Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_56.223346.7ON1008100845260.0
KLTH0C11594g6.7ON1006101027150.0
Ecym_30096.7ON1027103019350.0
ACR020C6.7ON1002101318580.0
KLLA0D00792g6.7ON1020103617200.0
KAFR0L003306.7ON1028104616640.0
Skud_5.346.7ON1019104316350.0
Smik_5.326.7ON1020104116140.0
Suva_5.136.7ON1023104516060.0
SAKL0E00770g6.7ON104770116070.0
NCAS0F001806.7ON1018104415550.0
KNAG0E009706.7ON1004103215380.0
TBLA0A072106.7ON1041105814520.0
Kpol_1045.806.7ON101971411631e-142
TDEL0G046406.7ON101771111341e-138
NDAI0K029106.7ON106374911271e-136
ZYRO0F00440g6.7ON103972210981e-132
YEL055C (POL5)6.7ON102272410901e-131
TPHA0J002506.7ON102472010331e-123
CAGL0B03553g6.7ON102171410051e-119
YBR184Wna 1ON523152736.0
KAFR0E044304.375ON163563736.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_56.22334
         (1008 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_56.22334 s56 (53478..56504) [3027 bp, 1008 aa] {ON} YEL055C...  1748   0.0  
KLTH0C11594g Chr3 complement(952163..955183) [3021 bp, 1006 aa] ...  1050   0.0  
Ecym_3009 Chr3 (18017..21100) [3084 bp, 1027 aa] {ON} similar to...   749   0.0  
ACR020C Chr3 complement(391573..394581) [3009 bp, 1002 aa] {ON} ...   720   0.0  
KLLA0D00792g Chr4 (73422..76484) [3063 bp, 1020 aa] {ON} similar...   667   0.0  
KAFR0L00330 Chr12 complement(57677..60763) [3087 bp, 1028 aa] {O...   645   0.0  
Skud_5.34 Chr5 complement(47480..50539) [3060 bp, 1019 aa] {ON} ...   634   0.0  
Smik_5.32 Chr5 complement(50787..53849) [3063 bp, 1020 aa] {ON} ...   626   0.0  
Suva_5.13 Chr5 complement(24593..27664) [3072 bp, 1023 aa] {ON} ...   623   0.0  
SAKL0E00770g Chr5 (53894..57037) [3144 bp, 1047 aa] {ON} similar...   623   0.0  
NCAS0F00180 Chr6 (25742..28798) [3057 bp, 1018 aa] {ON} Anc_6.7 ...   603   0.0  
KNAG0E00970 Chr5 (183126..186140) [3015 bp, 1004 aa] {ON} Anc_6....   597   0.0  
TBLA0A07210 Chr1 (1796426..1799551) [3126 bp, 1041 aa] {ON} Anc_...   563   0.0  
Kpol_1045.80 s1045 complement(186944..190003) [3060 bp, 1019 aa]...   452   e-142
TDEL0G04640 Chr7 complement(845491..848544) [3054 bp, 1017 aa] {...   441   e-138
NDAI0K02910 Chr11 complement(658930..662121) [3192 bp, 1063 aa] ...   438   e-136
ZYRO0F00440g Chr6 (42723..45842) [3120 bp, 1039 aa] {ON} similar...   427   e-132
YEL055C Chr5 complement(48471..51539) [3069 bp, 1022 aa] {ON}  P...   424   e-131
TPHA0J00250 Chr10 (55997..59071) [3075 bp, 1024 aa] {ON} Anc_6.7...   402   e-123
CAGL0B03553g Chr2 (354365..357430) [3066 bp, 1021 aa] {ON} simil...   391   e-119
YBR184W Chr2 (597363..598934) [1572 bp, 523 aa] {ON} Putative pr...    33   6.0  
KAFR0E04430 Chr5 complement(895687..900594) [4908 bp, 1635 aa] {...    33   6.3  

>Kwal_56.22334 s56 (53478..56504) [3027 bp, 1008 aa] {ON} YEL055C
            (POL5) - DNA polymerase V [contig 186] FULL
          Length = 1008

 Score = 1748 bits (4526), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 884/1008 (87%), Positives = 884/1008 (87%)

Query: 1    MGGIEINRDLFYKLASDLSEERLQATIDLVTQLSKLEKDSSEWQYVLDRLIKGLSSSRNG 60
            MGGIEINRDLFYKLASDLSEERLQATIDLVTQLSKLEKDSSEWQYVLDRLIKGLSSSRNG
Sbjct: 1    MGGIEINRDLFYKLASDLSEERLQATIDLVTQLSKLEKDSSEWQYVLDRLIKGLSSSRNG 60

Query: 61   ARLGFSLCLTEVVALALEKGVLARVDQYMHLLISALSKENVKNGKEERGLLFGKLFGLQV 120
            ARLGFSLCLTEVVALALEKGVLARVDQYMHLLISALSKENVKNGKEERGLLFGKLFGLQV
Sbjct: 61   ARLGFSLCLTEVVALALEKGVLARVDQYMHLLISALSKENVKNGKEERGLLFGKLFGLQV 120

Query: 121  LLNEPLFSKVFTPDENQLNVELMSSYMSYLIDIALAKTWIRESSLFTLFQAVEKLAPLLG 180
            LLNEPLFSKVFTPDENQLNVELMSSYMSYLIDIALAKTWIRESSLFTLFQAVEKLAPLLG
Sbjct: 121  LLNEPLFSKVFTPDENQLNVELMSSYMSYLIDIALAKTWIRESSLFTLFQAVEKLAPLLG 180

Query: 181  SRQPLKAVLELLDSKGLTQTSEGLAIYLFLLHRCSHTGPVLRKKGFLDELNLKNPWKNND 240
            SRQPLKAVLELLDSKGLTQTSEGLAIYLFLLHRCSHTGPVLRKKGFLDELNLKNPWKNND
Sbjct: 181  SRQPLKAVLELLDSKGLTQTSEGLAIYLFLLHRCSHTGPVLRKKGFLDELNLKNPWKNND 240

Query: 241  PLKRGNLPAISNALKDSGARDDPSLTQKGVWAPRLHFAWDIVLQTLLHAENSEITTMQXX 300
            PLKRGNLPAISNALKDSGARDDPSLTQKGVWAPRLHFAWDIVLQTLLHAENSEITTMQ  
Sbjct: 241  PLKRGNLPAISNALKDSGARDDPSLTQKGVWAPRLHFAWDIVLQTLLHAENSEITTMQPP 300

Query: 301  XXXXXXXXXXXXXXXXXXWKSVVDESFFNEKSSSERKYLGILVFEKTFQLSPPRYLPQLF 360
                              WKSVVDESFFNEKSSSERKYLGILVFEKTFQLSPPRYLPQLF
Sbjct: 301  SKKRKKEEKEAFIKFPEFWKSVVDESFFNEKSSSERKYLGILVFEKTFQLSPPRYLPQLF 360

Query: 361  SKNLIRCLINQCGSAERNLHKISQKALATIVEVCKAQPEKTAPSFVGLSFGEYGTINFDH 420
            SKNLIRCLINQCGSAERNLHKISQKALATIVEVCKAQPEKTAPSFVGLSFGEYGTINFDH
Sbjct: 361  SKNLIRCLINQCGSAERNLHKISQKALATIVEVCKAQPEKTAPSFVGLSFGEYGTINFDH 420

Query: 421  LTKTKTVNSLLSNKSLRSDDLMILEESLISNLFGNLKELSRARFILDAILHLVRAHKAHA 480
            LTKTKTVNSLLSNKSLRSDDLMILEESLISNLFGNLKELSRARFILDAILHLVRAHKAHA
Sbjct: 421  LTKTKTVNSLLSNKSLRSDDLMILEESLISNLFGNLKELSRARFILDAILHLVRAHKAHA 480

Query: 481  DEVWLKPVLKALVCLGFFQQSELKDVKDSQESFHSLSSIASERLFSILADLLTVEQDTYS 540
            DEVWLKPVLKALVCLGFFQQSELKDVKDSQESFHSLSSIASERLFSILADLLTVEQDTYS
Sbjct: 481  DEVWLKPVLKALVCLGFFQQSELKDVKDSQESFHSLSSIASERLFSILADLLTVEQDTYS 540

Query: 541  VCWPFIAVQLLKTDTNQKTLLQSMDEELGDILDSSMTVLSSISQKANEANXXXXXXXXXX 600
            VCWPFIAVQLLKTDTNQKTLLQSMDEELGDILDSSMTVLSSISQKANEAN          
Sbjct: 541  VCWPFIAVQLLKTDTNQKTLLQSMDEELGDILDSSMTVLSSISQKANEANLSQFQGLQLL 600

Query: 601  XXVNILQAYAGEVESISVLEDLVSFCNEFEDGAKSAPLAGFIEIXXXXXXXXXXXXXXXX 660
              VNILQAYAGEVESISVLEDLVSFCNEFEDGAKSAPLAGFIEI                
Sbjct: 601  FSVNILQAYAGEVESISVLEDLVSFCNEFEDGAKSAPLAGFIEILLSLAAQKKALSRKSS 660

Query: 661  XXXWESFVADVTEKDLTVLLNVLPTRENKEGFSNLFXXXXXXXXXXXXXXXXXXXXXXXK 720
               WESFVADVTEKDLTVLLNVLPTRENKEGFSNLF                       K
Sbjct: 661  LLAWESFVADVTEKDLTVLLNVLPTRENKEGFSNLFEGGSESEGDSEEDEEMNDEEEPEK 720

Query: 721  XXXXXXXXXXXXXXXXXXXXXXXXMGKIDKEATSALAKALNLPDSIVDDKGEVRFXXXXX 780
                                    MGKIDKEATSALAKALNLPDSIVDDKGEVRF     
Sbjct: 721  DASDDEIEESDNNVSEDDSSSDDDMGKIDKEATSALAKALNLPDSIVDDKGEVRFEDLGD 780

Query: 781  XXXXXXXXXXXXXXXXXXXXXGQLSEIFKRRKEALSKIPTGNKRKQEVKESRENVIAFKH 840
                                 GQLSEIFKRRKEALSKIPTGNKRKQEVKESRENVIAFKH
Sbjct: 781  TDEEEEESEEDLDDEKMMELDGQLSEIFKRRKEALSKIPTGNKRKQEVKESRENVIAFKH 840

Query: 841  RVVDMLEILVRWIESKMKKDGHIEKSVLDKVFAIILPLLDCIRTTLDKPLAEKIAKLLKN 900
            RVVDMLEILVRWIESKMKKDGHIEKSVLDKVFAIILPLLDCIRTTLDKPLAEKIAKLLKN
Sbjct: 841  RVVDMLEILVRWIESKMKKDGHIEKSVLDKVFAIILPLLDCIRTTLDKPLAEKIAKLLKN 900

Query: 901  KICKLKPSFSSTTEKVDKKAVLSLLRSVHEAMLVKKAGQFQTLYFSGCSTTSMFLARLVV 960
            KICKLKPSFSSTTEKVDKKAVLSLLRSVHEAMLVKKAGQFQTLYFSGCSTTSMFLARLVV
Sbjct: 901  KICKLKPSFSSTTEKVDKKAVLSLLRSVHEAMLVKKAGQFQTLYFSGCSTTSMFLARLVV 960

Query: 961  DTFPELETYEELTGIYHKTLDGWFVTGKFGVSMFVEFLNWLSVKKTQQ 1008
            DTFPELETYEELTGIYHKTLDGWFVTGKFGVSMFVEFLNWLSVKKTQQ
Sbjct: 961  DTFPELETYEELTGIYHKTLDGWFVTGKFGVSMFVEFLNWLSVKKTQQ 1008

>KLTH0C11594g Chr3 complement(952163..955183) [3021 bp, 1006 aa] {ON}
            similar to uniprot|P39985 Saccharomyces cerevisiae
            YEL055C
          Length = 1006

 Score = 1050 bits (2715), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 564/1010 (55%), Positives = 693/1010 (68%), Gaps = 10/1010 (0%)

Query: 1    MGGIEINRDLFYKLASDLSEERLQATIDLVTQLSKLEKDSSEWQYVLDRLIKGLSSSRNG 60
            M   E++RDLFYKLASDLSEERLQA I LVTQLSK+EK+S EW+YVL+RLIKGLSSSRNG
Sbjct: 1    MVAAEVDRDLFYKLASDLSEERLQAIIGLVTQLSKVEKESREWEYVLNRLIKGLSSSRNG 60

Query: 61   ARLGFSLCLTEVVALALEKGVLARVDQYMHLLISALSKENVKNGKEERGLLFGKLFGLQV 120
            ARLG+ LCLTEVVA ALEK VLA  D+Y+ LL+S LS+EN+KNGKEERG+LFGKLFGLQV
Sbjct: 61   ARLGYCLCLTEVVASALEKSVLAHADEYLRLLLSTLSRENIKNGKEERGILFGKLFGLQV 120

Query: 121  LLNEPLFSKVFTPDENQLNVELMSSYMSYLIDIALAKTWIRESSLFTLFQAVEKLAPLLG 180
            LLNEPLFS+VF   E+++N+E M +Y+  LID+ALAKTWIRESS+FTL+QA+EKL+P++G
Sbjct: 121  LLNEPLFSQVFKA-EDEINLEFMLTYVGTLIDVALAKTWIRESSMFTLYQAIEKLSPVMG 179

Query: 181  SRQPLKAVLELLDSKGLTQTSEGLAIYLFLLHRCSHTGPVLRKKGFLDELNLKNPWKNND 240
            S++PLKA+L LLDS+GLTQTSEGLA+YL+L H+   T   LRKKG L++L L +PWKNND
Sbjct: 180  SQKPLKALLTLLDSRGLTQTSEGLAVYLYLFHKSFITTGALRKKGLLEDLKLNSPWKNND 239

Query: 241  PLKRGNLPAISNALKDSGARDDPSLTQKGVWAPRLHFAWDIVLQTLLHAENSEITTMQXX 300
            PL +GNLPAI+NALK+  + +D S+ QKG+W PRLHF WDI+L +       E    +  
Sbjct: 240  PLSKGNLPAIANALKEINSSEDLSVKQKGIWMPRLHFVWDIILTSFFEGGEYEDKASEPA 299

Query: 301  XXXXXXXXXXXXXXXX--XXWKSVVDESFFNEKSSSERKYLGILVFEKTFQLSPPRYLPQ 358
                                WKSVVDESFFNEKSSSERKYLG LVFEK F L+P  Y   
Sbjct: 300  KKKRKKSSEERHQQIKFPEFWKSVVDESFFNEKSSSERKYLGFLVFEKAFSLAPVSYTHT 359

Query: 359  LFSKNLIRCLINQCGSAERNLHKISQKALATIVEVCKAQPEKTAPSFVGLSFGEYGTINF 418
            L SKNL RCLINQCGS+ERNLHK+SQ+ L TIV+VCK QPEKTAPSF  L+  E+G+I+F
Sbjct: 360  LLSKNLTRCLINQCGSSERNLHKVSQRVLTTIVDVCKNQPEKTAPSFETLALKEHGSISF 419

Query: 419  DHLTKTKTVNSLLSNKSLRSDDLMILEESLISNLFGNLKELSRARFILDAILHLVRAHKA 478
            D LTK+KT+N LLS KSL    L +L E L ++LF +L++ SR RF+LDA+LHLVRAHK+
Sbjct: 420  DQLTKSKTLNLLLSGKSLTDQQLTLLGEVLTNHLFTSLRDHSRVRFLLDAMLHLVRAHKS 479

Query: 479  HADEVWLKPVLKALVCLGFFQQSELKDVKDSQESFHSLSSIASERLFSILADLLTVEQDT 538
             AD+VWL P+L +LV  GFF+  E     +  +   ++S +A ERL+SILADL++ +  +
Sbjct: 480  AADKVWLAPLLDSLVQQGFFELDENDRQPEVGDETFTVSKLAVERLYSILADLISADYKS 539

Query: 539  YSVCWPFIAVQLLKTDTNQKTLLQSMDEELGDILDSSMTVLSSISQKANEANXXXXXXX- 597
              VCWP   V++L +   +  LL  MDEEL +IL+SS+    +I  +A +          
Sbjct: 540  EKVCWPRFTVEILMSKLKKNKLLNPMDEELTEILNSSIKTFKTICSEAEKGGKQMQARGF 599

Query: 598  XXXXXVNILQAYAGEVESISVLEDLVSFCNEFEDGAKSAPLAGFIEIXXXXXXXXXXXXX 657
                 VNILQAY+GE +SI VL+DL SF    E+  KS   AGFIEI             
Sbjct: 600  QLIFSVNILQAYSGETDSIPVLQDLNSFHQTLEEN-KSGSYAGFIEILLSLAAQKKALLR 658

Query: 658  XXXXXXWESFVADVTEKDLTVLLNVLPTRENKEGFSNLFXXXXXXXXXXXXXXXXXXXXX 717
                  WE FV + ++ D+ VLL +LP RENKEGFS LF                     
Sbjct: 659  KASLLVWELFVGEASQDDIAVLLEILPARENKEGFSKLF----EGDDEGGSDEEEISDEL 714

Query: 718  XXKXXXXXXXXXXXXXXXXXXXXXXXXMGKIDKEATSALAKALNLPDSIVDDKGEVRFXX 777
              +                          +IDKEATSAL KALNLP+SIV+D GEV F  
Sbjct: 715  FAEEGASGDNTEEEESGPDSDDQDGEDTEQIDKEATSALVKALNLPESIVNDNGEVHF-E 773

Query: 778  XXXXXXXXXXXXXXXXXXXXXXXXGQLSEIFKRRKEALSKIPTGNKRKQEVKESRENVIA 837
                                    GQLSEIFKRRKEALSKIPTGNKRKQEVKESRENVIA
Sbjct: 774  DLEDTEDEEISDEDLDDEKMMELDGQLSEIFKRRKEALSKIPTGNKRKQEVKESRENVIA 833

Query: 838  FKHRVVDMLEILVRWIESKMKKDGHIEKSVLDKVFAIILPLLDCIRTTLDKPLAEKIAKL 897
            FKHRVVDMLEI VRW ES++K+ G  EKSV  K+ +IILPL+ C+RTTLDKPLAEK+ KL
Sbjct: 834  FKHRVVDMLEIFVRWAESELKQGGRPEKSVTSKIISIILPLISCVRTTLDKPLAEKVTKL 893

Query: 898  LKNKICKLKPSFSSTTEKVDKKAVLSLLRSVHEAMLVKKAGQFQTLYFSGCSTTSMFLAR 957
            LKNKICKLK +  ++ + +++    + L+SVHEAML+KK GQFQ LYFS CST SMFLA+
Sbjct: 894  LKNKICKLKITTDTSLDGLEENLFENSLKSVHEAMLLKKCGQFQNLYFSACSTASMFLAK 953

Query: 958  LVVDTFPELETYEELTGIYHKTLDGWFVTGKFGVSMFVEFLNWLSVKKTQ 1007
            L V   P  ETY  LT +YHKTL+ WFV GKF  ++F+EFLNWLS+KK Q
Sbjct: 954  LFVHRSPRPETYFTLTEVYHKTLNEWFVGGKFSANLFIEFLNWLSIKKQQ 1003

>Ecym_3009 Chr3 (18017..21100) [3084 bp, 1027 aa] {ON} similar to
            Ashbya gossypii ACR020C
          Length = 1027

 Score =  749 bits (1935), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 421/1030 (40%), Positives = 601/1030 (58%), Gaps = 33/1030 (3%)

Query: 5    EINRDLFYKLASDLSEERLQATIDLVTQLSKL-EKDS-SEWQYVLDRLIKGLSSSRNGAR 62
            ++NRDLFY+LASD+ EER++A + +V +LS++ E+D+  EWQYVL RLIKGL+S+R GAR
Sbjct: 3    QVNRDLFYRLASDIEEERVKAAVGIVNELSEIVEQDNEQEWQYVLGRLIKGLASARQGAR 62

Query: 63   LGFSLCLTEVVALALEKGVLARVDQYMHLLISALSKENVKNGKEERGLLFGKLFGLQVLL 122
            LGFS+CL+EVV L LEKG L  V+ Y+  L   L+  +VKNGKEERGL+FGKLFGLQ LL
Sbjct: 63   LGFSMCLSEVVTLGLEKGRLESVEVYIGQLFEKLADGHVKNGKEERGLVFGKLFGLQALL 122

Query: 123  NEPLFSKVFTPDENQLNVELMSSYMSYLIDIALAKTWIRESSLFTLFQAVEKLAPLLGSR 182
            NEPLF ++F  D   ++++    +M +L+ +AL+KTW+RE  LFTL+Q +EKL+      
Sbjct: 123  NEPLFGRIFM-DGKVIDLQFTVLFMDHLVKLALSKTWLREPCLFTLYQLIEKLSSKFTEV 181

Query: 183  QPLKAVLELLDSKGLTQTSEGLAIYLFLLHRCSHTGPVLRKKGFLDELNLKNPWKNNDPL 242
              L+A+ +LLD   LT T+EGLAIYL L++ C  T  +L K   L ++ L++ WKNNDPL
Sbjct: 182  GHLEAIFKLLDHHKLTLTNEGLAIYLLLIYECVETKSLLIKSKILSKITLRSCWKNNDPL 241

Query: 243  KRGNLPAISNALKDSGARDDPSLTQKGVWAPRLHFAWDIVLQTLLHAEN-----SEITTM 297
             +GN+  +S+ LKD    +D  + QKG WAPRLHF WDI++  L   +        +   
Sbjct: 242  SKGNVTILSSVLKDIIPVEDNVMKQKGSWAPRLHFVWDILIPILCRQQEIPGAAEHVPKK 301

Query: 298  QXXXXXXXXXXXXXXXXXXXXWKSVVDESFFNEKSSSERKYLGILVFEKTFQLSPPRYLP 357
            +                    W+ VVDESFFN K+SSERKYLG+L+ EK  Q  P  Y+P
Sbjct: 302  RKTDKKDKIEKVRAPLSFSEFWQVVVDESFFNAKASSERKYLGLLIIEKAMQCVPSSYVP 361

Query: 358  QLFSKNLIRCLINQCGSAERNLHKISQKALATIVEVCKAQPEKTAPSFVGLSFGEYGTIN 417
             +FSKN++R LINQ   + RNLHKIS   L  IV +C++ P K  P    L FG  G+IN
Sbjct: 362  SIFSKNIMRTLINQSSESTRNLHKISTNVLKNIVSICESDPTKVLPVVNSLWFGPNGSIN 421

Query: 418  FDHLTKTKTVNSLLSNKSLRSDDLMILEESLISNLFGNLKELSRARFILDAILHLVRAHK 477
            FD LTK+KT++S+++ + L+S+ L  L   ++S +      +S+ R++LD +LH+V+AHK
Sbjct: 422  FDILTKSKTMDSIIAVQGLKSEHLASLVALIVSEIDKESSPVSKVRYLLDILLHIVQAHK 481

Query: 478  AHADEVWLKPVLKALVCLGFFQQSELKDVKDSQESF--------HSLSSIASERLFSILA 529
              AD  W KP+L ++V L FF   +L D +D               +  ++ ERLFSIL 
Sbjct: 482  LKADMFWTKPLLSSIVKLSFF-NDKLSDFEDVDLDAHADADAESKKIPVLSRERLFSILG 540

Query: 530  DLL-TVEQDTYSVCWPFIAVQLLKTDTNQKTLLQSMDEELGDILDSSMTVLSSISQKANE 588
             L+ T +Q+     WP++ +Q++  + ++++L+  +DEEL    + ++  ++ I +K+ E
Sbjct: 541  QLIPTSKQNVDGPTWPYVTLQIVIAEEHRRSLIFKLDEELQQTKEHALKAINDIRKKSQE 600

Query: 589  A-NXXXXXXXXXXXXVNILQAYAGEVESISVLEDLVSFCNEFEDGAKSAPLAGFIEIXXX 647
            +              V ILQ Y+G+ ES S+LE+L +F    +   K   L G  EI   
Sbjct: 601  SPQASELCGLELLLGVTILQMYSGDAESASILEELTTFYKSID--TKPNGLVGITEILLS 658

Query: 648  XXXXXXXXXXXXXXXXWESFVADVTEKDLTVLLNVLPTRENKEGFSNLFXXXXXXXXXXX 707
                            WES +  +   +L +L ++L  RENK+GF+ LF           
Sbjct: 659  MVAQKKAVLRRLTLIVWESLIDKIEGDELNLLFDILSVRENKQGFAALFEAADEYVEVDD 718

Query: 708  XXXXXXXXXXXXKXXXXXXXXXXXXXXXXXXXXXXXXMGK------IDK---EATSALAK 758
                                                  G       IDK   E TSALA 
Sbjct: 719  DEINEDVDISHENCDSSDHNDSHSSSYFEECGSNEEDSGNNGYNEYIDKINKETTSALAD 778

Query: 759  ALNLPDSIVDDKGEVRFXXXXXXXXXXXXXXXXXXXXXXXXXXGQLSEIFKRRKEALSKI 818
            AL LP++++D+ G+V F                          GQLSEIFKRRKEALSK+
Sbjct: 779  ALKLPENMIDENGDVGF-EDFDDGDEEEEEEESMDDEAMMELDGQLSEIFKRRKEALSKV 837

Query: 819  PTGNKRKQEVKESRENVIAFKHRVVDMLEILVRWIESKMKKDGHIEKSVLDKVFAIILPL 878
            PTGNKRK EV+ESRE+VI+FKHRV+DMLEI  +++     K    E S L  + ++I PL
Sbjct: 838  PTGNKRKLEVRESRESVISFKHRVLDMLEIYCKYVVRLAGKSQQCEASKLLNIHSMIDPL 897

Query: 879  LDCIRTTLDKPLAEKIAKLLKNKICKLK-PSFSSTTEKVDKKAVLSLLRSVHEAMLVKKA 937
            L CI+ T+D+PLAEK AKLLKN ICKLK   F    ++V +   LS L ++H +ML KK 
Sbjct: 898  LKCIQQTIDRPLAEKAAKLLKNHICKLKLEPFKGCVDEVSEIVFLS-LENIHNSMLAKKP 956

Query: 938  GQFQTLYFSGCSTTSMFLARLVVDTFPELETYEELTGIYHKTLDGWFVTGKFGVSMFVEF 997
            GQFQ LYF  CST+S+FL +++V T P+  TY  +  IY +++  W V GKFG + F++F
Sbjct: 957  GQFQQLYFGACSTSSLFLGKILVVTKPDEVTYNRIIDIYSQSIKNWTVKGKFGPNFFIDF 1016

Query: 998  LNWLSVKKTQ 1007
            +NWL+ K+++
Sbjct: 1017 INWLASKRSK 1026

>ACR020C Chr3 complement(391573..394581) [3009 bp, 1002 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YEL055C
            (POL5)
          Length = 1002

 Score =  720 bits (1858), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 412/1013 (40%), Positives = 586/1013 (57%), Gaps = 25/1013 (2%)

Query: 5    EINRDLFYKLASDLSEERLQATIDLVTQLSKL--EKDSSEWQYVLDRLIKGLSSSRNGAR 62
            ++NRDLFYKL SDLS+ER+Q+ I L+T+L++L  E++  EW+YVL RL++GL+SS   AR
Sbjct: 4    QVNRDLFYKLTSDLSDERVQSAIALITELNELAVEENGKEWEYVLGRLVRGLASSNKSAR 63

Query: 63   LGFSLCLTEVVALALEKGVLARVDQYMHLLISALSKENVKNGKEERGLLFGKLFGLQVLL 122
            LGFSLCLTEV A ALE G +   ++Y+  L +AL  + VKNGKEERG LFG++FGLQ +L
Sbjct: 64   LGFSLCLTEVAAAALENGHIGSAEEYLERLEAALPVDKVKNGKEERGQLFGRMFGLQAML 123

Query: 123  NEPLFSKVFTPDENQLNVELMSSYMSYLIDIALAKTWIRESSLFTLFQAVEKLAPLLGSR 182
            NEPLFS+VF   + Q+       +M  L+ +AL K W+R+  LFTL+Q +E+LAP     
Sbjct: 124  NEPLFSRVFVAGDGQIQQAFAHQFMQRLVQLALTKAWLRQPCLFTLYQVIERLAPRATDT 183

Query: 183  QPLKAVLELLDSKGLTQTSEGLAIYLFLLHRCSHTGPVLRKKGFLDELNLKNPWKNNDPL 242
            + L+AVL LLD   LT TSEGLAIYLFL ++C     +L +    D L L   WK ++PL
Sbjct: 184  EFLRAVLTLLDEHNLTHTSEGLAIYLFLQNKCPEIKRILDETKIFDALPLVKRWKADNPL 243

Query: 243  KRGNLPAISNALKDSGARDDPSLTQKGVWAPRLHFAWDIVLQTLLHAENSEITTMQXXXX 302
             +GN  A+++ LKD    +     QKGVW PRLHF WD++L  L   + S  T +     
Sbjct: 244  AKGNAKALASVLKDDALIEGDGPKQKGVWTPRLHFVWDLLLPLLAEEKVSPDTHVHIAKK 303

Query: 303  XXXXXXXXXXXXXXXX----WKSVVDESFFNEKSSSERKYLGILVFEKTFQLSPPRYLPQ 358
                                W+ VVDESFF+EK+SSERKYLG+L+ EK  +  P   +  
Sbjct: 304  HKTGKKPKSAESGMLSFGEFWQVVVDESFFSEKASSERKYLGVLIMEKAVRSVPSSLVQD 363

Query: 359  LFSKNLIRCLINQCGSAERNLHKISQKALATIVEVCKAQPEKTAPSFVGLSFGEYGTINF 418
            +FSKN +R LINQ     R+LHK+S   L TIV  C+    K  P    + FG  GTINF
Sbjct: 364  IFSKNALRTLINQSSETTRHLHKLSVNFLKTIVSACETDASKVVPVLTAIWFGPNGTINF 423

Query: 419  DHLTKTKTVNSLLSNKSLRSDDLMILEESLISNLFGNLKELSRARFILDAILHLVRAHKA 478
            D LTK+KT +SL++ KSL + +L  L   L+  L     ++S+ +FILD +LH++RAHK 
Sbjct: 424  DKLTKSKTTDSLVTAKSLTATELAQLVTLLLQQLEHENTDISKIKFILDTLLHVIRAHKW 483

Query: 479  HADEVWLKPVLKALVCLGFFQQSELKDVKDSQESFHSLSSIASERLFSILADLLTV-EQD 537
             A   W  P+L ALV   FF  S    + +  E   +LS    ERLFS+L +L+ + + D
Sbjct: 484  KAHLSWTNPLLLALVRYAFF--SAPSHLSEQSEEIITLS---RERLFSVLGELIPLSKHD 538

Query: 538  TYSVCWPFIAVQLLKTDTNQKTLLQSMDEELGDILDSSMTVLSSISQKANEA--NXXXXX 595
              +  W +  ++LL  +  +  L   +D EL  +  +++ +L  I  K+ ++        
Sbjct: 539  MGAPSWAYATLELLLQEKEKHPLALQLDAELETVTSNALKILRKIINKSTKSPNENPQLF 598

Query: 596  XXXXXXXVNILQAYAGEVESISVLEDLVSFCNEFEDGAKSAPLAGFIEIXXXXXXXXXXX 655
                   V+ILQ +AG+V+S S LE+L SF      GA +  L G  EI           
Sbjct: 599  GLELLLSVSILQVHAGDVDSASTLEELASFYESATQGADNG-LVGITEILLSLVAQKKSM 657

Query: 656  XXXXXXXXWESFVADVTEKDLTVLLNVLPTRENKEGFSNLFXXXXXXXXXXXXXXXXXXX 715
                    WESF+  V +++L +LLN L  RENK GF+ LF                   
Sbjct: 658  LRKLTLVVWESFIDKVGKEELELLLNTLSARENKAGFAQLF-----EGADEYEELGSDEA 712

Query: 716  XXXXKXXXXXXXXXXXXXXXXXXXXXXXXMGKIDKEATSALAKALNLPDSIVDDKGEVRF 775
                +                        + KIDKEATSALA AL LPD+I+D+ G V F
Sbjct: 713  GTDNEDQSSESNEDSSDEVSDQEDYSDEDVAKIDKEATSALAHALRLPDNILDEDGNVGF 772

Query: 776  XXXXXXXXXXXXXXXXXXXXXXXXXXGQLSEIFKRRKEALSKIPTGNKRKQEVKESRENV 835
                                      GQLSEIFKRRK+AL+KIPTGN+RK E KESR++V
Sbjct: 773  ----EEMDDEEEEEESMDDEAMMELDGQLSEIFKRRKDALNKIPTGNQRKIEAKESRDSV 828

Query: 836  IAFKHRVVDMLEILVRWIESKMKKDGHIEKSVLDKVFAIILPLLDCIRTTLDKPLAEKIA 895
            IAFKHRVVDMLEI  + +E  + K+  +  ++   + ++  P++  I+ TLD+PLAEKI+
Sbjct: 829  IAFKHRVVDMLEIYCKNVERSVTKNKKLSATMSANMLSMAEPMVKAIQQTLDRPLAEKIS 888

Query: 896  KLLKNKICKLKP-SFSSTTEKVDKKAVLSLLRSVHEAMLVKKAGQFQTLYFSGCSTTSMF 954
            KLLKN +CK+KP ++   T +++++++L+ L +VH  +L  K GQF  L+FS CS+TS+F
Sbjct: 889  KLLKNSVCKMKPAAYKEFTSEINEESILTSLENVHATILSPKPGQFPQLFFSACSSTSLF 948

Query: 955  LARLVVDTFPELETYEELTGIYHKTLDGWFVTGKFGVSMFVEFLNWLSVKKTQ 1007
            L+++++    +  T E++ GIY  T+  W V+GKFG + F++F+NWL+ KK++
Sbjct: 949  LSKVLIAMKDDPSTSEQVIGIYSTTMKHWNVSGKFGPNFFIDFINWLASKKSK 1001

>KLLA0D00792g Chr4 (73422..76484) [3063 bp, 1020 aa] {ON} similar to
            uniprot|P39985 Saccharomyces cerevisiae YEL055C
          Length = 1020

 Score =  667 bits (1720), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/1036 (39%), Positives = 574/1036 (55%), Gaps = 61/1036 (5%)

Query: 6    INRDLFYKLASDLSEERLQATIDLVTQLSKLEKDSSE-----WQYVLDRLIKGLSSSRNG 60
            +NRDLF+K+AS+L +ERL+A I L+ ++S+++   SE     W+YV+ RL+KGL+S+R G
Sbjct: 10   VNRDLFFKVASELEKERLEAAIQLINEISRVDTRESEDGVREWEYVIGRLVKGLASNRGG 69

Query: 61   ARLGFSLCLTEVVALALEK-GVLARVDQYMHLLISALSKENV-KNGKEERGLLFGKLFGL 118
            ARLGFS+CLTEV+ALALE+  +L  +  +++ L   L      KNGKEERG+LFG++F L
Sbjct: 70   ARLGFSMCLTEVIALALERRDILPSIYAFLNQLEQTLPAGTAFKNGKEERGVLFGQMFAL 129

Query: 119  QVLLNEPLFSKVF-TPDENQLNVELMSSYMSYLIDIALAKTWIRESSLFTLFQAVEKL-A 176
            Q LLNEP+FSK+F + D+N +N+E + +Y++ LI +AL+KTW+RE  L++++Q ++K   
Sbjct: 130  QSLLNEPVFSKLFLSTDDNSINMEFLLTYLNKLIQLALSKTWLREPCLYSVYQTIQKCET 189

Query: 177  PLLGSRQPLKAVLELLDSKGLTQTSEGLAIYL-FLLHRCSHTGP-VLRKKGFLDELNLKN 234
             L      +  +L LLD K LT T+EGL+IYL F   R +++   V+   G         
Sbjct: 190  RLFNDPTAINLILGLLDEKKLTLTNEGLSIYLMFNAQRDTYSSSLVIHNSG--------- 240

Query: 235  PWKNNDPLKRGNLPAISNALKDSGARDDPSLTQKGVWAPRLHFAWDIVLQTLL------H 288
             WKNNDPL +GN+  +++ LKD    +   L QKG WAPRLH+ WDI+L  L        
Sbjct: 241  -WKNNDPLSKGNVQLLASVLKDVVPVEKSDLKQKGTWAPRLHYVWDILLPLLEDDGSFGQ 299

Query: 289  AENSEITTMQXXXXXXXXXXXXXXXXXXXXWKSVVDESFFNEKSSSERKYLGILVFEKTF 348
            +  S I+  +                    W++VVDESFFNEKSS+ERKYLG L+ E+  
Sbjct: 300  SMESHISKKRKKNTASMSSERTGRIQFPDFWQAVVDESFFNEKSSNERKYLGFLILEEAI 359

Query: 349  QLSPPRYLPQLFSKNLIRCLINQCGSAERNLHKISQKALATIVEVCKAQPEKTAPSFVGL 408
            ++  P+ +  L S+NL+RC+INQ   ++R L+KIS +AL +IV  C+  P K  P     
Sbjct: 360  KVCSPKLIQVLLSQNLLRCIINQSQDSQRMLNKISTQALKSIVAECERSPAKVVPLVEVF 419

Query: 409  SFGEYGTINFDHLTKTKTVNSLLSNKSLRSDDLMILEESLISNLFGNLK---ELSRARFI 465
             FG  G+INFD L K+K VNSL+S  SL  + L+ L   LIS L  +       +  RFI
Sbjct: 420  WFGRNGSINFDKLIKSKLVNSLISTSSLEKEHLVDLVNLLISQLPQDQSTKDSFNLTRFI 479

Query: 466  LDAILHLVRAHKAHADEVWLKPVLKALVCLGFFQQSELKDVKDSQESFHSLSSIASERLF 525
             D  LH+ RAHK   +  W+KP+L A++   FF +S+             LS +A ERL+
Sbjct: 480  FDTFLHITRAHKTRLESHWVKPLLSAIIKAAFFNESD----------NSKLSELAKERLY 529

Query: 526  SILADLLTVEQDTYS--VCWPFIAVQ-LLKTDTNQKTLLQSMDEELGDILDSSMTVLSSI 582
            SIL +L++    +      WP+IA+Q +LK + +  TL   +DE+L  +  S++  L   
Sbjct: 530  SILGELISEPSKSSGDISTWPYIALQIILKIEGSGSTLSIDLDEDLESVRKSAIKSLKQN 589

Query: 583  SQKANEANXXXXXXXXXXXXVNILQAYAGEVESISVLEDLVSFCNEFEDGAKSAPLAGFI 642
                                V ILQ YAG+ ES+S+L+DL+SF  E +   +S  L G  
Sbjct: 590  HSDNKNNTNPKLNGLELLLSVAILQLYAGDEESVSILQDLISFYEECD--KESTDLVGIT 647

Query: 643  EIXXXXXXXXXXXXXXXXXXXWESFVADVTEKDLTVLLNVLPTRENKEGFSNLFXXXXXX 702
            EI                   WESFV D+ E +L VLL  L  RENK+GF++LF      
Sbjct: 648  EILLSLVAQRKSLLKKLSLIVWESFVHDIGEPELNVLLQTLTARENKQGFADLFEGDEEE 707

Query: 703  XXXXXXXXXXXXXXXXXKXXXXXXX--XXXXXXXXXXXXXXXXXMGKIDKEATSALAKAL 760
                                                        + KI+KEATSALAKAL
Sbjct: 708  DDEDAVERGTDDDDDEDDEDNDDDDEPSAEDSEDDVSEEDKDAALEKIEKEATSALAKAL 767

Query: 761  NLPDSIVDDKGEVRFXXXXXXXXXXXXXX--------XXXXXXXXXXXXGQLSEIFKRRK 812
            NLPDSIV + G+V+                                    QLSEIFKRRK
Sbjct: 768  NLPDSIVGEHGDVQLGNNEEEDSDEDSDEDDDFSGEDESMDDEAMMQLDDQLSEIFKRRK 827

Query: 813  EALSKIPTGNKRKQEVKESRENVIAFKHRVVDMLEILVRWIESKMKKDGH--IEKSVLDK 870
            EAL  +PTGNKRK EV+ESRENVI+FKHRVVDMLEI V+  +  + ++    I     + 
Sbjct: 828  EALGSVPTGNKRKVEVQESRENVISFKHRVVDMLEIYVKSFDRAVARNNTSIITVEEWNN 887

Query: 871  VFAIILPLLDCIRTTLDKPLAEKIAKLLKNKICKLKPSFSSTTEKVDKKAVLSLLRSVHE 930
            + +IILPLL C++ TLDK LA+K AKL+K ++CK+K + +   EK     +  LL  VH+
Sbjct: 888  LSSIILPLLKCLQHTLDKALADKCAKLMKLRLCKVKATIAK-EEKTVTSEIFHLLEKVHK 946

Query: 931  AMLVKKAGQFQTLYFSGCSTTSMFLARLVVDTFPELETYEELTGIYHKTLDGWFVTGKFG 990
             ++  K GQFQ L+FS CS  S+FL++L + +     ++E L  +Y  T   W   GK  
Sbjct: 947  LIMTAKPGQFQQLFFSTCSLASLFLSKLYLSSGG---SHENLIDLYADTSKAWMKDGKCT 1003

Query: 991  VSMFVEFLNWLSVKKT 1006
            V+ F++F NWL  K+ 
Sbjct: 1004 VNFFIDFSNWLQTKRA 1019

>KAFR0L00330 Chr12 complement(57677..60763) [3087 bp, 1028 aa] {ON}
            Anc_6.7 YEL055C
          Length = 1028

 Score =  645 bits (1664), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/1046 (39%), Positives = 581/1046 (55%), Gaps = 59/1046 (5%)

Query: 1    MGGIEINRDLFYKLASDLSEERLQATIDLVTQLS--KLEKDSSEWQYVLDRLIKGLSSSR 58
            M G ++NRDLFYKLAS+L EERLQA + ++ +LS  KL   + EW YVL RLIKGLSS R
Sbjct: 4    MSG-KVNRDLFYKLASELGEERLQAAVSIIQELSALKLPDHTEEWNYVLGRLIKGLSSDR 62

Query: 59   NGARLGFSLCLTEVVALALE---KGV----LARVDQYMHLL-----ISALSKENVK--NG 104
             GARLGFSLCLTEV+ LA++   KGV    L+ +DQY+ +L     I A +K+N K   G
Sbjct: 63   TGARLGFSLCLTEVINLAIDLAGKGVELDSLSNIDQYLTILSETLSIDAGNKQNNKKMKG 122

Query: 105  KEERGLLFGKLFGLQVLLNEPLFSKVFTPDENQLNVELMSSYMSYLIDIALAKTWIRESS 164
            K+ERGLLFGK+FGL+ LLNEPLFSK F P++ ++       +M  L+D+A  K WIRE  
Sbjct: 123  KDERGLLFGKMFGLKALLNEPLFSKTFLPNK-KVASNFCERFMVELLDLASRKNWIREPC 181

Query: 165  LFTLFQAVEKLAPLLGSRQPLKAVLELLDSKGLTQTSEGLAIYLFLLHRCSHTGPVLRKK 224
            LFTLFQ VEKL P     + +K VL LLD    T T+EGLAIYL LLH+    G     K
Sbjct: 182  LFTLFQTVEKLLP-FADFEFIKIVLGLLDDHKFTLTNEGLAIYLLLLHKGPEKGKEFNDK 240

Query: 225  GFLDELNLKN-PWKNNDPLKRGNLPAISNALKDS--GARDDPSLTQKGVWAPRLHFAWDI 281
              L  L LKN  WK NDPL RGNLP ++  L++S   + +         W PRLHF WDI
Sbjct: 241  IKL--LVLKNSSWKLNDPLARGNLPRLTQVLRESSLASEEKKVEVMSANWQPRLHFVWDI 298

Query: 282  VLQTLLHAE-NSEITTMQXXXXXXXXXXXXXXXXXXXXWKSVVDESFFNEKSSSERKYLG 340
            +L T+   E NS+   M                     W+  VDESFFNEK+SSERKYLG
Sbjct: 299  LLPTVSTIESNSDEKHMSKRRKKNKGPETNTYIRFPEFWQMTVDESFFNEKASSERKYLG 358

Query: 341  ILVFEKTFQL-SPPRYLPQLFSKNLIRCLINQCGSAERNLHKISQKALATIVEVCKAQPE 399
              +FE+   +   P +    FS+N +R LINQ   A R LHKIS + + TIV+ C+  P 
Sbjct: 359  FSIFERAISIVQNPLHSETCFSQNFMRSLINQSSDASRLLHKISTRVMNTIVKACEESPS 418

Query: 400  -KTAPSFVGLSFGEYGTINFDHLTKTKTVNSLLSNKSLRSDDLMILEESLISNL-FGNLK 457
             K  P    + F   G+ NFD LTK+KTV+ L+S   L    L+ L + L S +  G  +
Sbjct: 419  TKLIPVIHSILFATNGSTNFDKLTKSKTVSKLISITGLTLHTLLQLFDMLTSQIKVGTSE 478

Query: 458  ELSRARFILDAILHLVRAHK---------AHADEVWLKPVLKALVCLGFFQQSELKDVKD 508
            +  + +FILD++LH+VR+HK         +   E+ +K  +  LV L FF Q+++   K 
Sbjct: 479  DFKKTQFILDSLLHIVRSHKQDIFDSCTGSTETELIIKHAIAPLVRLAFFAQTDI--AKK 536

Query: 509  SQESFHSLSSIASERLFSILADLLTVEQDTYSVCWPFIAVQLL-KTDTNQKTLLQSMDEE 567
              ES + +  +A ERLFS+L++L T           +  ++++ + + N  +L+  MD++
Sbjct: 537  EDESDNQVDELAKERLFSVLSELTTTTNKQLHSWQYYTLLEIIDRENENPNSLINKMDDD 596

Query: 568  LGDILDSSMTVLSSISQKANEANXXXXXXXXXXXXVNILQAYAGEVESISVLEDLVSFCN 627
            L  + D+++ V+  I+ K  +              + +LQ Y+G+ +S++ +E+L++F N
Sbjct: 597  LKTVRDNAIKVIKGIASKNEKTTSSGERGLESLLSMCLLQLYSGDADSVATIEELITFYN 656

Query: 628  EFEDGAKSAPLAGFIEIXXXXXXXXXXXXXXXXXXXWESFVADVTEKDLTVLLNVLPTRE 687
               D  +   + G  EI                   WE FV+++ E  L +LL+VLP RE
Sbjct: 657  ASRDVEEKRTMVGITEILLSLLAQKKAVLKKLSLLVWEQFVSEIDEDVLNLLLDVLPARE 716

Query: 688  NKEGFSNLF-XXXXXXXXXXXXXXXXXXXXXXXKXXXXXXXXXXXXXXXXXXXXXXXXMG 746
            NK+GF+ LF                        +                        + 
Sbjct: 717  NKQGFAELFENADEYEEDDEEENEYKEENESDDESSSDDEDDEEGDEDDEGAEGGNEAIA 776

Query: 747  KIDKEATSALAKALNLPDSIVDDKGEVRFXXXXXXXXXXXXXXXXXXXXXXXXXXGQLSE 806
            KIDKEATSALAKALNLPD I+++ GEV F                           QL+E
Sbjct: 777  KIDKEATSALAKALNLPDDIINENGEVNF-DDLSDGSDISSDEESLDDEKMMELDDQLAE 835

Query: 807  IFKRRKEALSKIPTGNKRKQEVKESRENVIAFKHRVVDMLEILVRWIESKMKKDGHIEKS 866
            IFKRRKEALS + TGN+RK EVKESRE+VIAFKHRV D+L I ++          H E S
Sbjct: 836  IFKRRKEALSSVSTGNQRKIEVKESRESVIAFKHRVFDLLSIYIK----------HAEDS 885

Query: 867  VLDKVFAIIL--PLLDCIRTTLDKPLAEKIAKLLKNKICKLKPSFSSTTEKVDKKAVLSL 924
             L   +AI+   P++ C++ TLDK LA+KI+KLLK K+ KLK   +   E++  + V   
Sbjct: 886  ELPAKYAILFIEPMMKCVQQTLDKSLADKISKLLKTKVYKLK---TKNMEEITAEQVFDH 942

Query: 925  LRSVHEAMLVKKAGQFQTLYFSGCSTTSMFLAR-LVVDTFPELETYEELTGIYHKTLDGW 983
            + SVHE +L  K GQ+Q  ++S CS+TS+FL++ L++ +  + E Y ++  IY +T   W
Sbjct: 943  MTSVHETLLTSKPGQYQPTFYSLCSSTSIFLSKLLLLVSNDKEEAYGKIVDIYSETTKKW 1002

Query: 984  FVT-GKFGVSMFVEFLNWLSVKKTQQ 1008
             +   KFG ++F++F NWLS KK+ +
Sbjct: 1003 VLKDSKFGSNIFIDFYNWLSSKKSTK 1028

>Skud_5.34 Chr5 complement(47480..50539) [3060 bp, 1019 aa] {ON}
            YEL055C (REAL)
          Length = 1019

 Score =  634 bits (1635), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 412/1043 (39%), Positives = 576/1043 (55%), Gaps = 76/1043 (7%)

Query: 5    EINRDLFYKLASDLSEERLQATIDLVTQLSKLE--KDSSEWQYVLDRLIKGLSSSRNGAR 62
            ++NRDLF+KLASDL EERL A + L+  LS LE   D+ EW YVL+RLIKGL+S RN AR
Sbjct: 4    KVNRDLFFKLASDLQEERLHAAVALIKDLSALELPSDAEEWSYVLNRLIKGLASDRNSAR 63

Query: 63   LGFSLCLTEVVALALE-------KGVLARVDQYMHLLISAL-------SKENVKNGKEER 108
            LGFSLCLTEVV L +        KG+ ++ ++++  L S L       SK+ VK GK+ER
Sbjct: 64   LGFSLCLTEVVNLGINMPSGQRPKGLESK-NEFLDTLSSILDIYVNDGSKKPVK-GKDER 121

Query: 109  GLLFGKLFGLQVLLNEPLFSKVFTPDENQLNVELMSSYMSYLIDIALAKTWIRESSLFTL 168
            G+LFGKLFGL+ LLNEPLFS++F  D  + N E +  +M  LID+AL K WIRE  LF+L
Sbjct: 122  GILFGKLFGLKSLLNEPLFSEIFVDDIKKGNTEFVIRFMEQLIDLALRKNWIREPCLFSL 181

Query: 169  FQAVEKLAPLLGSRQPLKAVLELLDSKGLTQTSEGLAIYLFLLHRCSHTGPVLRKKGFLD 228
            FQ ++ L P +     +K +L + D   LT T+EGL+ YL L +    +           
Sbjct: 182  FQTIKMLLPFMNESTAVKILL-IYDKYDLTLTNEGLSTYLVLKYESDES-------LIPS 233

Query: 229  ELNLKNP-WKNNDPLKRGNLPAISNALKDS-------GARDDPSLTQKGVWAPRLHFAWD 280
             L+L+N  WKNNDPL RGNLP ++  L+DS       G   D    +   W PRLHF WD
Sbjct: 234  TLDLRNSGWKNNDPLARGNLPLLTKVLRDSSVLPDTNGKLQDAKKQKNANWNPRLHFVWD 293

Query: 281  IVLQTLLHA--ENSEITTMQXXXXXXXXXXXXXXXXXXXXWKSVVDESFFNEKSSSERKY 338
            ++L        EN+E  T +                    WK  VDESFFNEK+SSERKY
Sbjct: 294  VLLPLFGSGKLENTEHITKK--RKKTSGKKVQNSIQFPEFWKMAVDESFFNEKASSERKY 351

Query: 339  LGILVFEKTFQLSPPRYLPQLFSKNLIRCLINQCGSAERNLHKISQKALATIVEVCKAQP 398
            LG L+ + TF+  P   +   FS+N++R LINQ   ++R L+KI+Q  L +IV+ C+  P
Sbjct: 352  LGFLIIDATFKTVPGSCIGSCFSQNVMRTLINQSIDSQRILNKIAQITLESIVKACEEDP 411

Query: 399  -EKTAPSFVGLSFGEYGTINFDHLTKTKTVNSLLSNKSLRSDDLMILEESLISNLFGNLK 457
             +K  P    + FG +G+INFD LTK+  ++ L++ K L S  L  L  + +  L     
Sbjct: 412  IKKLVPCLNAMLFGPHGSINFDKLTKSNIISKLIAIKELPSAVLAQLISAFLLQLQEKRG 471

Query: 458  ELSRARFILDAILHLVRAHKAHADEVW-LKPVLKALVCLGFFQQSELKDVKDSQESFHSL 516
            +L    FILD++LH++RAHK   ++V  +KPVL  ++ + FF     K   D QE F  L
Sbjct: 472  DLPHTHFILDSLLHIIRAHKVEINDVGIIKPVLTPIIHMAFF-----KHATDEQE-FEQL 525

Query: 517  SSIASERLFSILADLLTVEQDTYSV-----CWPFIAVQL-LKTDTNQKT-LLQSMDEELG 569
              +A ERL+SIL + LT+ ++  S       W ++ + L L  + + K  L+  +DE L 
Sbjct: 526  HELAKERLYSILGE-LTINKEVNSEDPQINSWQYLTLNLILDIEKSYKADLINPLDESLE 584

Query: 570  DILDSSMTVLSSISQKANEANXXXXXXXXXXXXVNILQAYAGEVESISVLEDLVSFCNEF 629
             I + +++ L+ IS+    +N            + ++Q YAGE +SISV+E+L  F    
Sbjct: 585  KIKNEAISSLAEISK----SNTTQSWGLSTLLSMCLIQLYAGETDSISVIEELCEFTKH- 639

Query: 630  EDGAKSAPLAGFIEIXXXXXXXXXXXXXXXXXXXWESFVADVTEKDLTVLLNVLPTRENK 689
                 +  + G  EI                   W+ F+ DV  ++L +LL+VL  RENK
Sbjct: 640  ----DNNSMVGITEILLSFLAQKKALLRKLSLIIWQQFIEDVGLEELQILLDVLKARENK 695

Query: 690  EGFSNLFXXXXXXXXXXXXXXXXXXXXXXXKXXXXXXXXXXXXXXXXXXXXXXXXMGKID 749
            +GF+ LF                                                +  ID
Sbjct: 696  QGFAQLFEGEGEFEEINEEENANEGDSKSESESESESDSDESNEKDEEDEANEDVVN-ID 754

Query: 750  KEATSALAKALNLPDSIVDDKGEVRFXXX-XXXXXXXXXXXXXXXXXXXXXXXGQLSEIF 808
            KEAT AL KAL+LPD+IV+DKGEV                              QLSEIF
Sbjct: 755  KEATGALIKALHLPDNIVNDKGEVDMNQLGGLSDDDDDEDEESMDDEKMMELDDQLSEIF 814

Query: 809  KRRKEALSKIPTGNKRKQEVKESRENVIAFKHRVVDMLEILVRWIE-----SKMKKDGHI 863
            KRRKEALS I TGN+RK EVKESRENVI+FKHR+VDML + V++ E     +K++   ++
Sbjct: 815  KRRKEALSNISTGNQRKVEVKESRENVISFKHRIVDMLTVYVKYCEKLAIANKVENSSNL 874

Query: 864  EKSVLDKVFAIILPLLDCIRTTLDKPLAEKIAKLLKNKICKLKPSFSSTTEKVDKK-AVL 922
            E   L K+   I+P+L CIR TLDKPLA+KI+KLLK KI K+K   ++T + +DK   ++
Sbjct: 875  E-GPLSKLVYFIVPMLKCIRETLDKPLADKISKLLKGKIFKIK---ANTFKILDKNIELM 930

Query: 923  SLLRSVHEAMLVKKAGQFQTLYFSGCSTTSMFLARLVVDTFPELETYEELTGIYHKTLDG 982
            +LL+S HE ML  K GQ  +++FS CST+S+FL++L  +        +EL  +Y  T   
Sbjct: 931  NLLKSTHELMLTSKPGQHASVFFSACSTSSLFLSKLYFEIGGN-NALDELIDLYAATTKE 989

Query: 983  WFVTGKFGVSMFVEFLNWLSVKK 1005
            W + GKF  ++F++F NWLS KK
Sbjct: 990  WMLKGKFSTNVFIDFTNWLSSKK 1012

>Smik_5.32 Chr5 complement(50787..53849) [3063 bp, 1020 aa] {ON}
            YEL055C (REAL)
          Length = 1020

 Score =  626 bits (1614), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/1041 (38%), Positives = 567/1041 (54%), Gaps = 71/1041 (6%)

Query: 5    EINRDLFYKLASDLSEERLQATIDLVTQLSKLE--KDSSEWQYVLDRLIKGLSSSRNGAR 62
            ++NRDLF+KLASDL EERL A + L+  LS L    D+ EW YVL+RL+KGL+S RN AR
Sbjct: 4    KVNRDLFFKLASDLQEERLHAAVALIEDLSALNLPSDAEEWLYVLNRLVKGLASDRNSAR 63

Query: 63   LGFSLCLTEVVALALE-------KGVLARVDQYMHLLISAL-------SKENVKNGKEER 108
            LGFSLCLTEV+ LA+        KG L   + +++ L S L        K++VK GK+ER
Sbjct: 64   LGFSLCLTEVINLAINMPSGQRPKG-LESTNDFLNTLSSVLDVNVNDGGKKSVK-GKDER 121

Query: 109  GLLFGKLFGLQVLLNEPLFSKVFTPDENQLNVELMSSYMSYLIDIALAKTWIRESSLFTL 168
            G+LFGKLFGL+ LLNEPLFS++F  +    N +    +   LID+AL K WI+E   FTL
Sbjct: 122  GILFGKLFGLKSLLNEPLFSEIFIKNFENGNTDFFIRFTEELIDLALKKNWIKEPCFFTL 181

Query: 169  FQAVEKLAPLLGSRQPLKAVLELLDSKGLTQTSEGLAIYLFLLHRCSHTGPVLRKKGFLD 228
            FQ ++ L P +      K +L + D   +T T+EGL+ YL L +          K     
Sbjct: 182  FQTIKMLLPFIDESIAAKILL-IYDKYNMTLTNEGLSTYLLLKYGGD-------KNLIPS 233

Query: 229  ELNLKN-PWKNNDPLKRGNLPAISNALKDS-------GARDDPSLTQKGVWAPRLHFAWD 280
             L+LKN  WK++DPL RGNLP ++  L+DS       G   D    +   W PRLHF WD
Sbjct: 234  TLDLKNLGWKSDDPLARGNLPLLTKVLRDSSVIPDTDGKSRDTKKQKNTNWNPRLHFVWD 293

Query: 281  IVLQTLLHAENSEITTMQXXXXXXXXXXXXXXXXXXXXWKSVVDESFFNEKSSSERKYLG 340
            I+L      +      +                     WK  +DESFFNEK+SSERKYLG
Sbjct: 294  ILLPLFGSGKLENTEHVSKKRKKTSTKKVQNSIQFPEFWKMAIDESFFNEKASSERKYLG 353

Query: 341  ILVFEKTFQLSPPRYLPQLFSKNLIRCLINQCGSAERNLHKISQKALATIVEVCKAQ-PE 399
             L+ +  F+  P  Y+   FS+N++R LINQ   ++R L+KI+Q  L +IV+ C+     
Sbjct: 354  FLIIDAAFKTVPGSYIGSCFSQNVMRTLINQSIDSQRVLNKIAQITLGSIVKACEEDLTN 413

Query: 400  KTAPSFVGLSFGEYGTINFDHLTKTKTVNSLLSNKSLRSDDLMILEESLISNLFGNLKEL 459
            K  P    + FG +G++NFD LTK+ TV+ L++ K L S  L  L    +  L  + ++L
Sbjct: 414  KLVPCLNSMLFGPHGSVNFDKLTKSSTVSKLIAIKELPSTVLTQLLNVFLPQLQQSKRDL 473

Query: 460  SRARFILDAILHLVRAHKAHADEV-WLKPVLKALVCLGFFQQSELKDVKDSQESFHSLSS 518
            +   FILD+ILH++RAHK   D++  +KP+L  ++ + FF     KD  D QE    L  
Sbjct: 474  THTHFILDSILHIIRAHKVEIDDMDVMKPILTPIIYMAFF-----KDATDDQE-LEQLHE 527

Query: 519  IASERLFSILADLLTVEQDTYSV-----CWPFIAVQLL--KTDTNQKTLLQSMDEELGDI 571
            +A ERLFSIL + LT+ ++ +S       W F+ ++L+     +++  L+  +DE L   
Sbjct: 528  LAKERLFSILGE-LTMNKEIHSEDPEINSWQFLTLKLILDMEKSHRGILINPLDENLEKT 586

Query: 572  LDSSMTVLSSISQKANEANXXXXXXXXXXXXVNILQAYAGEVESISVLEDLVSFCNEFED 631
             + +++ L+ IS+    ++            + ++Q YAGE +SISV+E+L  F  +   
Sbjct: 587  KEEAISSLAEISR----SSTAQAWGLSTLLSMCLIQLYAGETDSISVIEELCEFSKD--- 639

Query: 632  GAKSAPLAGFIEIXXXXXXXXXXXXXXXXXXXWESFVADVTEKDLTVLLNVLPTRENKEG 691
              K+  + G  EI                   W+ F+ DV  ++L VLL+VL  RENK+G
Sbjct: 640  --KNNSMVGITEILLSLLAQKKALLKKLSLIIWQQFIEDVGLEELQVLLDVLKARENKQG 697

Query: 692  FSNLFXXXXXXXXXXXXXXXXXXXXXXXKXXXXXXXXXXXXXXXXXXXXXXXXMGKIDKE 751
            F+ LF                                                +  IDKE
Sbjct: 698  FAQLFEGEGEFEEIKEEESASEDESKSEGDSESESNSDDADEKDEEDDANEEVVN-IDKE 756

Query: 752  ATSALAKALNLPDSIVDDKGEVRFXXXX--XXXXXXXXXXXXXXXXXXXXXXGQLSEIFK 809
            ATSAL KALNLPD+IV+DKGEV                              GQLSEIFK
Sbjct: 757  ATSALVKALNLPDNIVNDKGEVDIDQLEGLSDDDEDDEDEESMDDEKMMELDGQLSEIFK 816

Query: 810  RRKEALSKIPTGNKRKQEVKESRENVIAFKHRVVDMLEILVRWIE----SKMKKDGHIEK 865
            RRKEALS I TGN+RK EVKESRENVI+FKHR+VDML + V++ E    +   +D     
Sbjct: 817  RRKEALSNISTGNQRKVEVKESRENVISFKHRIVDMLTVYVKYCEKLALANKSEDSSSIG 876

Query: 866  SVLDKVFAIILPLLDCIRTTLDKPLAEKIAKLLKNKICKLKPSFSSTTEKVDKK-AVLSL 924
            S L K+   I+P+L CI  TLD+PLA+KI+KLLK KI K+K    +  +++DK   V+ L
Sbjct: 877  SPLSKLVYFIIPILKCINETLDRPLADKISKLLKGKIFKIK---VNAFKEMDKNIEVMDL 933

Query: 925  LRSVHEAMLVKKAGQFQTLYFSGCSTTSMFLARLVVDTFPELETYEELTGIYHKTLDGWF 984
            L+S H+ +L  K GQ   +++S CST+S+FL++L V+     +  +EL  +Y  T   W 
Sbjct: 934  LKSTHKVLLTSKPGQHPAVFYSACSTSSLFLSKLYVEIHGN-DKLDELIDLYAATTKEWT 992

Query: 985  VTGKFGVSMFVEFLNWLSVKK 1005
              GKFG ++F++F+NWLS KK
Sbjct: 993  NRGKFGANVFIDFINWLSSKK 1013

>Suva_5.13 Chr5 complement(24593..27664) [3072 bp, 1023 aa] {ON}
            YEL055C (REAL)
          Length = 1023

 Score =  623 bits (1606), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/1045 (38%), Positives = 569/1045 (54%), Gaps = 75/1045 (7%)

Query: 5    EINRDLFYKLASDLSEERLQATIDLVTQLSKLE--KDSSEWQYVLDRLIKGLSSSRNGAR 62
            ++NRDLF+KLASDL EERL A + L+  LS LE   DS EW YVL+RLIKGL+S RN AR
Sbjct: 4    KVNRDLFFKLASDLQEERLHAAVALIKDLSALELPSDSEEWSYVLNRLIKGLASDRNSAR 63

Query: 63   LGFSLCLTEVVALALE-------KGVLARVDQYMHLL-------ISALSKENVKNGKEER 108
            LGFSLCLTEV+ LA+        KG L  ++ ++  L       ++   K+ VK GK+ER
Sbjct: 64   LGFSLCLTEVINLAMNMPSGQRPKG-LESMNDFLDTLSFILDINVNETGKKPVK-GKDER 121

Query: 109  GLLFGKLFGLQVLLNEPLFSKVFTPDENQLNVELMSSYMSYLIDIALAKTWIRESSLFTL 168
            G+LFGKLFGL+ LLNEPLFS +F  D  + N E +  +M  LID+AL K WI+E  L++L
Sbjct: 122  GILFGKLFGLKSLLNEPLFSGIFVEDLKRGNTEFIIRFMEQLIDLALRKNWIKEPCLYSL 181

Query: 169  FQAVEKLAPLLGSRQPLKAVLELLDSKGLTQTSEGLAIYLFLLHRCSHTGPVLRKKGFLD 228
            FQ ++ L P +      + +L   D   LT T+EGL+ YL L +          K     
Sbjct: 182  FQTIKMLLPTMNESTAAEILLT-YDKYDLTLTNEGLSTYLLLKYESD-------KDLVPS 233

Query: 229  ELNLKN-PWKNNDPLKRGNLPAISNALKDSG--------ARDDPSLTQKGVWAPRLHFAW 279
             L LKN  WKNNDPL RGNLP ++  L+DS         A+D+    +   W PRLHF W
Sbjct: 234  TLGLKNLGWKNNDPLARGNLPLLTKVLRDSAVAPDTNGKAQDNTKKQKNTNWNPRLHFVW 293

Query: 280  DIVLQTLLHAENSEITTMQXXXXXXXXXXXXXXXXXXXXWKSVVDESFFNEKSSSERKYL 339
            +I+L      +      +                     W+  VDESFFNEK+SSERKYL
Sbjct: 294  NILLPLFGSGKLENAEHISKKRKKTSNKKVPSSIQFPEFWQMAVDESFFNEKASSERKYL 353

Query: 340  GILVFEKTFQLSPPRYLPQLFSKNLIRCLINQCGSAERNLHKISQKALATIVEVCKAQP- 398
            G L+ + TF+  P   +   FS+N++R LINQ   ++R L+KI+Q  L +I++ C+  P 
Sbjct: 354  GFLIIDATFKTVPGSCIGYCFSRNVMRTLINQSIDSQRILNKIAQITLDSIIKACEEDPV 413

Query: 399  EKTAPSFVGLSFGEYGTINFDHLTKTKTVNSLLSNKSLRSDDLMILEESLISNLFGNLKE 458
             K  P    + FG +G+INFD LTKT   + L++ K L +  L  L    +  L     +
Sbjct: 414  NKLVPCLSAMLFGPHGSINFDKLTKTSITSKLIAIKELPATVLNQLFNLFVLQLQEKKDD 473

Query: 459  LSRARFILDAILHLVRAHKAHADEV-WLKPVLKALVCLGFFQQSELKDVKDSQESFHSLS 517
            L    F+LD++LH++RAHKA  ++V  +KPVL  +V + FF+ +   D K+S++    L 
Sbjct: 474  LPHTHFVLDSLLHIIRAHKAEINDVEIIKPVLSPIVYMAFFKHA--TDDKESEQ----LH 527

Query: 518  SIASERLFSILADLLTVEQDTYSV-----CWPFIAVQLL--KTDTNQKTLLQSMDEELGD 570
             +A ERL+SIL + LT+ ++  S       W F+ ++L+     +++  L   +DE L  
Sbjct: 528  ELAKERLYSILGE-LTINKEMRSEDPQINSWQFLTLRLILDMEKSHKGDLTNPLDEGLEK 586

Query: 571  ILDSSMTVLSSISQKANEANXXXXXXXXXXXXVNILQAYAGEVESISVLEDLVSFCNEFE 630
              + +++ L+ IS+    +N            + ++Q YAGE +SISV+E+L  F  +  
Sbjct: 587  TKNEAISSLTEISK----SNTSQSWGLSTLLSMCLIQLYAGETDSISVIEELCEFAKD-- 640

Query: 631  DGAKSAPLAGFIEIXXXXXXXXXXXXXXXXXXXWESFVADVTEKDLTVLLNVLPTRENKE 690
               +++ + G  EI                   W+ F+ DV  K+L +LL+VL TRENK+
Sbjct: 641  ---ENSSMVGITEILLSLLAQKKALLKKLSLIIWQQFIGDVGLKELQILLDVLKTRENKQ 697

Query: 691  GFSNLFXXXXXXXXXXXXXXXXXXXXXXXKXXXXXXXXXXXXXXXXXXXXXXXXMGKIDK 750
            GF+ L                        +                        +  IDK
Sbjct: 698  GFA-LLFEGEGEFEEVDEEESAVEDESKSESESDSDSESNDDEERDEEDEANEDVVNIDK 756

Query: 751  EATSALAKALNLPDSIVDDKGEVRFXX-----XXXXXXXXXXXXXXXXXXXXXXXXGQLS 805
            EATSAL KALNLPD+IV+DKGEV                                  QLS
Sbjct: 757  EATSALIKALNLPDNIVNDKGEVDMDQLEGISDDGDGGDDDEDEESMDDEKMMELDDQLS 816

Query: 806  EIFKRRKEALSKIPTGNKRKQEVKESRENVIAFKHRVVDMLEILVRWIES-KMKKDGHIE 864
            EIFKRRKEALS I TGN+RK EVKESRENVIAFKHR+VDML I V+  E   +   G + 
Sbjct: 817  EIFKRRKEALSSISTGNQRKVEVKESRENVIAFKHRIVDMLTIYVKHCEKLAIANKGELS 876

Query: 865  KSV---LDKVFAIILPLLDCIRTTLDKPLAEKIAKLLKNKICKLKPSFSSTTEKVDKK-A 920
              +   L  +   I+P++ CI+ TLD+PLA+KI+KLLK KI K++   +S  + +DK   
Sbjct: 877  IEIGGPLSNLVYFIIPMIKCIKETLDRPLADKISKLLKGKIFKIR---TSAFKDLDKTIE 933

Query: 921  VLSLLRSVHEAMLVKKAGQFQTLYFSGCSTTSMFLARLVVDTFPELETYEELTGIYHKTL 980
            +L LL+S H+ ML  K GQ   ++FS CST+S+FL++L VD     + +++L  +Y  T 
Sbjct: 934  LLDLLKSAHKEMLTSKPGQHANVFFSACSTSSLFLSKLYVDINGN-DKFDDLIDLYASTT 992

Query: 981  DGWFVTGKFGVSMFVEFLNWLSVKK 1005
              W   GKFG ++F++F+NWLS KK
Sbjct: 993  KQWTQKGKFGANIFIDFINWLSSKK 1017

>SAKL0E00770g Chr5 (53894..57037) [3144 bp, 1047 aa] {ON} similar to
           uniprot|P39985 Saccharomyces cerevisiae YEL055C
          Length = 1047

 Score =  623 bits (1607), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/701 (46%), Positives = 448/701 (63%), Gaps = 9/701 (1%)

Query: 5   EINRDLFYKLASDLSEERLQATIDLVTQLSKLEKDSSEWQYVLDRLIKGLSSSRNGARLG 64
           +INRDLFYKLASDL EER+QA I L+ +L+ LE + SEW+YVL+RLIKGLSS+RN ARLG
Sbjct: 4   KINRDLFYKLASDLQEERVQAAISLIKELASLENNDSEWEYVLNRLIKGLSSNRNSARLG 63

Query: 65  FSLCLTEVVALALEKGVLARVDQYMHLLISALSKENVKNGKEERGLLFGKLFGLQVLLNE 124
           FSLCLTEV+++ALEKG L  +++Y+ LL S L KE VKNGKEERGLLFG++FGLQ LLNE
Sbjct: 64  FSLCLTEVLSVALEKGYLNSIEEYIQLLQSTLLKETVKNGKEERGLLFGRMFGLQALLNE 123

Query: 125 PLFSKVFTPDENQLNVELMSSYMSYLIDIALAKTWIRESSLFTLFQAVEKLAPLLGSRQP 184
           PL SK+F      LN   M ++M  L+ +AL+KTWIRE  LFTLFQ VEKL+P L     
Sbjct: 124 PLLSKIFLDKTGGLNAHFMVNFMGELVQVALSKTWIREPCLFTLFQVVEKLSPFLNDTVC 183

Query: 185 LKAVLELLDSKGLTQTSEGLAIYLFLLHRCSHTGPVLRKKGFLDELNLKNPWKNNDPLKR 244
           ++++ +LLD   L+ T+EGLAIYLFL+H C  T   ++K G L  L L + WKNNDPL +
Sbjct: 184 IESIFKLLDDNKLSLTNEGLAIYLFLIHLCPGTSKFIKKSGLLKNLELNSQWKNNDPLTK 243

Query: 245 GNLPAISNALKDSGARDDPSLTQKGVWAPRLHFAWDIVLQTLLHAENSEITTMQXXXXXX 304
           GNLP +S  LKD    +D  L QKG WAPRLHF W+I+L  L   + +E ++ +      
Sbjct: 244 GNLPTLSAVLKDVSPVEDSGLKQKGSWAPRLHFVWNIILPILARDDQNEGSSDEHITKKR 303

Query: 305 XXXXXXXXXXXXXX----WKSVVDESFFNEKSSSERKYLGILVFEKTFQLSPPRYLPQLF 360
                             WK+VVDESFFNEKSS ERKYLG L+ E  F+  P   +  LF
Sbjct: 304 KKEKAKDVQVKMIEFPEFWKAVVDESFFNEKSSGERKYLGFLILEAAFKQVPLSLVSLLF 363

Query: 361 SKNLIRCLINQCGSAERNLHKISQKALATIVEVCKAQPEKTAPSFVGLSFGEYGTINFDH 420
           SKNL+R LINQ   ++R LHKISQK LA+I+E+C++ P+KT PS   + F E GTINFD 
Sbjct: 364 SKNLMRTLINQSSDSKRILHKISQKVLASILELCESHPDKTVPSIQAMLFSENGTINFDK 423

Query: 421 LTKTKTVNSLLSNKSLRSDDLMILEESLISNLFGNL-KELSRARFILDAILHLVRAHKAH 479
           LTKTKTV+ L++N S+    L  L +  +S+L  +  +E +  RF+LD++LH+VR HK  
Sbjct: 424 LTKTKTVDLLVANPSMTPKHLSSLVDLFVSHLPDDPNEEAALTRFLLDSMLHVVRTHKTV 483

Query: 480 ADEVWLKPVLKALVCLGFFQQSELKDVKDSQESFHS--LSSIASERLFSILADLLTV-EQ 536
           +D+ W+KP++ +++ +GFF+ S  K  +++Q+  H+      A ERL+SILADL+ + +Q
Sbjct: 484 SDKTWVKPLITSVISMGFFKTSPAKVDQENQDDDHTDGFEFQARERLYSILADLIPLSKQ 543

Query: 537 DTYSVCWPFIAVQLLKTDTNQKTLLQSMDEELGDILDSSMTVLSSISQK-ANEANXXXXX 595
             +S  WP+I +Q+L +    K L+  +D+ L  I   ++  L  I ++  N+ +     
Sbjct: 544 SIHSASWPYITLQVLLSQEQSKELIHPLDDGLNKIKLDALNDLEGIRRELENDPSASQFY 603

Query: 596 XXXXXXXVNILQAYAGEVESISVLEDLVSFCNEFEDGAKSAPLAGFIEIXXXXXXXXXXX 655
                  + +LQ Y G+ ES+SVLEDLV+F +   D ++   L G IEI           
Sbjct: 604 GLELLLSMTVLQIYGGDTESLSVLEDLVTFYHSMRDSSEENSLIGVIEILLALLAQKKAL 663

Query: 656 XXXXXXXXWESFVADVTEKDLTVLLNVLPTRENKEGFSNLF 696
                   WE FV  V   +L VL ++L  RENKEGF+ LF
Sbjct: 664 LRRLSLLVWELFVDKVGTPELEVLFDILSARENKEGFTALF 704

 Score =  231 bits (589), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 128/268 (47%), Positives = 168/268 (62%), Gaps = 11/268 (4%)

Query: 745  MGKIDKEATSALAKALNLPDSIVDDKGEVRFXX----XXXXXXXXXXXXXXXXXXXXXXX 800
            + KIDKE TSALAKALNLPD I+++ GEV F                             
Sbjct: 779  INKIDKETTSALAKALNLPDGIINENGEVNFNELSESDDEDESEEDEDEESMDDEKMMEL 838

Query: 801  XGQLSEIFKRRKEALSKIPTGNKRKQEVKESRENVIAFKHRVVDMLEILVRWIE--SKMK 858
              QLS+IF+RRKEALSKI TGNKRK E KESRENVIAFKH+VVDMLE+ V+++E  SK K
Sbjct: 839  DDQLSQIFQRRKEALSKISTGNKRKLEAKESRENVIAFKHKVVDMLEVFVKFVERTSKNK 898

Query: 859  KDGHIEKSVLDKVFAIILPLLDCIRTTLDKPLAEKIAKLLKNKICKLK-PSFSSTTEKVD 917
            + G  E   L  V ++  PL+ C++ T DK LA+K++KL+KN++CKLK P   + ++ ++
Sbjct: 899  ECGETE---LKSVTSMFQPLIKCVQQTTDKALADKLSKLIKNRMCKLKLPKLINDSDDIE 955

Query: 918  KKAVLSLLRSVHEAMLVKKAGQFQTLYFSGCSTTSMFLARLVVDTFPELETYEELTGIYH 977
            +  + S L +VH  ML  K GQF  LYFS CS  S+FL++L+V        Y+ L  IY 
Sbjct: 956  ELTI-SNLGAVHRLMLADKCGQFPNLYFSTCSVVSLFLSKLLVQASTNDSIYDRLIDIYL 1014

Query: 978  KTLDGWFVTGKFGVSMFVEFLNWLSVKK 1005
             T+  WF  GKFG S F +F+NWL+ KK
Sbjct: 1015 STMKKWFSKGKFGTSFFFDFINWLASKK 1042

>NCAS0F00180 Chr6 (25742..28798) [3057 bp, 1018 aa] {ON} Anc_6.7
            YEL055C
          Length = 1018

 Score =  603 bits (1555), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/1044 (37%), Positives = 559/1044 (53%), Gaps = 72/1044 (6%)

Query: 5    EINRDLFYKLASDLSEERLQATIDLVTQLSKL--EKDSSEWQYVLDRLIKGLSSSRNGAR 62
            ++NRDLFYKLASDL EER QA I LV +L+ L    ++ EW YV++RLIKGL+S R+ AR
Sbjct: 4    KVNRDLFYKLASDLQEERFQAAISLVKELTNLLLPDETEEWTYVVNRLIKGLASDRSSAR 63

Query: 63   LGFSLCLTEVVALALE------KGVLARVDQYMHLLISALSKENVKN---------GKEE 107
            LGFSLCLTEV+ LAL       +G L  +D ++ LL   LS +   N         G++E
Sbjct: 64   LGFSLCLTEVINLALSMKENAPEG-LQTIDDFLQLLSKTLSLDTNANEKGALKKKKGRDE 122

Query: 108  RGLLFGKLFGLQVLLNEPLFSKVF-TPDENQLNVELMS-SYMSYLIDIALAKTWIRESSL 165
            RGLLFGK+FGLQ + NEP+FS VF T  + +  +   +  +M+ ++D+AL K WI+ES L
Sbjct: 123  RGLLFGKMFGLQAVTNEPVFSSVFLTKKDGKTEITPFAFKFMNEVVDLALKKNWIKESCL 182

Query: 166  FTLFQAVEKLAPLLGSRQPLKAVLELLDSKGLTQTSEGLAIYLFLLHRCSHTGPVLRKKG 225
            FTLFQ ++KL P   ++    ++L LLDS  L+ TSEGLA+YL +L+     G     K 
Sbjct: 183  FTLFQTIQKLLPY-ANKDTYLSILSLLDSHNLSLTSEGLAVYLTILY-----GDTNDNKL 236

Query: 226  FLDELNLKNP-WKNNDPLKRGNLPAISNALKDSG------ARDDPSLTQKGVWAPRLHFA 278
                +  KNP WKNNDPL RGNLP ++  L+DS         ++        W PRLHF 
Sbjct: 237  DTSSIEFKNPGWKNNDPLSRGNLPLLTEVLRDSSVTQPSEGYENSKKQNASNWNPRLHFV 296

Query: 279  WDIVLQTLLHAENSEITTMQXXXXXXXXXXXXXXXXXX--XXWKSVVDESFFNEKSSSER 336
            WDI+L  L+  +++  +  Q                      W+ VVDESFFNEK+SSER
Sbjct: 297  WDILLPILISGKHTTASNTQHISKKRKKNNNELPKHIEFPEFWQMVVDESFFNEKASSER 356

Query: 337  KYLGILVFEKTFQLSPPRYLPQLFSKNLIRCLINQCGSAERNLHKISQKALATIVEVCKA 396
            KYLG L+F KT ++     L   FS N +R LINQ   ++R LHK+SQ AL TI+EVC+ 
Sbjct: 357  KYLGFLIFIKTIKVVSQTQLNNCFSHNFMRSLINQSTDSKRLLHKMSQNALNTIIEVCQE 416

Query: 397  Q-PEKTAPSFVGLSFGEYGTINFDHLTKTKTVNSLLSNKSLRSDDLMILEESLISNLFGN 455
                K       + FG  G+INFD LTK+KT++ L+S   L    L  L +   SN+   
Sbjct: 417  DSSNKLVKCVNAMVFGPSGSINFDKLTKSKTISKLISIHPLDVKTLADLFDLFTSNISEK 476

Query: 456  LKELSRARFILDAILHLVRAHKAHAD-EVWLKPVLKALVCLGFFQQSELKDVKDSQESFH 514
             +   + R++LD +LH+VR HK   + +  + P+L  L+   FF +              
Sbjct: 477  SENKQKNRYVLDTLLHIVRTHKTGLEYDAIVTPLLDPLIQWAFFAKEN-----------E 525

Query: 515  SLSSIASERLFSILADLLTVEQDTYSVCWPFIAVQLL--KTDTNQKTLLQSMDEELGDIL 572
             L+ +A ER  SILA+L +V        W + A+ ++  K  T +  L+  +DE LG I 
Sbjct: 526  PLNELAKERFSSILAELTSVIPKEPHHSWQYYALDIILKKERTGKFELVNKLDENLGKIK 585

Query: 573  DSSMTVLSSI--SQKANEANXXXXXXXXXXXXVNILQAYAGEVESISVLEDLVSFCNEFE 630
            + +  V+  I  S ++ + N            + +LQ ++GE ES+S +E+L+ F  E +
Sbjct: 586  NDACDVIVKIIKSPQSPQLN-----GLESLLSMCLLQLFSGETESLSTIEELIEFYKEHK 640

Query: 631  DGAKSAPLAGFIEIXXXXXXXXXXXXXXXXXXXWESFVADVTEKDLTVLLNVLPTRENKE 690
               +S  L G  EI                   WE F+ +V +++L +LL+VL  RENK+
Sbjct: 641  GDTESTSLVGITEILLSLLAQKKAVLRKLSLMVWEQFITNVGKEELNILLDVLKARENKQ 700

Query: 691  GFSNLFXXXXXXXXXXXXXXXXXXXXXXXKXX-XXXXXXXXXXXXXXXXXXXXXXMGKID 749
            GF++LF                                                 +  ID
Sbjct: 701  GFAHLFEGADEYEEIEDEQEGESNQSEEKDVSGEESEESEESEIDDEDDSLDTAEVNNID 760

Query: 750  KEATSALAKALNLPDSIVDDKGEV------RFXXXXXXXXXXXXXXXXXXXXXXXXXXGQ 803
            KEATSALAKALNLP++IV+DKGEV                                   Q
Sbjct: 761  KEATSALAKALNLPENIVNDKGEVDVAKLEALSDSDMDDDDDDSDEESMDDEKMMLLDDQ 820

Query: 804  LSEIFKRRKEALSKIPTGNKRKQEVKESRENVIAFKHRVVDMLEILVRWIESKMKKDGHI 863
            LSEIFKRRKEALS   TGN+RK E KESRENVIAFK RVVD+L + V+++E K++   H 
Sbjct: 821  LSEIFKRRKEALSTTSTGNQRKIEAKESRENVIAFKSRVVDLLTVYVKYVE-KLQTADHS 879

Query: 864  EKSVLDKVFAIILPLLDCIRTTLDKPLAEKIAKLLKNKICKLKPS-FSSTTEKVDKKAVL 922
            +K V   + + + P++ C++ TLDK LA+K++KLLK +I K+K S F ++   V+   VL
Sbjct: 880  QKFV--NLISFVEPMVTCVQKTLDKSLADKVSKLLKTRIFKIKSSTFKNSANPVE---VL 934

Query: 923  SLLRSVHEAMLVKKAGQFQTLYFSGCSTTSMFLARL-VVDTFPELETYEELTGIYHKTLD 981
              L+ +HE +L +K GQ   LY++  S+ S+F +++ V  +  E   Y +L   Y  T  
Sbjct: 935  EYLKKLHEKLLTEKPGQHPQLYYTLSSSASLFFSKIYVASSTDETNAYNKLIDQYSNTTK 994

Query: 982  GWFVTGKFGVSMFVEFLNWLSVKK 1005
             W    KFG + F +F NWL+ +K
Sbjct: 995  SWMSKSKFGPNFFADFFNWLASRK 1018

>KNAG0E00970 Chr5 (183126..186140) [3015 bp, 1004 aa] {ON} Anc_6.7
            YEL055C
          Length = 1004

 Score =  597 bits (1538), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/1032 (37%), Positives = 564/1032 (54%), Gaps = 59/1032 (5%)

Query: 5    EINRDLFYKLASDLSEERLQATIDLVTQLSKLEKDSS--EWQYVLDRLIKGLSSSRNGAR 62
            ++NRD FYKLASDL EERLQA + L+ +LS L   +S  EW YV++RLIKGLSS RNGAR
Sbjct: 4    KVNRDHFYKLASDLPEERLQAAVSLIKELSSLPLPASKDEWSYVVNRLIKGLSSDRNGAR 63

Query: 63   LGFSLCLTEVVALALEKG------VLARVDQYMHLLISALSKE-----NVKNGKEERGLL 111
            LGFSLCLTEVV LA++         L  +D ++HLL    S +       + GKEERGL+
Sbjct: 64   LGFSLCLTEVVDLAIKMDDDKAPEELKSMDSFLHLLSKTFSIDPQDEKKKRKGKEERGLM 123

Query: 112  FGKLFGLQVLLNEPLFSKVFTPDENQLNVELMSSYMSYLIDIALAKTWIRESSLFTLFQA 171
            FGKLF LQ LLNEPLFS +F  D      +  + ++  L+++A  K WI++  LFTL+Q 
Sbjct: 124  FGKLFALQALLNEPLFSDIFIKDGKI--TKFTTKFIDELVNLASRKNWIKQPCLFTLYQT 181

Query: 172  VEKLAPLLGSRQPLKAVLELLDSKGLTQTSEGLAIYLFLLHRCSHTGPVLRKKGFLDELN 231
            +E+L P       +K V+ +LD    T T+EGLAIYL  + +   +         L  +N
Sbjct: 182  IERLLPY-SDDSFVKTVVTVLDVNKYTLTNEGLAIYLLFISKGYSSA--------LLSIN 232

Query: 232  LKNP-WKNNDPLKRGNLPAISNALKDSGA--RDDPSLTQKGVWAPRLHFAWDIVLQTLLH 288
            + N  WK N+PL +GNL  +S  +++S     D+ + T    W P+LHF WDI+L  L +
Sbjct: 233  VTNKGWKYNNPLLKGNLSLVSEVVRESAVVVDDNETKTNNANWHPKLHFVWDILLPILYN 292

Query: 289  AENSEITTMQXXXXXXXXXXXXXXXXXXXX---WKSVVDESFFNEKSSSERKYLGILVFE 345
                E    +                       WK++VDE++F++K+SSERK+LG+L+F 
Sbjct: 293  DPREEPLKKKKKHNNGSSKSKSEAVGAIEFPEFWKAIVDETYFSDKASSERKFLGLLIFL 352

Query: 346  KTFQLSPPRYLPQLFSKNLIRCLINQCGSAERNLHKISQKALATIVEVCKAQP-EKTAPS 404
            K     P +++   FS+NL+RCLINQC  +ER+LHKI++K L +IV+ C+A P  K  P 
Sbjct: 353  KALPTVPSKWIACCFSQNLMRCLINQCSDSERHLHKIAEKCLISIVKTCEADPGHKLVPV 412

Query: 405  FVGLSFGEYGTINFDHLTKTKTVNSLLSNKSLRSDDLMILEESLISNLFGNLKELSRARF 464
               L FG  G+INFD LTK+KTV  L++ K L  D +  L  +L ++   + K  +   F
Sbjct: 413  VGALLFGTNGSINFDRLTKSKTVAKLIATKGLEDDSIGKL-FALFTSELNSQKNEAVLHF 471

Query: 465  ILDAILHLVRAHKAHAD----EVWLKPV-LKALVCLGFFQQSELKDVKDSQESFHSLSSI 519
            ILD +LH++R+HK +        WL  V L  LV LGFF  +E      S E   ++S I
Sbjct: 472  ILDTLLHILRSHKLNLKGEHISTWLMSVLLLPLVKLGFFHATET-----SPEDKINVSEI 526

Query: 520  ASERLFSILADLLTVEQ-DTYSVCWPFIAVQLLKTDTNQKTLLQSMDEELGDILDSSMTV 578
            A ER++SIL++L +V   D +S  W F  +  L T  N+ TL  ++DE+L  + D+ ++V
Sbjct: 527  ARERIYSILSELSSVPTGDAHS--WQFHILNELTTVENELTLTNALDEDLTTVKDTGLSV 584

Query: 579  LSSISQKANEANXXXXXXXXXXXXVNILQAYAGEVESISVLEDLVSFCNEFEDGAKSAPL 638
            + S+S K    N            + +LQ Y+GE +S++ ++++  +  E +    S  L
Sbjct: 585  IHSLSVK----NDKSSRGIESLLAMCLLQLYSGEADSVATIKEICDYLTEEKSSKNSISL 640

Query: 639  AGFIEIXXXXXXXXXXXXXXXXXXXWESFVADVTEKDLTVLLNVLPTRENKEGFSNLFXX 698
             G  EI                   WE  + DV   +L ++L+VL  RENKEGFS LF  
Sbjct: 641  VGITEILLGLLAQKKTVLTKTSLLVWEQLIEDVGSDELNLILDVLSARENKEGFSYLF-- 698

Query: 699  XXXXXXXXXXXXXXXXXXXXXKXXXXXXXXXXXXXXXXXXXXXXXXMGKIDKEATSALAK 758
                                 +                        +  ID++   ALAK
Sbjct: 699  -EGAEEYEKVSGDENEVAPEEESASSDTSDSSSDSDDESEEADNKDVTNIDRQTACALAK 757

Query: 759  ALNLPDSIVDDKGEVRFXXXXXXXXXXXXXXXXXXXXXXXXXXGQLSEIFKRRKEALSKI 818
            AL LP+++V++ GEV+F                          GQL++IFKRRK+ALS +
Sbjct: 758  ALKLPENVVNEDGEVKF-NEIDDLEDESSDDESMDDEAMMALDGQLADIFKRRKDALSHV 816

Query: 819  PTGNKRKQEVKESRENVIAFKHRVVDMLEILVRWIESKMKKDGHIEKSVLDKVFAIILPL 878
            PTGN RK EV++SRE+VI FK R++DML I V+++E    +D  + K  L  V   + P+
Sbjct: 817  PTGNMRKIEVRDSRESVINFKQRMIDMLTIYVKYVEKLDLEDKDVMKEKLQTVSTFVEPM 876

Query: 879  LDCIRTTLDKPLAEKIAKLLKNKICKLKPSFSSTTEKVDKKAVLSLLRSVHEA-MLVKKA 937
            L C++ TLD+PLA+KI KLLK KI K+K   S+     D +  +  L+ +H   +L +K+
Sbjct: 877  LKCVQRTLDRPLADKIFKLLKAKIFKVKIPVSAE----DGERFVESLQRIHGTYLLAEKS 932

Query: 938  GQFQTLYFSGCSTTSMFLARLVVDTFPELE-TYEELTGIYHKTLDGWFVTGKFGVSMFVE 996
            GQ+Q +Y+S CS+ S+F  +L++++    +  + E+  IY +T   W    KF  S+F +
Sbjct: 933  GQYQAIYYSLCSSASIFFCKLLIESRDNKDAAHNEVIDIYAETTKKWMDKKKFPTSVFFD 992

Query: 997  FLNWLSVKKTQQ 1008
            F NWLS K+ QQ
Sbjct: 993  FYNWLSSKRQQQ 1004

>TBLA0A07210 Chr1 (1796426..1799551) [3126 bp, 1041 aa] {ON} Anc_6.7
            YEL055C
          Length = 1041

 Score =  563 bits (1452), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/1058 (36%), Positives = 559/1058 (52%), Gaps = 83/1058 (7%)

Query: 6    INRDLFYKLASDLSEERLQATIDLVTQLSKLEKDSS---------EWQYVLDRLIKGLSS 56
            +NRD+FY+LASDL EERLQ+ + LV +L +L+ ++S         EW YV++RLI GL+S
Sbjct: 4    VNRDVFYRLASDLEEERLQSVVLLVKELDELKANNSDENRELVVKEWNYVVNRLINGLAS 63

Query: 57   SRNGARLGFSLCLTEVVALALEKG-------VLARVDQYMHLLISALSKENVKN------ 103
            +R GARLGFSLCLTEV+ LAL +         L  +  ++HL+   LS  + K       
Sbjct: 64   NRKGARLGFSLCLTEVLNLALSQKWKNILPPNLTDISSFLHLISDTLSIPSSKQGEPRKL 123

Query: 104  --GKEERGLLFGKLFGLQVLLNEPLFSKVFTPDENQLNVELMSSYMSYLIDIALAKTWIR 161
              GK+ERGLLFGKLF LQ LLN+P+F K+F  D    N  ++  ++  LI ++  K WI+
Sbjct: 124  LKGKDERGLLFGKLFALQSLLNDPIFGKIFNKD----NKAILFEFIYELIALSNLKNWIK 179

Query: 162  ESSLFTLFQAVEKLAPLLGSRQPLKAVLELLDSKGLTQTSEGLAIYLFLLHRCSHTGPVL 221
            E +LFTLF  ++K+   L  R  +  +L +L S  LT T+EGL+IY++L++   H  P  
Sbjct: 180  EPTLFTLFNFIQKIIEFLD-RSDIVQLLNILASNNLTLTNEGLSIYIYLIYTNPHISP-- 236

Query: 222  RKKGFLDELNLKNPWKNNDPLKRGNLPAISNA-LKDSGARDDPSLTQKGVWAPRLHFAWD 280
              +    + N  N WKNNDP  + N+  +S   L  S A      T    W PRLH+ WD
Sbjct: 237  --EDIQIDNNNNNTWKNNDPFLKSNIVLLSKVLLNTSAASQSEKHTSNANWTPRLHYVWD 294

Query: 281  IVLQTLLHAENSEITTMQXXXXXXXXXXXXXXXXXXXXWKSVVDESFFNEKSSSERKYLG 340
            ++L  LL+ ++S+   +                     W+ V+DESFFNEK+S ERKYLG
Sbjct: 295  VILPILLNPKSSD--KLLNKNGNKRRKVSRDRIKFNEFWRQVIDESFFNEKASHERKYLG 352

Query: 341  ILVFEKTFQ-LSPPRYLPQLFSKNLIRCLINQCGSAERNLHKISQKALATIVEVCKAQPE 399
             L+ +KTF  L+    +  +F+ NLIR +INQ   ++R L+KIS K +  IV  C++  E
Sbjct: 353  FLIIQKTFPLLNTANDIESIFTSNLIRSIINQMNDSKRYLNKISHKTIDQIVSQCQSNSE 412

Query: 400  -KTAPSFVGLSFGE--YGTINFDHLTKTKTVNSLLSNKSLRSDDLMILEESLISNL--FG 454
             +  P   G  F E    +INFD LTKTKT++ L++ + L +D L  L     S L  F 
Sbjct: 413  LRLIPVLNGFLFKEENSSSINFDKLTKTKTISRLINLQDLSTDTLSKLFFLFTSKLDSFT 472

Query: 455  NLKELSRARFILDAILHLVRAHKAH--ADEVWLKPVLKALVCLGFFQQSELKDVKDSQES 512
               EL   +F+LD+ILH++R+HK+       +L PVL+ ++ L FF+  E  DV      
Sbjct: 473  TTTEL---QFLLDSILHIIRSHKSQIIVSHKFLDPVLEPIILLTFFK--ETADV------ 521

Query: 513  FHSLSSIASERLFSILADLLTVEQDTYSVCWPFIAVQLLKTDTNQKTLLQSMDEELGDIL 572
              S+S+I  +RL SIL DL TV +++ S+ +  + + +   +  +  L    D+ L ++ 
Sbjct: 522  --SISNILKDRLISILNDLTTVGENSSSIQYLTLNLIVNLNEDPKNVLNFKFDDSLLEVK 579

Query: 573  DSSMTVLSSISQKANEANXXXXXXXXXXXXVNILQAYAGEVESISVLEDLVSFCNEFEDG 632
            DS++T L    + +   +            V  +Q Y  +++SI+ ++DL  F + ++  
Sbjct: 580  DSAITTLKRAIEHSKRDSRLKSLVSLLSLSV--IQLYLADIDSIATIQDLCDFYDRYKSN 637

Query: 633  A-----KSAPLAGFIEIXXXXXXXXXXXXXXXXXXXWESFVADVTEKDLTVLLNVLPTRE 687
                  K+ P  G IEI                   WESF+  +   +   + +VL TRE
Sbjct: 638  TIMKNDKNRPSLGIIEILLALFAQKKSILKKLGLAMWESFIDLIELNEFDEIFDVLLTRE 697

Query: 688  NKEGFSNLFXXXXXXXXXXXXXXXXXXXXXXXKXXXXXXX--XXXXXXXXXXXXXXXXXM 745
            NKEGF+ LF                                                  +
Sbjct: 698  NKEGFARLFEGDDEYEEIDSHDDEEKDEDKNIDDISTENSDDDNSSDEENDSIVESNDDI 757

Query: 746  GKIDKEATSALAKALNLPDSIVDDKGEVRFXXXXXXXXXXX----------XXXXXXXXX 795
             +IDKEATSALAKAL LPD+I++DKGEV                                
Sbjct: 758  NRIDKEATSALAKALKLPDNIINDKGEVDLGKLEDISDNEVHFSSSDDDADMSDESMDDE 817

Query: 796  XXXXXXGQLSEIFKRRKEALSKIPTGNKRKQEVKESRENVIAFKHRVVDMLEILVRWIES 855
                  GQLS+IF RRKEALS I TGNKRK +VKESRENVIAFKHR+VDM+E+ ++ IE 
Sbjct: 818  QMMELDGQLSQIFSRRKEALSNIQTGNKRKLDVKESRENVIAFKHRIVDMIEVYLKHIEI 877

Query: 856  KMKKDGHIEKSVLDKVFA----IILPLLDCIRTTLDKPLAEKIAKLLKNKICKLKPSFSS 911
              K   +IE++  +K+      II  LL CI+ TLD+ LAEKI+KLLKNK+ K+K     
Sbjct: 878  ITKSSENIERTYFNKILNSIPLIIKSLLLCIQQTLDRNLAEKISKLLKNKLFKIKLVEFK 937

Query: 912  TTEKVDKKAVLSLLRSVH-EAMLVKKAGQFQTLYFSGCSTTSMFLARLVVDTFPELETYE 970
                +  + +L  + ++H E +LVKK+GQ+Q LYF  CS +S+F  R+  +T    + Y+
Sbjct: 938  DCGDLTSENILEWISTLHTECILVKKSGQYQPLYFKLCSGSSLFYCRIFAETSTNADLYD 997

Query: 971  ELTGIYHKTLDGWFVTG--KFGVSMFVEFLNWLSVKKT 1006
             L  +Y +T   WF     K   ++F +F NWLS K++
Sbjct: 998  SLIDLYGQTTKTWFKNSEMKIPTTIFSDFHNWLSSKRS 1035

>Kpol_1045.80 s1045 complement(186944..190003) [3060 bp, 1019 aa]
           {ON} complement(186946..190005) [3060 nt, 1020 aa]
          Length = 1019

 Score =  452 bits (1163), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 278/714 (38%), Positives = 413/714 (57%), Gaps = 56/714 (7%)

Query: 5   EINRDLFYKLASDLSEERLQATIDLVTQLSKLEKDS--SEWQYVLDRLIKGLSSSRNGAR 62
           ++NRD FYKLASDL EER+Q+ + L+  LS L+      E++YVL+RLI GLSS+RN AR
Sbjct: 3   KVNRDSFYKLASDLPEERVQSAVALIKDLSALKPSEVEKEFEYVLNRLISGLSSNRNSAR 62

Query: 63  LGFSLCLTEVVALALEK-----GVLARVDQYMHL------LISALSKENVKNGKEERGLL 111
           LGFSLCLTEVV LAL++       L  +D ++ +      L S  + + +K GK+ERG++
Sbjct: 63  LGFSLCLTEVVNLALDRKDQPLTCLRSIDDFLDMVDKTLVLDSVATGKKLKKGKDERGIM 122

Query: 112 FGKLFGLQVLLNEPLFSKVFTPDENQLNVELMSSYMSYLIDIALAKTWIRESSLFTLFQA 171
           FG++F LQ LLNEPLF+KVF  D+N    +    + + L+++A+ K W+RE  LFTL+Q 
Sbjct: 123 FGRMFALQALLNEPLFAKVFI-DKNGKISKFAIRFQTQLVELAVLKNWLREPCLFTLYQT 181

Query: 172 VEKLAPLLGSRQPLKAVLELLDSKGLTQTSEGLAIYLFLLH----RCSHTGPVLRKKGFL 227
           VEK  P + S   ++++++LLD   LT T+EGLAIYL L+H    + + + P L  +G  
Sbjct: 182 VEKFMPYIDSSY-IESLVQLLDKYKLTLTNEGLAIYLSLIHTNGKKIASSLP-LESQG-- 237

Query: 228 DELNLKNPWKNNDPLKRGNLPAISNALKDSGARDDPSLTQKGV---WAPRLHFAWDIVLQ 284
                   WK NDPL +GNLP ++  L +S    + S T +G    W+PRLHF WDI+L 
Sbjct: 238 --------WKLNDPLAKGNLPTLTQVLLNSNI--NQSETPQGNAANWSPRLHFVWDILLP 287

Query: 285 TLLHAENSEITTMQXXXXXXXXXXXXXXXXXXXXWKSVVDESFFNEKSSSERKYLGILVF 344
            LL  ++S                          WK VVDESFFNEKSSSERKYLG L+ 
Sbjct: 288 ILL-GQDSTTNDEHVSKKQKSKTTSSTSIKFQSFWKMVVDESFFNEKSSSERKYLGFLII 346

Query: 345 EKTFQLSPPRYLPQLFSKNLIRCLINQCGSAERNLHKISQKALATIVEVCKAQPEKTAPS 404
           +K+ +L P + +  LF +N++R +INQ    +R LHKISQK L +I+E C+    K  P 
Sbjct: 347 QKSLELVPAQLVESLFGQNVLRSMINQSADTKRMLHKISQKVLNSIIEACEKDTTKITPI 406

Query: 405 FVGLSFGEYGTINFDHLTKTKTVNSLLSNKSLRSDDLMILEESLISNLFGNLKELSRARF 464
              + FGE G  NFD LTKTKT+N +LS K+L  + L  +   L + + G+ + + + +F
Sbjct: 407 VKVILFGENGATNFDKLTKTKTINKILSIKNLEEETLSQIFIMLSNEIKGSSESIQKDQF 466

Query: 465 ILDAILHLVRAHKAHAD-EVWLKPVLKALVCLGFFQQSELKDVKDSQESFHSLSSIASER 523
           +LD ILH+VR HK   +    +  +L  ++ L FF       +K+++     +S+IA ER
Sbjct: 467 VLDTILHVVRNHKLEMNIGTIIIQLLTPVIDLAFF-------LKENER----ISNIAKER 515

Query: 524 LFSILADLLTVEQDTYSVCWPFIAVQLLKT-DTNQKTLLQSMDEELGDILDSSMTVLSSI 582
            FS+L++L  +   T S  W + A++L+   + +   L Q MD++L  I +  +  L  +
Sbjct: 516 FFSLLSELAAITTSTRS--WQYTALELISNKEASGSPLNQEMDQDLIAIKEKGIECLKEV 573

Query: 583 SQKANEANXXXXXXXXXXXXVNILQAYAGEVESISVLEDLVSFCNEFEDGAKSAPLAGFI 642
           ++K++               +++LQ YAG+V+S+S++EDL +F +E ED   S  L G  
Sbjct: 574 TKKSDTVQ---LRGLECLLSMSLLQLYAGDVDSVSIVEDLCTFYDEREDD--SVSLVGIT 628

Query: 643 EIXXXXXXXXXXXXXXXXXXXWESFVADVTEKDLTVLLNVLPTRENKEGFSNLF 696
           EI                   WE FV  +  +++ VL++VL  RENKEGF+ LF
Sbjct: 629 EILLALLAQRKAVLKKIALVAWEQFVPFIGPEEVKVLVDVLNARENKEGFAQLF 682

 Score =  208 bits (530), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 115/276 (41%), Positives = 174/276 (63%), Gaps = 17/276 (6%)

Query: 747  KIDKEATSALAKALNLPDSIVDDKGEVRFXX----------XXXXXXXXXXXXXXXXXXX 796
            KI+KE TSALAKALNLPD+I+++ GEV                                 
Sbjct: 738  KINKETTSALAKALNLPDNIINENGEVDLDALEGMSEEENDDDDDDESEEEDDESMDDEK 797

Query: 797  XXXXXGQLSEIFKRRKEALSKIPTGNKRKQEVKESRENVIAFKHRVVDMLEILVRWIE-- 854
                  QLSEIFKRRKEALS + +GN+RK +VKESRENVIAFKHR++D+LE  ++++E  
Sbjct: 798  MMELDDQLSEIFKRRKEALSSVASGNQRKLDVKESRENVIAFKHRIIDLLETYIKYVEKI 857

Query: 855  -SKMKKDGHIEK-SVLDKVFAIILPLLDCIRTTLDKPLAEKIAKLLKNKICKLKPSFSST 912
             S+  +D  I K  +L+ VF ++  +++CI+ TLD+PLA+KI+KLLK K+ K+  +F   
Sbjct: 858  TSRKLEDQPINKEQLLNCVFMMMNAMVECIQHTLDRPLADKISKLLKVKLFKINLTFFDN 917

Query: 913  TEKVDKKAVLSLLRSVHEAMLVKKAGQFQTLYFSGCSTTSMFLARLVVDTFPELE---TY 969
                ++++VL+ L+++HE ++  K GQ  +LYFS CST+S+FL++L+++T    E    +
Sbjct: 918  GNVSNQESVLTQLKAIHELLITSKPGQHASLYFSVCSTSSLFLSKLLIETTNADERSYAF 977

Query: 970  EELTGIYHKTLDGWFVTGKFGVSMFVEFLNWLSVKK 1005
             +L  IY +    W + G+FG  +F++F NWL+ KK
Sbjct: 978  SQLIDIYGELSKKWLLKGRFGPIVFMDFYNWLNSKK 1013

>TDEL0G04640 Chr7 complement(845491..848544) [3054 bp, 1017 aa] {ON}
           Anc_6.7 YEL055C
          Length = 1017

 Score =  441 bits (1134), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 284/711 (39%), Positives = 407/711 (57%), Gaps = 45/711 (6%)

Query: 6   INRDLFYKLASDLSEERLQATIDLVTQLSKLE--KDSSEWQYVLDRLIKGLSSSRNGARL 63
           +NRD FYKLASDL EER+QA + L+ +LS L+    +SEW YVL RLI GLSSSRN ARL
Sbjct: 5   VNRDWFYKLASDLQEERVQAAVALIQELSALDLPDGASEWSYVLKRLINGLSSSRNSARL 64

Query: 64  GFSLCLTEVVALAL-----EKGVLARVDQYMHLLISAL--------SKENVKNGKEERGL 110
           GFSLCLTEV+ LAL         L+ +D ++ LL S L        SK+ +K GK+ERGL
Sbjct: 65  GFSLCLTEVINLALNLEGDRPEELSSIDTFLDLLSSTLSLQPSGQDSKKQIK-GKDERGL 123

Query: 111 LFGKLFGLQVLLNEPLFSKVFTPDENQLNVELMSSYMSYLIDIALAKTWIRESSLFTLFQ 170
           LFGK+FGLQ LL+EPLF KVF   E  ++ +    +M  L  +A+ K+W+RE  LFTLFQ
Sbjct: 124 LFGKMFGLQALLSEPLFEKVFISKEKGIS-DFALRFMDELCQLAVFKSWLREPCLFTLFQ 182

Query: 171 AVEKLAPLLGSRQPLKAVLELLDSKGLTQTSEGLAIYLFLLHRCSHTGPVLRKKGFLDEL 230
           A E++ PL    +  + VL LLD   LT T+EGLAIYL LL++     P       L   
Sbjct: 183 AYERILPL-ADIETAQVVLRLLDQYQLTLTNEGLAIYLLLLYK----SPRDYSSSILQMD 237

Query: 231 NLKNPWKNNDPLKRGNLPAISNALKDSG-ARDDPSLTQKGVWAPRLHFAWDIVLQTLLHA 289
                WK+NDPL RGNLP +S  L+DS  A +D S  +   W PRLHF WDI+L  +   
Sbjct: 238 FESKSWKSNDPLARGNLPLLSQVLRDSSVATEDESSPKASNWTPRLHFVWDILLPIITQD 297

Query: 290 ENSEITTMQXXXXXXXXXXXXXXXXXXXXWKSVVDESFFNEKSSSERKYLGILVFEKTFQ 349
            +   +  +                    W+  VDES FNEK+S+ERK+LG+++F+K  +
Sbjct: 298 NSRRESEDRKPKTKKRKKEKATAIQFPEFWQMAVDESMFNEKASTERKFLGLVIFQKALE 357

Query: 350 LSPPRYLPQLFSKNLIRCLINQCGSAERNLHKISQKALATIVEVCKAQP-EKTAPSFVGL 408
           ++P + +   FS+N++R LIN    ++R L KIS K L +IV++CK +P EK  P    +
Sbjct: 358 VTPHKLVGCCFSQNVMRTLINHASDSKRLLFKISLKVLNSIVDICKKRPKEKLVPCLSAI 417

Query: 409 SFGEYGTINFDHLTKTKTVNSLLSNKSLRSDDLMILEESLISNLF-GNLKELSRARFILD 467
            FG +G+INFD LTK+KT  +LL+   L    L  L   L SNL   +L E    +FILD
Sbjct: 418 LFGPHGSINFDKLTKSKTATNLLAVNGLDETALNELFGLLSSNLIESSLVEQKNQQFILD 477

Query: 468 AILHLVRAHKAHAD-EVWLKPVLKALVCLGFFQQSELKDVKDSQESFHSLSSIASERLFS 526
            +LH VR+HK+  + ++ +  +L+ ++ L FF       VKD     H+ S++A ER +S
Sbjct: 478 TMLHAVRSHKSELNKDIIVTSILRPIISLAFFT------VKDE----HT-SNLAKERFYS 526

Query: 527 ILADLLTVEQDTYSVCWPFIAVQLLKTDTNQ-KTLLQSMDEELGDILDSSMTVLSSISQK 585
           IL+++  +  +  S  +  +A+ +++ +    K L   +D+ L D+   ++  L +IS  
Sbjct: 527 ILSEITHLNNEGPS--YQNMALDIIRDEIAAGKELTTKLDDTLEDVKSEALRTLQAISN- 583

Query: 586 ANEANXXXXXXXXXXXXVNILQAYAGEVESISVLEDLVSFCNEFEDGAKSAPLAGFIEIX 645
            NE N              +LQ Y+GE E++SV+E+L +F  + ++ + S  L G  EI 
Sbjct: 584 -NEKNPQLRGLEMLISMC-LLQLYSGESEAVSVIEELCAFYQDTDENSTS--LVGITEIL 639

Query: 646 XXXXXXXXXXXXXXXXXXWESFVADVTEKDLTVLLNVLPTRENKEGFSNLF 696
                             W+ FV+++ E +L  LL+VLP RENK+GFS LF
Sbjct: 640 LSLLAQKKAVLRKLSLSAWQQFVSEIGEAELKALLDVLPARENKKGFSQLF 690

 Score =  204 bits (520), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 114/277 (41%), Positives = 162/277 (58%), Gaps = 20/277 (7%)

Query: 745  MGKIDKEATSALAKALNLPDSIVDDKGEVRFXX---------------XXXXXXXXXXXX 789
            + KIDKEATSALAKALNLPD+IV+DKGEV                               
Sbjct: 745  VAKIDKEATSALAKALNLPDNIVNDKGEVDLNNWDDGADDVADDGADDEVDGEEDEDEDE 804

Query: 790  XXXXXXXXXXXXGQLSEIFKRRKEALSKIPTGNKRKQEVKESRENVIAFKHRVVDMLEIL 849
                         QLS+IFKRRK+ALS I TGN+RK E KESRE+VIAFK RV+DMLEI 
Sbjct: 805  DSMDDEKMMELDDQLSQIFKRRKDALSNISTGNQRKNEAKESREDVIAFKQRVIDMLEIY 864

Query: 850  VRWIESKMKKDGHIEKSVLDKVFAIILPLLDCIRTTLDKPLAEKIAKLLKNKICKLKPSF 909
            V+++E +  K+ +  K  +     ++ P++ CI+ T DK LA +IAKLL+ K+ KLK   
Sbjct: 865  VKFVEKQSLKEENYSK--ISSCLLLLEPMIKCIQQTTDKSLANRIAKLLRTKVFKLKT-- 920

Query: 910  SSTTEKVDKKAVLSLLRSVHEAMLVKKAGQFQTLYFSGCSTTSMFLARLVVDTFPELE-T 968
            S+     D+  ++ +LR  HE +   K GQ Q +Y+S CST S+FL +++++     +  
Sbjct: 921  SAFCGSCDQDELMEMLRMTHEKIQTLKPGQHQAIYYSVCSTASLFLTKIIIENSDSKDAA 980

Query: 969  YEELTGIYHKTLDGWFVTGKFGVSMFVEFLNWLSVKK 1005
              ++  +Y +T+  W   GKFG ++F++F NWLS +K
Sbjct: 981  VHDIIDLYAETMKQWASNGKFGPNIFIDFSNWLSSRK 1017

>NDAI0K02910 Chr11 complement(658930..662121) [3192 bp, 1063 aa]
           {ON} Anc_6.7 YEL055C
          Length = 1063

 Score =  438 bits (1127), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 294/749 (39%), Positives = 415/749 (55%), Gaps = 71/749 (9%)

Query: 1   MGGIEINRDLFYKLASDLSEERLQATIDLVTQLSKLE--KDSSEWQYVLDRLIKGLSSSR 58
           M G ++NRDLFYKLASDL EERLQ+ + L+ +LS+L    D  EW YVL+RLIKGL+S R
Sbjct: 1   MAG-KVNRDLFYKLASDLEEERLQSAVSLIKELSQLNVPDDIEEWTYVLNRLIKGLASDR 59

Query: 59  NGARLGFSLCLTEVVALALEKGVLA-----RVDQYMHLLISAL-------SKEN-----V 101
           N ARLGFSLCLTE + LAL  G  A      +++++ LL   L       + EN      
Sbjct: 60  NSARLGFSLCLTEAINLALGMGDNAPQGVQSINEFLDLLSKTLPIDSNTVATENKTALKK 119

Query: 102 KNGKEERGLLFGKLFGLQVLLNEPLFSKVF-TPDENQLNVELMSSYMSYLIDIALAKTWI 160
           K G++ERG+LFGKLF LQ LLNEPLFS +F + D+ +++  L   Y+  L  +   K WI
Sbjct: 120 KKGRDERGILFGKLFALQALLNEPLFSTIFLSEDKKKIDSSLFIRYVDELFTLGSKKNWI 179

Query: 161 RESSLFTLFQAVEKLAPLLGSRQPLKAVLELLDSKGLTQTSEGLAIYLFLLHRCSHTGPV 220
           RES  FTL+Q +EKL P     +  + VL LLD   LT + EGLAIYL +++R ++   +
Sbjct: 180 RESCFFTLYQTIEKLLP-YADIEFYQLVLTLLDKYELTLSKEGLAIYLLIIYRSANKKQL 238

Query: 221 LRKKGFLDELNLKNP-WKNNDPLKRGNLPAISNALKDSGARD------DPSLTQK---GV 270
            +    L ++ L N  WK+N+PL RGNLPA++N L+DS   +       P+   K     
Sbjct: 239 EKT---LSDIQLSNSHWKSNNPLARGNLPALTNILRDSNVTEFQDHEKPPTKNNKQPPAN 295

Query: 271 WAPRLHFAWDIVLQTL------LHAENSEITTMQXXXXXXXXXXXXXXXXXXXXWKSVVD 324
           WAPRLHF WDI+L  L          + +    +                    W+  +D
Sbjct: 296 WAPRLHFVWDILLPILTTTTTEEDTNSDDKHISKKRKKIKKNQDSNEFIRFPEFWQMAID 355

Query: 325 ESFFNEKSSSERKYLGILVFEKTFQL---SPPRYLPQLFSKNLIRCLINQCGSAERNLHK 381
           ESFFNEK+SSERKYLG L+F+KT Q    +  + +   F++N +R LINQ    +R LHK
Sbjct: 356 ESFFNEKASSERKYLGFLIFQKTIQSIGKNNAKLISTCFTRNFMRSLINQSSDNKRLLHK 415

Query: 382 ISQKALATIVEVCKAQP-EKTAPSFVGLSFGEY--GTINFDHLTKTKTVNSLLSNKSLRS 438
           +SQ A+ TIV+VC+  P  K  P    L F     G+INFD LTK+KTV+ L+S K L S
Sbjct: 416 MSQIAIDTIVKVCEDDPSNKLIPCLDALLFNTNVGGSINFDKLTKSKTVSKLISIKHLSS 475

Query: 439 DDLMILEESLIS--NLFGNLKELSRA-RFILDAILHLVRAHKAHAD-EVWLKPVLKALVC 494
             L  L +  IS  N     KE++   +F LD ILH+VR+HK+  D +  ++P+L  LV 
Sbjct: 476 STLRQLIKLFISQINAMSTEKEITIVNQFALDTILHVVRSHKSEFDYDSVVEPLLNPLVK 535

Query: 495 LGFFQQSELKDVKDSQESFHSLSSIASERLFSILADLLTVEQDTYSV----CWPFIAVQL 550
           L FF        KD++    +L+ +A ERL+SIL++L        S      W +  +QL
Sbjct: 536 LAFFS-------KDNE----ALNELAKERLYSILSELTGATSSPKSSNAAHSWHYYTLQL 584

Query: 551 ---LKTDTNQKTLLQSMDEELGDILDSSMTVLSSISQKANEANXXXXXXXXXXXXVNILQ 607
              L+   NQ+ L+  +D +L  I ++ + VL+ IS    +              + ILQ
Sbjct: 585 ILELEKSGNQE-LVNKLDADLETIKNNGLKVLNEISMTNTDEMTQQSKGLELLLSMCILQ 643

Query: 608 AYAGEVESISVLEDLVSFCNEFEDGAKSAPLAGFIEIXXXXXXXXXXXXXXXXXXXWESF 667
            ++G+ ES+S +E+LV F +  +   +S  L G  EI                   WE F
Sbjct: 644 LFSGDTESLSTIEELVEFYSNSKQ-EESTSLVGITEILLSLLAQKKAILRKLSLSVWEHF 702

Query: 668 VADVTEKDLTVLLNVLPTRENKEGFSNLF 696
           ++D+ + +L VLL VLP RENK+GF++LF
Sbjct: 703 ISDIGKNELNVLLAVLPVRENKQGFAHLF 731

 Score =  207 bits (527), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 120/276 (43%), Positives = 166/276 (60%), Gaps = 17/276 (6%)

Query: 745  MGKIDKEATSALAKALNLPDSIVDDKGEVRFXXXXXXXXXXXXXXXXXXXX--------- 795
            +  IDKEATSALAKALNLP++IV++KGEV                               
Sbjct: 787  IANIDKEATSALAKALNLPENIVNEKGEVDLAKLENMSDNDLDNSINDDDDDESDEESMD 846

Query: 796  --XXXXXXGQLSEIFKRRKEALSKIPTGNKRKQEVKESRENVIAFKHRVVDMLEILVRWI 853
                     QLSEIFKRRKEALS I TGN+RK EVKESRENVIAFKHRV+DML I ++++
Sbjct: 847  DEKMMELDDQLSEIFKRRKEALSNISTGNQRKIEVKESRENVIAFKHRVIDMLMIYMKYV 906

Query: 854  ESKMKKDGHIEKSVLDKVFAIILPLLDCIRTTLDKPLAEKIAKLLKNKICKLKPS-FSST 912
            E       + EK     +   I P++ C++ TLDK LA+K+ KL+K K+ K+K S F   
Sbjct: 907  EGLTLTTENGEK--FGNLLLFIEPMIKCVKQTLDKSLADKVVKLVKTKLFKIKSSNFQIE 964

Query: 913  TEKVDKKAVLSLLRSVHEAMLVKKAGQFQTLYFSGCSTTSMFLARLV--VDTFPELETYE 970
            +   D   V+ LL+  HE++L  KAGQF +LY+S CST S+FL +++  V++  +   Y 
Sbjct: 965  SLNADDDRVMELLQRTHESLLTSKAGQFPSLYYSLCSTFSIFLGKILVHVESNDKEIAYG 1024

Query: 971  ELTGIYHKTLDGWFVT-GKFGVSMFVEFLNWLSVKK 1005
            +L  +Y +T   W ++ GKFG++ F +F NWLS ++
Sbjct: 1025 KLIDLYGETTKSWVMSKGKFGINTFTDFYNWLSSQR 1060

>ZYRO0F00440g Chr6 (42723..45842) [3120 bp, 1039 aa] {ON} similar to
           gnl|GLV|CAGL0B03553g Candida glabrata CAGL0B03553g and
           weakly similar to YEL055C uniprot|P39985 Saccharomyces
           cerevisiae
          Length = 1039

 Score =  427 bits (1098), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 279/722 (38%), Positives = 404/722 (55%), Gaps = 64/722 (8%)

Query: 5   EINRDLFYKLASDLSEERLQATIDLVTQLSKLEKDS--SEWQYVLDRLIKGLSSSRNGAR 62
           ++NRD FY+LASDL +ER++A + L+ +LS LE  +   EW YVL RLI GL+S RN AR
Sbjct: 4   KVNRDCFYRLASDLQDERVKAAVSLIEELSALELPACNEEWSYVLKRLISGLASGRNSAR 63

Query: 63  LGFSLCLTEVVALALEKGVLA-----RVDQYMHLLISALSKENVKN------GKEERGLL 111
           LGFSLCL+EVV +AL+KG LA       DQY+ LL + LS + V        GK+ERG+L
Sbjct: 64  LGFSLCLSEVVKMALDKGTLAPQDLSSPDQYLELLSNNLSPDAVGKSKKDLKGKDERGIL 123

Query: 112 FGKLFGLQVLLNEPLFSKVFTPDENQLNVELMSSYMSYLIDIALAKTWIRESSLFTLFQA 171
           FGK+FGLQ +LNEPLF+ +F   E +++      +   L ++A+ K W+RES L+TLFQ 
Sbjct: 124 FGKMFGLQAILNEPLFTSIFFDQEGKVS-PFALRFAQELAELAVKKNWLRESCLYTLFQT 182

Query: 172 VEKLAPLLGSRQPLKAVLELLDSKGLTQTSEGLAIYLFLLH-RCSHTGPVLRKKGFLDEL 230
           V++L P + S + + ++L LLD   LT T+EGLAIYL L H +    G   +    L  L
Sbjct: 183 VQRLVPAMES-EIVSSILLLLDKYQLTMTNEGLAIYLLLFHGKARKNGKSFKVPSSL-AL 240

Query: 231 NLKNPWKNNDPLKRGNLPAISNALKDSGARD----DPSLTQKGVWAPRLHFAWDIVLQTL 286
                WKNNDPL +GNLP +S  L+D+ A D    D S  +   W PRLHF WDI++  L
Sbjct: 241 EFA-AWKNNDPLSKGNLPQLSRVLRDAPANDSEVADGSHPKSANWNPRLHFVWDILIPIL 299

Query: 287 LHAENSEITTMQXXXXXXXXXXXXXXXXXXXXWKSVVDESFFNEKSSSERKYLGILVFEK 346
              ++ E                         +++ VDE+FF+EK+SSERKYLG LVF +
Sbjct: 300 APGKSDE-EIPSKKSHKKKKKDTVEGIEFPEFFQAAVDETFFSEKASSERKYLGFLVFIR 358

Query: 347 TFQLSPPRYLPQLFSKNLIRCLINQCGSAERNLHKISQKALATIVEVC-KAQPEKTAPSF 405
             ++   +++   F++N +R LINQ   ++R L+KISQKAL  IV+ C K   EK A   
Sbjct: 359 AVEVVSSQWIQSCFTQNFMRTLINQSSDSKRLLNKISQKALDAIVKACEKDASEKIALCL 418

Query: 406 VGLSFGEYGTINFDHLTKTKTVNSLLSNKSLRSDDLMILEESLISNLFGNLK-ELSRA-- 462
             + FG +GTI+FD LTK+KT + L++ K + S        S +  LF  L  +LSR   
Sbjct: 419 EAMLFGPHGTISFDKLTKSKTASKLVAIKDISS--------SGLDRLFNMLSAQLSREEE 470

Query: 463 ------RFILDAILHLVRAHKAH-ADEVWLKPVLKALVCLGFFQQSELKDVKDSQESFHS 515
                 +F+LD +LH VR H+   + E+   P+L ++V L FF +               
Sbjct: 471 PNKQHYQFVLDTVLHAVRTHRLEISQELIAHPLLDSIVTLAFFSKKG-----------ED 519

Query: 516 LSSIASERLFSILADLLTVEQDTYSVCWPFIAVQL-LKTDTNQKTLLQSMDEELGDILDS 574
           +S +A ERLFSIL++ LT+++D  S  W    ++L L  +      +  +DE+L  I   
Sbjct: 520 ISDLARERLFSILSE-LTIQKDGQS--WQHYTLKLILSKEAEGNEPINKLDEDLKAIETE 576

Query: 575 SMTVLSSISQKANEANXXXXXXXXXXXXVNILQAYAGEVESISVLEDLVSFCNEFEDGAK 634
           ++ +L +IS  + ++               +LQ Y+G+ ES+S++E+L  F  E  + + 
Sbjct: 577 ALDILQNISSDSPQSRGLEWLLSNC-----LLQLYSGDSESLSIVEELCIFYREGLNESN 631

Query: 635 SAPLAGFIEIXXXXXXXXXXXXXXXXXXXWESFVADVTEKDLTVLLNVLPTRENKEGFSN 694
           S  L G  EI                   WE FV++V E++L +LL VL  RENKEGF+ 
Sbjct: 632 S--LVGITEILLSLLAQKKALLRKLSLVVWEQFVSEVGEQELKILLEVLDARENKEGFAK 689

Query: 695 LF 696
           LF
Sbjct: 690 LF 691

 Score =  209 bits (533), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 122/284 (42%), Positives = 166/284 (58%), Gaps = 24/284 (8%)

Query: 745  MGKIDKEATSALAKALNLPDSIVDDKGEVRFXXXXXXXXXXXXXXXXXXXX--------- 795
            + KID+EATSALAKALNLP++IV+DKGEV                               
Sbjct: 755  VAKIDREATSALAKALNLPENIVNDKGEVDVERLEAENGANSDEMDDDDDDEEDEEEDEE 814

Query: 796  -------XXXXXXGQLSEIFKRRKEALSKIPTGNKRKQEVKESRENVIAFKHRVVDMLEI 848
                          QLS+IFKRRKEALS + TGN+RK EVKE+RENVI FKHR+VDMLE 
Sbjct: 815  EESMDDEQMMKLDEQLSQIFKRRKEALSGVTTGNERKVEVKEARENVITFKHRIVDMLEA 874

Query: 849  LVRWIESKMKKDGHIE---KSVLDKVFAIILPLLDCIRTTLDKPLAEKIAKLLKNKICKL 905
             ++  +    +D + E   K     +F  + P++ C++ TLDKPLA+KI+KLLK ++ K+
Sbjct: 875  YIKHADRIALQDNNDEANSKDTFKNLFLFVEPMIRCLQLTLDKPLADKISKLLKGRLYKI 934

Query: 906  KPSFSSTTEKVDKKAVLSLLRSVHEAMLVKKAGQFQTLYFSGCSTTSMFLARLVVDTFPE 965
            K   S+    +D K +L  L   H+A+L  K GQF  LYFS CSTTS+FL +++V+   E
Sbjct: 935  K--ISAFKGAIDSKRLLEQLEVTHKALLTSKPGQFPALYFSTCSTTSLFLGKVLVENNSE 992

Query: 966  LE--TYEELTGIYHKTLDGWFVTGKFGVSMFVEFLNW-LSVKKT 1006
                +Y ++  +Y  T   W + GKFG ++F +F NW LS KKT
Sbjct: 993  DPAISYGQMIDLYADTTKEWLLIGKFGANVFADFHNWLLSRKKT 1036

>YEL055C Chr5 complement(48471..51539) [3069 bp, 1022 aa] {ON}
           POL5DNA Polymerase phi; has sequence similarity to the
           human MybBP1A and weak sequence similarity to B-type DNA
           polymerases, not required for chromosomal DNA
           replication; required for the synthesis of rRNA
          Length = 1022

 Score =  424 bits (1090), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 271/724 (37%), Positives = 400/724 (55%), Gaps = 57/724 (7%)

Query: 5   EINRDLFYKLASDLSEERLQATIDLVTQLSKLE--KDSSEWQYVLDRLIKGLSSSRNGAR 62
           ++NRDLF+KLASDL EERL A + L+  LS L+   D+ EW YVL+RLIKGLSS RN AR
Sbjct: 4   KVNRDLFFKLASDLREERLHAAVALIKDLSALDLPDDAEEWSYVLNRLIKGLSSDRNSAR 63

Query: 63  LGFSLCLTEVVALALE-------KGV------LARVDQYMHLLISALSKENVKNGKEERG 109
           LGFSLCLTEV+ LA+        KG+      L+ +   +++ ++  +K+++K GK+ERG
Sbjct: 64  LGFSLCLTEVINLAVNMPPGQRPKGLESTNEFLSTLSTILNVNVNEGTKKSMK-GKDERG 122

Query: 110 LLFGKLFGLQVLLNEPLFSKVFTPDENQLNVELMSSYMSYLIDIALAKTWIRESSLFTLF 169
           +LFGKLFGL+ LLNEPLFS++F  D  + N E    +   LID+AL K WI+E   FTLF
Sbjct: 123 ILFGKLFGLKSLLNEPLFSEIFVKDLEKGNTEFFIRFTEQLIDLALKKNWIKEPCFFTLF 182

Query: 170 QAVEKLAPLLGSRQPLKAVLELLDSKGLTQTSEGLAIYLFLLHRCSHT-GPVLRKKGFLD 228
           Q ++ L P +      K +L + D   LT T+EGL+ YL L +    +  P +       
Sbjct: 183 QTMKMLLPFMDESSAEKILL-IYDKYDLTLTNEGLSTYLLLKYEGDESLIPSV------- 234

Query: 229 ELNLKNP-WKNNDPLKRGNLPAISNALKDSGARDDP------SLTQKGV-WAPRLHFAWD 280
            L+LKNP WK+NDPL RGNLP ++  L++S    D       +  QK   W PRLHF W 
Sbjct: 235 -LDLKNPGWKDNDPLARGNLPLLTKVLRNSSVIPDANGGLKETKKQKNTNWNPRLHFVWS 293

Query: 281 IVLQTLLHAENSEITTMQXXXXXXXXXXXXXXXXXXXXWKSVVDESFFNEKSSSERKYLG 340
           ++L    + +    + +                     WK  VDESFFNEK+SSERKYLG
Sbjct: 294 VLLPLFGNGKLENTSHISKKRKKTNNKKVQNSIQFPEFWKMAVDESFFNEKASSERKYLG 353

Query: 341 ILVFEKTFQLSPPRYLPQLFSKNLIRCLINQCGSAERNLHKISQKALATIVEVCKAQ-PE 399
            L+ +  F+  P  Y+   FS+N++R LINQ   ++R L+KISQ  L +IV+ C+     
Sbjct: 354 FLIIDAAFKAVPGSYIGFCFSQNVMRTLINQSIDSQRVLNKISQLTLDSIVKACEEDSAN 413

Query: 400 KTAPSFVGLSFGEYGTINFDHLTKTKTVNSLLSNKSLRSDDLMILEESLISNLFGNLKEL 459
           +  P    + FG +G+INFD LTK+ TV+ L++ K L S  L  L +     L      L
Sbjct: 414 RLVPCLNAMLFGPHGSINFDKLTKSGTVSKLIAIKELPSTVLAQLLDVFFLQLQDKKGVL 473

Query: 460 SRARFILDAILHLVRAHKAHADEV-WLKPVLKALVCLGFFQQSELKDVKDSQESFHSLSS 518
           S   F LD+ILH+VRAHK   +++  +KPVL+ +V + FF+ +   D+K  Q     L  
Sbjct: 474 SHTLFALDSILHIVRAHKVEINDMDIMKPVLRPIVYMAFFKHTS-DDLKLEQ-----LHE 527

Query: 519 IASERLFSILADLLTVEQ----DTYSVCWPFIAVQLLKTDTNQKT--LLQSMDEELGDIL 572
           +A ERL+SIL +L   ++    D     W ++ ++L+    N     L+  +DE L +I 
Sbjct: 528 LAKERLYSILGELTINKEIRCKDPEINSWQYLTLKLILDIENSHVGDLINPLDENLENIK 587

Query: 573 DSSMTVLSSISQKANEANXXXXXXXXXXXXVNILQAYAGEVESISVLEDLVSFCNEFEDG 632
           + +++ LS + +    +             + ++Q YAG+ +SISV+E+L  F       
Sbjct: 588 NEAISCLSKVCR----SRTAQSWGLSTLLSMCLVQLYAGDTDSISVIEELCEFSKH---- 639

Query: 633 AKSAPLAGFIEIXXXXXXXXXXXXXXXXXXXWESFVADVTEKDLTVLLNVLPTRENKEGF 692
            ++  + G  EI                   W+ F+ +V  ++L +LL++L  RENK+GF
Sbjct: 640 -ENNSMVGITEILLSLLAQKKALLRKLSLIIWQQFIEEVGLEELQILLDILKARENKQGF 698

Query: 693 SNLF 696
           + LF
Sbjct: 699 AQLF 702

 Score =  208 bits (529), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 121/266 (45%), Positives = 165/266 (62%), Gaps = 13/266 (4%)

Query: 748  IDKEATSALAKALNLPDSIVDDKGEVRFXXXX--XXXXXXXXXXXXXXXXXXXXXXGQLS 805
            IDKEATSAL KALNLPD+IV+DKGEV                               QLS
Sbjct: 755  IDKEATSALVKALNLPDNIVNDKGEVDLDQLEGLSDDGGDDEDEESMDDEKMMELDDQLS 814

Query: 806  EIFKRRKEALSKIPTGNKRKQEVKESRENVIAFKHRVVDMLEILVRWIE-----SKMKKD 860
            EIFKRRKEALS I TGN+RK EVK+SRENVI+FKHRVVDML + V++ E     +K +  
Sbjct: 815  EIFKRRKEALSSISTGNQRKFEVKQSRENVISFKHRVVDMLAVYVKYCEKLTLANKSEHS 874

Query: 861  GHIEKSVLDKVFAIILPLLDCIRTTLDKPLAEKIAKLLKNKICKLK-PSFSSTTEKVDKK 919
             ++  S L K+   I+P+L C+  TLD+PLA+KI+KLLK KI K+K  +F    + ++  
Sbjct: 875  NNLGGS-LSKLVYFIIPMLKCVNETLDRPLADKISKLLKGKIFKIKVTAFKDMNKDIE-- 931

Query: 920  AVLSLLRSVHEAMLVKKAGQFQTLYFSGCSTTSMFLARLVVDTFPELETYEELTGIYHKT 979
             ++ LL+  H+ ML  K GQ   +++S CST+S+FL++L V+     +  +EL  +Y  T
Sbjct: 932  -LMDLLKKTHKLMLTSKPGQHAAVFYSMCSTSSLFLSKLYVEIGGN-DKLDELIDLYTAT 989

Query: 980  LDGWFVTGKFGVSMFVEFLNWLSVKK 1005
               W   GK G ++F++F+NWLS KK
Sbjct: 990  TKEWMQKGKCGPNIFIDFINWLSSKK 1015

>TPHA0J00250 Chr10 (55997..59071) [3075 bp, 1024 aa] {ON} Anc_6.7
           YEL055C
          Length = 1024

 Score =  402 bits (1033), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 257/720 (35%), Positives = 396/720 (55%), Gaps = 63/720 (8%)

Query: 4   IEINRDLFYKLASDLSEERLQATIDLVTQLSKL---EKDSSEWQYVLDRLIKGLSSSRNG 60
           + ++RDLFYKLASD+ EER+ + + +V  L KL   ++   EW YV+DRL+KGL S+RN 
Sbjct: 1   MRVDRDLFYKLASDVPEERIASVVGVVGNLEKLSVGDEGEKEWVYVVDRLVKGLESNRNS 60

Query: 61  ARLGFSLCLTEVVALALEKGVLAR------VDQYMHLLISALSKENVKNGK--------E 106
           ARLGFS+CLTE + L L + V  R      V  Y+  + S      V  GK        +
Sbjct: 61  ARLGFSMCLTEALHLVLSRDVAERPRCLKDVGDYLKAVDSQFPLSAVGTGKAKVKVKGKD 120

Query: 107 ERGLLFGKLFGLQVLLNEPLFSKVFTPDENQLNVELMSSYMSYLIDIALAKTWIRESSLF 166
           ERG LFG+LF  +VLLNEPLFS +F       + + +  +   +I +   K W+ E   F
Sbjct: 121 ERGTLFGRLFAYKVLLNEPLFSLLF-------DQKFLIEFQERVIQLGSMKNWLLEPCFF 173

Query: 167 TLFQAVEKLAPLLGSRQPLKAVLELLDSKGLTQTSEGLAIYLFLLHRCSHTGPVLRKKGF 226
           +L+QA+EKL P L  ++  +A +  +D   LT T+EGL++YL           +L KK  
Sbjct: 174 SLYQAIEKLLPGL-DQEYAQATVAQIDEHKLTMTNEGLSVYL-----------LLAKKFT 221

Query: 227 LDELNLKN-PWKNNDPLKRGNLPAISNALKDSGARDDPSLTQKGVWAPRLHFAWDIVLQT 285
           L +  L+N  WK NDPL++GNL  ++  + D+      S T K  WAPRLH+ WDI+L+ 
Sbjct: 222 LSDFTLENSAWKANDPLQKGNLSVMAKVMLDTNVDGANSNTNKN-WAPRLHYIWDIILRE 280

Query: 286 LLHAENSEITTMQXXXXXXXXXXXX-XXXXXXXXWKSVVDESFFNEKSSSERKYLGILVF 344
               E                             W++VVDESFFN+K+S ERKY G L+F
Sbjct: 281 FFDNEQHGSDAKHVYQKKKHDKSKNPQRVEFKSFWQAVVDESFFNDKASPERKYQGYLIF 340

Query: 345 EKTFQLSPPRYLPQLFSKNLIRCLINQCGSAERNLHKISQKALATIVEVCKAQPEKTAPS 404
           +K  +  P   +   F++N++R +INQ   ++R L+K+SQK L T+V +C+++P K  P 
Sbjct: 341 QKAVESVPASEVEYCFTQNIMRSMINQASDSKRMLNKLSQKTLNTLVSICESEPAKLTPV 400

Query: 405 FVGLSFGEYGTINFDHLTKTKTVNSLLSNKSLRSDDLMILEESLISNL-----FGNLKEL 459
              L F E G++NFD LTK+KTV+ LL+ K      L  L     S L        L+EL
Sbjct: 401 LTALLFSEEGSLNFDILTKSKTVSRLLATKQSDHHYLATLIRLFTSRLNVSDKTPELEEL 460

Query: 460 S-RARFILDAILHLVRAHKA--HADEVWLKPVLKALVCLGFFQQSELKDVKDSQESFHSL 516
           + R +FILD++L+L+R+ KA    D+  +  +L++ + L FFQ       KD++     +
Sbjct: 461 NPRLKFILDSLLNLIRSQKALLETDKEIVMEILESTIQLAFFQ-------KDNE----YI 509

Query: 517 SSIASERLFSILADLLTVEQDTYSVCWPFIAVQLLKTDTNQKTLLQSMDEELGDILDSSM 576
           ++IA ERL S+LA+L+ +     S  WP++A++++ T    +TL+ S+D+ L  +   S+
Sbjct: 510 NNIAKERLSSMLAELIVLPSTDGS--WPYLALEIIVTKEKSETLIDSLDDSLVAVKAESL 567

Query: 577 TVLSSISQKANEANXXXXXXXXXXXXVNILQAYAGEVESISVLEDLVSFCNEFEDGAKSA 636
            +L  IS+  ++++            +N++Q Y+G+ ESI ++EDL +F +E  +  ++A
Sbjct: 568 DILKKISELKSKSS--QLLGIESLMSMNLIQLYSGDAESIGIIEDLTTFYHETSNH-ETA 624

Query: 637 PLAGFIEIXXXXXXXXXXXXXXXXXXXWESFVADVTEKDLTVLLNVLPTRENKEGFSNLF 696
              G  EI                   WE F+  + ++++ +LLN L  RENKEGFS LF
Sbjct: 625 NFTGVTEILLSLLAQRKSLLRKLSLLVWEQFIDQIGKEEINLLLNFLHARENKEGFSVLF 684

 Score =  198 bits (503), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 114/282 (40%), Positives = 161/282 (57%), Gaps = 20/282 (7%)

Query: 745  MGKIDKEATSALAKALNLPDSIVDDKGEVRFXX-------XXXXXXXXXXXXXXXXXXXX 797
            + +IDKE TSALAKALNLPD+I+++ GEV                               
Sbjct: 744  ISQIDKETTSALAKALNLPDNIINENGEVNINMLEGMDEDDDDDSSSAEDDDESMDDEKM 803

Query: 798  XXXXGQLSEIFKRRKEALSKIPTGNKRKQEVKESRENVIAFKHRVVDMLEILVRWIE--S 855
                 QLSEIFKRRK+ALS + TGN+RK +VKESRENVIAFKHR++DMLEI ++ IE  S
Sbjct: 804  MELDDQLSEIFKRRKDALSTVSTGNQRKLDVKESRENVIAFKHRIIDMLEIYIKHIEQLS 863

Query: 856  KMKKDGH--IEKSVLDKVFAIILPLLD----CIRTTLDKPLAEKIAKLLKNKICKLKPSF 909
              + DG   +     ++  AI+L ++D    C++ TLDKPL EKI KL K +  K++ + 
Sbjct: 864  LNRADGGKVVTTEKTEQTLAIMLAIVDAFANCVQQTLDKPLIEKIIKLFKGRFSKIRFTL 923

Query: 910  SSTTEKVDKKAVLSLLRSVHEAMLVKKAGQFQTLYFSGCSTTSMFLARLVVDTFPELE-- 967
                E      +++ L  +H  +   K GQF   Y+  CS+TS++L R ++DT  E E  
Sbjct: 924  FEDIET--STEIMNSLERIHIHLNTNKPGQFSAAYYLFCSSTSLYLCRFLIDTTVEAEKT 981

Query: 968  -TYEELTGIYHKTLDGWFVTGKFGVSMFVEFLNWLSVKKTQQ 1008
              +E+L  +Y  T   W   GK+G  +FV+F NWL+ KK ++
Sbjct: 982  KMFEKLVDVYAATTKIWMQEGKYGAKIFVDFYNWLASKKQRK 1023

>CAGL0B03553g Chr2 (354365..357430) [3066 bp, 1021 aa] {ON} similar
           to uniprot|P39985 Saccharomyces cerevisiae YEL055c POL5
           DNA polymerase V
          Length = 1021

 Score =  391 bits (1005), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 257/714 (35%), Positives = 392/714 (54%), Gaps = 46/714 (6%)

Query: 5   EINRDLFYKLASDLSEERLQATIDLVTQLSKLE--KDSSEWQYVLDRLIKGLSSSRNGAR 62
           ++NRD FYKLASDL EERLQA + ++  LS LE  ++  EW Y ++RL+KGL SSRN AR
Sbjct: 3   KVNRDHFYKLASDLPEERLQAAVGVIKDLSALEVPQEIEEWNYTINRLVKGLGSSRNSAR 62

Query: 63  LGFSLCLTEVVALALEKG-----VLARVDQYMHLLISALSKE----NVKNGKEERGLLFG 113
           LGFS+CL+E + LAL  G      L  ++ Y+ +L   L  +      + GK+ERG+LFG
Sbjct: 63  LGFSMCLSEALNLALSLGDKAPEGLNSIENYLKILNETLGADFDEGKKRKGKDERGILFG 122

Query: 114 KLFGLQVLLNEPLFSKVFTPDENQLNVELMSSYMSYLIDIALAKTWIRESSLFTLFQAVE 173
           KLFGLQ LLNEPLFS VF   +   N   +  ++  +I+++  K WIRE +LF+L+Q +E
Sbjct: 123 KLFGLQALLNEPLFSNVFVTKDGISN--FVPVFVQEMINLSKCKNWIREPALFSLYQTLE 180

Query: 174 KLAPLLGSRQPLKAVLELLDSKGLTQTSEGLAIYLFLLHRCSHTGPVLRKKGFLDELNLK 233
           KL   + S+  +  ++  LD   LT T+EGLAIYL L+   +        +  + E+ L+
Sbjct: 181 KLISKV-SKSDITNLISQLDENNLTMTNEGLAIYLLLVDESNKIS-----RAEIAEIKLQ 234

Query: 234 NP-WKNNDPLKRGNLPAISNALKDSG----ARDDPSLTQKG--VWAPRLHFAWDIVLQTL 286
           N  WK+NDPL +GNLP+++  L D+     A D+    QKG   W PRLHF W+ +L T+
Sbjct: 235 NQGWKSNDPLAKGNLPSLTKVLLDNDGVAFAEDNEQRKQKGGANWNPRLHFVWEKLLSTI 294

Query: 287 LHAENSEITTMQXXXXXXXXXXXXXXXXXXXXWKSVVDESFFNEKSSSERKYLGILVFEK 346
           ++  +S     +                    W+ VVDE++FN+K+SSERKYLG L+F++
Sbjct: 295 INGSHSLNVEDKHVSKKRKKNNTIASIKFHEFWQMVVDETYFNDKASSERKYLGFLIFQR 354

Query: 347 TF-QLSPPRYLPQLFSKNLIRCLINQCGSAERNLHKISQKALATIVEVCKAQPEKTAPSF 405
            F  L     +     +N IR LINQC   +R+L+KI+ + +  IVE C+    K  P F
Sbjct: 355 AFPMLKSYEDVVDSLGQNFIRSLINQCSEKKRHLNKIALQTVEIIVESCENDTTKILPVF 414

Query: 406 VGLSFGEYGTINFDHLTKTKTVNSLLSNKSLRSDDLMILEESLISNLFGNLKELSRARFI 465
             L+FG+ G+I FD L+KTK ++ LL  KS+R + L  L + L   L    +E S ++FI
Sbjct: 415 ETLAFGKSGSITFDRLSKTKLLSRLLGIKSVRYEVLSKLFDILSRQLSIKSEEKSFSQFI 474

Query: 466 LDAILHLVRAHKAHADEVWL-KPVLKALVCLGFFQQSELKDVKDSQESFHSLSSIASERL 524
           LD++LHLVR  KA  D + L + VL  +V L FF                +L  ++ ERL
Sbjct: 475 LDSMLHLVRNQKAEVDSLLLTEKVLPQIVKLAFFTGDN-----------ETLQEMSKERL 523

Query: 525 FSILADLLTVEQDTYSVCWPFIAVQLLKTDT-NQKTLLQSMDEELGDILDSSMTVLSSIS 583
           FSIL++L ++          ++ ++L++      + +   +D+EL +   S++ +L+ I+
Sbjct: 524 FSILSELNSLHLSESQEIPQYVVIKLVQQHIEGGEKMTSELDDELRETESSALRILAEIA 583

Query: 584 QKANEANXXXXXXXXXXXXVNILQAYAGEVESISVLEDLVSFCNEF-EDGAKSAPLAGFI 642
           +  ++                +LQ Y G+ ES+  L++L     +   D  +  PL+   
Sbjct: 584 KATDKP---YLRGLGSLFATCLLQLYTGDSESVGTLQELKDIYEKLISDDER--PLSSIT 638

Query: 643 EIXXXXXXXXXXXXXXXXXXXWESFVADVTEKDLTVLLNVLPTRENKEGFSNLF 696
           EI                   WE  V  V++ +L +LL++L  RENK+GF+ LF
Sbjct: 639 EILLSLLAQKKALLKKASIAVWEQVVPYVSQDELNLLLDILLARENKQGFAQLF 692

 Score =  201 bits (512), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 114/267 (42%), Positives = 161/267 (60%), Gaps = 10/267 (3%)

Query: 745  MGKIDKEATSALAKALNLPDSIVDDKGEVRFXXXXXXXXXXXXXXXXXXXXXXXXXX--G 802
            +  IDKE TSALAKAL+LP  I++  GEV                               
Sbjct: 753  VNNIDKETTSALAKALDLPADIINANGEVDIEKLEMQSDDDEDDEDDESMDDEQMMDLDD 812

Query: 803  QLSEIFKRRKEALSKIPTGNKRKQEVKESRENVIAFKHRVVDMLEILVRWIESKMKKDGH 862
            QLSEIFKRRKEALS IPTGNKRK EVKESRE+VIAFKHR+VD+L + ++ +E  ++++  
Sbjct: 813  QLSEIFKRRKEALSNIPTGNKRKNEVKESRESVIAFKHRIVDLLLVYIKHVEKMIQREDV 872

Query: 863  IEKSVLDKVFAII---LPLLDCIRTTLDKPLAEKIAKLLKNKICKLKPSFSSTTEKVDKK 919
             E S  DK+  ++   +P++ CI+ TLDK LAEK+AKLLK ++ K++     T  K+D  
Sbjct: 873  DENSKADKLNCLLTFAIPMIKCIKQTLDKSLAEKLAKLLKTRLFKIR----VTGIKLDTA 928

Query: 920  AVLSLLRSVHEAMLVKKAGQFQTLYFSGCSTTSMFLARLVVDTFPELE-TYEELTGIYHK 978
             V+   + +H+  L  K GQF  LY+S CS+TS++ ++++VD     +  YE L   Y  
Sbjct: 929  DVVEDFQRIHQDFLFAKPGQFPILYYSVCSSTSLYFSKILVDNADYQQGVYETLVDTYST 988

Query: 979  TLDGWFVTGKFGVSMFVEFLNWLSVKK 1005
            T+  W    KF  S+F++F+NWL+ KK
Sbjct: 989  TIKEWLKDTKFPHSIFLDFVNWLASKK 1015

>YBR184W Chr2 (597363..598934) [1572 bp, 523 aa] {ON} Putative
           protein of unknown function; YBR184W is not an essential
           gene
          Length = 523

 Score = 32.7 bits (73), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 34/152 (22%), Positives = 60/152 (39%), Gaps = 12/152 (7%)

Query: 414 GTINFDHLTKTKTVNSLLSNKSLRSDDLMILEESLISNLFGNLKELSRARFILDAILHLV 473
           GTI  +H     T N+ + +     ++    EE    ++        +AR + DAI H  
Sbjct: 23  GTILRNHKRPIITFNNNIEHTVSEPNNFTGYEEKEDLDIMDICPYYPKARMLADAIQHA- 81

Query: 474 RAHKAHADEVWLKPVLKALVCLGFFQQSELKDVKDSQESFHSLSSIASERLFSILADLLT 533
              K  A E  ++  +K + C        LK      E  H  S +++ R+  IL D+  
Sbjct: 82  ---KTSASENKMELSMKTIPC--------LKKENVHVEKGHDWSQLSTSRICKILEDIAD 130

Query: 534 VEQDTYSVCWPFIAVQLLKTDTNQKTLLQSMD 565
            +  T     P    +   T+ NQ T +++ +
Sbjct: 131 KKNKTRRQSAPLQKTKYFPTNENQNTDIENQN 162

>KAFR0E04430 Chr5 complement(895687..900594) [4908 bp, 1635 aa] {ON}
           Anc_4.375 YJR140C
          Length = 1635

 Score = 32.7 bits (73), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 36/63 (57%), Gaps = 5/63 (7%)

Query: 5   EINRDLFYKLASDLSEERLQAT--IDLVTQLSKLEKDSSEWQYVLDRLIKGLSSSRNGAR 62
           E+  D+   L  D++ ++ Q     DL TQ +KLEK+  +WQ++L+ +   LS + +  R
Sbjct: 548 EVLVDMLSDLTEDIASKKFQGNKITDLKTQKNKLEKNIVKWQFLLENM---LSENDHFFR 604

Query: 63  LGF 65
           L F
Sbjct: 605 LCF 607

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.378 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 86,385,807
Number of extensions: 3349155
Number of successful extensions: 11307
Number of sequences better than 10.0: 29
Number of HSP's gapped: 11328
Number of HSP's successfully gapped: 61
Length of query: 1008
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 888
Effective length of database: 39,721,479
Effective search space: 35272673352
Effective search space used: 35272673352
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 71 (32.0 bits)