Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_56.223416.8ON51951927710.0
KLTH0C11572g6.8ON51851914530.0
SAKL0E00792g6.8ON5115188771e-111
TDEL0G046306.8ON5035157132e-87
Kpol_1045.796.8ON5085186933e-84
YPL272C6.8ON5175236621e-79
Skud_16.56.8ON5155306586e-79
NDAI0G00860singletonON5235316586e-79
KNAG0E027706.8ON5085186446e-77
Smik_6.4806.8ON5165236446e-77
TPHA0J002606.8ON5155186384e-76
KAFR0B065106.8ON5085306332e-75
Suva_16.336.8ON5185236291e-74
CAGL0A01089g6.8ON5355616152e-72
TPHA0M001806.8ON5035256095e-72
NCAS0D021806.8ON5155275486e-63
ACR018C6.8ON4784525091e-57
Ecym_30116.8ON5095254953e-55
TBLA0A072206.8ON5095434655e-51
Kpol_1032.1singletonON2462482132e-18
TDEL0E051105.119ON4692951447e-09
KLTH0C02178g5.119ON4643011384e-08
CAGL0K00737g5.119ON4574301278e-07
NDAI0D023605.119ON4703011091e-04
ZYRO0F01540g5.119ON4702921010.001
Kwal_27.98985.119ON460541010.001
Kpol_1010.495.119ON4811311000.001
TPHA0H009605.119ON476145980.002
YGR212W (SLI1)5.119ON46855970.003
Skud_7.5485.119ON47590950.006
Ecym_24835.119ON461287930.008
Smik_16.945.119ON46663900.019
SAKL0G15004g5.119ON456144890.026
NCAS0A073905.119ON47886860.059
Kpol_191.16.8ON139137780.19
KNAG0G007005.119ON45687790.45
Suva_7.5065.119ON466100732.4
TBLA0E019007.56ON84053723.1
TBLA0D023905.119ON453298713.9
NCAS0A064904.121ON67359697.5
CAGL0C02013g3.556ON32951687.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_56.22341
         (519 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_56.22341 s56 (56939..58498) [1560 bp, 519 aa] {ON} YPL272C ...  1071   0.0  
KLTH0C11572g Chr3 complement(950297..951853) [1557 bp, 518 aa] {...   564   0.0  
SAKL0E00792g Chr5 (58155..59690) [1536 bp, 511 aa] {ON} similar ...   342   e-111
TDEL0G04630 Chr7 complement(843474..844985) [1512 bp, 503 aa] {O...   279   2e-87
Kpol_1045.79 s1045 complement(184348..185874) [1527 bp, 508 aa] ...   271   3e-84
YPL272C Chr16 complement(26611..28164) [1554 bp, 517 aa] {ON} Pu...   259   1e-79
Skud_16.5 Chr16 complement(5816..7363) [1548 bp, 515 aa] {ON} YP...   258   6e-79
NDAI0G00860 Chr7 (181464..183035) [1572 bp, 523 aa] {ON}              258   6e-79
KNAG0E02770 Chr5 (557579..559105) [1527 bp, 508 aa] {ON} Anc_6.8...   252   6e-77
Smik_6.480 Chr6 (793043..794593) [1551 bp, 516 aa] {ON} YPL272C ...   252   6e-77
TPHA0J00260 Chr10 (59857..61404) [1548 bp, 515 aa] {ON} Anc_6.8 ...   250   4e-76
KAFR0B06510 Chr2 complement(1349540..1351066) [1527 bp, 508 aa] ...   248   2e-75
Suva_16.33 Chr16 complement(42245..43801) [1557 bp, 518 aa] {ON}...   246   1e-74
CAGL0A01089g Chr1 complement(109009..110616) [1608 bp, 535 aa] {...   241   2e-72
TPHA0M00180 Chr13 (36974..38485) [1512 bp, 503 aa] {ON} Anc_6.8 ...   239   5e-72
NCAS0D02180 Chr4 (406396..407943) [1548 bp, 515 aa] {ON} Anc_6.8      215   6e-63
ACR018C Chr3 complement(388482..389918) [1437 bp, 478 aa] {ON} S...   200   1e-57
Ecym_3011 Chr3 (22943..24472) [1530 bp, 509 aa] {ON} similar to ...   195   3e-55
TBLA0A07220 Chr1 (1800531..1802060) [1530 bp, 509 aa] {ON} Anc_6...   183   5e-51
Kpol_1032.1 s1032 (25..765) [741 bp, 246 aa] {ON} (25..765) [741...    87   2e-18
TDEL0E05110 Chr5 (941876..943285) [1410 bp, 469 aa] {ON} Anc_5.1...    60   7e-09
KLTH0C02178g Chr3 complement(196605..197999) [1395 bp, 464 aa] {...    58   4e-08
CAGL0K00737g Chr11 complement(81263..82636) [1374 bp, 457 aa] {O...    54   8e-07
NDAI0D02360 Chr4 (545485..546897) [1413 bp, 470 aa] {ON} Anc_5.1...    47   1e-04
ZYRO0F01540g Chr6 complement(124663..126075) [1413 bp, 470 aa] {...    44   0.001
Kwal_27.9898 s27 (112396..113778) [1383 bp, 460 aa] {ON} YGR212W...    44   0.001
Kpol_1010.49 s1010 (113037..114482) [1446 bp, 481 aa] {ON} (1130...    43   0.001
TPHA0H00960 Chr8 (201187..202617) [1431 bp, 476 aa] {ON} Anc_5.1...    42   0.002
YGR212W Chr7 (917040..918446) [1407 bp, 468 aa] {ON}  SLI1N-acet...    42   0.003
Skud_7.548 Chr7 (891732..893159) [1428 bp, 475 aa] {ON} YGR212W ...    41   0.006
Ecym_2483 Chr2 (946645..948030) [1386 bp, 461 aa] {ON} similar t...    40   0.008
Smik_16.94 Chr16 complement(178129..179529) [1401 bp, 466 aa] {O...    39   0.019
SAKL0G15004g Chr7 (1288241..1289611) [1371 bp, 456 aa] {ON} simi...    39   0.026
NCAS0A07390 Chr1 (1463090..1464526) [1437 bp, 478 aa] {ON} Anc_5...    38   0.059
Kpol_191.1 s191 complement(429..848) [420 bp, 139 aa] {ON} compl...    35   0.19 
KNAG0G00700 Chr7 complement(132337..133707) [1371 bp, 456 aa] {O...    35   0.45 
Suva_7.506 Chr7 (873531..874931) [1401 bp, 466 aa] {ON} YGR212W ...    33   2.4  
TBLA0E01900 Chr5 (462299..464821) [2523 bp, 840 aa] {ON} Anc_7.5...    32   3.1  
TBLA0D02390 Chr4 (600149..601510) [1362 bp, 453 aa] {ON} Anc_5.1...    32   3.9  
NCAS0A06490 Chr1 (1279402..1281423) [2022 bp, 673 aa] {ON} Anc_4...    31   7.5  
CAGL0C02013g Chr3 complement(209930..210919) [990 bp, 329 aa] {O...    31   7.8  

>Kwal_56.22341 s56 (56939..58498) [1560 bp, 519 aa] {ON} YPL272C -
           Hypothetical ORF [contig 186] FULL
          Length = 519

 Score = 1071 bits (2771), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 519/519 (100%), Positives = 519/519 (100%)

Query: 1   MSLTKKVYRNLTATEKTIICETAAGIKNGVLFSSTYFEGPDNVDNTSPSVSCMKMGKGLP 60
           MSLTKKVYRNLTATEKTIICETAAGIKNGVLFSSTYFEGPDNVDNTSPSVSCMKMGKGLP
Sbjct: 1   MSLTKKVYRNLTATEKTIICETAAGIKNGVLFSSTYFEGPDNVDNTSPSVSCMKMGKGLP 60

Query: 61  DAIMWQALSQIIKENAELRSSINKFMQFEAIDTIAFDDVVRKIEFDNLTDEKVSCYNGVP 120
           DAIMWQALSQIIKENAELRSSINKFMQFEAIDTIAFDDVVRKIEFDNLTDEKVSCYNGVP
Sbjct: 61  DAIMWQALSQIIKENAELRSSINKFMQFEAIDTIAFDDVVRKIEFDNLTDEKVSCYNGVP 120

Query: 121 PYLLRHIFDKCHFSIGQQKPLWQVFVIDQSMVVFHGHDVLFDGFAAATFHKLFLEALNSF 180
           PYLLRHIFDKCHFSIGQQKPLWQVFVIDQSMVVFHGHDVLFDGFAAATFHKLFLEALNSF
Sbjct: 121 PYLLRHIFDKCHFSIGQQKPLWQVFVIDQSMVVFHGHDVLFDGFAAATFHKLFLEALNSF 180

Query: 181 RNVKGQKSDLIFKTREDLIPLCQSLAAEHNVSLISSVKDQVLTYSQTALKNLYSLAIKKP 240
           RNVKGQKSDLIFKTREDLIPLCQSLAAEHNVSLISSVKDQVLTYSQTALKNLYSLAIKKP
Sbjct: 181 RNVKGQKSDLIFKTREDLIPLCQSLAAEHNVSLISSVKDQVLTYSQTALKNLYSLAIKKP 240

Query: 241 LRFIESGRLEHSGIPASNPYDLASYAGDLCGTVVFGNVNPERVRGLRALMNESKISFRSF 300
           LRFIESGRLEHSGIPASNPYDLASYAGDLCGTVVFGNVNPERVRGLRALMNESKISFRSF
Sbjct: 241 LRFIESGRLEHSGIPASNPYDLASYAGDLCGTVVFGNVNPERVRGLRALMNESKISFRSF 300

Query: 301 IISVTMFCLLPVLEPSEEKIIFSVPINLRESIPWASDLGVFQNNVLFECPLDLIKHDIEP 360
           IISVTMFCLLPVLEPSEEKIIFSVPINLRESIPWASDLGVFQNNVLFECPLDLIKHDIEP
Sbjct: 301 IISVTMFCLLPVLEPSEEKIIFSVPINLRESIPWASDLGVFQNNVLFECPLDLIKHDIEP 360

Query: 361 CSGISTFNQEFLEGSTLTDVGGVNEDQNDPQTVFRRILTHVTTELELAAMRLEKSHSSGE 420
           CSGISTFNQEFLEGSTLTDVGGVNEDQNDPQTVFRRILTHVTTELELAAMRLEKSHSSGE
Sbjct: 361 CSGISTFNQEFLEGSTLTDVGGVNEDQNDPQTVFRRILTHVTTELELAAMRLEKSHSSGE 420

Query: 421 DLIKAEREARYFAASSRSKIVEINDLLEVDLSSKIHSRYKIGDVCSTSSRKSDTFMSISY 480
           DLIKAEREARYFAASSRSKIVEINDLLEVDLSSKIHSRYKIGDVCSTSSRKSDTFMSISY
Sbjct: 421 DLIKAEREARYFAASSRSKIVEINDLLEVDLSSKIHSRYKIGDVCSTSSRKSDTFMSISY 480

Query: 481 CSSEISGLNLGIHYSEGFNMEYFVESFEGFLDSFPEFVC 519
           CSSEISGLNLGIHYSEGFNMEYFVESFEGFLDSFPEFVC
Sbjct: 481 CSSEISGLNLGIHYSEGFNMEYFVESFEGFLDSFPEFVC 519

>KLTH0C11572g Chr3 complement(950297..951853) [1557 bp, 518 aa] {ON}
           similar to uniprot|Q08984 Saccharomyces cerevisiae
           YPL272C Hypothetical ORF
          Length = 518

 Score =  564 bits (1453), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/519 (53%), Positives = 369/519 (71%), Gaps = 1/519 (0%)

Query: 1   MSLTKKVYRNLTATEKTIICETAAGIKNGVLFSSTYFEGPDNVDNTSPSVSCMKMGKGLP 60
           MS   +VYRNLT TEKTI+CETA G+KNGVLFS+TY++   N D +        M + L 
Sbjct: 1   MSSVLRVYRNLTPTEKTILCETATGVKNGVLFSATYYKNFPNKDLSDNETLRSDMNQRLS 60

Query: 61  DAIMWQALSQIIKENAELRSSINKFMQFEAIDTIAFDDVVRKIEFDNLTDEKVSCYNGVP 120
           D+++W+AL ++IKE+AELR ++++ ++FE +D I F+DVVRKIEFD   DE+V+CYNGVP
Sbjct: 61  DSMIWKALLKVIKEHAELRCAVSRNLEFEPVDKIDFEDVVRKIEFDCYADEQVNCYNGVP 120

Query: 121 PYLLRHIFDKCHFSIGQQKPLWQVFVIDQSMVVFHGHDVLFDGFAAATFHKLFLEALNSF 180
           PYLLRHIFDKCHF++GQ++PLWQ+FVID +MVVFHGHDVLFD FAAA FHKLFL+ALNS 
Sbjct: 121 PYLLRHIFDKCHFTLGQKQPLWQLFVIDGTMVVFHGHDVLFDTFAAANFHKLFLQALNSL 180

Query: 181 RNVKGQKSDLIFKTREDLIPLCQSLAAEHNVSLISSVKDQVLTYSQTALKNLYSLAIKKP 240
                     +FK  + L  L ++L  +      SS+ D   + SQ  L++LY+LAIKKP
Sbjct: 181 SE-SCTSPRPVFKGGKILPTLPRALFQKQEPQAASSITDAFYSQSQAILRSLYNLAIKKP 239

Query: 241 LRFIESGRLEHSGIPASNPYDLASYAGDLCGTVVFGNVNPERVRGLRALMNESKISFRSF 300
           LRFIESGR+EHS    S   +  +Y   LCGTVVFG ++  R + L+ ++N+ KIS ++F
Sbjct: 240 LRFIESGRIEHSTEQHSGTPEPLNYPNHLCGTVVFGTISTPRFKILKGILNDHKISMKTF 299

Query: 301 IISVTMFCLLPVLEPSEEKIIFSVPINLRESIPWASDLGVFQNNVLFECPLDLIKHDIEP 360
           IIS T+FCL PVL+ SE+KI FS+PINLR+ IPW+S LG++  NVL ECPL     +   
Sbjct: 300 IISATLFCLQPVLDSSEDKITFSLPINLRDLIPWSSPLGIYHRNVLIECPLGTAGRNSNC 359

Query: 361 CSGISTFNQEFLEGSTLTDVGGVNEDQNDPQTVFRRILTHVTTELELAAMRLEKSHSSGE 420
            +G    N E LEG TL+D    N DQ DP+++F R +THV+ EL+ A   LE       
Sbjct: 360 SAGSYVSNPELLEGMTLSDANQTNADQADPESLFERTVTHVSNELKKALQDLETGKFKDM 419

Query: 421 DLIKAEREARYFAASSRSKIVEINDLLEVDLSSKIHSRYKIGDVCSTSSRKSDTFMSISY 480
           D++K E+EA+++AA+S SKI+EINDL E+DLS+   S+Y + D+C+T SR ++TFMSISY
Sbjct: 420 DMMKMEQEAKFYAAASGSKIIEINDLSEIDLSNVNPSQYVVEDICATKSRCNNTFMSISY 479

Query: 481 CSSEISGLNLGIHYSEGFNMEYFVESFEGFLDSFPEFVC 519
             S   GLNLGIHYSE   M YFVESFE FL+++P+FVC
Sbjct: 480 SFSSTCGLNLGIHYSEDCEMNYFVESFEAFLENYPKFVC 518

>SAKL0E00792g Chr5 (58155..59690) [1536 bp, 511 aa] {ON} similar to
           uniprot|Q08984 Saccharomyces cerevisiae YPL272C
           Hypothetical ORF
          Length = 511

 Score =  342 bits (877), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 190/518 (36%), Positives = 303/518 (58%), Gaps = 19/518 (3%)

Query: 6   KVYRNLTATEKTIICETAAGIKNGVLFSSTYFEGPDNVDNTSPSVSCMKM-GKGLPDAIM 64
           K +R+L++ EK +  +     +NG++F++ Y    D  +  S + + + +  + L ++++
Sbjct: 5   KSFRSLSSVEKKLFSQNLNNKRNGLMFAAVYSTCFDKEETWSDNATLLTVKDQRLSNSLV 64

Query: 65  WQALSQIIKENAELRSSINKFMQFEAIDTIAFDDVVRKIEFDNLTDEKVSCYNGVPPYLL 124
            +AL ++I  N EL ++IN  ++F+ + TI FDDVV+K+EFD+  DE V+C++GVPPYLL
Sbjct: 65  SRALKKVINNNVELYTTINDNLEFQPVKTIMFDDVVQKVEFDSYKDELVNCHDGVPPYLL 124

Query: 125 RHIFDKCHFSIGQQKPLWQVFVIDQSMVVFHGHDVLFDGFAAATFHKLFLEALNSFRNVK 184
           RHIFDK  F   + KPLWQ+ ++D++MV+FHGHDVLFD FAAA FHKLF +ALN      
Sbjct: 125 RHIFDKNKFETAKHKPLWQILIVDETMVIFHGHDVLFDIFAAANFHKLFQQALNQLPK-D 183

Query: 185 GQKSDLIFKTREDLIPLCQSLAAEHNVSLISSVKDQVLTYSQTALKNLYSLAIKKPLRFI 244
           G   + +FK         +S+   H + L +   D     +Q+  K++Y+  IKKPL FI
Sbjct: 184 GPTLECLFKNDSKASFFPKSIYENHKLRLPAIATDLFQLQTQSFFKSVYNWTIKKPLDFI 243

Query: 245 ESGRLEHSGIP--ASNPYDLASYAGDLCGTVVFGNVNPERVRGLRALMNESKISFRSFII 302
            +    +SG+    S   D+   A +LCGT VFGN++ ERV  L+ +M +  I   SF+ 
Sbjct: 244 NTN--PNSGLKYYQSCYTDILLGANNLCGTTVFGNISAERVCALKKIMKQENICLSSFVC 301

Query: 303 SVTMFCLLPVLEPSEEKIIFSVPINLRESIPWASDLGVFQNNVLFECPLDLIKHDIEPCS 362
           ++ + CL P++      + FS+P++LR +IP AS  G+   NVL ECPL LI  D +   
Sbjct: 302 AIALLCLKPLVNNFGSSVTFSIPVDLRSTIPQASRFGLCYKNVLVECPLTLI--DDKVFQ 359

Query: 363 GISTFNQEFLEGSTLTDVGGVNEDQNDPQTV----FRRILTHVTTELELAAMRLEKSHSS 418
           G++ +N     G  + +    N+D N  +++    FR   THV   L+      E+S  +
Sbjct: 360 GLNVYN-----GYDIRNTKPTNKDPNYEESLLEYQFREACTHVDNTLKQRWRAWERSGFN 414

Query: 419 GEDLIKAEREARYFAASSRSKIVEINDLLEVDLSSKIHSRYKIGDVCSTSSRKSDTFMSI 478
            +D IK  +  +     S+ +I+E+N++ E       ++ + I DVC T S+  +TFMS+
Sbjct: 415 DDD-IKRMKFGKTEQGKSK-RIIEVNNVTEFQFHVDDNATFNIKDVCFTKSQNLETFMSL 472

Query: 479 SYCSSEISGLNLGIHYSEGFNMEYFVESFEGFLDSFPE 516
           S   SE SGLN+ IHY +G+NM+ FVE F+ F++   +
Sbjct: 473 SCAFSERSGLNVCIHYPDGYNMDVFVECFQSFMEELSQ 510

>TDEL0G04630 Chr7 complement(843474..844985) [1512 bp, 503 aa] {ON}
           Anc_6.8 YPL272C
          Length = 503

 Score =  279 bits (713), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 163/515 (31%), Positives = 281/515 (54%), Gaps = 26/515 (5%)

Query: 8   YRNLTATEKTIICETAAGIKNGVLFSSTYFEGPDNVDNTSPSVSCMKMGKGLPDAIMWQA 67
           +R+L   EK I+ ++  G +NGV+F + Y   P+   + +  ++       L  +++ + 
Sbjct: 3   FRSLGGFEKKILSQSLEGHRNGVVFGAMYSTTPEEWSDDATLLTYKDSRLNL--SLLSRT 60

Query: 68  LSQIIKENAELRSSINKFMQFEAIDTIAFDDVVRKIEFDNLTDEKVSCYNGVPPYLLRHI 127
           L+++I ++ EL ++IN+ ++F  +  I  ++V+  + F +  DE V+C  G PPYLLRHI
Sbjct: 61  LAKMISDHVELFTTINEKLEFAPVKEIKAEEVINAVTFGSYKDEFVNCRFGAPPYLLRHI 120

Query: 128 FDKCHFSIGQQKPLWQVFVIDQSMVVFHGHDVLFDGFAAATFHKLFLEALNSFRNVKGQK 187
           F++  F  G    LWQ++V+D+++VVFHGHDVLFD F+AA FHK+FL+ LNS     G K
Sbjct: 121 FNQTTFQPGSGNVLWQIYVVDETLVVFHGHDVLFDIFSAANFHKIFLQTLNSISK-SGSK 179

Query: 188 SDLIFKTREDLI-PLCQSLAAEHNVSLISSVKDQVLTYSQTALKNLYSLAIKKPLRFIES 246
              IFK  + ++ P  +S+     + L +   D     +Q+  K+LY  A+KKPL +I S
Sbjct: 180 LSTIFKLEKAVLPPFPKSIYDNAKLRLPAKAADLFNLQTQSFFKSLYFNAVKKPLDYINS 239

Query: 247 GRLEHSGIPASNPYDLASYAGDLCGTVVFGNVNPERVRGLRALMNESKISFRSFIISVTM 306
              +      +   D+     +LCGT +FG + P+R+  L  +  +  I  +SF+  +TM
Sbjct: 240 NPPQQLKEYRTRYADILRTDNNLCGTTIFGRILPKRLESLDCIFKQQNICLKSFVCGITM 299

Query: 307 FCLLPVLEPSEEKIIFSVPINLRESIPWASDLGVFQNNVLFECPLDLIKHDIEPCSGIST 366
            CL P+++     I F VP++LR S+  +S+ G+F  ++  ECPL LI  D +  + ++ 
Sbjct: 300 LCLKPIVKNYTGSITFCVPVDLRSSLEASSEFGMFYKDIRVECPLSLI--DDKNFNSLTV 357

Query: 367 FNQEFLEGSTLTDVGGVNEDQNDP-------QTVFRRILTHVTTELELAAMRLEKSHSSG 419
           +N          D   V   + DP       +  F+++  HV   L       EK   + 
Sbjct: 358 YNG--------YDSSAVKMPEKDPGYKEQLLEYQFKQVTDHVVAALRQRMKAWEKFGFND 409

Query: 420 EDLIKAEREARYFAASSRSKIVEINDL--LEVDLSSKIHSRYKIGDVCSTSSRKSDTFMS 477
           +D+ + +  +     ++ +K+++IND+  + VD    I  ++ + ++  T S K    MS
Sbjct: 410 DDIKRMKFGSD--DTATNTKLIQINDVSDIPVDAHEDISGKFHMRELNMTQSLKPGQLMS 467

Query: 478 ISYCSSEISGLNLGIHYSEGFNMEYFVESFEGFLD 512
           +SY  SE  GL++ IHY +G+NME FVE F+ F++
Sbjct: 468 LSYTHSE-KGLDICIHYPDGYNMESFVECFQSFIE 501

>Kpol_1045.79 s1045 complement(184348..185874) [1527 bp, 508 aa]
           {ON} complement(184350..185876) [1527 nt, 509 aa]
          Length = 508

 Score =  271 bits (693), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 177/518 (34%), Positives = 279/518 (53%), Gaps = 31/518 (5%)

Query: 8   YRNLTATEKTIICETAAGIKNGVLFSSTYFEGPDNVDNTSPSVSCMKMGKGLP-DAIMWQ 66
           +R L   EK ++ +  AG  NG++FS+ Y       D  +   + +   + L  D+ +  
Sbjct: 4   FRQLGTYEKKLVGQALAGQSNGIIFSAKYISNAQ--DGLTDDATLLTNSEPLLLDSRLVN 61

Query: 67  ALSQIIKENAELRSSINKFMQFEAIDTIAFDDVVRKIEFDNLTDEKVSCYNGVPPYLLRH 126
           AL +++ ++ ELR+++N+ ++FE +  I   D++  ++FD+L DE V+C+ G PPYLLRH
Sbjct: 62  ALQKMVLKHPELRTTVNEKLEFEEVKEIKTSDIITSVKFDSLKDEFVNCHLGAPPYLLRH 121

Query: 127 IFDKCHFSIGQQKPLWQVFVIDQSMVVFHGHDVLFDGFAAATFHKLFLEALNSFRNVKGQ 186
           IF++  F+ G  KPLW++ VID S+V+FHG DVLFD FAAA FHKLFLE LNS  +    
Sbjct: 122 IFNRNKFTPGSGKPLWELCVIDDSLVMFHGQDVLFDIFAAANFHKLFLETLNSMDD--EH 179

Query: 187 KSDLIFKTREDL------IPLCQSLAAEHNVSLISSVKDQVLTYSQTALKNLYSLAIKKP 240
            +DL +  R D       I   +++     + +     D V   +Q+  K+ Y  AIKKP
Sbjct: 180 ITDLEYIYRYDATKSNRSISFPRTIYENPKLRIPGKTIDLVNLQTQSFFKSFYVNAIKKP 239

Query: 241 LRFIESGRLEHSGIPASNPYDLASYAGDLCGTVVFGNVNPERVRGLRALMNESKISFRSF 300
           L  I +   E       N  D  + A  LCGT VFG++  +R   L ++     +  RSF
Sbjct: 240 LDII-TFNSEPMKYIKPNEIDFMNEASALCGTTVFGHITTDRFEYLNSIARHENVCIRSF 298

Query: 301 IISVTMFCLLPVLEPSEEKIIFSVPINLRESIPWASDLGVFQNNVLFECPLDLIKHDIEP 360
           I  + + CL  +++     I FS+P+NLRESI   SD G+F   +L ECPL LI  D + 
Sbjct: 299 ICGIALLCLKSMIKDFTGSITFSIPVNLRESIEGPSDFGLFYKTILVECPLSLI--DDQV 356

Query: 361 CSGISTFNQEFLEGSTLTDVGGVNEDQNDP-------QTVFRRILTHVTTELELAAMRLE 413
            + I+ +N          D   V   + DP       +  F++I   V+T ++   MR  
Sbjct: 357 YNNINVYNG--------YDNSNVKVPETDPTFEEKKLEYQFKQISDLVSTTMK-ERMRAW 407

Query: 414 KSHSSGEDLIKAEREARYFAASSRSKIVEINDLLEVDLSSKIHSRYKIGDVCSTSSRKSD 473
           + +   +D IK  +      AS+ +KI++IND+ E  ++S   S+  I ++  T S  + 
Sbjct: 408 RRNGFNDDDIKKMKFTSDDKASN-TKIIQINDVSEFKINSSKSSKVSIKELNFTHSISNS 466

Query: 474 TFMSISYCSSEISGLNLGIHYSEGFNMEYFVESFEGFL 511
            FMS+SY   + +G N+ IHY + ++ME FVE F+ F+
Sbjct: 467 DFMSLSYTYCKETGSNICIHYPDAYDMEKFVERFQSFV 504

>YPL272C Chr16 complement(26611..28164) [1554 bp, 517 aa] {ON}
           Putative protein of unknown function; gene expression
           induced in response to ketoconazole; YPL272C is not an
           essential gene
          Length = 517

 Score =  259 bits (662), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 165/523 (31%), Positives = 277/523 (52%), Gaps = 25/523 (4%)

Query: 7   VYRNLTATEKTIICETAAGIKNGVLFSSTYF-------EGPDNVDNTSPSVSCMKMGKGL 59
            +R L++ EK I+ ++    +NG +FSSTY        +   + D  +   +  K    L
Sbjct: 3   TFRPLSSFEKKILTQSLNDQRNGTIFSSTYSKSLSRENDADWHSDEVTLGTNSSKDDSRL 62

Query: 60  PDAIMWQALSQIIKENAELRSSINKFMQFEAIDTIAFDDVVRKIEFDNLTDEKVSCYNGV 119
              ++   L ++IK    L +++N+  +FE +  +   D+V  IEF+ + D++V+C+ GV
Sbjct: 63  TLPLIATTLKRLIKSQPALFATVNEEWEFEPLKQLKTSDIVNVIEFETIKDKEVNCHWGV 122

Query: 120 PP-YLLRHIFDKCHFSIGQQKPLWQVFVIDQSMVVFHGHDVLFDGFAAATFHKLFLEALN 178
           PP YLLRH F+K  F  G  KPLW ++VID++++VFHGHDVLFD F+AA FHKLFL+ LN
Sbjct: 123 PPPYLLRHAFNKTRFVPGSNKPLWTLYVIDEALLVFHGHDVLFDIFSAANFHKLFLKELN 182

Query: 179 SFRNVKGQKSDLIFKTRE---DLIPLCQSLAAEHNVSLISSVKDQVLTYSQTALKNLYSL 235
               V   +  ++F   +     +   +S+     + L +         +Q+  K++Y  
Sbjct: 183 EISTVTHSEDRILFDVNDINLSELKFPKSIYDSAKLHLPAMTPQIFHKQTQSFFKSIYYN 242

Query: 236 AIKKPLRFIESGRLEHSGIPASN--PY-DLASYAGDLCGTVVFGNVNPERVRGLRALMNE 292
            +K+P  ++ +     S + A+    Y D+ +    LCGT VFG VN +R   L++++N+
Sbjct: 243 TLKRPFGYLTNQTSLSSSVSATQLKKYNDILNAHTSLCGTTVFGIVNNQRFNYLKSIVNQ 302

Query: 293 SKISFRSFIISVTMFCLLPVLEPSEEKIIFSVPINLRESIPWASDLGVFQNNVLFECPLD 352
             I  RSFI  + M CL P+++     I+F++PINLR  +     LG+F   +  ECPL 
Sbjct: 303 EHICLRSFICGIAMICLKPLVKDFSGTIVFTIPINLRNHLGLGGSLGLFFKELRVECPLS 362

Query: 353 LIKHDIEPCSGISTFNQEFLEGSTLTDVGGVNEDQNDPQTVFRRILTHVTTELELAAMRL 412
           LI  ++           EFL  S   +      ++   +  F ++  HV+  +       
Sbjct: 363 LIDDELSA--------NEFLTNSNDNEDNDDEFNERLMEYQFNKVTKHVSGFIMAKLRSW 414

Query: 413 EKSHSSGEDL--IKAEREARYFAASSRSKIVEINDLLEVDLSSKIHSR-YKIGDVCSTSS 469
           EK+  + +D+  +K + +  +   +SR+K+++IND+ ++ LS     + +KI     TSS
Sbjct: 415 EKNGFNDDDIRRMKYDNDDDFHIQNSRTKLIQINDVSDISLSMNGDDKSFKIVSTGFTSS 474

Query: 470 RKSDTFMSISYCSSEISGLNLGIHYSEGFNMEYFVESFEGFLD 512
               T MS+SY   E  GLN+ IHY + +N+E FVE FE F++
Sbjct: 475 INRPTLMSLSYTYCEEMGLNICIHYPDSYNLESFVECFESFIE 517

>Skud_16.5 Chr16 complement(5816..7363) [1548 bp, 515 aa] {ON}
           YPL272C (REAL)
          Length = 515

 Score =  258 bits (658), Expect = 6e-79,   Method: Compositional matrix adjust.
 Identities = 166/530 (31%), Positives = 281/530 (53%), Gaps = 41/530 (7%)

Query: 7   VYRNLTATEKTIICETAAGIKNGVLFSSTYFEGPD-------NVDNTSPSVSCMKMGKGL 59
            +R L++ EK ++ ++    +NG +FSSTY + P+       N D  +   +  K    L
Sbjct: 3   TFRPLSSFEKKLLTQSLNDQRNGTIFSSTYSKSPNRGNDADWNSDEVTLGTNSSKDDSRL 62

Query: 60  PDAIMWQALSQIIKENAELRSSINKFMQFEAIDTIAFDDVVRKIEFDNLTDEKVSCYNGV 119
               +   L ++IK    L +++N+  +FE +  +   D+V  IEF+ + D++V+C+ GV
Sbjct: 63  TLPSIAATLKRLIKSQPALFATVNEEWEFEPLKQLKTSDIVNVIEFETIKDKEVNCHWGV 122

Query: 120 PP-YLLRHIFDKCHFSIGQQKPLWQVFVIDQSMVVFHGHDVLFDGFAAATFHKLFLEALN 178
           PP YLLRH F+K  F  G  KPLW ++VID++++VFHGHDVLFD F+AA FHKLFL+ LN
Sbjct: 123 PPPYLLRHAFNKTRFVPGSNKPLWTLYVIDEALLVFHGHDVLFDIFSAANFHKLFLKELN 182

Query: 179 SFRNVKGQKSDLIFKTREDL----IPLCQSLAAEHNVSLISSVKDQVLTYSQTALKNLYS 234
           +  +++    D +     D+    +   +S+     + L +         +Q+  K+++ 
Sbjct: 183 NI-SLEAHSDDRVLFDISDVNISNLNFPKSIYDSAKLHLPAMTPQIFHKQTQSFFKSIFY 241

Query: 235 LAIKKPLRFIESGRLEHSGIPASNPYDLASY------AGDLCGTVVFGNVNPERVRGLRA 288
             +K+P  ++ +   + S  P+++   L  Y         LCGT VFG VN +R   L++
Sbjct: 242 NTLKRPFGYLTN---QTSLGPSTSTTQLKKYNDILNAHSSLCGTTVFGIVNNQRFNYLKS 298

Query: 289 LMNESKISFRSFIISVTMFCLLPVLEPSEEKIIFSVPINLRESIPWASDLGVFQNNVLFE 348
           ++N+  I  RSFI  + M CL P+++     I+FS+PI+LR+++     LG+F   +  E
Sbjct: 299 IVNQEHICLRSFICGIAMICLKPLVKDFTGAIVFSIPIDLRKNLDLGESLGLFFKELRIE 358

Query: 349 CPLDLIKHDIEPCSGISTFNQEFLEGSTLTDVGGVNEDQNDPQTVFRRILTHVTTELELA 408
           CPL LI  ++     ++  N +        D    NE   + Q  F ++  HV+  +   
Sbjct: 359 CPLSLIDDELSADEFLANRNDK-------EDDDEFNEKLMEYQ--FNKVTKHVSDFIMAK 409

Query: 409 AMRLEKSHSSGEDLIKAEREARY-----FAASSRSKIVEINDLLEVDLSSKIHSR-YKIG 462
               EK+  + +D+    R  +Y        +S++K+++IND+ ++ LS     + +KI 
Sbjct: 410 LKSWEKNGFNDDDI----RRMKYDNDDCHIQNSKTKLIQINDVSDISLSMNNDEKAFKII 465

Query: 463 DVCSTSSRKSDTFMSISYCSSEISGLNLGIHYSEGFNMEYFVESFEGFLD 512
               TSS    T MS+SY   E  GLN+ IHY + +N+E FVE FE F++
Sbjct: 466 SSGFTSSINRPTLMSLSYTYCEEMGLNICIHYPDSYNLESFVECFESFIE 515

>NDAI0G00860 Chr7 (181464..183035) [1572 bp, 523 aa] {ON} 
          Length = 523

 Score =  258 bits (658), Expect = 6e-79,   Method: Compositional matrix adjust.
 Identities = 161/531 (30%), Positives = 279/531 (52%), Gaps = 39/531 (7%)

Query: 9   RNLTATEKTIICETAAGIKNGVLFSSTYFEGPDNVDNTSPSVSCMKMGKG---LPDAIMW 65
           R L++ EK ++ +T    +NG+ +++ Y     +  +++ S +   +      L   I+ 
Sbjct: 4   RALSSFEKKVLSQTLDSKRNGISYTARYVSKVGSSSDSTLSDAATLLATKDIRLNIGIVT 63

Query: 66  QALSQIIKENAELRSSINKFMQFEAIDTIAFDDVVRKIEFDNLTDEKVSCYNGVPPYLLR 125
           + L ++IK++ EL S+IN+  +F+ +  I  +DV+  I FD   DE+++C++G PPYLLR
Sbjct: 64  RVLERLIKKHIELYSTINENYEFQILTKIKPEDVISVITFDTYKDEQINCHSGAPPYLLR 123

Query: 126 HIFDKCHFSIGQQKPLWQVFVIDQSMVVFHGHDVLFDGFAAATFHKLFLEALN------S 179
           HIF+K  F +   KPLW++++ID++M++FHG D+LFD F+AA FHKLF + LN      +
Sbjct: 124 HIFNKEKFELN--KPLWKLYIIDETMIIFHGFDMLFDIFSAANFHKLFFDELNDYFLTNT 181

Query: 180 FRNVKGQKSDLIFK---TREDLIP----LCQSLAAEHNVSLISSVKDQVLTYSQTALKNL 232
           F     +  D++FK   + ++ +P      +S+     + L +   D     +++  K +
Sbjct: 182 FSKSNSKPLDVVFKINVSDKNFVPNFEEFPRSIFDNPKLHLPAMTPDLFNLQTKSFFKTI 241

Query: 233 YSLAIKKPLRFIESGRLEHSG---------IPASNPYDLASYAGDLCGTVVFGNVNPERV 283
           YS  IKKP+    +G   H+              N  D+      LCGT VFG V+P R 
Sbjct: 242 YSNTIKKPIDLF-NGSNSHTKNDITSQLKEYQTHNYLDMLGITSSLCGTTVFGTVSPTRY 300

Query: 284 RGLRALMNESKISFRSFIISVTMFCLLPVLEPSEEKIIFSVPINLRESIPWASDLGVFQN 343
             L+ +M + +I  RSFI  + M CL P ++     IIFS+PINLR  I  A + G+F  
Sbjct: 301 NYLKGMMKQDEICLRSFICGIVMICLKPSIKNYSGNIIFSIPINLRNYIDGAKNFGLFYK 360

Query: 344 NVLFECPLDLIKHDIEPCSGISTFNQEFLEGSTLTDVGGVNEDQNDPQTVFRRILTHVTT 403
           +V  +CPL LI            F     + S++ D   +  ++   +  F+++ T    
Sbjct: 361 DVKIDCPLSLIDD--------RNFKYNGYKDSSIPDENDLEFNEKLLEYQFKQV-TEFIE 411

Query: 404 ELELAAMRLEKSHSSGEDLIKAEREARYFAASSRSKIVEINDLLEVDLSSKIHSR--YKI 461
            + L  +++ +  +  +D IK  +          SKI++IND  E+ L    ++   + +
Sbjct: 412 NVILERLKIWEKFNFNDDDIKRMKFDHDEVLGQNSKIIQINDTTEIMLGENDNNNKAFTL 471

Query: 462 GDVCSTSSRKSDTFMSISYCSSEISGLNLGIHYSEGFNMEYFVESFEGFLD 512
            +   T +   + FMS+S+   E +GLN+ IHY +G++ME FVE F+ F++
Sbjct: 472 TNPNFTRTLSGNEFMSVSFAICEETGLNVCIHYPDGYSMETFVECFQTFIE 522

>KNAG0E02770 Chr5 (557579..559105) [1527 bp, 508 aa] {ON} Anc_6.8
           YPL272C
          Length = 508

 Score =  252 bits (644), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 162/518 (31%), Positives = 279/518 (53%), Gaps = 31/518 (5%)

Query: 9   RNLTATEKTIICETAAGIKNGVLFS---STYFEGPDNVDNTSPSVSCMKMGKGLPDAIMW 65
           R L++ EK ++ ++  G+KNG  F    ST+ EG  + + T  +V   ++  GL    + 
Sbjct: 5   RALSSFEKKLLLQSVDGLKNGTTFGAEYSTFKEGWSDEEATLLTVKDSRLCLGL----LT 60

Query: 66  QALSQIIKENAELRSSINKFMQFEAIDTIAFDDVVRKIEFDNLTDEKVSCYNGVPPYLLR 125
           +AL  +IK++ EL  +IN+  +FE +  I   DV+  I+FD+  DEK++C  G PPYLLR
Sbjct: 61  KALENLIKKHIELFLTINEQFEFEVLKKIKTSDVISTIQFDSFKDEKINCQLGAPPYLLR 120

Query: 126 HIFDKCHFSIGQQKPLWQVFVIDQSMVVFHGHDVLFDGFAAATFHKLFLEALN--SFRNV 183
           HIF+   F  G  KPLW+++++D S+  FHG D LFD F+ A FH+L L+ +N  S R  
Sbjct: 121 HIFNHDRFVPGSGKPLWKLYLLDDSLAFFHGQDCLFDVFSTANFHRLLLKEVNLLSSRPQ 180

Query: 184 KGQKSDLIFKTREDLIP----LCQSLAAEHNVSLISSVKDQVLTYSQTALKNLYSLAIKK 239
           K +K D +FK   D +     L +S+     + + +   D     +Q+  K++Y   +KK
Sbjct: 181 KWKKLDYVFKFGPDSMSEVKQLPKSIYDNPKLYIPTLNPDLFNLQTQSFFKSIYVNTVKK 240

Query: 240 PLRFIESGRLEHSGIPASNPY-DLASYAGDLCGTVVFGNVNPERVRGLRALMNESKISFR 298
           P+ F+ +  +    + ++  Y D+      LCG  VFG V+ ER + L  ++N+  +  +
Sbjct: 241 PIEFLTNTDVSFLSLNSNMKYNDILDINSKLCGNTVFGCVSNERFKYLNTIINQEGLCLK 300

Query: 299 SFIISVTMFCLLPVLEPSEEKIIFSVPINLRESIPWASDLGVFQNNVLFECPLDLIKHDI 358
           SFI+ + M CL P+++     + FS+P++LR  +    D G++  ++  ECPL LI  D 
Sbjct: 301 SFIVGIAMLCLKPMVKNLSGTVTFSIPVDLRSFVDEPRDFGLYYKDIRVECPLSLIDDDK 360

Query: 359 EPCSGISTFNQEFLEGSTLTDVGGVNEDQNDPQTVFRRILTHVTTELELAAMRLEKSHSS 418
                    +++ ++G+++++    + D+   +  F+ I   V   LE    R  K+  +
Sbjct: 361 ---------SKDCMKGASVSE---EDFDEKLMEYQFKNITGFVRNHLEQRLTRFSKTGFN 408

Query: 419 GEDL--IKAEREARYFAASSRSKIVEIND--LLEVDLSSKIHSRYKIGDVCSTSSRKSDT 474
            +D+  +K + +     +S+    ++I D  L+ V+   + +S + I     T S  S+ 
Sbjct: 409 DDDIRRMKFDDKNTLGGSSNNGTFIQIYDTSLINVNEFGEPNS-FMIRACNLTKSLNSEE 467

Query: 475 FMSISYCSSEISGLNLGIHYSEGFNMEYFVESFEGFLD 512
            MS+SY   E +GLN+ IHY E + ME FVE F+ FL+
Sbjct: 468 LMSLSYTYCEENGLNICIHYPENYKMESFVECFQSFLE 505

>Smik_6.480 Chr6 (793043..794593) [1551 bp, 516 aa] {ON} YPL272C
           (REAL)
          Length = 516

 Score =  252 bits (644), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 163/523 (31%), Positives = 281/523 (53%), Gaps = 26/523 (4%)

Query: 7   VYRNLTATEKTIICETAAGIKNGVLFSSTYFE--GPDN-----VDNTSPSVSCMKMGKGL 59
            +R L++ EK ++ ++    +NG +FSSTY +  G +N      D  +   +  K    L
Sbjct: 3   TFRPLSSFEKKLLTQSLNDQRNGTIFSSTYSKSLGKENDADWHSDEVTLGTNSSKDDSRL 62

Query: 60  PDAIMWQALSQIIKENAELRSSINKFMQFEAIDTIAFDDVVRKIEFDNLTDEKVSCYNGV 119
              ++   L ++IK    L ++IN+  +FE ++ +   D+V  IEF+ L D++V+C+ GV
Sbjct: 63  TLPLIATTLKRLIKSQPALFATINEEWEFEPLEQLKTSDIVNVIEFETLKDKEVNCHWGV 122

Query: 120 PP-YLLRHIFDKCHFSIGQQKPLWQVFVIDQSMVVFHGHDVLFDGFAAATFHKLFLEALN 178
           PP YLLRH F+K  F  G  +PLW ++VID++++VFHGHDVLFD F+AA FHKLFL+ LN
Sbjct: 123 PPPYLLRHAFNKTRFIPGSNRPLWTLYVIDETLLVFHGHDVLFDIFSAANFHKLFLKELN 182

Query: 179 SFRNVKGQKSDLIFKTREDLIP---LCQSLAAEHNVSLISSVKDQVLTYSQTALKNLYSL 235
           +  +V   +  ++F      I      +S+     + L +         +Q+  K+++  
Sbjct: 183 NISSVTHYEDRILFDINNVSISDLNFPKSIYDSAKLHLPAMTPQIFHKQTQSFFKSIFYN 242

Query: 236 AIKKPLRFIESGRLEHSGIPASN--PY-DLASYAGDLCGTVVFGNVNPERVRGLRALMNE 292
            +K+P  ++ +     S   A+    Y D+ +    LCGT VFG V+ +R   L++++N+
Sbjct: 243 TLKRPFGYLTNQTSISSPASATQLKKYNDILNAHSSLCGTTVFGIVSNQRFNYLKSIVNQ 302

Query: 293 SKISFRSFIISVTMFCLLPVLEPSEEKIIFSVPINLRESIPWASDLGVFQNNVLFECPLD 352
             I  RSFI  + M CL P+++     I+FS+PI+LR+ +     LG+F   +   CPL 
Sbjct: 303 EHICLRSFICGIAMICLKPLVKDFSGTIVFSIPIDLRKHLGLGESLGLFFKELRIACPLS 362

Query: 353 LIKHDIEPCSGISTFNQEFLEGSTLTDVGGVNEDQNDPQTVFRRILTHVTTELELAAMRL 412
           LI  ++           EFL  S   +     +++   +  F  +  HV++ +       
Sbjct: 363 LIDDELSV--------NEFLANSNDNEEDEEFDEK-LMEYQFNNVTKHVSSFIMAKLKSW 413

Query: 413 EKSHSSGEDL--IKAEREARYFAASSRSKIVEINDLLEVDLSSKIHSR-YKIGDVCSTSS 469
           EK+  + +D+  +K + +  +   +S++K+V+IND+ ++ LS     + +KI     TSS
Sbjct: 414 EKNGFNDDDIRRMKYDNDDEFHIQNSKTKLVQINDVSDISLSMNNDDKSFKIVSSGFTSS 473

Query: 470 RKSDTFMSISYCSSEISGLNLGIHYSEGFNMEYFVESFEGFLD 512
               T +S+SY   +  GLN+ IHY + +N+E FVE FE F++
Sbjct: 474 INRPTLLSLSYTYCQEMGLNICIHYPDSYNLESFVECFESFIE 516

>TPHA0J00260 Chr10 (59857..61404) [1548 bp, 515 aa] {ON} Anc_6.8
           YPL272C
          Length = 515

 Score =  250 bits (638), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 164/518 (31%), Positives = 273/518 (52%), Gaps = 22/518 (4%)

Query: 8   YRNLTATEKTIICETAAGIKNGVLFSSTYFEGPDN--VDNTSPSVSCMKMGKGLPDAIMW 65
           +R L + E+ ++ E+     NG +FS+ Y +   N  +++ + ++        +    + 
Sbjct: 3   FRPLASYERNVLIESYENQTNGTIFSAKYTDMQTNSTINDDAATLLTQNEENNMFSRFI- 61

Query: 66  QALSQIIKENAELRSSINKFMQFEAIDTIAFDDVVRKIEFDNLTDEKVSCYNGVPPYLLR 125
            AL+ +I EN EL ++IN  ++FE I  I  DDV+  I+F++  DE V+C NG PPYLLR
Sbjct: 62  NALATVITENPELYTTINTKLEFEPITEIKTDDVISSIKFNSTKDEFVNCKNGAPPYLLR 121

Query: 126 HIFDKCHFSIGQQKPLWQVFVIDQSMVVFHGHDVLFDGFAAATFHKLFLEALNSFRNVKG 185
           HIF+K  F  G  KPLW ++++D S+V+FHG DVLFD ++AA+FH+ F  AL        
Sbjct: 122 HIFNKDKFVPGSGKPLWNLYIVDDSIVIFHGQDVLFDIYSAASFHRKFFAALEG-ATPTS 180

Query: 186 QKSDLIFKTREDL------IPLCQSLAAEHNVSLISSVKDQVLTYSQTALKNLYSLAIKK 239
           +K   IF+   DL       P  +S+     + L +   D V   ++  LK++ S  I K
Sbjct: 181 EKLTTIFRL-SDLSKSALTYPFPKSIYDSPLLMLPAKTIDLVSLQTRFFLKSVVSKTIVK 239

Query: 240 PLRFIESGRLEHSGIPASNPYDLASYAGDLCGTVVFGNVNPERVRGLRALMNESKISFRS 299
           PL  I            S+P D+      LCGT VFGN++ ER   L+++  E  +  +S
Sbjct: 240 PLNIIMFNDEPMKSFTNSDPMDILEKTSSLCGTTVFGNISNERFDYLQSIAEEENVCTKS 299

Query: 300 FIISVTMFCLLPVLEPSEEKIIFSVPINLRESIPWASDLGVFQNNVLFECPLDLIKHDIE 359
            +  +TM CL P+++     I FS+ +NLR+SI  +++ G+F  NV  E PL  I  ++ 
Sbjct: 300 LVCGITMLCLKPLIKDFSSNITFSIAMNLRDSIEESTEFGLFYKNVRIEVPLSFIDDNVF 359

Query: 360 PCSGISTFNQEFLEGSTLTDVGGVNEDQNDPQTVFRRILTHVTTELELAAMRLEKSHSSG 419
                +++N      S + +     E+Q      F +I T ++  L+   MR  + +   
Sbjct: 360 KLK--TSYNGYDASNSNIKETNPNYEEQLIAYQ-FNQIATFISRNLK-QRMRAWRRNGFN 415

Query: 420 EDLIKAEREARYFAASSRSKIVEINDLLEVDL-----SSKIHSRYKIGDVCSTSSRKSDT 474
           +D IK  +       +S +KI++IND+ ++       + +++S   + D+  T S   D 
Sbjct: 416 DDDIKMMKFGSKDKNTS-AKIIQINDISDLSFCPMNKNGELNS-VSLKDLSFTHSLVPDQ 473

Query: 475 FMSISYCSSEISGLNLGIHYSEGFNMEYFVESFEGFLD 512
           FMS+SY   + +G N+ IH+ E +++E FVE F+ F+D
Sbjct: 474 FMSLSYTHCKSTGSNICIHFPEVYDLELFVEKFQNFID 511

>KAFR0B06510 Chr2 complement(1349540..1351066) [1527 bp, 508 aa]
           {ON} Anc_6.8 YPL272C
          Length = 508

 Score =  248 bits (633), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 161/530 (30%), Positives = 276/530 (52%), Gaps = 51/530 (9%)

Query: 9   RNLTATEKTIICETAAGIKNGVLFSSTYFEGPDNVDNTSPSVSCMKMGKGLPD-AIMWQA 67
           R L++ E+ I+ ET    +NGV+F+++Y    +   + +   + + +    P  AI+ +A
Sbjct: 4   RTLSSYERKILDETIRRERNGVIFTASYSASSEEWGDDT---TLLTLKDSRPTIAILTKA 60

Query: 68  LSQIIKENAELRSSINKFMQFEAIDTIAFDDVVRKIEFDNLTDEKVSCYNGVPPYLLRHI 127
           + ++I  + EL ++IN+  +FE + +I  DD++  +EFD+  DEK++C+NG PPYLLRHI
Sbjct: 61  IQRLISRHVELFTTINENYEFEILKSIKKDDILNILEFDSYKDEKINCHNGCPPYLLRHI 120

Query: 128 FDKCHFSIGQQKPLWQVFVIDQSMVVFHGHDVLFDGFAAATFHKLFLEALNSFRN--VKG 185
           FD   F  G +KPLW + +ID+S+V+FHG D+LFD F+AA FHKL L+  N   N  +  
Sbjct: 121 FDNNRFVPGSKKPLWSLHIIDESLVIFHGQDMLFDIFSAANFHKLLLKETNIVANEPLDS 180

Query: 186 QKSDLIFKTREDL-----IPLCQSLAAEHNVSLISSVKDQVLTYSQTALKNLYSLAIKKP 240
            +SD+IF     +     + L +S+     + L ++  D     +Q+  K+++   +KKP
Sbjct: 181 SESDIIFSLENSIKKINNLKLSKSIYDNPRIHLPATSPDLFNLQTQSFFKSVFHSTVKKP 240

Query: 241 LRFIESG-RLEH-------SGIPASNPY-DLASYAGDLCGTVVFGNVNPERVRGLRALMN 291
           + ++ +  R +        S +     Y D+  Y   L  T VFG +  +R   L +L+ 
Sbjct: 241 IHYLVANVRTKEVTSDNTLSRVTTVQKYTDIFDYNTTLNNTTVFGKITRQRYEYLNSLIT 300

Query: 292 ESKISFRSFIISVTMFCLLPVLEPSEEKIIFSVPINLRESIPWAS-DLGVFQNNVLFECP 350
             +I F+SF++ + M CL P +E  E  + FS+ INLR  +  ++ + G+F  +VL + P
Sbjct: 301 NQRICFKSFMVGIIMLCLKPSIENFEGSMKFSIVINLRPFLKESNIEFGLFYKDVLIDVP 360

Query: 351 LDLIKHDIEPCSGISTFNQEFLEGSTLTDVGGVNEDQNDPQTV-------FRRILTHVTT 403
           L LI  +    SG   F+                   NDP          F+R+ + V  
Sbjct: 361 LSLIDDNAVMLSGYRDFS------------------DNDPDLTEKILEFQFKRVTSLVKD 402

Query: 404 ELELAAMRLEKSHSSGEDLIKAEREARYFAASSRSKIVEINDLLEVDL-SSKIHSRYKIG 462
            +E    +      + +D+    R+ +Y   +  +KI+ + D  EV L S K   +Y + 
Sbjct: 403 LIERRISKFSTMGFNDDDI----RQMKYGKPAEDTKIIRLFDTSEVSLGSGKRDGKYILH 458

Query: 463 DVCSTSSRKSDTFMSISYCSSEISGLNLGIHYSEGFNMEYFVESFEGFLD 512
           +   T S + + F S+SY   + SGLNL + + +  +ME FVE F+ F++
Sbjct: 459 NTNFTKSLRKNDFFSVSYTLCDNSGLNLCLQFPDDCDMEAFVECFQSFIE 508

>Suva_16.33 Chr16 complement(42245..43801) [1557 bp, 518 aa] {ON}
           YPL272C (REAL)
          Length = 518

 Score =  246 bits (629), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 157/523 (30%), Positives = 277/523 (52%), Gaps = 24/523 (4%)

Query: 7   VYRNLTATEKTIICETAAGIKNGVLFSSTYF-------EGPDNVDNTSPSVSCMKMGKGL 59
            +R L++ EK ++ ++    +NG +FSSTY        +   + D  +   +  K    L
Sbjct: 3   TFRPLSSFEKKLLTQSLNDQRNGTIFSSTYSKSSSKEADADWHSDEVTLGTNSSKDDSRL 62

Query: 60  PDAIMWQALSQIIKENAELRSSINKFMQFEAIDTIAFDDVVRKIEFDNLTDEKVSCYNGV 119
              ++   L ++IK    L +++N+  ++  +  +   D+V  IEF+   D++V+C+ GV
Sbjct: 63  TLPLIATTLKKLIKSQPALFATVNEDWEYAPLKQLKTSDIVNVIEFETTKDKEVNCHWGV 122

Query: 120 PP-YLLRHIFDKCHFSIGQQKPLWQVFVIDQSMVVFHGHDVLFDGFAAATFHKLFLEALN 178
           PP YLLRH F+K  F  G  KPLW ++VID++++VFHGHDVLFD F+AA FHKLFL+ LN
Sbjct: 123 PPPYLLRHAFNKTRFVPGSNKPLWTLYVIDETLLVFHGHDVLFDIFSAANFHKLFLKELN 182

Query: 179 SFRNVKGQKSDLIFKTRE---DLIPLCQSLAAEHNVSLISSVKDQVLTYSQTALKNLYSL 235
           S  +V      ++F   +     +   +S+     + L +     +   +Q+  K+++  
Sbjct: 183 SITSVSRSDDRVLFDINDVNFAELSFPKSIYDSAKLRLPAMTPQILHKQTQSFFKSIFYN 242

Query: 236 AIKKPLRFIESGRLEHSGIPASNPY---DLASYAGDLCGTVVFGNVNPERVRGLRALMNE 292
            +K+P  ++ +     S  P S      D+ +    LCGT VFG VN +R   L++++N+
Sbjct: 243 TLKRPFGYLTNQTSFSSPAPTSQLKRYNDILNTNSSLCGTTVFGIVNNQRFSYLKSIVNQ 302

Query: 293 SKISFRSFIISVTMFCLLPVLEPSEEKIIFSVPINLRESIPWASDLGVFQNNVLFECPLD 352
             I  RSFI  + M CL P+++     I+FS+PI+LR+ +     LG+F   +  ECPL 
Sbjct: 303 EHICLRSFICGIAMICLKPLVKDFSGTIVFSIPIDLRKHLNLGESLGLFFKELRIECPLS 362

Query: 353 LIKHDIEPCSGISTFNQEFLEGSTLTDVGGVNEDQNDPQTVFRRILTHVTTELELAAMRL 412
           LI  ++       + N+  +  +   +      ++   +  F ++  HV+  +       
Sbjct: 363 LIDDEL-------SINEFLVNSNDNENNDNDEFNEKLMEYQFNKVTKHVSNYIMTKLKSW 415

Query: 413 EKSHSSGEDL--IKAEREARYFAASSRSKIVEINDLLEVDLS-SKIHSRYKIGDVCSTSS 469
           E++  + +D+  +K + +  +   +S++K+++IND+ ++ LS S     +KI     T+S
Sbjct: 416 ERNGFNDDDIRRMKYDNDDDFHVQNSKTKLIQINDVSDISLSMSNDDKSFKIVSSGFTNS 475

Query: 470 RKSDTFMSISYCSSEISGLNLGIHYSEGFNMEYFVESFEGFLD 512
               T MS+SY   E  GLN+ IHY + +N+E FVE FE F++
Sbjct: 476 INRPTLMSLSYTYCEDMGLNICIHYPDSYNLESFVECFESFIE 518

>CAGL0A01089g Chr1 complement(109009..110616) [1608 bp, 535 aa] {ON}
           similar to uniprot|Q08984 Saccharomyces cerevisiae
           YPL272c
          Length = 535

 Score =  241 bits (615), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 176/561 (31%), Positives = 284/561 (50%), Gaps = 87/561 (15%)

Query: 9   RNLTATEKTIICETAAGIKNGVLFSSTYF--------EGPDNVDNTS------PSVSCMK 54
           R+L++ E+ ++ E     KNG +F ++Y         E   + DN +       S S  K
Sbjct: 3   RSLSSYERKLLSEILENNKNGTVFGASYIFDDSVTADEHIWDDDNDTLAATRVESRSTKK 62

Query: 55  MGKGLPDAIMWQALSQIIKENAELRSSINKFMQFEAIDTIAFDDVVRKIEFDNLTDEKVS 114
               L   ++ +AL  +I++N E+ +++N  ++F  +  I   DV+  + FDN  DEKV+
Sbjct: 63  PALSLTLPLVTRALKSLIEKNPEMYTTVNDLLEFAPLKEIRTPDVISVVTFDNEKDEKVN 122

Query: 115 CYNG-VPPYLLRHIFDKCHFSIGQQKPLWQVFVIDQSMVVFHGHDVLFDGFAAATFHKLF 173
           C++G  PPYL+RHI     F  G  KPLW +++ID+S +VFH  D+LFD F+AA FHKLF
Sbjct: 123 CHSGGPPPYLIRHILKNDVFQPGSNKPLWNLYLIDESQLVFHCQDILFDIFSAANFHKLF 182

Query: 174 LEALNSFRNVKGQKSDLIFKTREDLIPLCQSLAAEHNVSLISSVKDQVLTY--------- 224
           L+ L +    + Q+S    K  E L  L +S   E+N S+  S+ D +  +         
Sbjct: 183 LKELIAV--CRPQQS--YEKPLEYLFKLQKSF--ENNYSVPKSIYDNLKLHLPATRPELL 236

Query: 225 ---SQTALKNLYSLAIKKPLRFIE--------------------SGRLEHSGIPASNPYD 261
              +Q+  K+++  A+KKPL FI+                    S       +  +   +
Sbjct: 237 NLQTQSFFKSIFCNAVKKPLDFIQMPITSITNSSSNSDNSTTVISQEGNQLKLFRTRYTN 296

Query: 262 LASYAGDLCGTVVFGNVNPERVRGLRALMNESKISFRSFIISVTMFCLLPVLEPSEEKII 321
           + + A   CG  +FG+V+ ER   L +++   KI  RSFI ++TM CL P+++     +I
Sbjct: 297 ILTSATSNCGHTIFGSVSNERFNYLNSVVKNEKICLRSFIAAITMLCLKPMVKSFNGTLI 356

Query: 322 FSVPINLRESIPWASDLGVFQNNVLFECPLDLIKHDIEPCSGISTFNQEFLEGSTLTDVG 381
           FS+P+NLR+S+    D G+   ++  ECPL +I  D + CS                 V 
Sbjct: 357 FSMPMNLRDSMNEKRDFGLVYKDIRVECPLSMI--DDKQCS-----------------VP 397

Query: 382 GVNEDQNDP-------QTVFRRILTHVTTELELAAMRLEKSHSSGEDLIKAEREARY--- 431
           G+NE  +DP       +  F++I T+VT  +E   M   K +   ++ +K  +  +Y   
Sbjct: 398 GLNE--SDPEYNEKLLEIQFQQIATYVTESIE-QRMSTWKKYGYNDNDMKRMKFTKYDEK 454

Query: 432 FAASSRSKIVEINDLLEVDLSSKIHSRYKIGDVCSTSSRKSDTFMSISYCSSEISGLNLG 491
           FA ++R  +++IND+ EV           I     T+S   +T MS+SY   E  GLN+ 
Sbjct: 455 FAPNTR--LIKINDVSEVSFDDNDIRFPHIKSPGFTTSLSQNTLMSLSYTHCEEDGLNIC 512

Query: 492 IHYSEGFNMEYFVESFEGFLD 512
           IHY +G+NME FV+ FE F++
Sbjct: 513 IHYPDGYNMENFVDCFESFME 533

>TPHA0M00180 Chr13 (36974..38485) [1512 bp, 503 aa] {ON} Anc_6.8
           YPL272C
          Length = 503

 Score =  239 bits (609), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 163/525 (31%), Positives = 263/525 (50%), Gaps = 43/525 (8%)

Query: 8   YRNLTATEKTIICETAAGIKNGVLFSS--TYFEGPDN-VDNTSPSVSCMKMGKGLPDAIM 64
           +R L   EK ++ +T  G +NGV+FSS  T+ +  D   D+ +   +   + +    +++
Sbjct: 3   FRALGGYEKKVLAQTIEGRRNGVVFSSQITFNKKSDEFADDNATLYTGRSVNEVSLKSVL 62

Query: 65  WQALSQIIKENAELRSSINKFMQFEAIDTIAFDDVVRKIEFDNLTDEKVSCYNGVPPYLL 124
             AL  II  + EL ++IN  + F  +  I  +DV++ I +D   D K    + +   LL
Sbjct: 63  CAALQNIICNHVELYTTINDRLYFTPVLQIETNDVIKTISYDKSKD-KALMKDQISDKLL 121

Query: 125 RHIFDKCHFSIGQQKPLWQVFVIDQSMVVFHGHDVLFDGFAAATFHKLFL----EALNSF 180
           RHIF+KC F     KPLWQ  + + S ++FHGHDVLFD F+ A F K  L    + LNS 
Sbjct: 122 RHIFNKCDFKPNNGKPLWQFSIANDSTMIFHGHDVLFDIFSTANFEKYLLKEMNDVLNSN 181

Query: 181 RNVKGQKSDLIFKTREDLIPLCQSLAAEHNVSLISSVKDQVLTYSQTALKNLYSLAIKKP 240
           + +K  K+   F     L    +S+     + L +   D +   +Q+  K +Y   +KKP
Sbjct: 182 QKLKTVKTLFKFDAERSLTNYPRSIYENPKLHLPALTSDLLNLQTQSFFKTIYQNTLKKP 241

Query: 241 LRFIESGRLEHSGIPA---SNPYDLASYAGDLCGTVVFGNVNPERVRGLRALMNESKISF 297
           +  I S    ++   +   +   D+ S A  LCG  V G ++ ER + L+ L+ +  IS 
Sbjct: 242 IDLITSANSNNNNQLSEYRTRNTDILSGANSLCGRTVLGEISLERYQHLKMLVEQENISL 301

Query: 298 RSFIISVTMFCLLPVLEPSEEKIIFSVPINLRESIPWASDLGVFQNNVLFECPLDLI--- 354
           RSFI ++TM CL P+++  +  IIFS+P+NLR  I  +SD G+F  N+  ECPL+LI   
Sbjct: 302 RSFISAITMVCLKPIVKNFDGSIIFSIPVNLRSLIADSSDFGLFYKNIKVECPLELINDE 361

Query: 355 KHDIEPCSGISTFNQEFLEGSTLTDVGGVNEDQNDPQTVFRRILTHVTTELELAAMRLEK 414
           K+   P    S  N   LE                    F RI  HV+  +       EK
Sbjct: 362 KYYTNPEVLHSMQNNSLLE------------------IQFERISRHVSDVISQRMKAWEK 403

Query: 415 SHSSGEDLIKAEREARYFAASSRS---KIVEINDLLEVDL---SSKIHSRYKIGDVCSTS 468
              + +D+ + +     F+   ++    I++IND+ E+     +  I   + + ++  T 
Sbjct: 404 FGFNDDDIKRMK-----FSNDEKTGIAPIIQINDVTEISFDFGNDNISYSFSVNNLNFTK 458

Query: 469 SRKSDTFMSISYCSSEISGLNLGIHYSEGFNMEYFVESFEGFLDS 513
           S   + FMS+ Y  +   GLN+ IHY +G+NME FVE F+ F+++
Sbjct: 459 SLSCNEFMSLFYSHNAQGGLNICIHYPDGYNMEAFVECFQSFIEN 503

>NCAS0D02180 Chr4 (406396..407943) [1548 bp, 515 aa] {ON} Anc_6.8
          Length = 515

 Score =  215 bits (548), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 147/527 (27%), Positives = 260/527 (49%), Gaps = 39/527 (7%)

Query: 9   RNLTATEKTIICETAAGIKNGVLFSSTY---FEGPDNVDNTSPSVSCMKMGKGLPDAIMW 65
           R L+  E  ++ +T  G +NGV F++ Y   ++      +   ++  +K  + L  +++ 
Sbjct: 4   RQLSEYEVKLLEQTLQGKRNGVAFAAKYGRNYDDSSLSSSDESTLVSLK-DRRLTLSVIT 62

Query: 66  QALSQIIKENAELRSSINKFMQFEAIDTIAFDDVVRKIEFDNLTDEKVSCYNGVPPYLLR 125
           + L  +I ++ EL ++I++  ++  +  I   DV+  I FD+  DE+++C+ G PPYLLR
Sbjct: 63  RVLQILIPKHIELYTAISEDHRYSLVTEIRAKDVIDIITFDSEKDERINCHLGPPPYLLR 122

Query: 126 HIFDKCHFSIGQQKPLWQVFVIDQSMVVFHGHDVLFDGFAAATFHKLFLEALNSF----- 180
           HIF+K  F +GQQKPLW++++ID++ ++FHG D+LFD F+AA FHK FL  +NS+     
Sbjct: 123 HIFNKSDFKLGQQKPLWKLYIIDETTIIFHGFDMLFDSFSAAYFHKCFLAEVNSYMSSIV 182

Query: 181 RNVKGQKSDLIFK--TREDLIPLCQSLAA---EHNVSLISSVKDQVLTYSQTA--LKNLY 233
            + + +  D +F+  +  DLI +   +     +++ S  + +   V+   QT    K+LY
Sbjct: 183 SSKQKKPLDYLFQLSSSADLIKIYDEIPRSIYDYDSSPFAPLT-AVMFNDQTKSFFKSLY 241

Query: 234 SLAIKKPLRFIESGRLEHSGIPASNPYDLASYAG------DLCGTVVFGNVNPERVRGLR 287
             A+KKP+ FI +   +          +   Y         LCG  +FG ++  R   L 
Sbjct: 242 LNAVKKPIEFITNTSSQVKTYQQIKEAETEGYLNPMGIHRSLCGNTIFGTISSCRFNELT 301

Query: 288 ALMNESKISFRSFIISVTMFCLLPVLEPSEEKIIFSVPINLRESIPWASDLGVFQNNVLF 347
                 +IS +S I  + M  L P L    + ++FS+ +NLR+ +  +   G++  +++ 
Sbjct: 302 EKATREQISLKSLICGLIMMSLKPTLNDFSKNMVFSIRVNLRDDVSKSKTFGLYYRDIII 361

Query: 348 ECPLDLIKHDIEPCSGISTFNQEFLEGSTLTDVGGVNEDQNDPQTVFRRILTHVTTELEL 407
           ECPL LI       SG                VG   ++    + V+ +    VTT ++ 
Sbjct: 362 ECPLSLIDDRAIQFSGYR------------DHVGITAQELETYEKVYEQQFKDVTTYIQN 409

Query: 408 AAMRLEKSHSSGEDLIKAEREARYFAASSRSKIVEINDLLEVDLSSKIHSR--YKIGDVC 465
                     +  D+   +         S+ +I++INDL E+D++  +     Y +    
Sbjct: 410 VMNEKIGYWKTDNDIKMMKMMDD--MHQSKDEIIQINDLTEIDINENLSQNDPYCVKSSS 467

Query: 466 STSSRKSDTFMSISYCSSEISGLNLGIHYSEGFNMEYFVESFEGFLD 512
             +S       S+SY   E SGL + IH  +  +ME FVE+F+ FLD
Sbjct: 468 MVTSLSKKEMFSVSYTHCEASGLTISIHIPKMRSMESFVENFQAFLD 514

>ACR018C Chr3 complement(388482..389918) [1437 bp, 478 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL272C
          Length = 478

 Score =  200 bits (509), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 137/452 (30%), Positives = 229/452 (50%), Gaps = 32/452 (7%)

Query: 67  ALSQIIKENAELRSSINKFMQFEAIDTIAFDDVVRKIEFDNLTDEKVSCYNGVPPYLLRH 126
           AL  +I+EN E+  ++    +F  +  I +DDVVR IEF    DE ++C++G+PPY+ RH
Sbjct: 50  ALRSMIRENVEMCVTVTDGPKFAPVSRIEYDDVVRVIEFQTYKDEAIACHDGIPPYVARH 109

Query: 127 IFDKCHFSIGQQKPLWQVFVIDQSMVVFHGHDVLFDGFAAATFHKLFLEALNSF-RNVKG 185
           I +K  F  G  KPLW+V++ D SMV+FH H+VLFD FAA  FH  F +AL    +N   
Sbjct: 110 ILNKSKFEAG--KPLWEVYIADGSMVIFHCHNVLFDLFAAGNFHVRFQQALQRCEKNEPH 167

Query: 186 QKSDLIFKTREDLIPLCQSLAAEHNVSLISSVKDQVLTYSQTALKNLYSLAIKKPLRFIE 245
            ++  +++     +P+     +   V +        +++    +KN+   A+ KP   + 
Sbjct: 168 NETLFVYEGGPLQLPIDPDACSLPGVDVPYPASSPFVSF----VKNVCRYAL-KPFGALA 222

Query: 246 SG-----RLEHSGIPASNPYDLASYAGDLCGTVVFGNVNPERVRGLRALMNESKISFRSF 300
           S      RL  S +    P+ L      L GT V G +N +++  L  L+++ ++  RSF
Sbjct: 223 SAVTPSLRLNRSSL-GRKPFLLTLDKESLYGTTVSGYLNSKKLDSLLKLISKEEVCVRSF 281

Query: 301 IISVTMFCLLPVLEPSEEKIIFSVPINLRESIPWASDLGVFQNNVLFECPLDLIKHDIEP 360
           + ++T+  L P++   +  I FS+P++LR      +  G     +L +CPL LI   +  
Sbjct: 282 LCAITLLSLKPLIRNFDGSIAFSIPLDLRTESHKTTPFGFQSKRILVDCPLALIDDRVFE 341

Query: 361 CSGISTFNQEFLEGSTLTDVGGVNEDQNDPQTVFRRILTHVTTELELAAMRLEKSHSSGE 420
               S FN+   +  T  D       +   +  F+R+ THV   L         + +SG 
Sbjct: 342 ----SLFNRPSKQRKTKLDKNSPKFSEGLLEYQFKRVTTHVMKSLT--------AQTSG- 388

Query: 421 DLIKAEREARYFAASSRSKIVEINDLLEVDLSSKIHSRYKIGDVCSTSSRKSDTFMSISY 480
           D     + ++      + KI+EIN    VD+ +   +R++I ++  T S  S+TFMS+S 
Sbjct: 389 DWTGKRKYSK--CQLRKKKIIEIN---VVDMGTSPSARFQIKNMNFTDSLGSETFMSLSC 443

Query: 481 CSSEISGLNLGIHYSEGFNMEYFVESFEGFLD 512
                 G+N+ +HY E  +M+ FV+ F+ FLD
Sbjct: 444 ALMRGVGMNMCMHYLERDSMDMFVDCFQTFLD 475

>Ecym_3011 Chr3 (22943..24472) [1530 bp, 509 aa] {ON} similar to
           Ashbya gossypii ACR018C
          Length = 509

 Score =  195 bits (495), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 148/525 (28%), Positives = 249/525 (47%), Gaps = 42/525 (8%)

Query: 9   RNLTATEKTIICETAAGIKNGVLFSSTYFEGPDNVDNTSPSVSCMKMGKG-LPDAIMWQA 67
           R+L++ EK    E     +NG++F+  Y       +  S  ++   +    L D  +  A
Sbjct: 9   RDLSSVEKIFHKEVYTSRRNGIVFAVNYSSNKCESERWSDDITLSNLRDSRLFDGQISNA 68

Query: 68  LSQIIKENAELRSSINKFMQFEAIDTIAFDDVVRKIEFDNLTDEKVSCYNGVPPYLLRHI 127
           L  +IKEN EL  +I    +F   + I +DDVV  IEF    DE + C NG+PPY+LR+I
Sbjct: 69  LEAMIKENVELCVTITDDRKFAPTEIIRYDDVVIHIEFKTYKDELIECQNGIPPYILRNI 128

Query: 128 FDKCHFSIGQQKPLWQVFVIDQSMVVFHGHDVLFDGFAAATFHKLFLEALNSFRNVKGQK 187
            +   F  G  +PLW++ ++D +MV+ H H+V+FD FAAA FH  F +AL+ F       
Sbjct: 129 LENNKFEFG--RPLWELIIVDYTMVILHCHEVMFDLFAAANFHLKFQKALSQFPK-DTHA 185

Query: 188 SDLIFKTREDLIPLCQSL---AAEHNVSLISSVKDQVLTYSQTALKNLYSLAIKKPLRFI 244
            D++F    + + L ++     ++ +VS + S+  Q +    + LK  Y   +KK L  I
Sbjct: 186 LDILFVYEGNELQLSKTNFDGMSQISVSPVQSLPLQCI----SVLKGAYRTTVKKSLNVI 241

Query: 245 ESGRLEHSGIPA-----SNPYDLASYAGDLCGTVVFGNVNPERVRGLRALMNESKISFRS 299
               + ++ I       S+ +        LCGT V G++N ER+  L  L +   +   S
Sbjct: 242 RRNFVANNQITTYESSKSDVFKSMFNPNTLCGTTVSGSLNAERLASLLELTSSENVCMTS 301

Query: 300 FIISVTMFCLLPVLEPSEEKIIFSVPINLRESIPWASDLGVFQNNVLFECPLDLIKHDIE 359
            + ++T+  L P++      I F VPI++RE +    DLGV   N++ ECPL  I     
Sbjct: 302 VLCAITLLSLKPLIRKFNGSITFVVPIDIREKLE-IFDLGVSYTNLMVECPLSFIN---- 356

Query: 360 PCSGISTFNQEFLEGSTLTDVGGVNE-DQNDP-------QTVFRRILTHVTTELELAAMR 411
                   +++F    +  ++  +++ D N P       +  F+++ +HV   L+     
Sbjct: 357 --------DKDFQHTVSDGNIKSLHKIDPNSPDYPEMLLEYQFKQLTSHVMNSLKEKKQA 408

Query: 412 LEKSHSSGEDLIKAEREARYFAASSRSKIVEINDLLEVDLSSKIHSRYKIGDVCSTSSRK 471
            +K       L    ++ R      R K +EIN    VD+      ++   +V  TSS  
Sbjct: 409 WQKRRFDMSSL--KGKKLRRSNKIIRGKFIEIN---LVDMGEAQDGQFHTKNVNFTSSLG 463

Query: 472 SDTFMSISYCSSEISGLNLGIHYSEGFNMEYFVESFEGFLDSFPE 516
           S   +S+S       G+N+ +HY E  +M+ FVE F+  L+   +
Sbjct: 464 SKCLISVSCAILRGVGMNIFMHYPESNDMDAFVECFQILLEDLAK 508

>TBLA0A07220 Chr1 (1800531..1802060) [1530 bp, 509 aa] {ON} Anc_6.8
           YPL272C
          Length = 509

 Score =  183 bits (465), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 147/543 (27%), Positives = 266/543 (48%), Gaps = 78/543 (14%)

Query: 6   KVYRNLTATEKTIICET-AAGIKNGVLFSSTYFEGPDNVDNTSPSVSCMKMGKGLPDAIM 64
           KV R L++ EK  +  +  +  ++G + S  +     ++ + +  +S     K L  +++
Sbjct: 10  KVLRPLSSVEKRFLGNSLESETRHGSVCSGKWVSNSLDISDDATLLS--SKDKPLTISLV 67

Query: 65  WQALSQIIKENAELRSSINKFMQFEAIDTIAFDDVVRKIEFDNLTDEKVSCYNGVPPYLL 124
            +AL  +I  + E+ ++INK  +F+ +D I   DV+  I F+N  DE V+C++G PPYL+
Sbjct: 68  SRALKILISNHIEMFTTINKNSEFQLLDKINTSDVLHSICFENKKDELVNCHSGAPPYLI 127

Query: 125 RHIFDKCHFSIGQQKPLWQVFVIDQSMVVFHGHDVLFDGFAAATFHKLFLEALNS--FRN 182
            +IF   +F    +KPLWQ+F+++ S+VVF+G D LFD FA A F KL  E +NS  + N
Sbjct: 128 NYIFSLPYFQPDSKKPLWQLFIVNSSLVVFYGDDTLFDIFAVANFIKLLFEIINSLPYEN 187

Query: 183 VKGQKSDLIFKTREDLIPLCQSLAAEHNVSLISSVKDQVLTY------------SQTALK 230
            K  + D+IFK     +P  ++++    ++   S+ D  + +            +Q+  K
Sbjct: 188 -KEIQDDIIFK-----LPNIRNISK---INFPKSIYDNPMLHLPATKPELFNLQTQSFFK 238

Query: 231 NLYSLAIKKPLRFIESGR-----LEHSGIPASNPYDLASYAGDLCGTVVFGNVNPERVRG 285
           ++Y    KK   ++   +     L  +   + N  ++      +   +V GNV+ ER   
Sbjct: 239 SIYLNTFKKSFDYLNFTQQTPIILARNHNISKNYNEILHLNSIVKSELVTGNVSMERYLQ 298

Query: 286 LRALMNESKISFRSFIISVTMFCLLPVLEPSEEKIIFSVPINLRE-------------SI 332
           L  L++  KI  +SF  S+ + CL  ++   +  IIF +P NLR              S 
Sbjct: 299 LLKLIDAEKIDLKSFFCSIIIMCLKFMITCFDGSIIFKIPYNLRSMQNLRDKENHNSSSG 358

Query: 333 PW--ASDLGVFQNNVLFECPLDLIKHDIEPCSGISTFNQEFLEGSTLTDVGGVNEDQNDP 390
           P   A++LG+   ++  E PL LI+                        +G  NED  + 
Sbjct: 359 PEDSANELGIIYKDIYVEVPLKLIEK-----------------------IG--NEDVVEE 393

Query: 391 QTVFRRILTHVTTELELAAMRLEKSHSSGEDLIKAEREARYFAASSRSKIVEINDLLEVD 450
           Q  F+ +  ++   ++      EK+  + +D+ + +     F       I+E+NDL  +D
Sbjct: 394 Q--FKIVCNYINESIQKRIKAWEKNGFNDDDIKRMK-----FGYEQVGNIIEVNDLTSLD 446

Query: 451 LSSKIHSRYKIGDVCSTSSRKSDTFMSISYCSSEISGLNLGIHYSEGFNMEYFVESFEGF 510
           LS    S + I D+  T + K +  +S+S+ S+  +GLNL I+YS  + M+ F++ F+ F
Sbjct: 447 LSCSKDSLFHIEDLSLTRNLKKNQILSLSFASNNYNGLNLCINYSTEYKMKDFIDCFQSF 506

Query: 511 LDS 513
           +++
Sbjct: 507 MEN 509

>Kpol_1032.1 s1032 (25..765) [741 bp, 246 aa] {ON} (25..765) [741
           nt, 247 aa]
          Length = 246

 Score = 86.7 bits (213), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 65/248 (26%), Positives = 118/248 (47%), Gaps = 32/248 (12%)

Query: 273 VVFGNVNPERVRGLRALMNESKISFRSFIISVTMFCLLPVLEPSEEKIIFSVPINLRESI 332
           V+FG +  ER   L+AL+ + +I  RS I  + M C  P ++  +  I FS+ ++++  +
Sbjct: 24  VLFGTIAAERFNRLKALIRKGRICLRSVICGIVMLCTKPNIQNFDGNIRFSIGVDMKPIV 83

Query: 333 PWASDLGVFQNNVLFECPLDLI--KHDIEPCSGISTFNQEFLEGSTLTDVGGVNEDQNDP 390
             +S  G+ + N++ +CPL LI  KH  +     S  N + LE                 
Sbjct: 84  DDSSQFGILKKNIIVDCPLKLIDDKH-YKDTDSESIKNGDILE----------------- 125

Query: 391 QTVFRRILTHVTTELELAAMRLEKSHSSGEDLIKAEREARYFAASSR---SKIVEINDLL 447
              FR++   VT EL        K  S  +   +      + + +S+   SK+++INDL 
Sbjct: 126 -IQFRKVTDFVTEELS------NKLQSMAKHFKRNNCPFNFSSINSQISDSKVIQINDLT 178

Query: 448 EVDLSSKIH--SRYKIGDVCSTSSRKSDTFMSISYCSSEISGLNLGIHYSEGFNMEYFVE 505
           ++  ++     + Y   D+  T     +  MS+SY ++  S +++ IHY+E   M+ FVE
Sbjct: 179 DIPFTTTEQNPNGYSFHDLKVTEGLSPNESMSLSYITNSNSAMSISIHYTETKYMDSFVE 238

Query: 506 SFEGFLDS 513
            F  F+++
Sbjct: 239 CFRTFIEN 246

>TDEL0E05110 Chr5 (941876..943285) [1410 bp, 469 aa] {ON} Anc_5.119
           YGR212W
          Length = 469

 Score = 60.1 bits (144), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 72/295 (24%), Positives = 122/295 (41%), Gaps = 34/295 (11%)

Query: 51  SCMKMG---KGLPDA-IMWQALSQIIKENAELRSSI-----NKFMQFEAIDTIAFDDVVR 101
           SC  +G     LPD   +  AL   I  + +L  ++     +     + +DTI FDDVV 
Sbjct: 24  SCFFLGLQLNQLPDKHQIAHALRSTIANHPKLHQNVAIDPEDNIPYIKNVDTIKFDDVVE 83

Query: 102 KIEFDNLTDEKVSCYNGVPPYLLRHIFDKCHFSIGQQKPLWQVFVIDQSMVVFHGHD-VL 160
            + +D   D  +            HIF   +F    +KPLW+V V  +   +    D  L
Sbjct: 84  YVSWDGFDDNTIC-----------HIFQTYNFPYNIEKPLWKVLVYAKENRLLLLLDHAL 132

Query: 161 FDGFAAATFHKLFLEALNSFRNVKGQKSDLIFKTREDLIPLCQSLAAEHN---VSLISSV 217
           FDG +A  F K F+ +L+S         DL+++   D  P+ Q  +  +     S  S++
Sbjct: 133 FDGMSAVIFWKSFMSSLSS---DARDDFDLLYELTGD--PMVQEDSHVYENWPTSWSSTL 187

Query: 218 KDQVLTYSQTALKNLYSLAIKKPLRFIESGRLEHSGIPASNPYDLASYAGDLCGTVVFGN 277
              +       + ++ +   K  LRF  +G      +    P D +SY        +   
Sbjct: 188 TKAIAGVIFKFMPSVITSVGKDQLRF--NGYSFPDSLLTHKPDDDSSYEIRNNNRQLNLQ 245

Query: 278 VNPERVRGLRALMNESKISFRSFIISVTMFCLLPVLEP---SEEKIIFSVPINLR 329
           V P+ + G+ +     ++S  SFI ++    L   +E    S  KI+  +P+N R
Sbjct: 246 VQPDHLNGIISACKSHQVSLTSFITALISMSLQLKIEDGDYSGSKIMIDIPMNTR 300

>KLTH0C02178g Chr3 complement(196605..197999) [1395 bp, 464 aa] {ON}
           weakly similar to uniprot|P53304 Saccharomyces
           cerevisiae YGR212W SLI1 N-acetyltransferase confers
           resistance to the sphingolipid biosynthesis inhibitor
           myriocin (ISP-1) by inactivating it co-operates with
           Ypk1p in mediating resistance to myriocin converts
           myriocin into N-acetyl-myriocin
          Length = 464

 Score = 57.8 bits (138), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 74/301 (24%), Positives = 123/301 (40%), Gaps = 33/301 (10%)

Query: 66  QALSQIIKENAELRSSI---NKFMQFEAID-TIAFDDVVRKIEFDNLTDEKVSCYNGVPP 121
           QA+  ++ E  +L S +   N  +  E +  T+   DVV   E ++L +E  +       
Sbjct: 40  QAVRAVVPEYPQLYSDVVTRNGSLVLEPLQSTLVLSDVVEFTEMESLDEEHSN------- 92

Query: 122 YLLRHIFDKCHFSIGQQKPLWQVFVI-DQSMVVFHGHDVLFDGFAAATFHKLFLEALNSF 180
                IF +  F  G +KPLW+V ++ DQ   V     ++ DG +A  F   F+ +LN+ 
Sbjct: 93  ----KIFKEVTFVYGAEKPLWKVLILKDQRTFVLCSDHLILDGLSATVFWGSFMRSLNAS 148

Query: 181 RNVKGQKSDLIFKTREDLIPLCQSLAAEHNVSLISSVKDQVLTYSQTALKNLYSLAIKKP 240
                   +++FK   ++  + Q   +   VS IS +  +++      L +L  + +  P
Sbjct: 149 HADSTFPDEVVFKPSPNIAHVPQHPYSRIPVS-ISGLLLRIVV-RILVLISLLGIDLIGP 206

Query: 241 LRFIESG----RLEHSGIPASNPYDLASYAGDLCGTVVFGNVNPERVRGLRALMNESKIS 296
           +   E G    +  H   P        S   D C   +   V P  +R L     E K+S
Sbjct: 207 VFVPELGSEDFKFLHYRFPDGLLTSDGSVRNDNCQLKI--KVPPNNLRALLRRCKEKKVS 264

Query: 297 FRSFIISVTMFCLLPVLEPSEE--KIIFSVPINLRESI-------PWASDLGVFQNNVLF 347
              F+++V    L  V     E  +I  SVP+N R  I       P A ++G F      
Sbjct: 265 LSVFLLAVIAHSLKLVGTDCVEGSRIKASVPMNARPLIQEILSMKPEAVEIGNFITGATL 324

Query: 348 E 348
           E
Sbjct: 325 E 325

>CAGL0K00737g Chr11 complement(81263..82636) [1374 bp, 457 aa] {ON}
           similar to uniprot|P53304 Saccharomyces cerevisiae
           YGR212w
          Length = 457

 Score = 53.5 bits (127), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 92/430 (21%), Positives = 165/430 (38%), Gaps = 86/430 (20%)

Query: 92  DTIAFDDVVRKIEFDNLTDEKVSCYNGVPPYLLRHIFDKCHFSIGQQKPLWQVFVIDQS- 150
           + I FDDVV  +++D   +E+++            +F K +F  G  KPLW+V V+ ++ 
Sbjct: 71  EPIKFDDVVDYMDWDTYGEEEINS-----------VFRKYNFEYGVDKPLWKVIVVPKAN 119

Query: 151 MVVFHGHDVLFDGFAAATFHKLFLEALNSFRNVKGQKSDLIFKTREDLIPLCQSLAAEHN 210
            ++F    + FDG A   F    L++L   +    Q +DL      D+  +         
Sbjct: 120 KMIFATDHLFFDGIATVLFWTELLKSLEELK----QDNDL------DVDEIIYRPGGS-- 167

Query: 211 VSLISSVKDQVLTYSQTALKNLYSLAIKKP----LRFIESGRL--EHSGIPASNPY---- 260
               +   DQ   Y +  +   +S  +K+P    L  I  G +  + + I   + Y    
Sbjct: 168 ----TDSIDQCHPYEKLPIP--FSWKVKRPIVKALFTIAPGAVVSQDASIIQFDEYKIPE 221

Query: 261 DLASYAGDLCGTVVFGNVNPE-----RVRGLRALMNESK---ISFRSFIISVTMFCL--L 310
           D      +  G     N N +         L+ +M + K   +SF +++ +V    L  +
Sbjct: 222 DYLKKNSNDDGCYQIKNTNRQISLKMSSNKLKVIMKDCKQHHVSFTAYLTAVLYLALGKI 281

Query: 311 PVLEPSEEKIIFSVPINLRESIP----WASDLGVFQNNVLFECPLDLIKHDIEPCSGIST 366
           P  + S   I + VP+N R  I     +++  G F     F   LD  + + E    I  
Sbjct: 282 PKEKYSGSTIKYEVPMNTRNRISNSGEYSNSYGTFVAGGEFIETLDFERDEWELAQSI-- 339

Query: 367 FNQEFLEGSTLTDVGGVNEDQNDPQTVFRRILTHVTTELELAAMRLEKSHSSGEDLIKAE 426
            +++ +E ST   +  +NE          R+L  V  + +   M+ E             
Sbjct: 340 -HKKIVEKSTTGVMDAINE---------ARLLELVDAK-KFMKMKFE------------- 375

Query: 427 REARYFAASSRSKIVEINDLLEVDLSSKIHSRYKIGDVCSTSSRKSDTFMSISYCSSEIS 486
                   +  S   E+ +L   + S   HS+Y + D      +     ++ S  S+   
Sbjct: 376 ------TTTGPSSTFEVTNLGFQNFSQNEHSKYTVTDAFFNEPQLFTNLITYSVISTPSG 429

Query: 487 GLNLGIHYSE 496
           GLN  + Y E
Sbjct: 430 GLNCSMAYPE 439

>NDAI0D02360 Chr4 (545485..546897) [1413 bp, 470 aa] {ON} Anc_5.119
           YGR212W
          Length = 470

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 70/301 (23%), Positives = 124/301 (41%), Gaps = 57/301 (18%)

Query: 54  KMGKGLPDAI-MWQALSQIIKENAELRSSINKFMQFEAIDT--IAFDDVVRKIEFDNLTD 110
           ++ K L D I  +  L Q I +N E     ++++  E I    I F+DVV  + ++   +
Sbjct: 40  QLYKALQDTIATYPQLHQNITKNKE-----DEYLYVEDIKKTPIEFEDVVEFVAWEKFEE 94

Query: 111 EKVSCYNGVPPYLLRHIFDKCHFSIGQQKPLWQVFVID--QSMVVFHGHDVLFDGFAAAT 168
           ++++            IF   +F     +PLW++ V+    + ++   H  LFDG +A  
Sbjct: 95  KEINS-----------IFQTYNFHYRNDRPLWKILVVPSLNTFILLLDH-ALFDGISAVK 142

Query: 169 FHKLFLEALNSFRNVKGQKSDLIFKTREDLIPLCQSLAAEHNVSLISS----------VK 218
             + F+E LN     K  + + I  T    IP        H  +L++S          + 
Sbjct: 143 IWETFMEKLN-----KSSEIENIDVTVPLYIP-----EENHEGTLVASQHPYDIWPVPIA 192

Query: 219 DQVLTYSQTALKNLYSLAIKKPLRFIESGRLEHSGIPASNPYDLASYAGDLCGTVVFGNV 278
            +V ++  T L N Y  AI  P     S   E  G      + L+ Y  D   +    N 
Sbjct: 193 WKVKSFIATKLFNWYPQAIISP----NSNLFEFKGYKFPEGF-LSQYPKDGVTSFKVRND 247

Query: 279 NPERV-----RGLRALMNESK---ISFRSFIISVTMFCLLPVLEPSEEKIIF--SVPINL 328
           N +++       L  ++   K   +S  S+I+++ +  L  V + S    +   S+PIN 
Sbjct: 248 NTQKLIKMAPGKLETILKNCKTNAVSLTSYIVAIIIIALRNVTQESYTGNLLKVSIPINT 307

Query: 329 R 329
           R
Sbjct: 308 R 308

>ZYRO0F01540g Chr6 complement(124663..126075) [1413 bp, 470 aa] {ON}
           similar to uniprot|P53304 Saccharomyces cerevisiae
           YGR212W SLI1 N-acetyltransferase confers resistance to
           the sphingolipid biosynthesis inhibitor myriocin (ISP-1)
           by inactivating it co-operates with Ypk1p in mediating
           resistance to myriocin converts myriocin into N-acetyl-
           myriocin
          Length = 470

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 60/292 (20%), Positives = 116/292 (39%), Gaps = 65/292 (22%)

Query: 78  LRSSINKFMQFE---AID-------------TIAFDDVVRKIEFDNLTDEKVSCYNGVPP 121
           L+S+I+ F+Q      ID             ++   DVV  +++    ++K         
Sbjct: 46  LKSTIDTFIQLRCNVGIDEEDGKPYLKIIDQSLELKDVVEFVDWAKFDEDK--------- 96

Query: 122 YLLRHIFDKCHFSIGQQKPLWQVFVI--DQSMVVFHGHDVLFDGFAAATFHKLFLEALNS 179
             + ++F    F    +KPLW+V VI  ++ +V+   H VLFDG A     + FL+ LN 
Sbjct: 97  --MNYVFQNYAFPYHTEKPLWKVLVIPNERKLVLLMSH-VLFDGMAGVIILQEFLKNLNQ 153

Query: 180 FRNVKGQKSDLIFKTREDLIPLCQSLAAEHNVSLISSVKDQVLTYSQTALKNLYSLAIK- 238
             N        +++  E      QS  + H+       +D  + +    L+ L++  +K 
Sbjct: 154 SMNAIENTISTVYEPGE-----IQSFTSNHH-----PYEDWPIGWKAKLLQFLFAQYLKW 203

Query: 239 KPLR----------------FIESGRLEHSGIPASNPYDLASYAGDLCGTVVFGNVNPER 282
           KP+                 F+  G LE         Y +     +L   +   ++ PE 
Sbjct: 204 KPINADMVGPKSEDFKFNSYFLPHGLLEKRSDSTGGLYQVR--CDNLQRNI---HLTPEE 258

Query: 283 VRGLRALMNESKISFRSFIISVTMFCLLPVLEPSE---EKIIFSVPINLRES 331
           +  +  L  + ++SF S + ++    L    +P+     ++   +P+N R +
Sbjct: 259 LEKVLQLCKDHRVSFSSLLTALFARSLAKFSDPTSYTGSQMKICLPMNTRSA 310

>Kwal_27.9898 s27 (112396..113778) [1383 bp, 460 aa] {ON} YGR212W -
           Hypothetical ORF [contig 43] FULL
          Length = 460

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 31/54 (57%), Gaps = 1/54 (1%)

Query: 127 IFDKCHFSIGQQKPLWQVFVI-DQSMVVFHGHDVLFDGFAAATFHKLFLEALNS 179
           IF +  F+ G  KPLW+V V+ D+  +V     V+ DG +   F K FL +LN+
Sbjct: 94  IFREVEFTYGSGKPLWKVLVLNDRRTLVLCTDHVILDGLSTVAFWKKFLGSLNA 147

>Kpol_1010.49 s1010 (113037..114482) [1446 bp, 481 aa] {ON}
           (113037..114482) [1446 nt, 482 aa]
          Length = 481

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/131 (26%), Positives = 63/131 (48%), Gaps = 14/131 (10%)

Query: 78  LRSSINKFMQF--------EAIDTIAFDDV-VRKIEFDNLTDEKVSCYNGVPPYLLRHIF 128
           LR S+ K+ Q         ++ D I F+D+   KI F ++ + K   ++ V    +  IF
Sbjct: 44  LRKSVAKYQQLRCNVMKAGDSEDDIYFNDIGNEKIYFADIVEYK--NWDSVSESNINSIF 101

Query: 129 DKCHFSIGQQKPLWQVFVI-DQSMVVFHGHDVLFDGFAAATFHKLFLEALNSFRNVK--G 185
            +  F     KP+W++ V+ +Q+ ++     VLFDG +   F   F+ +L S  ++    
Sbjct: 102 QEYSFEYFTDKPVWKILVLENQNQLLMLLDHVLFDGMSGINFWNSFISSLPSIDSISEDA 161

Query: 186 QKSDLIFKTRE 196
             ++LIF   E
Sbjct: 162 NANELIFPFEE 172

>TPHA0H00960 Chr8 (201187..202617) [1431 bp, 476 aa] {ON} Anc_5.119
           YGR212W
          Length = 476

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/145 (26%), Positives = 69/145 (47%), Gaps = 13/145 (8%)

Query: 53  MKMGKGLPDAIMWQALSQIIKENAELRSSINKFMQFEAIDTIAFDDVVRKIEFDN-LTDE 111
           +K+ K   +  +  +L ++I +N  LR +INK       D+   +D+   IE DN  T +
Sbjct: 29  VKLNKLPTENELCSSLRKVIAKNRILRCNINK-----NGDSAYINDI---IENDNEFTVQ 80

Query: 112 KVSCY---NGVPPYLLRHIFDKCHFSIGQQKPLWQVFVIDQ-SMVVFHGHDVLFDGFAAA 167
            V  Y   N         +F + +F  G+ KPLW++ +  + + +V       FDG +A 
Sbjct: 81  DVIEYRDWNKFEEDEQNSVFQEINFKYGELKPLWKLIIASKINTIVLAMDHTFFDGSSAT 140

Query: 168 TFHKLFLEALNSFRNVKGQKSDLIF 192
            F K  L  L+S    + + +D++F
Sbjct: 141 LFWKALLLELSSIDRDQLEDTDVVF 165

>YGR212W Chr7 (917040..918446) [1407 bp, 468 aa] {ON}
           SLI1N-acetyltransferase, confers resistance to the
           sphingolipid biosynthesis inhibitor myriocin (ISP-1) by
           converting it into N-acetyl-myriocin, co-operates with
           Ypk1p in mediating resistance to myriocin
          Length = 468

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 33/55 (60%), Gaps = 1/55 (1%)

Query: 124 LRHIFDKCHFSIGQQKPLWQVFVI-DQSMVVFHGHDVLFDGFAAATFHKLFLEAL 177
           + HIF + +FS  + KPLW++ ++ +Q+ ++     VL DG +A    + F+E L
Sbjct: 95  INHIFQRYNFSYNENKPLWKILILPNQNQMLLLTDHVLMDGMSAIHVWETFMEGL 149

>Skud_7.548 Chr7 (891732..893159) [1428 bp, 475 aa] {ON} YGR212W
           (REAL)
          Length = 475

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 45/90 (50%), Gaps = 13/90 (14%)

Query: 90  AIDTIAFDDVVR-KIEFDNLTDEKVSCYNGVPPYLLRHIFDKCHFSIGQQKPLWQVFVI- 147
           A +   F DVV    ++D+L + +++           HIF + +F   + KPLW++ +I 
Sbjct: 79  AAEPFVFGDVVAYHHDWDHLKETEIN-----------HIFQEHNFPYSEHKPLWKILIIP 127

Query: 148 DQSMVVFHGHDVLFDGFAAATFHKLFLEAL 177
            Q+ ++     VL DG +A    + F+E L
Sbjct: 128 SQNQMLLMTDHVLMDGMSAVHVWETFMEGL 157

>Ecym_2483 Chr2 (946645..948030) [1386 bp, 461 aa] {ON} similar to
           Ashbya gossypii ACL138C
          Length = 461

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 64/287 (22%), Positives = 119/287 (41%), Gaps = 54/287 (18%)

Query: 94  IAFDDVVRKIEFDNLTDEKVSCYNGVPPYLLRHIFDKCHFSIGQQKPLWQVFVIDQ-SMV 152
           I  DDV+ +  FD+L DE  +            I     F   QQ+PLW++  +   +  
Sbjct: 73  IRLDDVLEETGFDSL-DESAA----------NSILKNSTFQYDQQRPLWKLISLKAGTQF 121

Query: 153 VFHGHDVLFDGFAAATFHKLFLEALNSFR--NVKGQK-SDLIFKTRE---------DLIP 200
           +F      FDG +A  F   F+ ALNS +  N +G   +++++K            DL P
Sbjct: 122 LFCFDHAFFDGMSAVIFWNDFISALNSIKPENRRGMDLNEVLYKAAADPEIRVHPFDLWP 181

Query: 201 LCQSLAAEHNVSLISSVKDQVLTYSQTALKNLYSLAIKKPLRF----IESGRLEHSGIPA 256
           +    + +  V+ I +           +LK +  ++ ++  RF      SG     G+  
Sbjct: 182 IPWVWSMKRAVTKIWTYYAGQSIPQCISLKGI--ISKREVFRFKHYIFPSGFFNSEGVLR 239

Query: 257 SNPYDLASYAGDLCGTVVFGNVNPERVRGLRALMNESKISFRSFIISVTMFCLLPVLEPS 316
           ++   L+S             + P+++  +     + K+SF S+  +  +  LL  L+P+
Sbjct: 240 NDNVQLSS------------RIPPDKMDAILVECRKHKVSFTSW-FAAKLIQLLRELDPN 286

Query: 317 EEK---IIFSVPINLR----ESIP-WASD---LGVFQNNVLFECPLD 352
           E     +   +P++ R    E +P + +D   +G+F  N      LD
Sbjct: 287 ESTGSIVKIMLPVDCRAEIAEKLPSYPADELKMGLFVKNASLHYDLD 333

>Smik_16.94 Chr16 complement(178129..179529) [1401 bp, 466 aa] {ON}
           YGR212W (REAL)
          Length = 466

 Score = 39.3 bits (90), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 35/63 (55%), Gaps = 1/63 (1%)

Query: 116 YNGVPPYLLRHIFDKCHFSIGQQKPLWQVFVI-DQSMVVFHGHDVLFDGFAAATFHKLFL 174
           +N +    + +IF   +FS  + KPLW++ +I +Q+ ++     VL DG +A    + F+
Sbjct: 87  WNHLTEVEINYIFQNYNFSYSEHKPLWKLLIIPNQNQMLLLTDHVLMDGISAVHVWETFM 146

Query: 175 EAL 177
           E L
Sbjct: 147 EGL 149

>SAKL0G15004g Chr7 (1288241..1289611) [1371 bp, 456 aa] {ON} similar
           to uniprot|P53304 Saccharomyces cerevisiae YGR212W SLI1
           N-acetyltransferase confers resistance to the
           sphingolipid biosynthesis inhibitor myriocin (ISP-1) by
           inactivating it co-operates with Ypk1p in mediating
           resistance to myriocin converts myriocin into N-acetyl-
           myriocin
          Length = 456

 Score = 38.9 bits (89), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 36/144 (25%), Positives = 70/144 (48%), Gaps = 24/144 (16%)

Query: 66  QALSQIIKENAELRSSINKFMQFEA-----IDT-IAFDDVVRKIEFDNLTDEKVSCYNGV 119
             ++++I    +L S  N F+Q E      I++ I F+DVV  ++ + LT+E        
Sbjct: 40  HVITKVIPRYPQLYS--NVFLQDEKPIVKPIESFIYFNDVVEYMQEEQLTEE-------- 89

Query: 120 PPYLLRHIFDKCHFSIGQQKPLWQVFVID--QSMVVFHGHDVLFDGFAAATFHKLFLEAL 177
              L+  IF    F      P+W++  ++  +S+V+   H + FDG +   F +  +E L
Sbjct: 90  ---LINQIFRTVKFKYHDDVPIWKILALNGGRSLVLCLEH-LFFDGLSGVKFLENIMEEL 145

Query: 178 NSFRNVKGQKSDLIFKTR-EDLIP 200
           N+       + D+++K   ++L+P
Sbjct: 146 NTIECFSNYQ-DIVYKCEGKELVP 168

>NCAS0A07390 Chr1 (1463090..1464526) [1437 bp, 478 aa] {ON}
           Anc_5.119 YGR212W
          Length = 478

 Score = 37.7 bits (86), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 41/86 (47%), Gaps = 14/86 (16%)

Query: 94  IAFDDVVRKIEFDNLTDEKVSCYNGVPPYLLRHIFDKCHFSIGQQKPLWQVFVIDQS--M 151
           I  +DV    E++   +++++            IF   +F   Q  PLW++ +I     M
Sbjct: 76  IFLEDVCEYKEWEQFAEDEIN-----------SIFQSYNFQYDQDTPLWKILLIPSKRIM 124

Query: 152 VVFHGHDVLFDGFAAATFHKLFLEAL 177
           V+   H VLFDG +A  F + F+ +L
Sbjct: 125 VLLIDH-VLFDGMSAVKFWECFVGSL 149

>Kpol_191.1 s191 complement(429..848) [420 bp, 139 aa] {ON}
           complement(429..848) [420 nt, 140 aa]
          Length = 139

 Score = 34.7 bits (78), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 32/137 (23%), Positives = 66/137 (48%), Gaps = 3/137 (2%)

Query: 9   RNLTATEKTIICETAAGIKNGVLFSSTYFEGPDNVDNTSPSVSCMKMGK-GLPDAIMWQA 67
           R L  +EK+ + +T+ G  NG++FS    +  +  DN S   +    G+ G    ++ ++
Sbjct: 3   RILNESEKSALKQTSEGSMNGIIFSVKISKKCE--DNLSDDATLHTTGESGNLQLLLLKS 60

Query: 68  LSQIIKENAELRSSINKFMQFEAIDTIAFDDVVRKIEFDNLTDEKVSCYNGVPPYLLRHI 127
           L  +I +  EL +++++ + F  +D +   DVV+ I +     +     +G    L+  I
Sbjct: 61  LKLLIPKYKELCTTVDENLHFVHLDEVKTTDVVKIINYSRRKFDINEGLSGPSSSLINSI 120

Query: 128 FDKCHFSIGQQKPLWQV 144
           +   +F  G  KP  ++
Sbjct: 121 YYHSNFQPGSGKPYGKL 137

>KNAG0G00700 Chr7 complement(132337..133707) [1371 bp, 456 aa] {ON}
           Anc_5.119 YGR212W
          Length = 456

 Score = 35.0 bits (79), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 40/87 (45%), Gaps = 5/87 (5%)

Query: 93  TIAFDDVVRKIEFDNLTDEKVSCYNGVPPYLLRHIFDKCHFSIGQQKPLWQVFVIDQS-- 150
           T  F ++   + +D+  +  V  +      L   IF + +F    +KPLW++  + +S  
Sbjct: 64  TPTFANITVPLRYDDFVE--VKQWGQWDAQLANEIFKEYNFQYTVEKPLWRILAMPKSST 121

Query: 151 MVVFHGHDVLFDGFAAATFHKLFLEAL 177
            V+   H VLFDG +     +  LE L
Sbjct: 122 FVLLVDH-VLFDGMSTVNLWRCLLENL 147

>Suva_7.506 Chr7 (873531..874931) [1401 bp, 466 aa] {ON} YGR212W
           (REAL)
          Length = 466

 Score = 32.7 bits (73), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 23/100 (23%), Positives = 47/100 (47%), Gaps = 3/100 (3%)

Query: 79  RSSINKFMQFEAIDTIAFDDVVRKIEFDNLTDEKVSCYNGVPPYLLRHIFDKCHFSIGQQ 138
           R S N F + E+ + + F  +     FD++  E    ++ +    + +IF    F+  + 
Sbjct: 52  RLSCNVFYE-ESDNEVYFKSITEPFLFDDIV-EYHRDWDQLKQNEINYIFQTYDFAYNEA 109

Query: 139 KPLWQVFVI-DQSMVVFHGHDVLFDGFAAATFHKLFLEAL 177
            PLW++ +I  Q+ ++     VL DG +A    +  ++ L
Sbjct: 110 TPLWKILIIPSQNEMLLVADHVLMDGMSAVHVWETLMKGL 149

>TBLA0E01900 Chr5 (462299..464821) [2523 bp, 840 aa] {ON} Anc_7.56
           YOR337W
          Length = 840

 Score = 32.3 bits (72), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 28/53 (52%)

Query: 122 YLLRHIFDKCHFSIGQQKPLWQVFVIDQSMVVFHGHDVLFDGFAAATFHKLFL 174
           YL+R IF+K      ++     + VI+  +++F      FDGF  A  ++L+L
Sbjct: 674 YLVRLIFNKPFMEDNEESRNVVIEVIEDLIILFDNFKYKFDGFLKANLYQLYL 726

>TBLA0D02390 Chr4 (600149..601510) [1362 bp, 453 aa] {ON} Anc_5.119
           YGR212W
          Length = 453

 Score = 32.0 bits (71), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 62/298 (20%), Positives = 118/298 (39%), Gaps = 52/298 (17%)

Query: 59  LPDAIMW-QALSQIIKENAELRSSIN----------KFMQFEAIDTIAFDDVVRKIEFDN 107
           LP    W  AL++ + +  +LR ++           K +  E    I ++DV+  + +  
Sbjct: 34  LPTKGEWIYALNKTMSQYFKLRCNVEWDLEADDIHMKLITAENGTPIKYEDVIEYVPWKK 93

Query: 108 LTDEKVSCYNGVPPYLLRHIFDKCHFSIGQQKPLWQVFVIDQ--SMVVFHGHDVLFDGFA 165
           L  +++           + IF   HF    +   W++ V+ +  + V+   H  L+DG +
Sbjct: 94  LEQDEI-----------QQIFQNYHFHYDSEHVAWKILVLKECNTCVLLLTH-ALYDGMS 141

Query: 166 AATFHKLFLEAL--NSFRNVK-----GQKSDLIFKTRE--DLIPLCQSLAAEHNVSLISS 216
                +  L+ L   S  N +       K D  F ++   +LIP   S  A+    L+ S
Sbjct: 142 LVKIWQSILQNLGNGSMDNTEIIYDAIDKPDKQFTSQHPYELIPTPWSWKAK---KLLVS 198

Query: 217 VKDQVLTYSQTALKNLYSLAIKKPLRFIESGRLEHSGIPASNPYDLASY-AGDLCGTVVF 275
              Q+  Y+ + +       I+ P    + G         SNP     Y   D C  +  
Sbjct: 199 ---QLFKYAPSTIVKPNKNIIQFPAYNFKEGLF-----AKSNPSQFERYLKNDFC--LHR 248

Query: 276 GNVNPERVRGLRALMNESKISFRSFIISVTMFCLLPVLEPSE---EKIIFSVPINLRE 330
            ++N E +     +     +SF S++ +V +  +   ++PS      +  S+PIN R+
Sbjct: 249 THINNENLTKTLKICKVHGVSFTSYLAAVLVIAMRK-MDPSAISGNNLQISIPINSRK 305

>NCAS0A06490 Chr1 (1279402..1281423) [2022 bp, 673 aa] {ON}
           Anc_4.121
          Length = 673

 Score = 31.2 bits (69), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 32/59 (54%), Gaps = 9/59 (15%)

Query: 64  MWQALSQIIKENAELRSSINKFMQF-------EAIDTIAFDDVVRKIEFDN--LTDEKV 113
           +W A   +IKEN +L+  +NK   F       + +  I FD+ ++++E +N  L  EKV
Sbjct: 605 VWLAHGTLIKENKDLKDKLNKLPLFSRGCEHIQNLSGINFDECLKQLEVENHVLDAEKV 663

>CAGL0C02013g Chr3 complement(209930..210919) [990 bp, 329 aa] {ON}
           weakly similar to uniprot|P38152 Saccharomyces
           cerevisiae YBR291c CTP1 or uniprot|P43617 Saccharomyces
           cerevisiae YFR045w
          Length = 329

 Score = 30.8 bits (68), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 13/51 (25%), Positives = 26/51 (50%)

Query: 215 SSVKDQVLTYSQTALKNLYSLAIKKPLRFIESGRLEHSGIPASNPYDLASY 265
           + V D V   +  ++  L+S  I  P  F+++G   H  + A+ P+++  Y
Sbjct: 4   NKVNDNVTLITAGSVSGLFSATITYPFEFLKTGLQLHRNVVAAKPFEVLGY 54

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.394 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 53,692,525
Number of extensions: 2322714
Number of successful extensions: 6455
Number of sequences better than 10.0: 50
Number of HSP's gapped: 6573
Number of HSP's successfully gapped: 50
Length of query: 519
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 405
Effective length of database: 40,409,475
Effective search space: 16365837375
Effective search space used: 16365837375
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)