQKLL-QKEPFNTIAFSK 256
           S +S  S   ++ KW+  DPN+  S   +   +   ++   PL  L       N+I F++
Sbjct: 153 STSSWRS-AASQVKWNYKDPNVLASSHGNDIFVWDLRKGSTPLCSLKGHVSSVNSIDFNR 211

Query: 257 HSSNLFAAAGTDAMVYLFD-SRKPTEALHSMS 287
             S    ++  D  V  +D S   TE+  +++
Sbjct: 212 FKSTEIMSSSNDGTVKFWDYSTSTTESKRTVT 243

 Score = 37.7 bits (86), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 30/132 (22%), Positives = 53/132 (40%), Gaps = 16/132 (12%)

Query: 252 IAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEAVTSLEFAHHKDGILCSG-G 310
           I F+    ++ A    D  V+ +D R P    +S S  + A + +++ +    +L S  G
Sbjct: 120 INFNPQHPDVLATCSVDTYVHAWDMRSPHRPFYSTSSWRSAASQVKWNYKDPNVLASSHG 179

Query: 311 SDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGHKSAINDFSFSPNVPWLMASVEEEN 370
           +D  + +WDL +             G   L    GH S++N   F+      + S   + 
Sbjct: 180 ND--IFVWDLRK-------------GSTPLCSLKGHVSSVNSIDFNRFKSTEIMSSSNDG 224

Query: 371 IVQIWKPSRKLT 382
            V+ W  S   T
Sbjct: 225 TVKFWDYSTSTT 236

>NDAI0K02350 Chr11 complement(524551..526932) [2382 bp, 793 aa] {ON}
           Anc_6.363
          Length = 793

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 49/163 (30%), Positives = 71/163 (43%), Gaps = 32/163 (19%)

Query: 175 LISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYG-----------SV 223
           L + ++D  I IWDI+ GK            IV   K HE D  +Y            S 
Sbjct: 510 LATGAEDKLIRIWDIQEGK------------IVMVLKGHEQD--VYSLDYFPDGQKLVSG 555

Query: 224 SEDSFLMIHDKRSEKPLQKLLQKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKP--TE 281
           S D  + I D R+ +    L  ++   T+A S H     AA   D  V ++DS      E
Sbjct: 556 SGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPHDGRFIAAGSLDRAVRVWDSTTGFLVE 615

Query: 282 ALHS----MSGHQEAVTSLEFAHHKDGILCSGGSDRRVLLWDL 320
            L S     +GHQ++V S+ F    + ++ SG  D+ V LW+L
Sbjct: 616 RLDSENELGTGHQDSVYSVVFTRDGNEVV-SGSLDKSVKLWNL 657

>ZYRO0G20152g Chr7 complement(1669233..1669655,1669872..1670408)
           [960 bp, 319 aa] {ON} highly similar to uniprot|P38011
           Saccharomyces cerevisiae YMR116C ASC1 WD repeat protein
           (G-beta like protein) involved in translation regulation
           required for repression of Gcn4p activity in the absence
           of amino-acid starvation core component of the ribosome
           ortholog of mammalian RACK1
          Length = 319

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 57/240 (23%), Positives = 99/240 (41%), Gaps = 28/240 (11%)

Query: 151 LRGKYAYHKENGYGLNFSVASPGELISCSDDGSIAIWDIKSGKT---VPTSVNSLHSDIV 207
           LRG    H      L  S   P  L+S S D ++  W +        VP      H+ IV
Sbjct: 9   LRGTLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDKQYGVPVRSFQGHNHIV 68

Query: 208 NECKWHESDPNIYGSVSEDSFLMIHDKRSEKPLQKLL-QKEPFNTIAFSKHSSNLFAAAG 266
            +C    +D     S S D  L + D  + +  Q+ +  K    ++A  + +S + + + 
Sbjct: 69  QDCS-LTADGAYALSASWDKTLRLWDVATGQTYQRFVGHKSDVMSVAIDRKASMIISGS- 126

Query: 267 TDAMVYLFDSRKPTEALHSMSGHQEAVTSLEFAHHKDG-----ILCSGGSDRRVLLWDLF 321
            D  V ++  R   + L +M GH + V+ +  A  +D       + S G D+ V  W++ 
Sbjct: 127 RDRTVKVWTIRG--QCLATMLGHNDWVSQVRIAPTEDANDDTVTVISAGMDKMVKAWNVN 184

Query: 322 QIGTEQQEEDADDGGPELLMMHAGHKSAINDFSFSPNVPWLMASVEEENIVQIWKPSRKL 381
           Q    Q E D             GH + +N  + SP+   L+AS  ++  + +W  + K+
Sbjct: 185 QF---QIEAD-----------FIGHNNYVNTITASPDGS-LVASAGKDGEIMLWNLADKV 229

>KAFR0B00370 Chr2 complement(83264..84649) [1386 bp, 461 aa] {ON}
           Anc_7.534 YPR178W
          Length = 461

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 50/209 (23%), Positives = 90/209 (43%), Gaps = 13/209 (6%)

Query: 112 HENEVTRARYAPFDSNLIATISGTGTVFLYDRTKDDENALRGKYAYHKENGYGLNFSVAS 171
           HE  V   ++ P  +  + + S   T  L+D     E  L+     H +  Y L+F    
Sbjct: 262 HEKRVVATKFHP-STRFLGSTSFDTTWRLWDIATSQELLLQ---EGHSKEVYSLSFQ--G 315

Query: 172 PGELISCSD-DGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLM 230
            G L+     D +  +WDI+ GK++ T +N  HS  V    W  +  N+  +   D  + 
Sbjct: 316 DGSLVCTGGLDNTALLWDIRCGKSIMT-LNG-HSKPVYCVDWSCNGYNV-ATGGGDGLIN 372

Query: 231 IHDKRSEKPLQKLL-QKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGH 289
           I D R    +  +L      + + F+K  S    +   D  + ++ S    + + ++ GH
Sbjct: 373 IWDIRKTNLVNTILAHNNIISDLRFAKQDSKCLVSCSYDKKINIYSSDNWLK-VKTLEGH 431

Query: 290 QEAVTSLEFAHHKDGILCSGGSDRRVLLW 318
              + S++  ++   ++ SGG DR V LW
Sbjct: 432 SHNILSVDMTNNAKALI-SGGWDRSVKLW 459

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 40/159 (25%), Positives = 76/159 (47%), Gaps = 11/159 (6%)

Query: 167 FSVASPGELISCSD-DGSIAIWDIKSGKTVPT-SVNSLHSDIVNECKWHESDPNIYGSVS 224
            ++A   E+ +  D +G + +++ K+ +  PT  ++++HS  +    W+++   +  + +
Sbjct: 182 IAIAPNDEVFATGDWNGDLKLFNSKTLE--PTVKIDNVHSGKIGGLDWNKTGGMLV-TGA 238

Query: 225 EDSFLMIHDKRS-EKPLQKLLQKEPFNTIAFSKHSSNLFAAAGT-DAMVYLFDSRKPTEA 282
           ED  + ++   S E     +L+      +A   H S  F  + + D    L+D     E 
Sbjct: 239 EDGMVKLYSYTSNEIKETTVLKGHEKRVVATKFHPSTRFLGSTSFDTTWRLWDIATSQEL 298

Query: 283 LHSMSGHQEAVTSLEFAHHKDG-ILCSGGSDRRVLLWDL 320
           L    GH + V SL F    DG ++C+GG D   LLWD+
Sbjct: 299 L-LQEGHSKEVYSLSF--QGDGSLVCTGGLDNTALLWDI 334

>TBLA0F02400 Chr6 complement(590293..591189) [897 bp, 298 aa] {ON}
           Anc_7.338 YLR208W
          Length = 298

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 58/253 (22%), Positives = 102/253 (40%), Gaps = 41/253 (16%)

Query: 129 IATISGTGTVFLYDRTKDDENALRGKYAYHKENGYGLNFSVASPGELI-SCSDDGSIAIW 187
           +AT S   T+ +Y+    D + L      H+   + ++++    G ++ SCS DG + IW
Sbjct: 24  LATCSSDKTIKIYE-IDGDSHKLLTTLTGHEGPVWRIDWAHPKFGTILASCSYDGKVIIW 82

Query: 188 DIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDKRSEKPLQKLLQKE 247
             ++G     +V+S+HS  VN  KW    P+ YG+V     L+      +  + +  +  
Sbjct: 83  KEENGTWSQIAVHSVHSASVNSVKW---APHEYGAV-----LLAASSDGKISVVEFKENG 134

Query: 248 PFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEAVTSLEFAHHKDGILC 307
             N +    H+  + +AA   A +     + PTE    +                     
Sbjct: 135 TQNPMVLDAHAVGVNSAAWAPATIQ--SPKNPTEKPLPLRR-----------------FV 175

Query: 308 SGGSDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGHKSAINDFSFSPNVPW--LMAS 365
           +GG+D  V +W   Q       ED  +          GH   + D ++SP+V     +AS
Sbjct: 176 TGGADNLVKIWKFDQAANTYILEDTLE----------GHSDWVRDVTWSPSVLLGSCIAS 225

Query: 366 VEEENIVQIWKPS 378
           V ++    IW  S
Sbjct: 226 VSQDRTCIIWTQS 238

>Kpol_530.25 s530 (67445..69169) [1725 bp, 574 aa] {ON}
           (67445..69169) [1725 nt, 575 aa]
          Length = 574

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 49/194 (25%), Positives = 89/194 (45%), Gaps = 18/194 (9%)

Query: 175 LISCSDDGSIAIWDIKSGKTVPTSVNSLHSDI-VNECKWHESDPNIYGSVSEDSFLMIHD 233
           L S S D ++ +WD+ SG T   S+ S+HS+  V+  +WH S  +I  +   DS L + D
Sbjct: 302 LASTSADHTVKLWDLNSG-TAARSIASIHSNKNVSASEWHMSHGSILLTGGYDSRLALTD 360

Query: 234 KR--SEKPLQK---LLQKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSR--KPTEALHSM 286
            R   E  + K   ++  E      F+  S NL         VY FD R  + ++ + ++
Sbjct: 361 VRISDESNMSKYWSVMGGEEIEAATFA--SENLILCGTDSGNVYSFDIRNNEGSKPVWTL 418

Query: 287 SGHQEAVTSLEFAHHKDGILCSGG-SDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAG 345
             H   +++L       G++ +G   ++ V LW  F +     E  ++  GP +++    
Sbjct: 419 KAHDAGISTLNCNKFIPGMMSTGAMGEKAVKLWK-FPV-----ESTSNGKGPNMVLSRDF 472

Query: 346 HKSAINDFSFSPNV 359
               +   SF+P++
Sbjct: 473 DAGNVLTSSFAPDM 486

 Score = 32.0 bits (71), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 33/71 (46%), Gaps = 1/71 (1%)

Query: 251 TIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEAVTSLEFAHHKDG-ILCSG 309
           ++A +KH  ++ A+   D  V L+D    T A    S H     S    H   G IL +G
Sbjct: 291 SLAHNKHFRSVLASTSADHTVKLWDLNSGTAARSIASIHSNKNVSASEWHMSHGSILLTG 350

Query: 310 GSDRRVLLWDL 320
           G D R+ L D+
Sbjct: 351 GYDSRLALTDV 361

>Kwal_27.12239 s27 complement(1143763..1144713) [951 bp, 316 aa]
           {ON} YBR175W (SWD3) - YBR175W [contig 22] FULL
          Length = 316

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 58/224 (25%), Positives = 95/224 (42%), Gaps = 25/224 (11%)

Query: 112 HENEVTRARYAPFDSNLIATISGTGTVFLYDRTKDDENALRGKYAYHKENGYGLNFSVAS 171
           H   ++   ++P DS  IAT S   T+ +      + + L G  A      Y +  ++  
Sbjct: 57  HSRPLSDLCWSP-DSQCIATASDDFTIIITHIVFGELHRLVGHTAPVTSVKYTMKGNL-- 113

Query: 172 PGELISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMI 231
              L SCS D SI IWDI SG  + T   S HS+ V        DP+I  S S D  + I
Sbjct: 114 ---LCSCSMDESIKIWDILSGTLLRTL--SAHSEPVVSIDLPPFDPSILSSGSYDGLIRI 168

Query: 232 HDKRSEKPLQKLL-----QKE----PFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEA 282
            D  +   L+ L      Q E    P + + FS++   L   +  D ++ ++D  +    
Sbjct: 169 FDTATGHCLKTLTYDKDWQSENGVVPISQVKFSRNGKYLLVKS-LDGILKIWDFVRGKVV 227

Query: 283 LHSMSGHQEAV---TSLEFAHHKDG----ILCSGGSDRRVLLWD 319
               SG   ++     ++F + +D     I+ SG    +++ WD
Sbjct: 228 RTFKSGESSSLRYSCGMDFLYPQDQTVDPIVVSGTESGQIVCWD 271

 Score = 34.7 bits (78), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 30/132 (22%), Positives = 54/132 (40%), Gaps = 18/132 (13%)

Query: 244 LQKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEAVTSLEFAHHKD 303
           L   P + + +S   S   A A  D  + +  +      LH + GH   VTS+++   K 
Sbjct: 56  LHSRPLSDLCWSP-DSQCIATASDDFTIII--THIVFGELHRLVGHTAPVTSVKYTM-KG 111

Query: 304 GILCSGGSDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGHKSAINDFSFSPNVPWLM 363
            +LCS   D  + +WD+   GT             LL   + H   +      P  P ++
Sbjct: 112 NLLCSCSMDESIKIWDILS-GT-------------LLRTLSAHSEPVVSIDLPPFDPSIL 157

Query: 364 ASVEEENIVQIW 375
           +S   + +++I+
Sbjct: 158 SSGSYDGLIRIF 169

>SAKL0A00660g Chr1 (71855..73837) [1983 bp, 660 aa] {ON} some
           similarities with uniprot|P18323 Saccharomyces
           cerevisiae YCR084C
          Length = 660

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 67/297 (22%), Positives = 126/297 (42%), Gaps = 52/297 (17%)

Query: 125 DSNLIATISGTGTVFLYD-RTKDDENALRGKYAYHKENGYGLNFSVASPGELISCSDDGS 183
           D   +AT +    + ++D  TK     L+G    H+++ Y L++   S  +L+S S D +
Sbjct: 389 DGKFLATGAEDKLIRIWDLSTKRIVMTLQG----HEQDIYSLDY-FPSGDKLVSGSGDRT 443

Query: 184 IAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDKRSEKPLQKL 243
           + IWD+++G+    S+     D V        +     + S D  L + D  +   +++L
Sbjct: 444 VRIWDLRTGQ---CSLTLSIEDGVTTVAVSPGEGKFIAAGSLDRTLRVWDSETGFLVERL 500

Query: 244 --------LQKEPFNTIAFSKHSSNLFAAAGTDAMVYLF----------DSRKPTEALHS 285
                     K+   ++ F++    + + +  D  V L+          +  KPT A   
Sbjct: 501 DSENELGTGHKDSVYSVVFTRDGQGVVSGS-LDRSVKLWNLHNTGSSSKNDSKPTAATCE 559

Query: 286 M--SGHQEAVTSLEFAHHKDGILCSGGSDRRVLLWDLFQIGTEQQEEDADDGGPELLMMH 343
           +  +GH++ V S+    + D  + SG  DR VL W            D   G P  L+M 
Sbjct: 560 VTYTGHKDFVLSVATTQN-DKYILSGSKDRGVLFW------------DTQSGNP--LLML 604

Query: 344 AGHKSAI------NDFSFSPNVPWLMASVEEENIVQIWKPSRKLTNPYFPQGYDIRS 394
            GH++++      N F   P+   + A+   +   +IWK S+   N   PQ  ++++
Sbjct: 605 QGHRNSVISVAVANGFPLGPDY-GVFATGSGDCKARIWKYSKNKANASEPQVQEVKA 660

>Ecym_4134 Chr4 complement(280146..282578) [2433 bp, 810 aa] {ON}
           similar to Ashbya gossypii AGR180W
          Length = 810

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 51/206 (24%), Positives = 87/206 (42%), Gaps = 15/206 (7%)

Query: 162 GYGLNFSVASPGELISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYG 221
           G G   S+ + G L++ S    I I  +K    +   +N+     +   K    D +   
Sbjct: 18  GSGTAVSITNDGSLLATSVLDVINIVQLKERHEIVHKINNDDEQEITALKL-TPDGSYLC 76

Query: 222 SVSEDSFLMIHDKRSEKPLQKLLQKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTE 281
            V+++  L I+   S+K ++ +    P   +   + +S L    GTD  V +FD      
Sbjct: 77  FVAQNQLLRIYSLASKKIVRSMKVSSPVYVMDCDE-TSTLLVIGGTDGSVSIFDIENGY- 134

Query: 282 ALHSMSGHQEAVTSLEFAHHKDG---ILCSGGSDRRVLLWDLFQ---IGTEQQEEDADDG 335
             HS  GH   ++S++F    DG   +L SG ++  V +WDL +   + T Q+   A  G
Sbjct: 135 VTHSFKGHGGIISSVKFYGELDGANWLLASGDTNGVVKIWDLVKRRCMHTIQEHTAAVRG 194

Query: 336 ------GPELLMMHAGHKSAINDFSF 355
                   E+L++  G    IN   F
Sbjct: 195 LDFCVKDSEMLLISGGRDEIINLHHF 220

 Score = 32.0 bits (71), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 34/70 (48%), Gaps = 4/70 (5%)

Query: 128 LIATISGTGTVFLYDRTKDDENALRGKYAYHKENGYGLNFSVASPGELISCSDDGSIAIW 187
           LIAT SG  T+ ++     +   ++     H      ++F +    +L+SC  DG + IW
Sbjct: 543 LIATCSGDKTIKIWSL---ENYNIKATLEGHTNAVQRISF-INKNKQLVSCGADGLVKIW 598

Query: 188 DIKSGKTVPT 197
           D  +G+ + T
Sbjct: 599 DCSTGECLRT 608

>TBLA0F02230 Chr6 (551746..555396) [3651 bp, 1216 aa] {ON} Anc_7.322
           YDL145C
          Length = 1216

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 50/242 (20%), Positives = 96/242 (39%), Gaps = 24/242 (9%)

Query: 154 KYAYHKENGYGLNFSVASPGELISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWH 213
           K+        G+ F  + P  L++     +I +WD + G  +    +  H   V    +H
Sbjct: 6   KFESKSTRAKGIAFHPSRPWALVALFS-STIQLWDYRMGTLLHRFED--HEGPVRSVDFH 62

Query: 214 ESDPNIYGSVSEDSFLMIHDKRSEKPLQKLLQKEPFNTIAFSKHSSNLFAAAGTDAMVYL 273
            + P ++ S  +D  + +    + K L  L     +    F  H      +A  D  + +
Sbjct: 63  PTQP-LFVSAGDDCTIKVWSLETNKCLYTLTGHLDYVRTVFFHHELPWIISASDDQTIRI 121

Query: 274 FDSRKPTEALHSMSGHQEAVTSLEFAHHKDGILCSGGSDRRVLLWDLF------------ 321
           ++ +   E + ++ GH   V   +F H  + ++ S   D  V +WD+             
Sbjct: 122 WNWQNRKE-IANLIGHNHFVMCAQF-HPTEDLVVSASLDETVRVWDISGLRKKHSAPAQS 179

Query: 322 -----QIGTEQQEEDADDGGPELLMMHAGHKSAINDFSFSPNVPWLMASVEEENIVQIWK 376
                Q+ T+Q   D   G   +  +  GH   +N  SF P +P L+ S  ++  V++W+
Sbjct: 180 ASFEEQMSTQQNILDGGFGDCVVKFILEGHTRGVNWVSFHPTLP-LIVSGSDDRQVKLWR 238

Query: 377 PS 378
            S
Sbjct: 239 MS 240

 Score = 38.1 bits (87), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 26/111 (23%), Positives = 51/111 (45%), Gaps = 2/111 (1%)

Query: 175 LISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDK 234
           ++S SDD  + +W + + K         H++ V+   +H    N+  SV ED  L + D 
Sbjct: 225 IVSGSDDRQVKLWRMSATKAWEVDTCRGHTNNVDSVIFHPHQ-NLIISVGEDKTLRVWDL 283

Query: 235 RSEKPLQKLLQKEPFNTIAFSKHSSNLFAAA-GTDAMVYLFDSRKPTEALH 284
               P+++  ++     +  +  + NLF AA  +  M++  D  +P   +H
Sbjct: 284 DKRTPVKQFKRENDRFWLIAAHPNINLFGAAHDSGVMIFKLDRERPPATIH 334

>NDAI0D02250 Chr4 complement(526907..529294) [2388 bp, 795 aa] {ON}
           Anc_5.139 YGR200C
          Length = 795

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 55/242 (22%), Positives = 102/242 (42%), Gaps = 42/242 (17%)

Query: 129 IATISGTGTVFLYDRTKDDENALRGKYAYHKENGYGLNFSVASPGELISCSDDGSIAIWD 188
           I       T+ L+D      + +      H+ +   + F   +P  +IS S+D  + +W 
Sbjct: 27  IVAFGACNTIALWDPLDPSNHGVIQTLKGHEADVTCVKFIHGTPF-MISASEDHHVKVWK 85

Query: 189 -----------IKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSE---DSFLMIHDK 234
                      I+  +    +++ L    V  C    +D N+   V E   D+F+M  + 
Sbjct: 86  VTDNVWNCVQTIQHYQNTIVALDVLEDLFVVGC----ADGNVSIWVRENELDTFVMSQEF 141

Query: 235 RSEKPLQKLLQKEPFNTIAFSKHSSN--LFAAAGTDAMVYL----FDSRKPTEALH---- 284
             ++ +  L       + A S  + N  L A  GT+  V++    F   +  +A+H    
Sbjct: 142 IVQQGVLPL-------SFALSNVTDNKYLLAIGGTNVNVFIYSFVFSRTQGVDAIHDCKL 194

Query: 285 --SMSGHQEAVTSLEFAHHK---DGILCSGGSDRRVLLWDL-FQIGTEQQEEDADDGGPE 338
              + GH++ + S+ F H +   D +LCSG  DR + LW +      E+Q+++ D+   E
Sbjct: 195 AAKLEGHEDWIKSMAFRHQETPGDYLLCSGSQDRYIRLWRIRINDLIEEQDDENDENKLE 254

Query: 339 LL 340
           LL
Sbjct: 255 LL 256

>NDAI0I00460 Chr9 (91809..94562) [2754 bp, 917 aa] {ON} Anc_6.325
          Length = 917

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 40/159 (25%), Positives = 73/159 (45%), Gaps = 9/159 (5%)

Query: 174 ELISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHD 233
            +++ +DDG I +WD+ SG  + T     H+  V + ++ +    ++ S S D  +   D
Sbjct: 355 RVVTAADDGKIKVWDVVSGFCLATFTE--HTSSVTQVQFAKKGQVLFSS-SLDGTVRAWD 411

Query: 234 KRSEKPLQKLLQKE--PFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQE 291
               +  +     E   FN +A    S  +  A   D+      S +  + L ++SGH+ 
Sbjct: 412 LIRYRNFRTFTAAERIQFNCLAVDP-SGEVVCAGSIDSFDIHVWSVQTGQLLDTLSGHEG 470

Query: 292 AVTSLEFAHHKDGILCSGGSDRRVLLWDLFQIGTEQQEE 330
            V+ L F+  ++ +L S   D+ V +W +F  G  QQ E
Sbjct: 471 PVSCLSFS-QENSVLASASWDKTVRIWSIF--GRSQQVE 506

>NCAS0D04610 Chr4 (881005..882552) [1548 bp, 515 aa] {ON} Anc_6.340
          Length = 515

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 77/319 (24%), Positives = 129/319 (40%), Gaps = 72/319 (22%)

Query: 112 HENEVTRARYAPFDSNLIATISGTGTVFLYDRTKDDE---NALRGKYAYHKENGYGLNFS 168
           H N V    Y P +  +IAT S   T+ L+D +KD +   +ALRG   +     +     
Sbjct: 185 HFNWVLCVSYCP-NGEVIATGSMDNTIRLWD-SKDGKPLGDALRGHLKWITSLAWE-PIH 241

Query: 169 VASPGE---LISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSE 225
           +  PGE   L S S DG+I IWDI   + V     S H++ V+  KW  S   I  S S 
Sbjct: 242 LVKPGESPRLASASKDGTIRIWDIT--RRVCLYTMSGHTNSVSCIKW--SGQGIIYSGSH 297

Query: 226 DSFLMIHDKRSEKPLQKLLQKEP--FNTIAFS-------------------------KHS 258
           D  + + D  ++     +L+      N ++ S                         K  
Sbjct: 298 DKTVRVWDMNADGKCINILKSHAHWVNHLSLSTDYALRVGAFDHTGAQPASAKDARDKAL 357

Query: 259 SN-------------LFAAAGTDAMVYLFDSRKPTEALHSMSGHQEAVTSLEFAHHKDG- 304
           +N             L   A  D  ++L++  K  + +  M+GHQ+ V  + F+   DG 
Sbjct: 358 ANYEKVVKKNGKLEELMVTASDDFTMFLWNPLKSNKPIARMTGHQKLVNHVAFS--PDGR 415

Query: 305 ILCSGGSDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGHKSAINDFSFSPNVPWLMA 364
            + S   D  + LW            D  DG  + +    GH +++   ++S +   L+ 
Sbjct: 416 YIVSASFDNSIKLW------------DGRDG--KFISTFRGHVASVYQVAWSADCR-LLV 460

Query: 365 SVEEENIVQIWK-PSRKLT 382
           S  ++  +++W   +RKL+
Sbjct: 461 SCSKDTTLKVWDVRTRKLS 479

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 48/210 (22%), Positives = 86/210 (40%), Gaps = 46/210 (21%)

Query: 112 HENEVTRARYAPFDSNLIATISGTGTVFLYD-RTKDDENALRGKYAYHKENGYGLNFSVA 170
           H + +  + +AP  S+ + T +G  T  ++D  T+  +  L G + +     Y  N  V 
Sbjct: 142 HGSTILCSAFAPNTSSRMVTGAGDNTARIWDCDTQTPKATLTGHFNWVLCVSYCPNGEVI 201

Query: 171 SPGELISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLM 230
           + G +     D +I +WD K GK        L   +    KW  S               
Sbjct: 202 ATGSM-----DNTIRLWDSKDGK-------PLGDALRGHLKWITS--------------- 234

Query: 231 IHDKRSEKPLQKLLQKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQ 290
                        L  EP + +   +  S   A+A  D  + ++D  +    L++MSGH 
Sbjct: 235 -------------LAWEPIHLVKPGE--SPRLASASKDGTIRIWDITRRV-CLYTMSGHT 278

Query: 291 EAVTSLEFAHHKDGILCSGGSDRRVLLWDL 320
            +V+ ++++    GI+ SG  D+ V +WD+
Sbjct: 279 NSVSCIKWSGQ--GIIYSGSHDKTVRVWDM 306

 Score = 35.0 bits (79), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 36/147 (24%), Positives = 71/147 (48%), Gaps = 10/147 (6%)

Query: 175 LISCSDDGSIAIWD-IKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHD 233
           +++ SDD ++ +W+ +KS K  P +  + H  +VN   +   D     S S D+ + + D
Sbjct: 374 MVTASDDFTMFLWNPLKSNK--PIARMTGHQKLVNHVAF-SPDGRYIVSASFDNSIKLWD 430

Query: 234 KRSEKPLQKLL-QKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEA 292
            R  K +            +A+S     L  +   D  + ++D R    ++  + GH++ 
Sbjct: 431 GRDGKFISTFRGHVASVYQVAWSA-DCRLLVSCSKDTTLKVWDVRTRKLSV-DLPGHKDE 488

Query: 293 VTSLEFAHHKDGI-LCSGGSDRRVLLW 318
           V +++++   DG  +CSGG D+ V +W
Sbjct: 489 VYTVDWS--VDGKRVCSGGKDKMVRIW 513

 Score = 34.3 bits (77), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 41/150 (27%), Positives = 70/150 (46%), Gaps = 12/150 (8%)

Query: 128 LIATISGTGTVFLYDRTKDDENALRGKYAYHKENGYGLNFSVASPGE--LISCSDDGSIA 185
           L+ T S   T+FL++  K ++   R     H++    +N    SP    ++S S D SI 
Sbjct: 373 LMVTASDDFTMFLWNPLKSNKPIAR--MTGHQKL---VNHVAFSPDGRYIVSASFDNSIK 427

Query: 186 IWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDKRSEKPLQKLL- 244
           +WD + GK + T    + S  V +  W  +D  +  S S+D+ L + D R+ K    L  
Sbjct: 428 LWDGRDGKFISTFRGHVAS--VYQVAW-SADCRLLVSCSKDTTLKVWDVRTRKLSVDLPG 484

Query: 245 QKEPFNTIAFSKHSSNLFAAAGTDAMVYLF 274
            K+   T+ +S     +  + G D MV ++
Sbjct: 485 HKDEVYTVDWSVDGKRV-CSGGKDKMVRIW 513

>Skud_4.389 Chr4 (681326..684781) [3456 bp, 1151 aa] {ON} YDR128W
           (REAL)
          Length = 1151

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 43/192 (22%), Positives = 73/192 (38%), Gaps = 44/192 (22%)

Query: 138 VFLYDRTKDDENALRGKYAYHKENGYGLNFSVASPGELISCSDDGSIAIWDIKSGKTVPT 197
             +++  K   NA+      H      +NF+   P  L +CS D  +  WD++S      
Sbjct: 92  AIIWNLAKHSSNAIEFVLHGHSRAITDINFNPQHPDVLATCSVDTYVHAWDMRSPHRPFY 151

Query: 198 SVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDKRSEKPLQKLLQKEPFNTIAFSKH 257
           S +S  S   ++ KW+  DPN+                                      
Sbjct: 152 STSSWRS-AASQVKWNYKDPNV-------------------------------------- 172

Query: 258 SSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEAVTSLEFAHHKDGILCSGGSDRRVLL 317
              L ++ G D  ++++D RK +  L S+ GH  +V S++F   K   + S  +D  V  
Sbjct: 173 ---LASSHGND--IFVWDLRKGSTPLCSLKGHVSSVNSIDFNRFKSTEIMSSSNDGTVKF 227

Query: 318 WDLFQIGTEQQE 329
           WD  +  TE + 
Sbjct: 228 WDYSKSTTESKR 239

 Score = 39.3 bits (90), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 30/132 (22%), Positives = 54/132 (40%), Gaps = 16/132 (12%)

Query: 252 IAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEAVTSLEFAHHKDGILCSG-G 310
           I F+    ++ A    D  V+ +D R P    +S S  + A + +++ +    +L S  G
Sbjct: 119 INFNPQHPDVLATCSVDTYVHAWDMRSPHRPFYSTSSWRSAASQVKWNYKDPNVLASSHG 178

Query: 311 SDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGHKSAINDFSFSPNVPWLMASVEEEN 370
           +D  + +WDL +             G   L    GH S++N   F+      + S   + 
Sbjct: 179 ND--IFVWDLRK-------------GSTPLCSLKGHVSSVNSIDFNRFKSTEIMSSSNDG 223

Query: 371 IVQIWKPSRKLT 382
            V+ W  S+  T
Sbjct: 224 TVKFWDYSKSTT 235

>AGL234W Chr7 (257969..259858) [1890 bp, 629 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCR084C (TUP1)
          Length = 629

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 59/252 (23%), Positives = 105/252 (41%), Gaps = 52/252 (20%)

Query: 158 HKENGYGLNFSVASPGELISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDP 217
           H+++ Y L++  A   +L+S S D ++ IWD+++G+    S+     D V        D 
Sbjct: 393 HEQDIYSLDYFPAG-DKLVSGSGDRTVRIWDLRTGQ---CSLTLSIEDGVTTVAVSPGDG 448

Query: 218 NIYGSVSEDSFLMIHDKRSEKPLQKL--------LQKEPFNTIAFSKHSSNLFAAAGTDA 269
               + S D  + + D  +   +++L          K+   ++ F++    + + +  D 
Sbjct: 449 KYIAAGSLDRTVRVWDSETGFLVERLDSENELSTGHKDSVYSVVFTRDGQGVISGS-LDR 507

Query: 270 MVYLFDSRKPTEALHSMSGHQEAVTSLEFAHHKDGILC-----------SGGSDRRVLLW 318
            V L+D R     L+    H  A   + +  HKD +L            SG  DR VL W
Sbjct: 508 SVKLWDLR----GLNGQKSH--ATCEVTYTGHKDFVLSVATTQDDEYILSGSKDRGVLFW 561

Query: 319 DLFQIGTEQQEEDADDGGPELLMMHAGHK------SAINDFSFSPNVPWLMASVEEENIV 372
                       D   G P  L+M  GH+      + +N F   P+V  + A+   +   
Sbjct: 562 ------------DTASGNP--LLMLQGHRNSVISVAVVNGFPLGPDV-GVFATGSGDCKA 606

Query: 373 QIWKPSRKLTNP 384
           +IWK ++K +NP
Sbjct: 607 RIWKYTKK-SNP 617

>TDEL0C02240 Chr3 complement(388060..391665) [3606 bp, 1201 aa] {ON}
           Anc_7.322 YDL145C
          Length = 1201

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 68/279 (24%), Positives = 116/279 (41%), Gaps = 44/279 (15%)

Query: 104 IKIIKKFKHENEVTRARYAPFDSN----LIATISGTGTVFLYDRTKDDENALRGKYAYHK 159
           +K++ KF  E++ TRA+   F  +    L+A  S T  ++ Y         L  ++  H+
Sbjct: 1   MKMLTKF--ESKSTRAKGIAFHPSRPWVLVALFSSTIQLWDYRM-----GTLLHRFEDHE 53

Query: 160 ENGYGLNFSVASPGELISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNI 219
               G++F    P   +S  DD SI +W +++ K + T +N  H D V    +H   P I
Sbjct: 54  GPVRGIDFHPTQP-IFVSAGDDYSIKVWSLETNKCLYT-LNG-HLDYVRTVFFHRELPWI 110

Query: 220 YGSVSEDSFLMIHDKRSEKPLQKLLQKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKP 279
             S S+D  + I + ++ K L  L     F   A    + +L  +A  D  + ++D    
Sbjct: 111 I-SASDDQTIRIWNWQNRKELACLTGHNHFVMCAQFHPTEDLVVSASLDETIRVWD---- 165

Query: 280 TEALHSMSGHQEAVTSLEFAHHKDGILCSGGSDRRVLLWDLFQIGTEQQEEDADDGGPEL 339
                        +  L   H   G   S   D         Q+ ++Q   DA  G   +
Sbjct: 166 -------------IAGLRKRHSAPG--ASSFED---------QMASQQNLLDAGFGDCVV 201

Query: 340 LMMHAGHKSAINDFSFSPNVPWLMASVEEENIVQIWKPS 378
             +  GH   +N  SF P +P L+ S  ++  V++W+ S
Sbjct: 202 KFILEGHTRGVNWASFHPTLP-LIVSGGDDRQVKLWRMS 239

 Score = 38.9 bits (89), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 51/112 (45%), Gaps = 4/112 (3%)

Query: 175 LISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDK 234
           ++S  DD  + +W + S K         H++ V+   +H    N+  SV ED  L + D 
Sbjct: 224 IVSGGDDRQVKLWRMSSTKAWEVDTCRGHTNNVDSVIFHPHQ-NLIISVGEDKTLRVWDL 282

Query: 235 RSEKPLQKLLQK-EPFNTIAFSKHSSNLFAAA-GTDAMVYLFDSRKPTEALH 284
               P+++  ++ + F  IA   H  NLF AA  +  MV+  D  +P    H
Sbjct: 283 DKRTPVKQFKRENDRFWLIAAHPH-INLFGAAHDSGIMVFKLDRERPCSVTH 333

 Score = 30.4 bits (67), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 55/234 (23%), Positives = 92/234 (39%), Gaps = 46/234 (19%)

Query: 175 LISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHD- 233
           +IS SDD +I IW+ ++ K +       H+  V   ++H ++ ++  S S D  + + D 
Sbjct: 110 IISASDDQTIRIWNWQNRKELACLTG--HNHFVMCAQFHPTE-DLVVSASLDETIRVWDI 166

Query: 234 ----KRSEKP-----------LQKLLQKEPFNTIA---FSKHSSN-----------LFAA 264
               KR   P            Q LL     + +       H+             L  +
Sbjct: 167 AGLRKRHSAPGASSFEDQMASQQNLLDAGFGDCVVKFILEGHTRGVNWASFHPTLPLIVS 226

Query: 265 AGTDAMVYLF--DSRKPTEALHSMSGHQEAVTSLEFAHHKDGILCSGGSDRRVLLWDLFQ 322
            G D  V L+   S K  E + +  GH   V S+ F  H++ ++ S G D+ + +WDL +
Sbjct: 227 GGDDRQVKLWRMSSTKAWE-VDTCRGHTNNVDSVIFHPHQN-LIISVGEDKTLRVWDLDK 284

Query: 323 IGTEQQEEDADD------GGPELLMMHAGHKSAINDFSFSPNVPWLMASVEEEN 370
               +Q +  +D        P + +  A H S I  F      P    SV  +N
Sbjct: 285 RTPVKQFKRENDRFWLIAAHPHINLFGAAHDSGIMVFKLDRERP---CSVTHQN 335

>KNAG0G00800 Chr7 (147792..150164) [2373 bp, 790 aa] {ON} Anc_5.139
           YGR200C
          Length = 790

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 59/235 (25%), Positives = 101/235 (42%), Gaps = 26/235 (11%)

Query: 127 NLIATISGTGTVFLYDRTKDDENALRGKYAYHKENGYGLNFSVASPGELISCSDDGSIAI 186
           NL+A  +G  T+ L++ T +    +      H+ +   + F +     L+S S+D  + I
Sbjct: 27  NLVAFGAGK-TIALWNPTDEKCKGVLATLKGHEADVTCVTF-IKGTDYLVSASEDFHVKI 84

Query: 187 WDIKSGKTVPTSVNSL-HSDIVNECKWHESDPNIYGSVSEDSFLMIHDKRSEKPLQKLLQ 245
           W   + K V   V ++ H +  N      + P +      D  + +   +S+   + +L 
Sbjct: 85  WKYTNDKEVLKCVQTIEHYN--NTIVTLTALPGVIAVGCADGLMSLWVCQSDDSGKFVLG 142

Query: 246 KEPF---NTIAFSKHSSN------LFAAAGTDAMVYLF------DSRK--PTEALHSMSG 288
            E     N +  S   SN      L A  GT   +++F      +SR     E   ++ G
Sbjct: 143 HECHVARNVLPLSLSLSNVKNDKYLLAVGGTSVNIFIFSFTFNKESRMIDDCELSATLEG 202

Query: 289 HQEAVTSLEFAHHK---DGILCSGGSDRRVLLWDLFQIGTEQQEEDADDGGPELL 340
           H++ V SL F H +   D +LCSG  DR + LW + +I    + E+ DD    LL
Sbjct: 203 HEDWVKSLAFRHQETPGDYLLCSGSQDRYIRLWRI-RIDDLIEGEEEDDNKLTLL 256

>ZYRO0F10406g Chr6 (843429..846245) [2817 bp, 938 aa] {ON} similar
           to uniprot|Q12220 Saccharomyces cerevisiae YLR129W DIP2
           Nucleolar protein specifically associated with the U3
           snoRNA part of the large ribonucleoprotein complex known
           as the small subunit (SSU) processome required for 18S
           rRNA biogenesis part of the active pre- rRNA processing
           complex
          Length = 938

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 53/207 (25%), Positives = 90/207 (43%), Gaps = 58/207 (28%)

Query: 172 PGELISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMI 231
           PG++I+ + + ++ IWDIK+G+ V                 H SD    G++        
Sbjct: 36  PGQIITGALE-NVNIWDIKTGELVS----------------HLSDGLPPGAI-------- 70

Query: 232 HDKRSEKPLQKLLQKEPFNTIAFSKHSSN--LFAAAGTDAMVYLFDSRKPTEALHSMSGH 289
            D R+ KP +          + + ++ S+  L A    D ++ ++D    T  L S +GH
Sbjct: 71  -DARTTKPAE----------VTYMQYYSDTSLLAVGYADGVIKIWDMFSKT-VLLSFNGH 118

Query: 290 QEAVTSLEFAHHKDGILCSGGSDRRVLLWDLF-QIGTEQQEEDADDGGPELLMMHAGHKS 348
           + AVT L F       L SG  D  +++WDL  ++G               L     HK 
Sbjct: 119 RSAVTQLLF-DSTGTRLISGSRDSNIIVWDLVSEVG---------------LYKLRSHKD 162

Query: 349 AINDFSFSPNVPWLMASVEEENIVQIW 375
           +I   S  P+  WLM SV ++ ++++W
Sbjct: 163 SITGLSL-PDENWLM-SVSKDGLIKLW 187

>TPHA0D04500 Chr4 (978756..982382) [3627 bp, 1208 aa] {ON} Anc_7.322
           YDL145C
          Length = 1208

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 66/279 (23%), Positives = 113/279 (40%), Gaps = 40/279 (14%)

Query: 104 IKIIKKFKHENEVTRARYAPFDSN----LIATISGTGTVFLYDRTKDDENALRGKYAYHK 159
           +K++ KF  E++ TRA+   F  +    L+A  S T  ++ Y         L  ++  H 
Sbjct: 1   MKLLTKF--ESKSTRAKGIAFHPSRPWVLVALFSSTIQLWDYRM-----GTLLHRFEDHD 53

Query: 160 ENGYGLNFSVASPGELISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNI 219
               G++F    P   +S  DD +I +W +++ K + T     H D V    +H   P I
Sbjct: 54  GPVRGIDFHPTQP-LFVSAGDDYTIKVWSLETNKCLYTLEG--HLDYVRTVFFHRELPWI 110

Query: 220 YGSVSEDSFLMIHDKRSEKPLQKLLQKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKP 279
             S S+D  + I + ++ K +  +     F   A    + +L  +A  D  V ++D  K 
Sbjct: 111 I-SASDDQTIRIWNWQNRKEIACITGHNHFVMCAQFHPTEDLIVSASLDETVRVWDISKL 169

Query: 280 TEALHSMSGHQEAVTSLEFAHHKDGILCSGGSDRRVLLWDLFQIGTEQQEEDADDGGPEL 339
            E  HS  G     ++ E                        +I  +Q   D   G   +
Sbjct: 170 REK-HSAPGGANIPSTFEE-----------------------KIAAQQNLLDGGFGDCTV 205

Query: 340 LMMHAGHKSAINDFSFSPNVPWLMASVEEENIVQIWKPS 378
             +  GH   +N  SF P +P L+ S  ++  V++WK S
Sbjct: 206 KFILEGHTRGVNWASFHPTLP-LIVSGGDDRQVKLWKMS 243

 Score = 34.3 bits (77), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 25/107 (23%), Positives = 49/107 (45%), Gaps = 2/107 (1%)

Query: 175 LISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDK 234
           ++S  DD  + +W + + K         H++ V+   +H +  N+  SV ED  L I D 
Sbjct: 228 IVSGGDDRQVKLWKMSATKAWELDSCRGHTNNVDSVIFHPTQ-NLIISVGEDKTLRIWDL 286

Query: 235 RSEKPLQKLLQKEPFNTIAFSKHSSNLFAAA-GTDAMVYLFDSRKPT 280
               P+++  ++     +  +  + NLF AA  +  M++  D  +P 
Sbjct: 287 DKRVPVKQFKRENDRFWLIAAHPNINLFGAAHDSGIMIFKLDRERPA 333

 Score = 31.6 bits (70), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 43/107 (40%), Gaps = 8/107 (7%)

Query: 261 LFAAAGTDAMVYLFD-SRKPTEALHSMSGHQEAVTSLEFAHHKDGILCSGGSDRRVLLWD 319
           L  + G D  V L+  S      L S  GH   V S+ F H    ++ S G D+ + +WD
Sbjct: 227 LIVSGGDDRQVKLWKMSATKAWELDSCRGHTNNVDSVIF-HPTQNLIISVGEDKTLRIWD 285

Query: 320 LFQIGTEQQEEDADD------GGPELLMMHAGHKSAINDFSFSPNVP 360
           L +    +Q +  +D        P + +  A H S I  F      P
Sbjct: 286 LDKRVPVKQFKRENDRFWLIAAHPNINLFGAAHDSGIMIFKLDRERP 332

>Ecym_2139 Chr2 complement(262217..263524) [1308 bp, 435 aa] {ON}
           similar to Ashbya gossypii AFL157C
          Length = 435

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 52/215 (24%), Positives = 90/215 (41%), Gaps = 21/215 (9%)

Query: 116 VTRARYAPFDSNLIATISGTGTVFLYDRTKDDENALRGKYAYHKENGYGLNFSVASPGEL 175
           VT   +   D+N+I + S   T  ++D      N ++ +   H    +   F   S    
Sbjct: 169 VTSFDWNSIDTNIILSSSIDTTCTVWDLQA--SNYVKTQLIAHDSEVFDAKFLTQSSNLF 226

Query: 176 ISCSDDGSIAIWDIK--SGKTV---PTSVNSLH--SDIVNECKWHE-SDPNIYGSVSEDS 227
            SC  DGS+ ++D++  +  T+   P S    H  S I    + H+          + ++
Sbjct: 227 ASCGGDGSVRVFDLRCLAHSTIIYEPQSQIQTHTPSQIQLSAQGHDDGHARKNNQNAAET 286

Query: 228 FLMIHDKRSEKPLQKLLQKEPFNTIAFSKHSSNLFAAAGTDA-MVYLFDSRKPTEALHSM 286
            L +    S    Q LL+ EP      S    N+ A    D+ +V + D R P   + ++
Sbjct: 287 SLAVSSLES----QALLRLEP------SPFDPNILATIQQDSNVVIILDMRYPGSPILTL 336

Query: 287 SGHQEAVTSLEFAHHKDGILCSGGSDRRVLLWDLF 321
           +GH  A+  L +   K  +L + G D ++L WDL 
Sbjct: 337 NGHYCALNQLRWHPSKPNVLATCGDDCQILYWDLL 371

 Score = 38.9 bits (89), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 60/252 (23%), Positives = 97/252 (38%), Gaps = 55/252 (21%)

Query: 174 ELISCSDDGSIAIWD-------------IKSGKTVPTSVNSLHS----DIVNECKWHESD 216
           +L +CSD  S+ IW              +K GK V    N  H+      V    W+  D
Sbjct: 122 KLATCSD--SLRIWSLGDQLKEQVNLSLVKYGKGVGDVANG-HTLGKLPPVTSFDWNSID 178

Query: 217 PNIYGSVSEDSFLMIHDKRSEKPLQKLL---QKEPFNTIAFSKHSSNLFAAAGTDAMVYL 273
            NI  S S D+   + D ++   ++  L     E F+   F   SSNLFA+ G D  V +
Sbjct: 179 TNIILSSSIDTTCTVWDLQASNYVKTQLIAHDSEVFDA-KFLTQSSNLFASCGGDGSVRV 237

Query: 274 FDSR------------------KPTEALHSMSGHQEAVTSLEFAHHKDGILCSGGSDRRV 315
           FD R                   P++   S  GH +        +  +  L     + + 
Sbjct: 238 FDLRCLAHSTIIYEPQSQIQTHTPSQIQLSAQGHDDGHARKNNQNAAETSLAVSSLESQA 297

Query: 316 LL------WDLFQIGTEQQEE------DADDGGPELLMMHAGHKSAINDFSFSPNVPWLM 363
           LL      +D   + T QQ+       D    G  +L ++ GH  A+N   + P+ P ++
Sbjct: 298 LLRLEPSPFDPNILATIQQDSNVVIILDMRYPGSPILTLN-GHYCALNQLRWHPSKPNVL 356

Query: 364 ASVEEENIVQIW 375
           A+  ++  +  W
Sbjct: 357 ATCGDDCQILYW 368

>SAKL0E03960g Chr5 complement(319708..320130,320346..320885) [963
           bp, 320 aa] {ON} highly similar to with YMR116C
           uniprot|P38011 Saccharomyces cerevisiae YMR116C ASC1 WD
           repeat protein (G- beta like protein) involved in
           translation regulation required for repression of Gcn4p
           activity in the absence of amino-acid starvation core
           component of the ribosome ortholog of mammalian RACK1
          Length = 320

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 56/241 (23%), Positives = 106/241 (43%), Gaps = 32/241 (13%)

Query: 151 LRGKYAYHKENGYGLNFSVASPGELISCSDDGSIAIWDIKSGKT---VPTSVNSLHSDIV 207
           LRG    H      L  S A P  L+S S D ++  W +        VP      HS I+
Sbjct: 10  LRGTLEGHNGWVTSLATSPAQPNLLLSASRDKTLITWKLTGDDQQYGVPVRSFKGHSHII 69

Query: 208 NECKWHESDPNIYGSVSEDSFLMIHDKRSEKPLQKLL-QKEPFNTIAFSKHSSNLFAAAG 266
            +C    +D     S S D  + + +  + K +++ +  K    ++A  + ++ + +A+ 
Sbjct: 70  QDCT-VTADGEYALSASWDKTIRLWELATGKCVKRFVGHKSDVLSVAIDRRATQIVSAS- 127

Query: 267 TDAMVYLFDSRKPTEALHSMSGHQEAVTSLEFAHHKD-----GILCSGGSDRRVLLWDL- 320
            D  V ++++    E + ++ GH + V+ +  A ++D       + S G D+ V +W+L 
Sbjct: 128 RDKTVKVWNTLG--ECMVTLLGHNDWVSQVRVAPNEDPEDKTVTVISAGMDKVVKVWNLH 185

Query: 321 -FQIGTEQQEEDADDGGPELLMMHAGHKSAINDFSFSPNVPWLMASVEEENIVQIWKPSR 379
            FQI       +AD           GH + +N  + SP+   L+AS  ++  + +W  + 
Sbjct: 186 SFQI-------EAD---------FIGHNNYVNTVTASPDGS-LVASAGKDGQIMLWNLTE 228

Query: 380 K 380
           K
Sbjct: 229 K 229

 Score = 37.7 bits (86), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 58/266 (21%), Positives = 111/266 (41%), Gaps = 38/266 (14%)

Query: 112 HENEVTRARYAPFDSNLIATISGTGTVFLYDRTKDDENALRGKYAYHKENGYGLNFSVAS 171
           H   VT    +P   NL+ + S   T+  +  T DD+       ++   +    + +V +
Sbjct: 17  HNGWVTSLATSPAQPNLLLSASRDKTLITWKLTGDDQQYGVPVRSFKGHSHIIQDCTVTA 76

Query: 172 PGEL-ISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLM 230
            GE  +S S D +I +W++ +GK V   V    SD+++      +   +  S S D  + 
Sbjct: 77  DGEYALSASWDKTIRLWELATGKCVKRFVGH-KSDVLSVAIDRRATQIV--SASRDKTVK 133

Query: 231 IHDKRSEKPLQKLLQKEPFNTIAFSKH-----SSNLFAAAGTDAMVYLFDSRKPTEALHS 285
           + +   E  +  L   +  + +  + +      +    +AG D +V +++       LHS
Sbjct: 134 VWNTLGECMVTLLGHNDWVSQVRVAPNEDPEDKTVTVISAGMDKVVKVWN-------LHS 186

Query: 286 MS------GHQEAVTSLEFAHHKDGILCSGGSDRRVLLWDLFQIGTEQQEEDADDGGPEL 339
                   GH   V ++  A     ++ S G D +++LW+L    TE+           L
Sbjct: 187 FQIEADFIGHNNYVNTVT-ASPDGSLVASAGKDGQIMLWNL----TEK---------TAL 232

Query: 340 LMMHAGHKSAINDFSFSPNVPWLMAS 365
             ++A  +  +   +FSPN  WL A+
Sbjct: 233 YTLNA--QDEVFALAFSPNRYWLTAA 256

>Kpol_1031.36 s1031 complement(87105..89225) [2121 bp, 706 aa] {ON}
           complement(87105..89225) [2121 nt, 707 aa]
          Length = 706

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 46/152 (30%), Positives = 64/152 (42%), Gaps = 42/152 (27%)

Query: 175 LISCSDDGSIAIWDIKSGKTVPT-----SVNSLHSDIVNECKWHESDPNIYGSVSEDSFL 229
           L+S S D +I  WD+ +GK + T      V    +DIVN        P+ Y S       
Sbjct: 510 LVSASQDKTIRQWDLVNGKCIQTIDLSSVVKQNQTDIVNI-------PDFYSS------- 555

Query: 230 MIHDKRSEKPLQKLLQKEPFNTIAFSKHSSNLFAAAGT-DAMVYLFDSRKPTEALHSMSG 288
                            EPF T +     + L  A GT D +V L+D R   + + +  G
Sbjct: 556 ----------------SEPFVTGSLQCFDAAL--ATGTRDGLVRLWDMRSG-KVVRTFMG 596

Query: 289 HQEAVTSLEFAHHKDGILCSGGSDRRVLLWDL 320
           H  AVTSL+F  +    L SG  D+ +  WDL
Sbjct: 597 HTNAVTSLKFDSYN---LISGSLDKSIRTWDL 625

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 41/145 (28%), Positives = 66/145 (45%), Gaps = 12/145 (8%)

Query: 175 LISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDK 234
           L + + DG + +WD++SGK V T +   H++ V   K+ +S   I GS+  D  +   D 
Sbjct: 571 LATGTRDGLVRLWDMRSGKVVRTFMG--HTNAVTSLKF-DSYNLISGSL--DKSIRTWDL 625

Query: 235 RSEKPLQKLLQKEPFNTIAFSKHSSNLFAAAG-TDAMVYLFDSRKPTEALHSMSGHQEAV 293
           R+           P  +I F   SSNL +A G T   VY     K  E ++S     E  
Sbjct: 626 RTGSLSDLFAYDSPVYSIDFD--SSNLVSAIGETSFKVYNRKDDKQWECVNSA----EDT 679

Query: 294 TSLEFAHHKDGILCSGGSDRRVLLW 318
           +S+    +K+    +G +D  +  W
Sbjct: 680 SSIYHVKYKNNYAVTGSNDGTIKAW 704

>CAGL0J03476g Chr10 (334536..336089) [1554 bp, 517 aa] {ON} highly
           similar to uniprot|P25382 Saccharomyces cerevisiae
           YCR072c
          Length = 517

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 42/168 (25%), Positives = 77/168 (45%), Gaps = 18/168 (10%)

Query: 167 FSVASPGELISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSED 226
           F+  +   +++   D +  IWD  + +T   ++N  H + V    W  +D  +  + S D
Sbjct: 153 FAPHTSSRVVTGGGDNTARIWDCDT-QTPKVTLNG-HRNWVLCVSW-SADGEVIATGSMD 209

Query: 227 SFLMIHDKRSEKPLQKLLQK----------EPFNTIAFSKHSSNLFAAAGTDAMVYLFDS 276
           + + + D  S KPL   L+           EP + +     S    A+A  D  + ++DS
Sbjct: 210 NTIRLWDAESGKPLGDALRGHSKWITSLTWEPIHLV--EPGSKPRLASASKDGTIRIWDS 267

Query: 277 RKPTEALHSMSGHQEAVTSLEFAHHKDGILCSGGSDRRVLLWDLFQIG 324
            +    L ++ GH  +V+ +++    +GIL SG  D+ V  WD+ Q G
Sbjct: 268 SRRV-CLMTLGGHTNSVSCVKWG--GEGILYSGSHDKTVRAWDMKQNG 312

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 53/214 (24%), Positives = 92/214 (42%), Gaps = 28/214 (13%)

Query: 173 GELISCSDDGSIAIWDIK-SGKTVPTSVNSLHSDIVNECKWHESDPNIYG-SVSEDSFLM 230
           G L S S D ++  WD+K +GK +  ++   H+  VN    H S    Y   V    +  
Sbjct: 292 GILYSGSHDKTVRAWDMKQNGKCI--NILKSHAHWVN----HLSLSTDYALRVGAFDYTG 345

Query: 231 IHDKRSEKPLQKLLQKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQ 290
           +    +++   K LQ          KH   L   A  D  ++L++  K T+ +  M+GHQ
Sbjct: 346 VKPANAKEARDKALQNYEKVARKNGKHE-ELMVTASDDFTMFLWNPLKGTKPISRMTGHQ 404

Query: 291 EAVTSLEFAHHKDG-ILCSGGSDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGHKSA 349
           + V  + F+   DG  + S   D  + LWD    G E             L    GH ++
Sbjct: 405 KLVNHVAFS--PDGKYIVSASFDNSIKLWD----GKEGT----------FLSTFRGHVAS 448

Query: 350 INDFSFSPNVPWLMASVEEENIVQIWK-PSRKLT 382
           +   ++S +   L+ S  ++  +++W   +RKL+
Sbjct: 449 VYQVAWSSDCR-LLVSCSKDTTLKVWDVKTRKLS 481

 Score = 33.5 bits (75), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 35/146 (23%), Positives = 68/146 (46%), Gaps = 8/146 (5%)

Query: 175 LISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDK 234
           +++ SDD ++ +W+   G T P S  + H  +VN   +   D     S S D+ + + D 
Sbjct: 376 MVTASDDFTMFLWNPLKG-TKPISRMTGHQKLVNHVAF-SPDGKYIVSASFDNSIKLWDG 433

Query: 235 RSEKPLQKLL-QKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEAV 293
           +    L            +A+S     L  +   D  + ++D +    ++  + GHQ+ V
Sbjct: 434 KEGTFLSTFRGHVASVYQVAWSS-DCRLLVSCSKDTTLKVWDVKTRKLSV-DLPGHQDEV 491

Query: 294 TSLEFAHHKDGI-LCSGGSDRRVLLW 318
            +++++   DG  +CSGG D+ + LW
Sbjct: 492 YTVDWS--VDGKRVCSGGKDKMMRLW 515

 Score = 31.2 bits (69), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 57/129 (44%), Gaps = 11/129 (8%)

Query: 67  QNYLKIAEINLPQEILSNEGPVLQNDNNGSDEQVPSK-IKIIKKFK-HENEVTRARYAPF 124
           QNY K+A  N   E L     V  +D+       P K  K I +   H+  V    ++P 
Sbjct: 360 QNYEKVARKNGKHEELM----VTASDDFTMFLWNPLKGTKPISRMTGHQKLVNHVAFSP- 414

Query: 125 DSNLIATISGTGTVFLYDRTKDDENALRGKYAYHKENGYGLNFSVASPGELISCSDDGSI 184
           D   I + S   ++ L+D     E      +  H  + Y + +S +    L+SCS D ++
Sbjct: 415 DGKYIVSASFDNSIKLWD---GKEGTFLSTFRGHVASVYQVAWS-SDCRLLVSCSKDTTL 470

Query: 185 AIWDIKSGK 193
            +WD+K+ K
Sbjct: 471 KVWDVKTRK 479

>KNAG0A01250 Chr1 (23559..24917) [1359 bp, 452 aa] {ON} Anc_3.25
           YNL317W
          Length = 452

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 52/235 (22%), Positives = 92/235 (39%), Gaps = 22/235 (9%)

Query: 158 HKENGYGLNFSVASPGELISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDP 217
           H E    + FS A+  + +SCSDD  + IW+  +G+     V + H   V  C WH +  
Sbjct: 165 HTECIRDVAFS-ANDSKFVSCSDDNILKIWNFTNGQQ--ERVLTGHHWDVKSCDWHPT-M 220

Query: 218 NIYGSVSEDSFLMIHDKRSEKPLQKLLQ-KEPFNTIAFSKHSSNLFAAAGTDAMVYLFDS 276
            +  S S+D+ + + D R+   +  +L+ K       F     NL      D    +FD 
Sbjct: 221 GLIASASKDNLVKLWDPRTGNCVSTILKFKHTVLKTRFQPGGGNLLLGISKDKSCRVFDI 280

Query: 277 RKPTEALHSMSGHQEAVTSLEFAHHKDGILCSGGSDRRVLLWDLFQIGTEQQEEDADDGG 336
           R+    L       + +T L +          G  D  +  +D+ Q           D  
Sbjct: 281 RQNMTELMVFRDDVDYMT-LLWHPINHSTFTVGNYDGSIKHFDVLQ-----------DIT 328

Query: 337 PELLMMHAGHKSAINDFSFSPNVPWLMASVEEENIVQIWKPSRKLTNPYFPQGYD 391
             + ++   H   +   S++P    ++AS  ++  ++ W  +R    P  P  YD
Sbjct: 329 KPVHVIPFAHDKCVTSLSYNP-AGNILASASKDRTIRFWTRAR----PVDPNAYD 378

>Suva_16.510 Chr16 (874866..876263) [1398 bp, 465 aa] {ON} YPR178W
           (REAL)
          Length = 465

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 57/215 (26%), Positives = 92/215 (42%), Gaps = 20/215 (9%)

Query: 112 HENEVTRARYAPFDSNLIATISGTGTVFLYDRTKDDENALRGKYAYHKENGYGLNFSVAS 171
           HE  V+  +Y P     I + S   T  L+D +   E  L+     H +  + L+F    
Sbjct: 264 HERRVSDLKYHP-SGKFIGSASHDMTWRLWDASTYQELLLQ---EGHAKGVFCLSFQC-- 317

Query: 172 PGELISCSDDGSIA-IWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIY--GSVSEDSF 228
            G L+      S+A IWDI+SG  V +     HS  V    W    PN Y   +   D  
Sbjct: 318 DGSLVCSGGMDSLAMIWDIRSGNKVMSLTG--HSKPVYTVDW---SPNGYQVATGGGDGL 372

Query: 229 LMIHDKRSE---KPLQKLLQKEPFNTIAFSK-HSSNLFAAAGTDAMVYLFDSRKPTEALH 284
           + + D R     +  Q L  +     + FSK  +     + G D ++ ++ S    + + 
Sbjct: 373 INVWDIRQRDGGQVHQILAHRNIVTKVQFSKDDNGKKLISCGYDNLINVYSSDNWLK-VA 431

Query: 285 SMSGHQEAVTSLEFAHHKDGILCSGGSDRRVLLWD 319
           S+ GH + + SL+ ++     L SGG DR V +W+
Sbjct: 432 SLEGHTDKIISLDISNDSK-YLVSGGWDRSVKIWN 465

 Score = 38.9 bits (89), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 43/199 (21%), Positives = 83/199 (41%), Gaps = 24/199 (12%)

Query: 182 GSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSED----SFLMIHDKRSE 237
           G I I + ++ +++   ++S H   +   +WH    N   S +ED    +F  ++++   
Sbjct: 197 GDIRILNSQTLQSLAQKLDS-HVGKIGAVQWHPESNNQIISCAEDGLIKNFQYLNEEGDL 255

Query: 238 KPLQKLLQKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEAVTSLE 297
           + L  L+  E         H S  F  + +  M +        + L    GH + V  L 
Sbjct: 256 RLLGSLVGHER-RVSDLKYHPSGKFIGSASHDMTWRLWDASTYQELLLQEGHAKGVFCLS 314

Query: 298 FAHHKDG-ILCSGGSDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGHKSAINDFSFS 356
           F    DG ++CSGG D   ++WD+ + G +             +M   GH   +    +S
Sbjct: 315 F--QCDGSLVCSGGMDSLAMIWDI-RSGNK-------------VMSLTGHSKPVYTVDWS 358

Query: 357 PNVPWLMASVEEENIVQIW 375
           PN  + +A+   + ++ +W
Sbjct: 359 PN-GYQVATGGGDGLINVW 376

>Suva_3.121 Chr3 complement(177765..179864) [2100 bp, 700 aa] {ON}
           YCR084C (REAL)
          Length = 700

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 54/218 (24%), Positives = 97/218 (44%), Gaps = 15/218 (6%)

Query: 175 LISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDK 234
           L + ++D  I IWDI++ K V   +     DI +   +   D  + G  S D  + I D 
Sbjct: 462 LATGAEDRLIRIWDIENRKIVMI-LQGHEQDIYSLDYFPSGDKLVSG--SGDRTVRIWDL 518

Query: 235 RSEKPLQKLLQKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKP--TEAL----HSMSG 288
           R+ +    L  ++   T+A S       AA   D  V ++DS      E L     S +G
Sbjct: 519 RTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDSENESGTG 578

Query: 289 HQEAVTSLEFAHHKDGILCSGGSDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGHKS 348
           H+++V S+ F    + ++ SG  DR V LW+L     +   +  + G  E  + + GHK 
Sbjct: 579 HKDSVYSVVFTRDGESVV-SGSLDRSVKLWNLQNANNKSDSKTPNSGTCE--VTYIGHKD 635

Query: 349 AINDFSFSPNVPWLMASVEEENIVQIWKPSRKLTNPYF 386
            +   + + N  ++++  ++  ++  W   +K  NP  
Sbjct: 636 FVLSVATTQNDEYILSGSKDRGVL-FW--DKKSGNPLL 670

>Kwal_56.24478 s56 complement(1010876..1014766) [3891 bp, 1296 aa]
           {ON} YDL195W (SEC31) - Component (p150) of COPII coat of
           secretory pathway vesicles [contig 161] FULL
          Length = 1296

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 43/184 (23%), Positives = 78/184 (42%), Gaps = 18/184 (9%)

Query: 153 GKYAYHKENGYGLNFSVASPGELISCSDDGSIAIWDIKSGKT------VPTSVNSLHSDI 206
            K A H      + F+      L S    G I IWD    +T      VP +  +   +I
Sbjct: 98  AKLAQHSTPVKTVRFNAKQHNVLCSGGSKGEIYIWDANKIETPGYAPFVPGTAMTPMDEI 157

Query: 207 VNECKWHESDPNIYGSVSEDSFLMIHDKRSEKPLQKLL-------QKEPFNTIAFSKHSS 259
            +   W+++  +++ S     F  I D +++K +  L        QK   + + +  ++S
Sbjct: 158 YS-LAWNQNQGHVFASAGSSGFASIWDLKAKKEVIHLSHTSSITGQKNQLSIVEWHPNNS 216

Query: 260 NLFAAAG---TDAMVYLFDSRKPTEALHSMS-GHQEAVTSLEFAHHKDGILCSGGSDRRV 315
              A A    +D  + ++D R     L ++S GH + V SL++    + +L S G D   
Sbjct: 217 TRIATASGSDSDPSILVWDLRNANVPLQTLSQGHTKGVLSLDWCKQDETLLLSSGRDNSC 276

Query: 316 LLWD 319
           +LW+
Sbjct: 277 VLWN 280

 Score = 36.6 bits (83), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 38/77 (49%), Gaps = 2/77 (2%)

Query: 249 FNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEAVTSLEFAHHKDGILCS 308
           FN + +S  +S L  A   D  V  F S    +++  ++ H   V ++ F   +  +LCS
Sbjct: 65  FNDLDWSYDNSVLTGA--LDNGVVEFFSPSEYKSIAKLAQHSTPVKTVRFNAKQHNVLCS 122

Query: 309 GGSDRRVLLWDLFQIGT 325
           GGS   + +WD  +I T
Sbjct: 123 GGSKGEIYIWDANKIET 139

>SAKL0F15972g Chr6 (1291625..1293037) [1413 bp, 470 aa] {ON} similar
           to uniprot|P20053 Saccharomyces cerevisiae YPR178W PRP4
           Splicing factor component of the U4/U6-U5 snRNP complex
          Length = 470

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 39/152 (25%), Positives = 78/152 (51%), Gaps = 7/152 (4%)

Query: 175 LISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHD- 233
           L++ + +G I IW++ +    P    + H + V   ++H S   +  S S D    + D 
Sbjct: 240 LVTGAANGEIRIWNLNNDSESPAGTLTGHENRVARVRFHPSGKYV-ASASFDMTWRLWDV 298

Query: 234 -KRSEKPLQKLLQKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEA 292
            K+ E  LQ+   KE +  +AF K  S L  + G D++  ++D R   +++ ++ GH + 
Sbjct: 299 EKQIELQLQEGHAKEVY-CVAFQKDGS-LLCSTGLDSVGLVWDLR-SGKSIMALEGHIKP 355

Query: 293 VTSLEFAHHKDGILCSGGSDRRVLLWDLFQIG 324
           +  L+++ +   I  +G +D  + LWD+ ++G
Sbjct: 356 IYGLDWSPNGYDI-ATGSADGTIRLWDVRKVG 386

>Kpol_1038.20 s1038 complement(43719..47660) [3942 bp, 1313 aa] {ON}
           complement(43719..47660) [3942 nt, 1314 aa]
          Length = 1313

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 45/199 (22%), Positives = 80/199 (40%), Gaps = 32/199 (16%)

Query: 126 SNLIATISGTGTVFLYDRTKDD--ENALRGKYAYHKENGYGLNFSVASPGELISCSDDGS 183
           +N IA  + +  + +YD  K+D  +N L   ++ H       +F++     LIS   DG 
Sbjct: 196 NNYIAVCNNSTIISIYDINKNDNIDNPLVTSFSEHSRAVNSFDFNMTQTSLLISGGQDGQ 255

Query: 184 IAIWDIK----SGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDKRSEKP 239
           I IWD++    SG   P    +  SD + + KW           +  SF   +D +    
Sbjct: 256 IKIWDLRSNSLSGSNKPDLNINAASDSIRDVKW-------MPGYNFSSFNQSYDGKQ--- 305

Query: 240 LQKLLQKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEAVTSLEFA 299
                          + +S   FA+     ++  FD R+P +    ++ H      L + 
Sbjct: 306 ---------------TGNSEYKFASIHDSGLLLKFDIRQPNQVEKKINAHTGPGLCLNWH 350

Query: 300 HHKDGILCSGGSDRRVLLW 318
            ++D I  +GG D +  +W
Sbjct: 351 PNQDYI-ATGGRDGKCCIW 368

 Score = 38.1 bits (87), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 42/90 (46%), Gaps = 10/90 (11%)

Query: 240 LQKLLQKEPFNTIA-----FSKHSSNLFAAAGTDAMVYLFDSRK----PTEALHSMSGHQ 290
           L K  ++   +TIA     F K++ N  A      ++ ++D  K        + S S H 
Sbjct: 173 LNKRRRQIKLSTIADVKSGFQKYN-NYIAVCNNSTIISIYDINKNDNIDNPLVTSFSEHS 231

Query: 291 EAVTSLEFAHHKDGILCSGGSDRRVLLWDL 320
            AV S +F   +  +L SGG D ++ +WDL
Sbjct: 232 RAVNSFDFNMTQTSLLISGGQDGQIKIWDL 261

>NCAS0C04430 Chr3 complement(905927..909862) [3936 bp, 1311 aa] {ON}
           Anc_3.22 YOL138C
          Length = 1311

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 93/411 (22%), Positives = 149/411 (36%), Gaps = 81/411 (19%)

Query: 11  SIDDEYDLWKSNVPLMYDFVSETRLLWPS-LTIQWLPRAE--------DSTEQELLVGTH 61
           S DD   + KS VP +      T  L  S LT  +L + E        D     L+    
Sbjct: 67  SKDDLNVMEKSKVPTIQGRKKHTTTLKSSGLTYNYLTKKELSSVSPINDPNSNALICAGK 126

Query: 62  TSDSEQNYLKI-AEINLPQEILSNEGPVLQNDNNGSDEQVPSKIKIIKKFKHENEVTRAR 120
           T      +  I  +I L Q+IL +    L++ N  +  +   KIK+       + +   +
Sbjct: 127 THLGYYKFSPIDKKITLVQDILESNLGSLRHGNGSNLIKRGKKIKL-------STIADVK 179

Query: 121 YAPFDSNLIATISGTGT---VFLYDRTKDDENALRGKYAYHKENGYGLNFSVASPGELIS 177
                SN    I  T T   +F   R  + EN L    + H  +    +F++     +IS
Sbjct: 180 TGFGSSNHYTAICTTSTDISIFDISRNINIENPLLTSLSEHTRSVNSFDFNMVQSNLIIS 239

Query: 178 CSDDGSIAIWDIKSGKTVPTSVNSLH----SDIVNECKWHESDPNIYGSVSEDSFLMIHD 233
              DG + IWD++S     +S   +     SD + + KW    PN               
Sbjct: 240 GGQDGCVKIWDLRSNSIKGSSRCDISFNTGSDSIRDVKWM---PNY-------------- 282

Query: 234 KRSEKPLQKLLQKEPFNTIAFSKHSSN----LFAAAGTDAMVYLFDSRKPTEALHSMSGH 289
                          FNT     H +      FA+     ++  FD R+P +    ++ H
Sbjct: 283 --------------AFNTTQAVPHLTGSPGYKFASIHDSGLLLKFDMRQPGQFEKKINAH 328

Query: 290 QEAVTSLEFAHHKDGILCSGGSDRRVLLWDLFQIGTEQQEEDADDGGPEL-----LMMHA 344
                 L +  H++ I  +GG D +  LW    +G  QQ +        L     L ++ 
Sbjct: 329 TGPGLCLNWHPHENYI-ATGGRDGKCCLW---YVGDRQQLDSNSYTNSNLIPFPELTINT 384

Query: 345 GHKSAINDFSFSP-------NVPWLMASVEEENIVQIWKPSRKLTNPYFPQ 388
           G  S +    F P       N    ++S+ EE  V I+  +RK    Y P+
Sbjct: 385 G--SPVTKLKFRPAYDADVFNSLLALSSMGEEAEVCIYSLARK----YIPK 429

>YCR084C Chr3 complement(260311..262452) [2142 bp, 713 aa] {ON}
           TUP1General repressor of transcription, forms complex
           with Cyc8p, involved in the establishment of repressive
           chromatin structure through interactions with histones
           H3 and H4, appears to enhance expression of some genes
          Length = 713

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 54/218 (24%), Positives = 96/218 (44%), Gaps = 15/218 (6%)

Query: 175 LISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDK 234
           L + ++D  I IWDI++ K V   +     DI +   +   D  + G  S D  + I D 
Sbjct: 458 LATGAEDRLIRIWDIENRKIVMI-LQGHEQDIYSLDYFPSGDKLVSG--SGDRTVRIWDL 514

Query: 235 RSEKPLQKLLQKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKP--TEAL----HSMSG 288
           R+ +    L  ++   T+A S       AA   D  V ++DS      E L     S +G
Sbjct: 515 RTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDSENESGTG 574

Query: 289 HQEAVTSLEFAHHKDGILCSGGSDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGHKS 348
           H+++V S+ F      ++ SG  DR V LW+L     +   +  + G  E  + + GHK 
Sbjct: 575 HKDSVYSVVFTRDGQSVV-SGSLDRSVKLWNLQNANNKSDSKTPNSGTCE--VTYIGHKD 631

Query: 349 AINDFSFSPNVPWLMASVEEENIVQIWKPSRKLTNPYF 386
            +   + + N  ++++  ++  ++  W   +K  NP  
Sbjct: 632 FVLSVATTQNDEYILSGSKDRGVL-FW--DKKSGNPLL 666

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 53/243 (21%), Positives = 103/243 (42%), Gaps = 44/243 (18%)

Query: 158 HKENGYGLNFSVASPGELISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDP 217
           H+++ Y L++   S  +L+S S D ++ IWD+++G+    S+     D V        D 
Sbjct: 484 HEQDIYSLDY-FPSGDKLVSGSGDRTVRIWDLRTGQ---CSLTLSIEDGVTTVAVSPGDG 539

Query: 218 NIYGSVSEDSFLMIHDKRSEKPLQKL--------LQKEPFNTIAFSKHSSNLFAAAGTDA 269
               + S D  + + D  +   +++L          K+   ++ F++   ++ + +  D 
Sbjct: 540 KYIAAGSLDRAVRVWDSETGFLVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGS-LDR 598

Query: 270 MVYLF---------DSRKPTEALHSMS--GHQEAVTSLEFAHHKDGILCSGGSDRRVLLW 318
            V L+         DS+ P      ++  GH++ V S+    + + IL SG  DR VL W
Sbjct: 599 SVKLWNLQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYIL-SGSKDRGVLFW 657

Query: 319 DLFQIGTEQQEEDADDGGPELLMMHAGHKSAINDFSFSPNVPW-----LMASVEEENIVQ 373
                       D   G P  L+M  GH++++   + +   P      + A+   +   +
Sbjct: 658 ------------DKKSGNP--LLMLQGHRNSVISVAVANGSPLGPEYNVFATGSGDCKAR 703

Query: 374 IWK 376
           IWK
Sbjct: 704 IWK 706

>TBLA0A03890 Chr1 complement(973249..974337) [1089 bp, 362 aa] {ON}
           Anc_8.316 YDR142C
          Length = 362

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 47/205 (22%), Positives = 78/205 (38%), Gaps = 25/205 (12%)

Query: 129 IATISGTGTVFLYDRTKDDENALRGKYAYHKENGYGLNFSVASPGELISCSDDGSIAIWD 188
           +    G GT+ L+D T   +      Y  H    +  N+++ +    IS S DG + IWD
Sbjct: 76  VLVAQGDGTLTLFDLTNKLQQI--QIYKEHYSEVFSCNWNMLTRRTFISGSWDGKVKIWD 133

Query: 189 IKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDKRSEKPLQKLLQKEP 248
               ++V T  N       N    H       G   E   L  + K  +   Q L     
Sbjct: 134 CARSESVLTLRN-------NRSLGHT------GEHIETKALQRNSKNKDCIYQAL----- 175

Query: 249 FNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEAVTSLEFAHHKDGILCS 308
                FS H  N+      ++ +  FD R+P +    ++       S ++  ++  I+ S
Sbjct: 176 -----FSPHDPNMAMCCSGNSYLTFFDLRQPNQQNSILAHSGLETLSCDYNKYRSYIVAS 230

Query: 309 GGSDRRVLLWDLFQIGTEQQEEDAD 333
            G D+ + +WDL  I  +     AD
Sbjct: 231 AGVDKAIRIWDLRMIKNKPHNMFAD 255

>SAKL0F10648g Chr6 (827399..831010) [3612 bp, 1203 aa] {ON} highly
           similar to uniprot|P53622 Saccharomyces cerevisiae
           YDL145C COP1 Alpha subunit of COPI vesicle coatomer
           complex which surrounds transport vesicles in the early
           secretory pathway
          Length = 1203

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 74/304 (24%), Positives = 123/304 (40%), Gaps = 56/304 (18%)

Query: 104 IKIIKKFKHENEVTRARYAPFDSN----LIATISGTGTVFLYDRTKDDENALRGKYAYHK 159
           +K++ KF  E++ TRA+   F  +    L+A  S T  ++ Y         L  ++  H+
Sbjct: 1   MKMLTKF--ESKSTRAKGIAFHPSRPWVLVALFSSTIQLWDYRM-----GTLLHRFEDHE 53

Query: 160 ENGYGLNFSVASPGELISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNI 219
               G++F    P   +S  DD +I +W +++ K + T +N  H D V    +H   P I
Sbjct: 54  GPVRGIDFHPTQP-LFVSAGDDYTIKVWSLETKKCLFT-LNG-HLDYVRTVFFHHELPWI 110

Query: 220 YGSVSEDSFLMIHDKRSEKPLQKLLQKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDS--- 276
             S S+D  + I + ++ K +  L     F   A    S +L  +A  D  V ++D    
Sbjct: 111 I-SCSDDQTIRIWNWQNRKEIACLTGHNHFVMCAQFHPSEDLVVSASLDETVRVWDISGL 169

Query: 277 RKPTEALHSMS--------------GHQEAVTSLEFAHHKDGI-----------LCSGGS 311
           RK   A  + S              G  E V       H  G+           + SGG 
Sbjct: 170 RKKHSAPGASSFEEQMIAQQNLLDGGFGECVVKFILEGHTRGVNWASFHPTLPLIVSGGD 229

Query: 312 DRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGHKSAINDFSFSPNVPWLMASVEEENI 371
           DR+V +W +    T+  E D             GH + ++   F P+   L+ SV E+  
Sbjct: 230 DRQVKIWRM--SATKAWEVDT----------CRGHTNNVDSVIFHPHQN-LIISVGEDKT 276

Query: 372 VQIW 375
           ++ W
Sbjct: 277 IRTW 280

>Kwal_55.22076 s55 (1098857..1102717) [3861 bp, 1286 aa] {ON}
           YOL138C - Hypothetical ORF [contig 124] FULL
          Length = 1286

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 63/281 (22%), Positives = 116/281 (41%), Gaps = 56/281 (19%)

Query: 47  RAEDSTEQELLVGTHTSDSEQNYLKIAEINLPQEILSNEGPVLQNDNNGSDEQVPSKIKI 106
           +  DS+ + ++V      S +++L+I   +  +  L     +L  D  G   ++ +K   
Sbjct: 113 KINDSSSKSIVV------SGKSHLRIYSFSEDRRELECTVDLLSEDQKGPSSRISNKTST 166

Query: 107 IKKFKHENEVTRARYAPFDS--NLIATISGTGTVFLYDRTKDD--ENALRGKYAYHKENG 162
           I   K          A F++  N IA    + +V +YD  K +  E  L    + H  + 
Sbjct: 167 ISDVK----------AGFNNHKNYIAICGTSTSVSIYDINKANTLEGPLTTILSKHTRSI 216

Query: 163 YGLNFSVASPGELISCSDDGSIAIWDIKSGKTVPT----SVNSLHSDIVNECKWHESDPN 218
             ++F++A    LIS S DG I +WD++S +        ++NS  SD V + KW      
Sbjct: 217 NSVDFNMAQSSLLISGSQDGCIKVWDLRSSQGRKNKSDLTINS-GSDSVRDVKW------ 269

Query: 219 IYGSVSEDSFLMIHDKRSEKPLQKLLQKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRK 278
                     +  +D   E       ++ P N         + FA+     ++  +D R+
Sbjct: 270 ----------MPTYDFSPE-------EQGPSN-------RGHRFASIHDSGLLLTYDLRQ 305

Query: 279 PTEALHSMSGHQEAVTSLEFAHHKDGILCSGGSDRRVLLWD 319
           P++A   ++ H      L +    D I+ +GG D +  LW+
Sbjct: 306 PSQAEKRINAHSGPGLCLCWHPTADYIM-TGGRDGKCCLWN 345

>KLTH0A06754g Chr1 complement(560921..562465) [1545 bp, 514 aa] {ON}
           highly similar to uniprot|P25382 Saccharomyces
           cerevisiae YCR072C Protein required for cell viability
          Length = 514

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 77/308 (25%), Positives = 122/308 (39%), Gaps = 65/308 (21%)

Query: 112 HENEVTRARYAPFDSNLIATISGTGTVFLYDRTKDDE--NALRGKYAYHKENGYGLNFSV 169
           H N V    ++P D  LIAT S   T+ L+   K +   +ALRG   +     +     +
Sbjct: 184 HFNWVLCVAWSP-DGELIATGSMDNTIRLWQSEKGENFGDALRGHSKWITSLSWE-PIHL 241

Query: 170 ASPGE---LISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKW----------HES- 215
             PG+   L S S DG+I IWD  + + V     S H++ V+  KW          H+  
Sbjct: 242 VKPGDKPRLASASKDGTIKIWD--TARRVCLFTLSGHTNSVSCVKWGGRGVLYSGSHDKT 299

Query: 216 ----DPNIYG----------------SVSEDSFLMI--HDKRSEKPLQ----KLLQKEPF 249
               D N  G                S+S D  L +   D   +KP      +    E +
Sbjct: 300 IRAWDMNAGGKCINILKSHAHWINHLSLSTDYALRVGAFDHTGKKPSSPEEARAKALENY 359

Query: 250 NTIAFSKHS-SNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEAVTSLEFAHHKDG-ILC 307
             IA        L   A  D  +YL+D  K T+ +  M+GHQ+ V  + F+   DG  + 
Sbjct: 360 EKIAKKNGKLEELMVTASDDFTMYLWDPIKSTKPITRMTGHQKLVNHVAFS--PDGRYIV 417

Query: 308 SGGSDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGHKSAINDFSFSPNVPWLMASVE 367
           S   D  + LW            D  DG    +    GH +++   ++S +   L+ S  
Sbjct: 418 SASFDNSIKLW------------DGRDG--TFIATFRGHVASVYQVAWSSDCR-LLVSCS 462

Query: 368 EENIVQIW 375
           ++  +++W
Sbjct: 463 KDTTLKVW 470

 Score = 33.9 bits (76), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 36/147 (24%), Positives = 69/147 (46%), Gaps = 10/147 (6%)

Query: 175 LISCSDDGSIAIWD-IKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHD 233
           +++ SDD ++ +WD IKS K  P +  + H  +VN   +   D     S S D+ + + D
Sbjct: 373 MVTASDDFTMYLWDPIKSTK--PITRMTGHQKLVNHVAF-SPDGRYIVSASFDNSIKLWD 429

Query: 234 KRSEKPLQKLL-QKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEA 292
            R    +            +A+S     L  +   D  + ++D R    ++  + GH++ 
Sbjct: 430 GRDGTFIATFRGHVASVYQVAWSS-DCRLLVSCSKDTTLKVWDVRTKKLSV-DLPGHKDE 487

Query: 293 VTSLEFAHHKDGI-LCSGGSDRRVLLW 318
           V +++++   DG  +CS G D+ V +W
Sbjct: 488 VYTVDWS--VDGKRVCSAGKDKMVRIW 512

>ZYRO0A09636g Chr1 (779501..781927) [2427 bp, 808 aa] {ON} highly
           similar to uniprot|Q05946 Saccharomyces cerevisiae
           YLR222C UTP13 Nucleolar protein component of the small
           subunit (SSU) processome containing the U3 snoRNA that
           is involved in processing of pre-18S rRNA
          Length = 808

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 57/219 (26%), Positives = 88/219 (40%), Gaps = 30/219 (13%)

Query: 164 GLNFSVASPGELISCSDDGSI----------AIWDIKSGKTVPTSVNSLHSDIVNECKWH 213
            LN   A  G + + S DGSI           I  +   KT+ T  N    DI       
Sbjct: 11  ALNPIYAGSGAVATVSSDGSILATPVLDEINIIQLVPERKTLFTIENDDEQDIT--ALKL 68

Query: 214 ESDPNIYGSVSEDSFLMIHDKRSEKPLQKLLQKEPFNTIAFSKHSSNLFAAAGTDAMVYL 273
            +D       S+   L I D R  K ++ +    P + +  S  +S L A  GTD  + +
Sbjct: 69  TADGRYLCFASQAQLLKIFDLREGKIVRSMKISSP-SYVVDSDSTSTLLAIGGTDGSITV 127

Query: 274 FDSRKPTEALHSMSGHQEAVTSLEFAHHKDG---ILCSGGSDRRVLLWDLFQ---IGTEQ 327
            D        HS+ GH   ++S++F   ++G   +L SG ++  V +WDL +   I T Q
Sbjct: 128 VDVENGY-VTHSLKGHGGTISSVKFYGEQNGEVWLLASGDTNGMVKIWDLVKRKCIHTVQ 186

Query: 328 QEEDADDG----------GPELLMMHAGHKSAINDFSFS 356
           +   A  G            EL ++  G    IN + F+
Sbjct: 187 EHTAAVRGIDFHESKNNDESELFLISGGRDDVINYWQFN 225

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 34/70 (48%), Gaps = 4/70 (5%)

Query: 128 LIATISGTGTVFLYDRTKDDENALRGKYAYHKENGYGLNFSVASPGELISCSDDGSIAIW 187
           LIAT SG  T+ ++     D  A+   +  H       +F +    +L+S S DG + IW
Sbjct: 541 LIATCSGDKTIKIWSL---DTFAVVKTFEGHTNAVQRCSF-INKQTQLVSSSADGLVKIW 596

Query: 188 DIKSGKTVPT 197
           D  +G+ V T
Sbjct: 597 DCSTGECVKT 606

>KLLA0E19515g Chr5 complement(1733708..1735426) [1719 bp, 572 aa]
           {ON} similar to uniprot|P21304 Saccharomyces cerevisiae
           YLR196W PWP1
          Length = 572

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 47/195 (24%), Positives = 86/195 (44%), Gaps = 21/195 (10%)

Query: 175 LISCSDDGSIAIWDIKSGKTVPTSVNSLHSDI-VNECKWHESDPNIYGSVSEDSFLMIHD 233
           L S S D ++ +WD+ +  T   S+ ++HS+  V+  +WH S+ ++  +   DS   + D
Sbjct: 304 LASTSADHTVKLWDLNTA-TAARSLINIHSNTNVSASQWHPSNGSVLLTAGYDSRAALSD 362

Query: 234 KRSEK-----PLQKLLQKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEA--LHSM 286
            R E          +   E    + F+    N+F     +  VY FD R   E+  + ++
Sbjct: 363 VRIENDNDMSKYWNVSSGEEIECVRFADE--NIFICGTDNGNVYSFDIRNGAESKPVWTL 420

Query: 287 SGHQEAVTSLEFAHH-KDGILCSGGSDRRVLLWDLFQIGTEQQEEDADDG-GPELLMMHA 344
             H   V+S+E   H  + +L S   ++ V LW        +   DA  G GP +++   
Sbjct: 421 KAHDAGVSSVEINRHIPNMLLTSAMGEKPVKLW--------KCPLDAKPGKGPSMVLSRD 472

Query: 345 GHKSAINDFSFSPNV 359
                +   SF+P++
Sbjct: 473 FGVGNVLTTSFAPDI 487

>Suva_6.187 Chr6 complement(344709..346853) [2145 bp, 714 aa] {ON}
           YJL112W (REAL)
          Length = 714

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 45/150 (30%), Positives = 69/150 (46%), Gaps = 35/150 (23%)

Query: 175 LISCSDDGSIAIWDIKSGKT---VPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMI 231
           L+S S D +I  WD++SGK    +  S  ++ S   N              +S+ + L  
Sbjct: 515 LVSGSQDRTIRQWDLRSGKCMQAIDLSFANVSSTATNV------------DLSKSTLLT- 561

Query: 232 HDKRSEKPLQKLLQKEPFNTIAFSKHSSNLFAAAGT-DAMVYLFDSRKPTEALHSMSGHQ 290
             +RSE+P    LQ            S +   A GT D +V L+D R   + + ++ GH 
Sbjct: 562 --QRSERPSIGALQ------------SFDAALATGTKDGVVRLWDLRSG-KVIRTLEGHT 606

Query: 291 EAVTSLEFAHHKDGILCSGGSDRRVLLWDL 320
           +A+TSL+F       L +G  DR V +WDL
Sbjct: 607 DAITSLKF---DSACLVTGSYDRTVRVWDL 633

 Score = 35.0 bits (79), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 37/149 (24%), Positives = 67/149 (44%), Gaps = 20/149 (13%)

Query: 175 LISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDK 234
           L + + DG + +WD++SGK + T     H+D +   K+   D     + S D  + + D 
Sbjct: 579 LATGTKDGVVRLWDLRSGKVIRTLEG--HTDAITSLKF---DSACLVTGSYDRTVRVWDL 633

Query: 235 RSEKPLQKLLQK-----EPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGH 289
           R+      LL K      P  ++ FS+ ++ +  A  T   VY  DS K         G+
Sbjct: 634 RT-----GLLNKFHAYSAPVLSLDFSQDNAAVVVADETSVQVY--DSNKDESWPCVEEGN 686

Query: 290 QEAVTSLEFAHHKDGILCSGGSDRRVLLW 318
           +  VT++++   K+  +  G  +  V +W
Sbjct: 687 ETNVTAVKY---KENYMVEGRGNGSVHIW 712

>Skud_12.56 Chr12 (118914..120383) [1470 bp, 489 aa] {ON} YLL011W
           (REAL)
          Length = 489

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 37/198 (18%), Positives = 76/198 (38%), Gaps = 55/198 (27%)

Query: 175 LISCSDDGSIAIWDI--------------------------------------KSGKTVP 196
           ++SCSDD ++ +W I                                      +   T  
Sbjct: 136 MLSCSDDKTVKLWSINVDDYSNKRSSDNDSVTNEEGLVRTFDGESAFQGIDSHRENSTFA 195

Query: 197 TSVNSLH----------------SDIVNECKWHESDPNIYGSVSEDSFLMIHDKRSEKPL 240
           T    +H                +D +   ++++++ +I  S   D+ ++++D R+  P 
Sbjct: 196 TGGAKIHLWDVNRLKPISNLSWGADNITSVRFNQNETDILASTGSDNSIVLYDLRTNSPT 255

Query: 241 QKLLQKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEAVTSLEFAH 300
           QK++Q    N I ++   +  F  A  D   Y +D R  + +L     H  AV  ++F+ 
Sbjct: 256 QKIVQTMRTNAICWNPMEAFNFVTANEDHNAYYYDMRNLSRSLTVFKDHVSAVMDVDFSP 315

Query: 301 HKDGILCSGGSDRRVLLW 318
             D I+ +G  D+ + ++
Sbjct: 316 TGDEIV-TGSYDKSIRMY 332

 Score = 34.3 bits (77), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 44/188 (23%), Positives = 82/188 (43%), Gaps = 29/188 (15%)

Query: 158 HKENGYGLNFSVASPGELISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNEC----KWH 213
           H++  Y +  +  S  +L + S DG I  W++ S +    S  + +  I   C     +H
Sbjct: 66  HRDGIYAIAKNYGSLNKLATGSADGVIKYWNM-STREEFVSFKAHYGLITGLCVTQPHFH 124

Query: 214 ES-----DPNIYGSVSEDSFLMI--------HDKRS--------EKPLQKLLQKEPFNTI 252
           +      + N   S S+D  + +         +KRS        E+ L +    E     
Sbjct: 125 DKKSDWKNQNFMLSCSDDKTVKLWSINVDDYSNKRSSDNDSVTNEEGLVRTFDGESAFQG 184

Query: 253 AFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEAVTSLEFAHHKDGILCSGGSD 312
             S   ++ FA  G  A ++L+D  +  + + ++S   + +TS+ F  ++  IL S GSD
Sbjct: 185 IDSHRENSTFATGG--AKIHLWDVNR-LKPISNLSWGADNITSVRFNQNETDILASTGSD 241

Query: 313 RRVLLWDL 320
             ++L+DL
Sbjct: 242 NSIVLYDL 249

>Smik_4.90 Chr4 complement(171469..175074) [3606 bp, 1201 aa] {ON}
           YDL145C (REAL)
          Length = 1201

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 49/241 (20%), Positives = 94/241 (39%), Gaps = 23/241 (9%)

Query: 154 KYAYHKENGYGLNFSVASPGELISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWH 213
           K+        G+ F  + P  L++     +I +WD + G  +    +  H   V    +H
Sbjct: 6   KFESKSTRAKGIAFHPSRPWVLVALFS-STIQLWDYRMGTLLHRFED--HEGPVRGLDFH 62

Query: 214 ESDPNIYGSVSEDSFLMIHDKRSEKPLQKLLQKEPFNTIAFSKHSSNLFAAAGTDAMVYL 273
            + P I+ S  +D  + +    + K L  L     +    F         +A  D  + +
Sbjct: 63  PTQP-IFVSAGDDYTIKVWSLDTNKCLYTLTGHLDYVRTVFFHRELPWIISASDDQTIRI 121

Query: 274 FDSRKPTEALHSMSGHQEAVTSLEFAHHKDGILCSGGSDRRVLLWDLF------------ 321
           ++ +   E +  ++GH   V   +F H  D ++ S   D  + +WD+             
Sbjct: 122 WNWQNRKE-IACLTGHNHFVMCAQF-HPTDDLIVSASLDETIRIWDISGLRKRHSAPGTN 179

Query: 322 ----QIGTEQQEEDADDGGPELLMMHAGHKSAINDFSFSPNVPWLMASVEEENIVQIWKP 377
               Q+  +Q   D   G   +  +  GH   +N  SF P +P L+ S  ++  V++W+ 
Sbjct: 180 SFEEQMNAQQNLLDGSLGDCVVKFILEGHTRGVNWASFHPTLP-LIVSASDDRQVKLWRM 238

Query: 378 S 378
           S
Sbjct: 239 S 239

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 59/125 (47%), Gaps = 6/125 (4%)

Query: 164 GLNFSVASPGE--LISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYG 221
           G+N++   P    ++S SDD  + +W + + K         H++ V+   +H    N+  
Sbjct: 211 GVNWASFHPTLPLIVSASDDRQVKLWRMSATKAWEVDTCRGHTNNVDSVIFHPHQ-NLII 269

Query: 222 SVSEDSFLMIHDKRSEKPLQKLLQK-EPFNTIAFSKHSSNLFAAA-GTDAMVYLFDSRKP 279
           SV ED  L + D     P+++  ++ + F  IA   H  NLF AA  +  MV+  D  +P
Sbjct: 270 SVGEDKTLRVWDLDKRTPVKQFKRENDRFWLIAAHPH-INLFGAAHDSGIMVFKLDRERP 328

Query: 280 TEALH 284
              +H
Sbjct: 329 CSFIH 333

>ADL186C Chr4 complement(369320..373405) [4086 bp, 1361 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL138C
          Length = 1361

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 48/197 (24%), Positives = 81/197 (41%), Gaps = 32/197 (16%)

Query: 127 NLIATISGTGTVFLYD--RTKDDENALRGKYAYHKENGYGLNFSVASPGELISCSDDGSI 184
           N IA    + +V +YD  R    ++ L    + H  +   ++F++     LIS   DG I
Sbjct: 197 NYIAICGTSTSVSIYDINRASAKDSPLITTLSEHSRSINSVDFNMGQTHLLISGGQDGCI 256

Query: 185 AIWDIKSG--KTVPTSVN-SLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDKRSEKPLQ 241
            +WD++S   K   + +N +  SD V + KW  +    + S+  D+ L            
Sbjct: 257 KVWDLRSHSYKVNRSDLNFNSGSDSVRDVKWMPTYD--FASLGADTSLC----------- 303

Query: 242 KLLQKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEAVTSLEFAHH 301
                        S   SN FA+     ++  FD R+P +    ++ H      + +  H
Sbjct: 304 -------------SSGRSNKFASVHDSGLLLTFDMRQPNQVERKINAHSGPGLCMHWHPH 350

Query: 302 KDGILCSGGSDRRVLLW 318
            D I+ SGG D +  LW
Sbjct: 351 MDYII-SGGRDGKCALW 366

 Score = 38.9 bits (89), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 35/68 (51%), Gaps = 4/68 (5%)

Query: 257 HSSNLFAAAGTDAMVYLFD----SRKPTEALHSMSGHQEAVTSLEFAHHKDGILCSGGSD 312
           H  N  A  GT   V ++D    S K +  + ++S H  ++ S++F   +  +L SGG D
Sbjct: 194 HHKNYIAICGTSTSVSIYDINRASAKDSPLITTLSEHSRSINSVDFNMGQTHLLISGGQD 253

Query: 313 RRVLLWDL 320
             + +WDL
Sbjct: 254 GCIKVWDL 261

>Ecym_2523 Chr2 complement(1021566..1023506) [1941 bp, 646 aa] {ON}
           similar to Ashbya gossypii AGL234W
          Length = 646

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 56/251 (22%), Positives = 105/251 (41%), Gaps = 51/251 (20%)

Query: 158 HKENGYGLNFSVASPGELISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDP 217
           H+++ Y L++  A   +L+S S D ++ IWD+++G+    S+     D V        D 
Sbjct: 410 HEQDIYSLDYFPAG-DKLVSGSGDRTVRIWDLRTGQ---CSLTLSIEDGVTTVAVSPGDG 465

Query: 218 NIYGSVSEDSFLMIHDKRSEKPLQKL--------LQKEPFNTIAFSKHSSNLFAAAGTDA 269
               + S D  + + D  +   +++L          K+   ++ F++   ++ + +  D 
Sbjct: 466 KYIAAGSLDRTVRVWDSETGFLVERLDSENELSTGHKDSVYSVVFTRDGRSVVSGS-LDR 524

Query: 270 MVYLFDSRKPTEALHSMSGHQEAVTSLEFAHHKDGILC-----------SGGSDRRVLLW 318
            V L+D R     L+    H  A   + +  HKD +L            SG  DR VL W
Sbjct: 525 SVKLWDLR----GLNGQKSH--ATCEVTYTGHKDFVLSVATTQDDEYILSGSKDRGVLFW 578

Query: 319 DLFQIGTEQQEEDADDGGPELLMMHAGHK------SAINDFSFSPNVPWLMASVEEENIV 372
                       D   G P  L+M  GH+      + +N F   P++  + A+   +   
Sbjct: 579 ------------DTASGNP--LLMLQGHRNSVISVAVVNGFPLGPDI-GVFATGSGDCKA 623

Query: 373 QIWKPSRKLTN 383
           +IWK ++K ++
Sbjct: 624 RIWKYTKKTSS 634

>Skud_3.156 Chr3 complement(244873..247014) [2142 bp, 713 aa] {ON}
           YCR084C (REAL)
          Length = 713

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 50/204 (24%), Positives = 91/204 (44%), Gaps = 12/204 (5%)

Query: 175 LISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDK 234
           L + ++D  I IWDI++ K V   +     DI +   +   D  + G  S D  + I D 
Sbjct: 458 LATGAEDRLIRIWDIENRKIVMI-LQGHEQDIYSLDYFPSGDKLVSG--SGDRTVRIWDL 514

Query: 235 RSEKPLQKLLQKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKP--TEAL----HSMSG 288
           R+ +    L  ++   T+A S       AA   D  V ++DS      E L     S +G
Sbjct: 515 RTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDSENESGTG 574

Query: 289 HQEAVTSLEFAHHKDGILCSGGSDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGHKS 348
           H+++V S+ F      ++ SG  DR V LW+L     +   +  + G  E  + + GHK 
Sbjct: 575 HKDSVYSVVFTRDGQSVV-SGSLDRSVKLWNLQNANNKSDSKTPNSGTCE--VTYIGHKD 631

Query: 349 AINDFSFSPNVPWLMASVEEENIV 372
            +   + + N  ++++  ++  ++
Sbjct: 632 FVLSVATTQNDEYILSGSKDRGVL 655

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 53/243 (21%), Positives = 103/243 (42%), Gaps = 44/243 (18%)

Query: 158 HKENGYGLNFSVASPGELISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDP 217
           H+++ Y L++   S  +L+S S D ++ IWD+++G+    S+     D V        D 
Sbjct: 484 HEQDIYSLDY-FPSGDKLVSGSGDRTVRIWDLRTGQ---CSLTLSIEDGVTTVAVSPGDG 539

Query: 218 NIYGSVSEDSFLMIHDKRSEKPLQKL--------LQKEPFNTIAFSKHSSNLFAAAGTDA 269
               + S D  + + D  +   +++L          K+   ++ F++   ++ + +  D 
Sbjct: 540 KYIAAGSLDRAVRVWDSETGFLVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGS-LDR 598

Query: 270 MVYLF---------DSRKPTEALHSMS--GHQEAVTSLEFAHHKDGILCSGGSDRRVLLW 318
            V L+         DS+ P      ++  GH++ V S+    + + IL SG  DR VL W
Sbjct: 599 SVKLWNLQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYIL-SGSKDRGVLFW 657

Query: 319 DLFQIGTEQQEEDADDGGPELLMMHAGHKSAINDFSFSPNVPW-----LMASVEEENIVQ 373
                       D   G P  L+M  GH++++   + +   P      + A+   +   +
Sbjct: 658 ------------DKTSGNP--LLMLQGHRNSVISVAVANGSPLGPEYNVFATGSGDCKAR 703

Query: 374 IWK 376
           IWK
Sbjct: 704 IWK 706

>NDAI0A02090 Chr1 complement(466744..470346) [3603 bp, 1200 aa] {ON}
           Anc_7.322 YDL145C
          Length = 1200

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 50/242 (20%), Positives = 95/242 (39%), Gaps = 23/242 (9%)

Query: 154 KYAYHKENGYGLNFSVASPGELISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWH 213
           K+        G+ F  + P  L++     +I +WD + G  +    +  H   V    +H
Sbjct: 6   KFESKSSRAKGIAFHPSRPWVLVALFS-STIQLWDYRMGTLLHRFED--HEGPVRGLDFH 62

Query: 214 ESDPNIYGSVSEDSFLMIHDKRSEKPLQKLLQKEPFNTIAFSKHSSNLFAAAGTDAMVYL 273
            + P I+ S  +D  + +    + K L  L     +    F  H      +A  D  + +
Sbjct: 63  PTQP-IFVSAGDDYTIKVWSLETNKCLYTLQGHLDYVRTVFFHHELPWIISASDDQTIRI 121

Query: 274 FDSRKPTEALHSMSGHQEAVTSLEFAHHKDGILCSGGSDRRVLLWDLF------------ 321
           ++ +   E +  ++GH   V   +F H  + ++ S   D  V +WD+             
Sbjct: 122 WNWQNRKE-IACLTGHNHFVMCAQF-HPNEDLVVSASLDESVRVWDISGLRKKHSAPGTT 179

Query: 322 ----QIGTEQQEEDADDGGPELLMMHAGHKSAINDFSFSPNVPWLMASVEEENIVQIWKP 377
               QI  +    D   G   +  +  GH   +N  SF P +P L+ S  ++  V++W+ 
Sbjct: 180 SMEDQIAAQNNLLDGGFGDCVVKFILEGHTRGVNWASFHPTLP-LIVSGSDDRQVKLWRM 238

Query: 378 SR 379
           S+
Sbjct: 239 SQ 240

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 39/161 (24%), Positives = 67/161 (41%), Gaps = 10/161 (6%)

Query: 133 SGTGTVFLYDRTKDDENALRGKYA------YHKENGYGLNFSVASPGE--LISCSDDGSI 184
           S  GT  + D+     N L G +         + +  G+N++   P    ++S SDD  +
Sbjct: 174 SAPGTTSMEDQIAAQNNLLDGGFGDCVVKFILEGHTRGVNWASFHPTLPLIVSGSDDRQV 233

Query: 185 AIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDKRSEKPLQKLL 244
            +W +   K         H++ V +C       N+  SV ED  L I D     P+++  
Sbjct: 234 KLWRMSQTKAWEVDTCRGHTNNV-DCVIFHPHQNLIISVGEDKTLRIWDLDKRVPVKQFK 292

Query: 245 QKEPFNTIAFSKHSSNLFAAA-GTDAMVYLFDSRKPTEALH 284
           ++     +  +  + NLF AA  T  MV+  D  +P   +H
Sbjct: 293 REHDRFWLIAAHPNINLFGAAHDTGIMVFKLDRERPCSFIH 333

>TDEL0A00410 Chr1 complement(70940..74728) [3789 bp, 1262 aa] {ON}
           Anc_3.22 YOL138C
          Length = 1262

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 55/251 (21%), Positives = 95/251 (37%), Gaps = 56/251 (22%)

Query: 127 NLIATISGTGTVFLYD--RTKDDENALRGKYAYHKENGYGLNFSVASPGELISCSDDGSI 184
           N +A  S +  + ++D  RT   E++     + H  +    +F+      +IS   D  I
Sbjct: 189 NYVAVCSSSTAISVFDMNRTGSSESSFVTALSEHTRSINSFDFNTVQTNLIISGGQDSCI 248

Query: 185 AIWDIKS-----GKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDKRSEKP 239
            +WD++S      K    S+N+  SD + + KW                           
Sbjct: 249 KVWDLRSSNAKNSKNCDLSINTA-SDSIRDVKWM-------------------------- 281

Query: 240 LQKLLQKEPFNTIAFS-----KHSSNL---FAAAGTDAMVYLFDSRKPTEALHSMSGHQE 291
                   PF   AF+     K+ SN    FA+     ++  FD R+P +    ++ H  
Sbjct: 282 --------PFQNYAFNHQQEFKNGSNAGFKFASIHYSGLLLNFDLRQPGQIEKRINAHSG 333

Query: 292 AVTSLEFAHHKDGILCSGGSDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGHK--SA 349
               L + H     + +GG D +  LW    +G  QQ E+A       L  H+ H   +A
Sbjct: 334 PGLCLSW-HPNLEYIATGGRDGKCGLW---YVGDRQQYENACGTPSSNLYGHSAHANLAA 389

Query: 350 INDFSFSPNVP 360
           + + + S  +P
Sbjct: 390 LPETTLSTGLP 400

 Score = 32.3 bits (72), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 17/72 (23%), Positives = 33/72 (45%), Gaps = 5/72 (6%)

Query: 253 AFSKHSSNLFAAAGTDAMVYLFDSRKPTEA----LHSMSGHQEAVTSLEFAHHKDGILCS 308
            F  H  N  A   +   + +FD  +   +    + ++S H  ++ S +F   +  ++ S
Sbjct: 183 GFHNHK-NYVAVCSSSTAISVFDMNRTGSSESSFVTALSEHTRSINSFDFNTVQTNLIIS 241

Query: 309 GGSDRRVLLWDL 320
           GG D  + +WDL
Sbjct: 242 GGQDSCIKVWDL 253

>TBLA0B08730 Chr2 complement(2077729..2079114) [1386 bp, 461 aa]
           {ON} Anc_3.25 YNL317W
          Length = 461

 Score = 46.2 bits (108), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 37/149 (24%), Positives = 72/149 (48%), Gaps = 6/149 (4%)

Query: 173 GELISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIH 232
           G ++S S D  +  WD +SG+ V T +N  H+  V   ++  +  N    +S+D    + 
Sbjct: 222 GLIVSGSKDNLVKFWDPRSGQCVSTILNFKHT--VLRTRFQPTRGNYLLGISKDKSCRVF 279

Query: 233 DKRSE-KPLQKLLQKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEA-LHSMS-GH 289
           D R+  K L  +  +  F T+++   + ++F  A  D  +  FD  +  E  +H++   H
Sbjct: 280 DIRNHTKELLTVRDEVDFMTLSWHPINESVFTLANYDGSIKHFDILEDLEKPIHTIPFAH 339

Query: 290 QEAVTSLEFAHHKDGILCSGGSDRRVLLW 318
           ++ +T++ + +    IL S   DR +  W
Sbjct: 340 EKCITAMSY-NPIGHILASASKDRTIRFW 367

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 46/219 (21%), Positives = 89/219 (40%), Gaps = 21/219 (9%)

Query: 174 ELISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHD 233
           + ++CSDD  + IW+  +GK     + + H   V  C WH  +  +  S S+D+ +   D
Sbjct: 181 KFVTCSDDNILKIWNFSNGKQ--ERILTGHHWDVKSCDWHP-EMGLIVSGSKDNLVKFWD 237

Query: 234 KRSEKPLQKLLQ-KEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEA 292
            RS + +  +L  K       F     N       D    +FD R  T+ L ++    + 
Sbjct: 238 PRSGQCVSTILNFKHTVLRTRFQPTRGNYLLGISKDKSCRVFDIRNHTKELLTVRDEVDF 297

Query: 293 VTSLEFAHHKDGILCSGGSDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGHKSAIND 352
           +T L +    + +      D  +  +D+ +           D    +  +   H+  I  
Sbjct: 298 MT-LSWHPINESVFTLANYDGSIKHFDILE-----------DLEKPIHTIPFAHEKCITA 345

Query: 353 FSFSPNVPWLMASVEEENIVQIWKPSRKLTNPYFPQGYD 391
            S++P +  ++AS  ++  ++ W  S+    P  P G+D
Sbjct: 346 MSYNP-IGHILASASKDRTIRFWTRSK----PIDPNGFD 379

>KLTH0D04466g Chr4 (413024..413560,413816..414238) [960 bp, 319 aa]
           {ON} highly similar to uniprot|P38011 Saccharomyces
           cerevisiae YMR116C ASC1 WD repeat protein (G-beta like
           protein) involved in translation regulation required for
           repression of Gcn4p activity in the absence of
           amino-acid starvation core component of the ribosome
           ortholog of mammalian RACK1
          Length = 319

 Score = 45.8 bits (107), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 59/241 (24%), Positives = 102/241 (42%), Gaps = 32/241 (13%)

Query: 151 LRGKYAYHKENGYGLNFSVASPGELISCSDDGSIAIWDIKSGKT---VPTSVNSLHSDIV 207
           LRG    H      L  S A P  L+S S D S+  W +        VP      HS IV
Sbjct: 9   LRGTLEGHNGWVTSLATSPAQPNLLLSGSRDKSLITWKLTGDDQQYGVPVRSFRGHSHIV 68

Query: 208 NECKWHESDPNIYGSVSEDSFLMIHDKRSEKPLQKLL-QKEPFNTIAFSKHSSNLFAAAG 266
            +C     D     S S D  + + +  S K +Q+ +  K    ++   + +S + +A+ 
Sbjct: 69  QDCT-VTPDGEYALSASWDKTVRLWELASGKCIQRFVGHKSDVLSVTIDRRASQIVSAS- 126

Query: 267 TDAMVYLFDSRKPTEALHSMSGHQEAVTSLEFA-----HHKDGILCSGGSDRRVLLWDL- 320
            D  V ++++    E + ++ GH + V+ +  A       +   + S G D+ V +W+L 
Sbjct: 127 RDKTVKVWNTLG--ECMVTLLGHNDWVSQVRVAPNETPEDETVTVISAGMDKVVKVWNLH 184

Query: 321 -FQIGTEQQEEDADDGGPELLMMHAGHKSAINDFSFSPNVPWLMASVEEENIVQIWKPSR 379
            FQI       +AD           GH + +N  + SP+   L+AS  ++  + +W  + 
Sbjct: 185 SFQI-------EAD---------FIGHNNYVNTVTASPDGT-LVASAGKDGQIMLWNLTE 227

Query: 380 K 380
           K
Sbjct: 228 K 228

 Score = 35.4 bits (80), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 63/288 (21%), Positives = 119/288 (41%), Gaps = 49/288 (17%)

Query: 112 HENEVTRARYAPFDSNLIATISGTGTVFLYDRTKDDENALRGKYAYHKENGYGLNFSVAS 171
           H   VT    +P   NL+ + S   ++  +  T DD+       ++   +    + +V  
Sbjct: 16  HNGWVTSLATSPAQPNLLLSGSRDKSLITWKLTGDDQQYGVPVRSFRGHSHIVQDCTVTP 75

Query: 172 PGEL-ISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLM 230
            GE  +S S D ++ +W++ SGK +   V    SD+++      +   +  S S D  + 
Sbjct: 76  DGEYALSASWDKTVRLWELASGKCIQRFVGH-KSDVLSVTIDRRASQIV--SASRDKTVK 132

Query: 231 IHDKRSEKPLQKLLQKEPFNTIAFSKH-----SSNLFAAAGTDAMVYLFDSRKPTEALHS 285
           + +   E  +  L   +  + +  + +      +    +AG D +V +++       LHS
Sbjct: 133 VWNTLGECMVTLLGHNDWVSQVRVAPNETPEDETVTVISAGMDKVVKVWN-------LHS 185

Query: 286 MS------GHQEAVTSLEFAHHKDGIL-CSGGSDRRVLLWDLFQIGTEQQEEDADDGGPE 338
                   GH   V ++  +   DG L  S G D +++LW+L    TE++          
Sbjct: 186 FQIEADFIGHNNYVNTVTAS--PDGTLVASAGKDGQIMLWNL----TEKE---------A 230

Query: 339 LLMMHAGHKSAINDFSFSPNVPWLMAS---------VEEENIVQIWKP 377
           L  ++A  +  +   +FSPN  WL A+         +EE  +V   KP
Sbjct: 231 LYTLNA--QDEVFAVAFSPNRYWLTAATSSGIKIFNLEERKVVDELKP 276

>NCAS0A15170 Chr1 (2984221..2985645) [1425 bp, 474 aa] {ON}
           Anc_7.534
          Length = 474

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 53/200 (26%), Positives = 87/200 (43%), Gaps = 27/200 (13%)

Query: 182 GSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIH----DKRSE 237
           G I I D K+   V + + + H   +    W+ ++ ++  S ++D  + IH    D +  
Sbjct: 208 GDIKILDTKT-LDVISGIENGHDGKIGGLAWNSTNTHLV-SGADDCLVKIHSFDPDVKII 265

Query: 238 KPLQKLLQKEPFNTIAFSKHSSNLFAAAGTDAMVY-LFDSRKPTEALHSMSGHQEAVTSL 296
           K L  L Q      +    H S  F A+ +  M + L+D    TE L    GH + V SL
Sbjct: 266 KELTAL-QGHTGRVVNVDFHPSGRFVASASFDMTWRLWDIESETE-LQFQEGHGKEVYSL 323

Query: 297 EFAHHKDG-ILCSGGSDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGHKSAINDFSF 355
            F    DG +LCSGG D   ++WD+ + G               +M   GH   I    +
Sbjct: 324 SF--QNDGALLCSGGLDNAAIVWDV-RTGKS-------------IMNLQGHAKPIYSVDW 367

Query: 356 SPNVPWLMASVEEENIVQIW 375
           SP+  + +A+   + ++ IW
Sbjct: 368 SPD-GYHIATGGGDGVINIW 386

 Score = 43.1 bits (100), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 51/222 (22%), Positives = 96/222 (43%), Gaps = 19/222 (8%)

Query: 104 IKIIKKFK----HENEVTRARYAPFDSNLIATISGTGTVFLYDRTKDDENALRGKYAYHK 159
           +KIIK+      H   V    + P     +A+ S   T  L+D   + E  L+ +  + K
Sbjct: 262 VKIIKELTALQGHTGRVVNVDFHP-SGRFVASASFDMTWRLWD--IESETELQFQEGHGK 318

Query: 160 ENGYGLNFSVASPGELISCSD--DGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDP 217
           E  Y L+F   + G L+ CS   D +  +WD+++GK++       H+  +    W     
Sbjct: 319 EV-YSLSFQ--NDGALL-CSGGLDNAAIVWDVRTGKSIMNLQG--HAKPIYSVDWSPDGY 372

Query: 218 NIYGSVSEDSFLMIHDKRSEKPLQKLLQKEPFNT-IAFSKHSSNLFAAAGTDAMVYLFDS 276
           +I  +   D  + I D R      +LL      T + F K + +   + G D  + ++ S
Sbjct: 373 HI-ATGGGDGVINIWDIRKTTETTRLLAHNNIVTGVRFQKSTGHCLVSCGYDKQIRIYSS 431

Query: 277 RKPTEALHSMSGHQEAVTSLEFAHHKDGILCSGGSDRRVLLW 318
               + + ++ GH + +  ++ +     ++ S G DR + LW
Sbjct: 432 DNWIQ-VKTLEGHTDKILDVDISEDAQ-LIVSSGWDRSLKLW 471

>SAKL0C13332g Chr3 (1177358..1181419) [4062 bp, 1353 aa] {ON}
           similar to uniprot|Q92271 Saccharomyces cerevisiae
           YOL138C Hypothetical ORF
          Length = 1353

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 50/225 (22%), Positives = 90/225 (40%), Gaps = 46/225 (20%)

Query: 105 KIIKKFKHENEVTRARYAPFDSNLIATISGTGTVFLYD--RTKDDENALRGKYAYHKENG 162
           +++KK    ++V    Y     N +A    + +V +YD  +T   +N L    + H  + 
Sbjct: 175 RVVKKISVISDVKAGFYN--HKNYVAICGTSTSVSVYDINKTSTIDNPLVTTLSEHTRSI 232

Query: 163 YGLNFSVASPGELISCSDDGSIAIWDIKSGK--TVPTSVN-SLHSDIVNECKWHES---- 215
             ++F+++    LIS   DG I +WD++S +  T  + +N +  SD + + KW  S    
Sbjct: 233 NSVDFNMSQTNLLISGGQDGCIKVWDLRSSQRSTNRSDININTGSDSIRDIKWMPSYDFA 292

Query: 216 --DPNIYGSVSEDSFLMIHDKRSEKPLQKLLQKEPFNTIAFSKHSSNLFAAAGTDAMVYL 273
             D N    +S   F                                 FA+     ++  
Sbjct: 293 TNDVNNSNGISNRGF--------------------------------KFASIHDSGLLLK 320

Query: 274 FDSRKPTEALHSMSGHQEAVTSLEFAHHKDGILCSGGSDRRVLLW 318
           FD R+P +    ++ H      L +  H++ I+ SGG D +  LW
Sbjct: 321 FDLRQPNQMEKKINAHSGPGLCLHWHPHQEYII-SGGRDGKCCLW 364

 Score = 37.0 bits (84), Expect = 0.100,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 33/65 (50%), Gaps = 4/65 (6%)

Query: 260 NLFAAAGTDAMVYLFDSRKPTEA----LHSMSGHQEAVTSLEFAHHKDGILCSGGSDRRV 315
           N  A  GT   V ++D  K +      + ++S H  ++ S++F   +  +L SGG D  +
Sbjct: 195 NYVAICGTSTSVSVYDINKTSTIDNPLVTTLSEHTRSINSVDFNMSQTNLLISGGQDGCI 254

Query: 316 LLWDL 320
            +WDL
Sbjct: 255 KVWDL 259

>KNAG0I02840 Chr9 (554645..556204) [1560 bp, 519 aa] {ON} Anc_6.340
           YCR072C
          Length = 519

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 79/324 (24%), Positives = 129/324 (39%), Gaps = 74/324 (22%)

Query: 112 HENEVTRARYAPFDSNLIATISGTGTVFLYDRTKD--------DENALRGKYAYHKENGY 163
           H N V    ++P D  +IAT S   T+ L++ TK           +AL+G   +     +
Sbjct: 181 HSNWVLCVSWSP-DGEVIATGSMDSTIRLWESTKGKPVGGGNGSSSALKGHMKWITSLSW 239

Query: 164 ---GLNFSVASPGELISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKW-------- 212
               L    A P  L S S DG+I IWD  + + V     S HS+ V   KW        
Sbjct: 240 EPLHLVPDGAKP-RLASASKDGTIKIWD--TARRVCLYTLSGHSNSVACVKWGGEGLLYS 296

Query: 213 --HESDPNIYG-----------------------SVSEDSFLMI--HDKRSEKPL----Q 241
             H+    ++                        S+S D  L I   D    KP      
Sbjct: 297 GSHDKTVRVWDMNSATVGKCISILKNHAHWVNHLSLSTDYALRIGPFDHTGVKPSTPAEA 356

Query: 242 KLLQKEPFNTIAFSKHSSN-LFAAAGTDAMVYLFDSRKPTEALHSMSGHQEAVTSLEFAH 300
           K   +  ++ +A    S+  L   A  D  ++L++ +K T+ L  M+GHQ+ V  + F+ 
Sbjct: 357 KRRAQANYDKVAKRNGSAEELMVTASDDFTMFLWNPKKLTKPLARMTGHQKLVNHVAFS- 415

Query: 301 HKDG-ILCSGGSDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGHKSAINDFSFSPNV 359
             DG  + S   D  + LW            D  DG  + L    GH +++   ++S + 
Sbjct: 416 -PDGRYIVSASFDNSIKLW------------DGRDG--KFLSTFRGHVASVYQVAWSSDC 460

Query: 360 PWLMASVEEENIVQIWK-PSRKLT 382
             L+ S  ++  +++W   +RKL+
Sbjct: 461 R-LLVSCSKDTTLKVWDVRTRKLS 483

 Score = 40.0 bits (92), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 47/210 (22%), Positives = 87/210 (41%), Gaps = 40/210 (19%)

Query: 112 HENEVTRARYAPFDSNLIATISGTGTVFLYDRTKDDENALRGKYAYHKENGYGLNFSVAS 171
           H + +  + +AP  S+ + T +G  T  ++D   D +  L         + + L  S + 
Sbjct: 138 HGSTILCSAFAPDTSSRMVTGAGDNTARIWD--CDTQTPL---ATLEGHSNWVLCVSWSP 192

Query: 172 PGELISC-SDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLM 230
            GE+I+  S D +I +W+   GK V    N   S +    KW  S               
Sbjct: 193 DGEVIATGSMDSTIRLWESTKGKPVGGG-NGSSSALKGHMKWITS--------------- 236

Query: 231 IHDKRSEKPLQKLLQKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQ 290
                        L  EP + +     +    A+A  D  + ++D+ +    L+++SGH 
Sbjct: 237 -------------LSWEPLHLVP--DGAKPRLASASKDGTIKIWDTARRV-CLYTLSGHS 280

Query: 291 EAVTSLEFAHHKDGILCSGGSDRRVLLWDL 320
            +V  +++    +G+L SG  D+ V +WD+
Sbjct: 281 NSVACVKWG--GEGLLYSGSHDKTVRVWDM 308

 Score = 37.0 bits (84), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 37/146 (25%), Positives = 69/146 (47%), Gaps = 8/146 (5%)

Query: 175 LISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDK 234
           +++ SDD ++ +W+ K   T P +  + H  +VN   +   D     S S D+ + + D 
Sbjct: 378 MVTASDDFTMFLWNPKK-LTKPLARMTGHQKLVNHVAF-SPDGRYIVSASFDNSIKLWDG 435

Query: 235 RSEKPLQKLL-QKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEAV 293
           R  K L            +A+S     L  +   D  + ++D R    ++  + GHQ+ V
Sbjct: 436 RDGKFLSTFRGHVASVYQVAWSS-DCRLLVSCSKDTTLKVWDVRTRKLSV-DLPGHQDEV 493

Query: 294 TSLEFAHHKDGI-LCSGGSDRRVLLW 318
            +++++   DG  +CSGG D+ V +W
Sbjct: 494 FTVDWS--VDGKRVCSGGKDKMVRIW 517

>SAKL0A01738g Chr1 (157360..160089) [2730 bp, 909 aa] {ON} highly
           similar to uniprot|P25636 Saccharomyces cerevisiae
           YCR057C PWP2 part of small (ribosomal) subunit (SSU)
           processosome (contains U3 snoRNA) Eight WD-repeats with
           homology with G protein beta subunits flanked by
           nonhomologous N-terminal and C-terminal extensions
           regulatory protein
          Length = 909

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 41/162 (25%), Positives = 74/162 (45%), Gaps = 9/162 (5%)

Query: 174 ELISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHD 233
            +++ SDDG I IWD+ SG  + T  +  H+  V   ++ +    ++ S S D  +   D
Sbjct: 356 RVVTSSDDGKIKIWDVVSGFCLATFDD--HTSSVTAVQFAKKGQVLF-SASLDGTVKAWD 412

Query: 234 KRSEKPLQKLLQKE--PFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQE 291
               +  +     E   FN +A    S  +  A   D+      S +    L +++GH+ 
Sbjct: 413 LIRYRNFRTFTAAERIQFNCLAVDP-SGEVVCAGSVDSFEIHVWSVQTGNLLDTLAGHEG 471

Query: 292 AVTSLEFAHHKDGILCSGGSDRRVLLWDLFQIGTEQQEEDAD 333
            V+ L F+ +++ +L S   D+ + +W +F  G  QQ E  D
Sbjct: 472 PVSCLSFS-NENSVLASASWDKTIRIWSIF--GRSQQVEPFD 510

>TPHA0A00380 Chr1 complement(55881..59813) [3933 bp, 1310 aa] {ON}
           Anc_3.22 YOL138C
          Length = 1310

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 45/198 (22%), Positives = 81/198 (40%), Gaps = 31/198 (15%)

Query: 127 NLIATISGTGTVFLYDRTKDD--ENALRGKYAYHKENGYGLNFSVASPGELISCSDDGSI 184
           N +A  + +  + +YD  K +  +  L   Y+ H       +F++     LIS   DG I
Sbjct: 194 NYVAICAKSTVISIYDINKAEKLDKTLITSYSEHTRAVNSFDFNMVDSNLLISGGQDGCI 253

Query: 185 AIWDIKSGKTVPTSVNSLH----SDIVNECKWHESDPNIYGSVSEDSFLMIHDKRSEKPL 240
            IWD+++G    ++ + ++    SD + + KW       Y   S  S             
Sbjct: 254 KIWDLRTGSLNGSTRSDININTASDSIRDVKWMPG----YNFASHGS-----------AT 298

Query: 241 QKLLQKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEAVTSLEFAH 300
             L +K          +S   FA+     ++  FD R+P+ A   ++ H      L +  
Sbjct: 299 ANLRRKN---------NSGYKFASIHDSGLLLKFDIRQPSHAERKINAHTGPGLCLNWHP 349

Query: 301 HKDGILCSGGSDRRVLLW 318
           ++D I+ +GG D +  LW
Sbjct: 350 NQDYIV-TGGRDGKCCLW 366

 Score = 34.7 bits (78), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 29/65 (44%), Gaps = 4/65 (6%)

Query: 260 NLFAAAGTDAMVYLFDSRKPTEA----LHSMSGHQEAVTSLEFAHHKDGILCSGGSDRRV 315
           N  A      ++ ++D  K  +     + S S H  AV S +F      +L SGG D  +
Sbjct: 194 NYVAICAKSTVISIYDINKAEKLDKTLITSYSEHTRAVNSFDFNMVDSNLLISGGQDGCI 253

Query: 316 LLWDL 320
            +WDL
Sbjct: 254 KIWDL 258

>NCAS0G03600 Chr7 complement(672904..673887) [984 bp, 327 aa] {ON}
           Anc_1.399
          Length = 327

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 64/270 (23%), Positives = 122/270 (45%), Gaps = 29/270 (10%)

Query: 125 DSNLIATISGTGTVFLYDRTKDDENALRGKYAYHKENGYGLNFSVASPGELISCSDDGSI 184
           D  L+A  +G   V LYD    + NA+   +  HK N   ++F   +   +++ S+DG+I
Sbjct: 63  DKKLLAA-AGYQNVRLYDIRTTNPNAV-ATFEGHKGNVTSVSFQQDNKW-MVTSSEDGTI 119

Query: 185 AIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDKRSEKPLQKLL 244
            +WD++S  +VP   N  H+  VNE   H +   +  S   D  + I D    +   +L+
Sbjct: 120 KVWDVRS-PSVPR--NYKHNAPVNEVVIHPNQGELI-SCDRDGTIKIWDLGENQCTHQLI 175

Query: 245 QKEPFNTIAFSKHSSN--LFAAAGTDAMVYLFDSRKPTEA-----LHSMSGHQEAVTSLE 297
             +   ++     +S+  +  AA      Y+++    T+A     ++  S H++ +T + 
Sbjct: 176 PDDDNTSLQSLSVASDGSMLVAANNKGDCYVWEMPNHTDASNLKPINKFSAHKDYITRVV 235

Query: 298 FAHH-KDGILCSGGSDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGHKSAINDFSFS 356
            +   K    CS  +DR   +W +         E  DD   E  +   GH+  + D +FS
Sbjct: 236 LSSDVKHMATCS--ADRTAKIWSV--------GETEDDFNLETTL--DGHQRWVWDCAFS 283

Query: 357 PNVPWLMASVEEENIVQIWKPS-RKLTNPY 385
            +  +L+ +   ++ V++W  S R++   Y
Sbjct: 284 ADSAYLV-TASSDHYVRLWDLSTREIVRQY 312

>AER255C Chr5 complement(1107932..1109335) [1404 bp, 467 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR364C
           (CDC40)
          Length = 467

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 47/105 (44%), Gaps = 20/105 (19%)

Query: 274 FDSRKPTEALHSMSGHQEAVTSLEFAHHKDGILCSGGSDRRVLLWDLFQIGTEQQEEDAD 333
           F    P   LH   GH    T+LEF      +  SGG+D  + +WD++            
Sbjct: 158 FQCYLPKRILHVYDGHDRGTTALEFLRKTGHLFLSGGNDGVLKIWDMYH----------- 206

Query: 334 DGGPELLMM--HAGHKSAINDFSFS-PNVPWLMASVEEENIVQIW 375
               E L++  + GH+ AI+  SFS  NV +  AS   +  V+IW
Sbjct: 207 ----ERLLLRDYCGHRKAISATSFSHDNVQF--ASSSYDKTVKIW 245

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 18/71 (25%), Positives = 36/71 (50%), Gaps = 3/71 (4%)

Query: 250 NTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEAVTSLEFAHHKDGI-LCS 308
             + F + + +LF + G D ++ ++D       L    GH++A+++  F+H  D +   S
Sbjct: 178 TALEFLRKTGHLFLSGGNDGVLKIWDMYHERLLLRDYCGHRKAISATSFSH--DNVQFAS 235

Query: 309 GGSDRRVLLWD 319
              D+ V +WD
Sbjct: 236 SSYDKTVKIWD 246

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 20/87 (22%), Positives = 37/87 (42%), Gaps = 2/87 (2%)

Query: 127 NLIATISGTGTVFLYDRTKDDENALRGKYAYHKENGYGLNFSVASPGELISCSD-DGSIA 185
           N  A  S   ++++Y      +   R  +  HK  GY   F +A  G  ++  D  G + 
Sbjct: 361 NQFAAQSMDNSIYVYSMKPKYKRHPRKAFRGHKSAGYNSMFDIAPDGRYVAAGDTSGRLF 420

Query: 186 IWDIKSGKTVPTSVNSLHSDIVNECKW 212
           IWD K+ K +   + +   + + +  W
Sbjct: 421 IWDWKTTKIL-RQLETTKGETLKQVAW 446

>Suva_4.99 Chr4 complement(182425..186030) [3606 bp, 1201 aa] {ON}
           YDL145C (REAL)
          Length = 1201

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 64/295 (21%), Positives = 111/295 (37%), Gaps = 76/295 (25%)

Query: 104 IKIIKKFKHENEVTRARYAPFDSN----LIATISGTGTVFLYDRTKDDENALRGKYAYHK 159
           +K++ KF  E++ TRA+   F  +    L+A  S T  ++ Y         L  ++  H+
Sbjct: 1   MKMLTKF--ESKSTRAKGIAFHPSRPWVLVALFSSTIQLWDYRM-----GTLLHRFEDHE 53

Query: 160 ENGYGLNFSVASPGELISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNI 219
               GL+F    P   +S  DD +I +W + + K + T   S H D V    +H   P I
Sbjct: 54  GPVRGLDFHPTQP-IFVSAGDDYTIKVWSLDTNKCLYTL--SGHLDYVRTVFFHRELPWI 110

Query: 220 YGSVSEDSFLMIHDKRSEKPLQKLLQKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKP 279
             S S+D  + I + ++ K +                                       
Sbjct: 111 I-SASDDQTIRIWNWQNRKEIA-------------------------------------- 131

Query: 280 TEALHSMSGHQEAVTSLEFAHHKDGILCSGGSDRRVLLWDLF----------------QI 323
                 ++GH   V   +F H  D ++ S   D  + +WD+                 Q+
Sbjct: 132 -----CLTGHNHFVMCAQF-HPTDDLIVSASLDETIRIWDISGLRKRHSAPSNNSFEEQL 185

Query: 324 GTEQQEEDADDGGPELLMMHAGHKSAINDFSFSPNVPWLMASVEEENIVQIWKPS 378
             +Q   D   G   +  +  GH   +N  SF P +P L+ S  ++  V++W+ S
Sbjct: 186 NAQQNLLDGSLGDCVVKFILEGHTRGVNWASFHPTLP-LIVSASDDRQVKLWRMS 239

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 59/125 (47%), Gaps = 6/125 (4%)

Query: 164 GLNFSVASPGE--LISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYG 221
           G+N++   P    ++S SDD  + +W + + K         H++ V+   +H    N+  
Sbjct: 211 GVNWASFHPTLPLIVSASDDRQVKLWRMSATKAWEVDTCRGHTNNVDSVIFHPHQ-NLII 269

Query: 222 SVSEDSFLMIHDKRSEKPLQKLLQK-EPFNTIAFSKHSSNLFAAA-GTDAMVYLFDSRKP 279
           SV ED  L + D     P+++  ++ + F  IA   H  NLF AA  +  MV+  D  +P
Sbjct: 270 SVGEDKTLRVWDLDKRTPVKQFKRENDRFWLIAAHPH-INLFGAAHDSGIMVFKLDRERP 328

Query: 280 TEALH 284
              +H
Sbjct: 329 CSVIH 333

>Skud_4.109 Chr4 complement(190191..193796) [3606 bp, 1201 aa] {ON}
           YDL145C (REAL)
          Length = 1201

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 64/295 (21%), Positives = 111/295 (37%), Gaps = 76/295 (25%)

Query: 104 IKIIKKFKHENEVTRARYAPFDSN----LIATISGTGTVFLYDRTKDDENALRGKYAYHK 159
           +K++ KF  E++ TRA+   F  +    L+A  S T  ++ Y         L  ++  H+
Sbjct: 1   MKMLTKF--ESKSTRAKGIAFHPSRPWVLVALFSSTIQLWDYRM-----GTLLHRFEDHE 53

Query: 160 ENGYGLNFSVASPGELISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNI 219
               GL+F    P   +S  DD +I +W + + K + T   S H D V    +H   P I
Sbjct: 54  GPVRGLDFHPTQPI-FVSAGDDYTIKVWSLDTNKCLYTL--SGHLDYVRTVFFHRELPWI 110

Query: 220 YGSVSEDSFLMIHDKRSEKPLQKLLQKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKP 279
             S S+D  + I + ++ K +                                       
Sbjct: 111 I-SASDDQTIRIWNWQNRKEIA-------------------------------------- 131

Query: 280 TEALHSMSGHQEAVTSLEFAHHKDGILCSGGSDRRVLLWDLF----------------QI 323
                 ++GH   V   +F H  D ++ S   D  + +WD+                 Q+
Sbjct: 132 -----CLTGHNHFVMCAQF-HPTDDLIVSASLDETIRIWDISGLRKRHSAPGTNSFEEQM 185

Query: 324 GTEQQEEDADDGGPELLMMHAGHKSAINDFSFSPNVPWLMASVEEENIVQIWKPS 378
             +Q   D   G   +  +  GH   +N  SF P +P L+ S  ++  V++W+ S
Sbjct: 186 NAQQNLLDGSLGDCVVKFILEGHTRGVNWASFHPTLP-LIVSASDDRQVKLWRMS 239

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 59/125 (47%), Gaps = 6/125 (4%)

Query: 164 GLNFSVASPGE--LISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYG 221
           G+N++   P    ++S SDD  + +W + + K         H++ V+   +H    N+  
Sbjct: 211 GVNWASFHPTLPLIVSASDDRQVKLWRMSATKAWEVDTCRGHTNNVDSVIFHPHQ-NLII 269

Query: 222 SVSEDSFLMIHDKRSEKPLQKLLQK-EPFNTIAFSKHSSNLFAAA-GTDAMVYLFDSRKP 279
           SV ED  L + D     P+++  ++ + F  IA   H  NLF AA  +  MV+  D  +P
Sbjct: 270 SVGEDKTLRVWDLDKRTPVKQFKRENDRFWLIAAHPH-INLFGAAHDSGIMVFKLDRERP 328

Query: 280 TEALH 284
              +H
Sbjct: 329 CSFIH 333

>TBLA0B09100 Chr2 complement(2156320..2156742,2157014..2157544) [954
           bp, 317 aa] {ON} Anc_2.431 YMR116C
          Length = 317

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 60/241 (24%), Positives = 102/241 (42%), Gaps = 32/241 (13%)

Query: 151 LRGKYAYHKENGYGLNFSVASPGELISCSDDGSIAIWDIKSGKT---VPTSVNSLHSDIV 207
           LRG    H      L  S   P  L+S S D ++  W +        VP      HS IV
Sbjct: 7   LRGTLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQQYGVPVRSFKGHSHIV 66

Query: 208 NECKWHESDPNIYGSVSEDSFLMIHDKRSEKPLQKLL-QKEPFNTIAFSKHSSNLFAAAG 266
            +C    +D     S S D  + + D  + +  Q+ +  K    ++A  + +S + + + 
Sbjct: 67  QDCA-LTADGAYALSASWDKTIRLWDVSTGETFQRFVGHKGDVMSVAIDRKASMIISGS- 124

Query: 267 TDAMVYLFDSRKPTEALHSMSGHQEAVTSLEFAHH----KDGI-LCSGGSDRRVLLWDL- 320
            D  + ++  +   E L +M GH + V+ +  A +     D + + S GSD+ V  W++ 
Sbjct: 125 RDKTIKVWSIKG--ECLATMLGHNDWVSQVRVAPNDKPEDDTVTVISAGSDKVVKSWNVN 182

Query: 321 -FQIGTEQQEEDADDGGPELLMMHAGHKSAINDFSFSPNVPWLMASVEEENIVQIWKPSR 379
            FQI       DAD           GH + IN    SP+   L+AS  ++  + +W  ++
Sbjct: 183 QFQI-------DAD---------FIGHNNYINAIVASPDGS-LIASAGKDGEIMMWDLAQ 225

Query: 380 K 380
           K
Sbjct: 226 K 226

>KAFR0F04350 Chr6 (853842..855389) [1548 bp, 515 aa] {ON} Anc_6.340
           YCR072C
          Length = 515

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 75/318 (23%), Positives = 125/318 (39%), Gaps = 70/318 (22%)

Query: 112 HENEVTRARYAPFDSNLIATISGTGTVFLY--DRTKDDENALRGKYAYHKENGYGLNFSV 169
           H+N V    ++P D  +IAT S   T+ L+  DR K     LRG   +     +     +
Sbjct: 185 HQNWVLCVSWSP-DGEIIATGSMDNTIRLWESDRGKPLGEPLRGHLKWITSLSWE-PLHL 242

Query: 170 ASPGE---LISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSED 226
              GE   L S S DG+I IWD  + + V     S H++ V+  KW      +  S S D
Sbjct: 243 VKAGEKPRLASASKDGTIKIWD--TVRRVCVYTLSGHTNSVSCVKW--GGQGVLYSGSHD 298

Query: 227 SFLMIHDKR-SEKPLQKL-----------------LQKEPFN------------------ 250
             + + D     K +  L                 L++ PF+                  
Sbjct: 299 KTVRVWDMNLGGKCINILKNHAHWVNHLSLSTDYALRRGPFDHTGTKMASPEEAREKALK 358

Query: 251 ----TIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEAVTSLEFAHHKDG-I 305
                +  +  +  L   A  D  ++L++  K  + L  M+GHQ+ V  + F+   DG  
Sbjct: 359 NYEKVVKKNGTTEELMVTASDDFTMFLWNPLKSNKPLARMTGHQKLVNHVAFS--PDGRY 416

Query: 306 LCSGGSDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGHKSAINDFSFSPNVPWLMAS 365
           + S   D  + LW            D  DG  + L    GH S++   ++S +   L+ S
Sbjct: 417 IVSASFDNSIKLW------------DGRDG--KFLSTFRGHVSSVYQVAWSSDCR-LLVS 461

Query: 366 VEEENIVQIWK-PSRKLT 382
             ++  +++W   +RKL+
Sbjct: 462 CSKDTTLKVWDVRTRKLS 479

 Score = 38.1 bits (87), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 38/147 (25%), Positives = 71/147 (48%), Gaps = 10/147 (6%)

Query: 175 LISCSDDGSIAIWD-IKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHD 233
           +++ SDD ++ +W+ +KS K  P +  + H  +VN   +   D     S S D+ + + D
Sbjct: 374 MVTASDDFTMFLWNPLKSNK--PLARMTGHQKLVNHVAF-SPDGRYIVSASFDNSIKLWD 430

Query: 234 KRSEKPLQKLL-QKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEA 292
            R  K L            +A+S     L  +   D  + ++D R    ++  + GHQ+ 
Sbjct: 431 GRDGKFLSTFRGHVSSVYQVAWSS-DCRLLVSCSKDTTLKVWDVRTRKLSV-DLPGHQDE 488

Query: 293 VTSLEFAHHKDGI-LCSGGSDRRVLLW 318
           V +++++   DG  +CSGG D+ + LW
Sbjct: 489 VYTVDWS--VDGKRVCSGGKDKMIRLW 513

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 22/107 (20%), Positives = 46/107 (42%), Gaps = 15/107 (14%)

Query: 273 LFDSRKPTEALHSMSGHQEAVTSLEFAHHKDGILCSGGSDRRVLLWDLFQIGTEQQEEDA 332
           +F  +  T +  +++GH   +    FA H    + +G  D    +W            D 
Sbjct: 126 VFKVKPVTRSSSAIAGHGSTILCSAFAPHTSSRMVTGAGDNTARIW------------DC 173

Query: 333 DDGGPELLMMHAGHKSAINDFSFSPNVPWLMASVEEENIVQIWKPSR 379
           D   P   +   GH++ +   S+SP+   ++A+   +N +++W+  R
Sbjct: 174 DTQTPMTTL--TGHQNWVLCVSWSPDGE-IIATGSMDNTIRLWESDR 217

>CAGL0I03718g Chr9 complement(317565..321170) [3606 bp, 1201 aa]
           {ON} highly similar to uniprot|P53622 Saccharomyces
           cerevisiae YDL145c RET1 Coatomer alpha subunit
          Length = 1201

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 61/279 (21%), Positives = 113/279 (40%), Gaps = 44/279 (15%)

Query: 104 IKIIKKFKHENEVTRARYAPFDSN----LIATISGTGTVFLYDRTKDDENALRGKYAYHK 159
           +K++ KF  E++ TRA+   F  +    L+A  S T  ++ Y         L  ++  H+
Sbjct: 1   MKLLTKF--ESKSTRAKGIAFHPSRPWALVALFSSTIQLWDYRM-----GTLLHRFEGHE 53

Query: 160 ENGYGLNFSVASPGELISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNI 219
                ++F    P   +S  DD SI +W +++ + + T     H D V    +H   P +
Sbjct: 54  GPVRAVDFHPTQP-IFVSAGDDASIKVWSLETNRCLYTLTG--HLDYVRTVFFHSELPWV 110

Query: 220 YGSVSEDSFLMIHDKRSEKPLQKLLQKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKP 279
             S S+D  + I + ++ K L  L     F   A    + +L  +A  D  V ++D    
Sbjct: 111 I-SASDDQTVRIWNWQNRKELACLTGHNHFVMCAQFHQTEDLVVSASLDETVRVWD---- 165

Query: 280 TEALHSMSGHQEAVTSLEFAHHKDGILCSGGSDRRVLLWDLFQIGTEQQEEDADDGGPEL 339
                        ++ L   H   G+     S           + ++Q   D   G  ++
Sbjct: 166 -------------ISGLRKKHSAPGVTSYEDS-----------LASQQNLLDGAFGDCKV 201

Query: 340 LMMHAGHKSAINDFSFSPNVPWLMASVEEENIVQIWKPS 378
             +  GH   +N  SF P +P L+ +  ++  V++W+ S
Sbjct: 202 KFILEGHTRGVNWASFHPTLP-LIVTGGDDRQVKLWRMS 239

 Score = 36.6 bits (83), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 29/119 (24%), Positives = 55/119 (46%), Gaps = 4/119 (3%)

Query: 164 GLNFSVASPGE--LISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYG 221
           G+N++   P    +++  DD  + +W + S K         H++ V +C     D N+  
Sbjct: 211 GVNWASFHPTLPLIVTGGDDRQVKLWRMSSNKAWEVDTCRGHTNNV-DCVVFHPDQNLIL 269

Query: 222 SVSEDSFLMIHDKRSEKPLQKLLQKEPFNTIAFSKHSSNLFAAA-GTDAMVYLFDSRKP 279
           SV+ED  L I D     P+++  ++     +  S  + +LF AA  +  M++  D  +P
Sbjct: 270 SVAEDKTLRIWDLDKRTPVKQFKRENDRFWLIRSHPNMSLFGAAHDSGIMIFKLDRERP 328

>Ecym_4280 Chr4 complement(600066..603464) [3399 bp, 1132 aa] {ON}
           similar to Ashbya gossypii AGR067W
          Length = 1132

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 49/223 (21%), Positives = 94/223 (42%), Gaps = 15/223 (6%)

Query: 138 VFLYDRTKDDENALRGKYAYHKENGYGLNFSVASPGELISCSDDGSIAIWDIKSGKTVPT 197
             +++ ++   NA+  +   H      +NF  + P  L +CS D  +  WD++S +  P 
Sbjct: 93  ALVWNLSRTSSNAIEYELHGHFRAITDINFHPSHPELLATCSIDTYVHAWDMRSPQR-PY 151

Query: 198 SVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDKRSEKPLQKLL-QKEPFNTIAFSK 256
              S  S   ++ KW+  + N+  S   +S  +   ++   PL KL       N I F+K
Sbjct: 152 YSTSDWSAGASQVKWNLQNANVLASSHANSVFIWDIRKGCTPLYKLSGNNSSVNNIDFNK 211

Query: 257 HSSNLFAAAGTDAMVYLFD-SRKPTEALHSMSGHQEAVTSLEFAHHKDGILCS---GGSD 312
              N   ++  D  V  +D S+  TE L ++   +  V    +    DG       GG++
Sbjct: 212 VKENEIMSSSNDGTVKFWDYSKSSTEPLFTIKA-EFPVWRGRYLPFGDGCCIMPMVGGNN 270

Query: 313 RRVLLWDLFQIGTEQQEEDADDGGPEL--LMMHAGHKSAINDF 353
                  ++ I    + E +++   +L  + +  GH + + DF
Sbjct: 271 ------SIYLINNSWRNEISEEKEAKLQPIYVFKGHSNIVTDF 307

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/165 (21%), Positives = 82/165 (49%), Gaps = 15/165 (9%)

Query: 170 ASPGELISCSDDGSIAIWDIKSGKTVPTSVNSL------HSDIVNECKWHESDPNIYGSV 223
           + P  ++S S+  ++ +W++       TS N++      H   + +  +H S P +  + 
Sbjct: 80  SKPHWVVSTSNQKAL-VWNLSR-----TSSNAIEYELHGHFRAITDINFHPSHPELLATC 133

Query: 224 SEDSFLMIHDKRS-EKPLQKLLQ-KEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTE 281
           S D+++   D RS ++P           + + ++  ++N+ A++  ++ V+++D RK   
Sbjct: 134 SIDTYVHAWDMRSPQRPYYSTSDWSAGASQVKWNLQNANVLASSHANS-VFIWDIRKGCT 192

Query: 282 ALHSMSGHQEAVTSLEFAHHKDGILCSGGSDRRVLLWDLFQIGTE 326
            L+ +SG+  +V +++F   K+  + S  +D  V  WD  +  TE
Sbjct: 193 PLYKLSGNNSSVNNIDFNKVKENEIMSSSNDGTVKFWDYSKSSTE 237

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 29/135 (21%), Positives = 52/135 (38%), Gaps = 14/135 (10%)

Query: 252 IAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEAVTSLEFAHHKDGILCSGGS 311
           I F      L A    D  V+ +D R P    +S S      + +++      +L S  +
Sbjct: 120 INFHPSHPELLATCSIDTYVHAWDMRSPQRPYYSTSDWSAGASQVKWNLQNANVLASSHA 179

Query: 312 DRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGHKSAINDFSFSPNVPWLMASVEEENI 371
           +  V +WD+ +             G   L   +G+ S++N+  F+      + S   +  
Sbjct: 180 NS-VFIWDIRK-------------GCTPLYKLSGNNSSVNNIDFNKVKENEIMSSSNDGT 225

Query: 372 VQIWKPSRKLTNPYF 386
           V+ W  S+  T P F
Sbjct: 226 VKFWDYSKSSTEPLF 240

 Score = 32.3 bits (72), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 33/140 (23%), Positives = 60/140 (42%), Gaps = 16/140 (11%)

Query: 249 FNTIAFSKHSSNLFAAAGTDAMVY-LFDSRKPTEALHSMSGHQEAVTSLEFAHHKDGI-L 306
           FN ++ +    ++  A+ T   V  L D   P   L  ++  Q  V  ++++ H      
Sbjct: 27  FNAVSINPSGRDVVLASRTGLYVVDLDDPFSPPRWLQHITPWQ--VADIQWSPHPSKPHW 84

Query: 307 CSGGSDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGHKSAINDFSFSPNVPWLMASV 366
               S+++ L+W+L +  +   E +          +H GH  AI D +F P+ P L+A+ 
Sbjct: 85  VVSTSNQKALVWNLSRTSSNAIEYE----------LH-GHFRAITDINFHPSHPELLATC 133

Query: 367 EEENIVQIWKPSRKLTNPYF 386
             +  V  W   R    PY+
Sbjct: 134 SIDTYVHAWD-MRSPQRPYY 152

>CAGL0K09284g Chr11 (915766..918501) [2736 bp, 911 aa] {ON} highly
           similar to uniprot|P25635 Saccharomyces cerevisiae
           YCR057c PWP2 periodic tryptophan protein
          Length = 911

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 38/159 (23%), Positives = 74/159 (46%), Gaps = 9/159 (5%)

Query: 174 ELISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHD 233
            +++ ++DG I +WD+ SG  + T     H+  V   ++ +    ++ S S D  +   D
Sbjct: 355 RVVTAAEDGKIKVWDVASGFCLATFEE--HTSAVTAVQFAKKGQVLF-SASLDGTVRAWD 411

Query: 234 KRSEKPLQKLLQKE--PFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQE 291
               +  +     E   F  +A  + S  + +A  TD+      S +  + L ++SGH+ 
Sbjct: 412 LIRYRNFRVFTATERVQFTCLAV-EPSGEVVSAGSTDSFDVFVWSVQTGQLLDTLSGHEG 470

Query: 292 AVTSLEFAHHKDGILCSGGSDRRVLLWDLFQIGTEQQEE 330
            V+ L F+  ++ +L S   D+ + +W +F  G  QQ E
Sbjct: 471 PVSCLAFS-MENAVLASASWDKTIRIWSIF--GRSQQVE 506

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.131    0.388 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 47,559,312
Number of extensions: 2242093
Number of successful extensions: 10244
Number of sequences better than 10.0: 1027
Number of HSP's gapped: 8788
Number of HSP's successfully gapped: 1682
Length of query: 396
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 284
Effective length of database: 40,638,807
Effective search space: 11541421188
Effective search space used: 11541421188
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 67 (30.4 bits)