Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_56.223336.6ON62623166e-40
Kthe_YGOB_Anc_6.66.6ON62612654e-32
Sklu_YGOB_Anc_6.66.6ON61622255e-26
TDEL0G046506.6ON62622255e-26
Klac_YGOB_Anc_6.66.6ON61622091e-23
TBLA0A072006.6ON65622092e-23
Kpol_1045.826.6ON62622047e-23
ZYRO0F00418g6.6ON62601987e-22
Skud_16.66.6ON62601933e-21
YPL271W (ATP15)6.6ON62601873e-20
Suva_16.346.6ON62561865e-20
CAGL0A01111g6.6ON69611813e-19
Smik_6.4796.6ON62601804e-19
TPHA0J002306.6ON62621762e-18
KNAG0E027906.6ON65631673e-17
NDAI0I027406.6ON66591674e-17
KAFR0B064906.6ON66611641e-16
ACR021W6.6ON62621527e-15
Ecym_30086.6ON61621465e-14
NCAS0D022006.6ON85581486e-14
Ecym_47615.435ON79842556.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_56.22333
         (62 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_56.22333 s56 complement(53024..53212) [189 bp, 62 aa] {ON} ...   126   6e-40
Kthe_YGOB_Anc_6.6 Chr3 (955501..955689) [189 bp, 62 aa] {ON} ANN...   106   4e-32
Sklu_YGOB_Anc_6.6 Chr5 complement(53390..53575) [186 bp, 61 aa] ...    91   5e-26
TDEL0G04650 Chr7 (850149..850337) [189 bp, 62 aa] {ON} Anc_6.6 Y...    91   5e-26
Klac_YGOB_Anc_6.6 Chr4 complement(72752..72937) [186 bp, 61 aa] ...    85   1e-23
TBLA0A07200 Chr1 complement(1795871..1796068) [198 bp, 65 aa] {O...    85   2e-23
Kpol_1045.82 s1045 (192421..192609) [189 bp, 62 aa] {ON} (192423...    83   7e-23
ZYRO0F00418g Chr6 complement(41813..42001) [189 bp, 62 aa] {ON} ...    81   7e-22
Skud_16.6 Chr16 (9212..9397) [186 bp, 62 aa] {ON} YPL271W (REAL)       79   3e-21
YPL271W Chr16 (30079..30267) [189 bp, 62 aa] {ON}  ATP15Epsilon ...    77   3e-20
Suva_16.34 Chr16 (45660..45845) [186 bp, 62 aa] {ON} YPL271W (REAL)    76   5e-20
CAGL0A01111g Chr1 (111480..111689) [210 bp, 69 aa] {ON} highly s...    74   3e-19
Smik_6.479 Chr6 complement(790945..791130) [186 bp, 62 aa] {ON} ...    74   4e-19
TPHA0J00230 Chr10 complement(54347..54535) [189 bp, 62 aa] {ON} ...    72   2e-18
KNAG0E02790 Chr5 (561923..562120) [198 bp, 65 aa] {ON} Anc_6.6 Y...    69   3e-17
NDAI0I02740 Chr9 complement(643557..643757) [201 bp, 66 aa] {ON}...    69   4e-17
KAFR0B06490 Chr2 complement(1346858..1347058) [201 bp, 66 aa] {O...    68   1e-16
ACR021W Chr3 (394894..395082) [189 bp, 62 aa] {ON} Syntenic homo...    63   7e-15
Ecym_3008 Chr3 complement(17404..17589) [186 bp, 61 aa] {ON} sim...    61   5e-14
NCAS0D02200 Chr4 (410202..410459) [258 bp, 85 aa] {ON} Anc_6.6 Y...    62   6e-14
Ecym_4761 Chr4 (1479649..1482045) [2397 bp, 798 aa] {ON} similar...    26   6.8  

>Kwal_56.22333 s56 complement(53024..53212) [189 bp, 62 aa] {ON}
          YPL271W (ATP15) - nuclear gene for ATP synthase epsilon
          subunit [contig 186] FULL
          Length = 62

 Score =  126 bits (316), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 62/62 (100%), Positives = 62/62 (100%)

Query: 1  MSAWRKAGLTYNNYMAIAAQTVRSALKKEAQTARVLDRSKTEARFVKYENGTATAESQPL 60
          MSAWRKAGLTYNNYMAIAAQTVRSALKKEAQTARVLDRSKTEARFVKYENGTATAESQPL
Sbjct: 1  MSAWRKAGLTYNNYMAIAAQTVRSALKKEAQTARVLDRSKTEARFVKYENGTATAESQPL 60

Query: 61 KE 62
          KE
Sbjct: 61 KE 62

>Kthe_YGOB_Anc_6.6 Chr3 (955501..955689) [189 bp, 62 aa] {ON}
          ANNOTATED BY YGOB -
          Length = 62

 Score =  106 bits (265), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 51/61 (83%), Positives = 55/61 (90%)

Query: 1  MSAWRKAGLTYNNYMAIAAQTVRSALKKEAQTARVLDRSKTEARFVKYENGTATAESQPL 60
          MSAWRKAGLTYNNYMAIAAQTVRSALK + QTA+VL RSKTEARF+KYE GT  AE+QPL
Sbjct: 1  MSAWRKAGLTYNNYMAIAAQTVRSALKNDLQTAQVLGRSKTEARFIKYEKGTPVAEAQPL 60

Query: 61 K 61
          K
Sbjct: 61 K 61

>Sklu_YGOB_Anc_6.6 Chr5 complement(53390..53575) [186 bp, 61 aa]
          {ON} ANNOTATED BY YGOB -
          Length = 61

 Score = 91.3 bits (225), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 55/62 (88%), Gaps = 1/62 (1%)

Query: 1  MSAWRKAGLTYNNYMAIAAQTVRSALKKEAQTARVLDRSKTEARFVKYENGTATAESQPL 60
          MSAWRKAGLTYNNY++IAA+TVR+ALK E QTA+VL RSK+EA+F+K+ENGT + +  PL
Sbjct: 1  MSAWRKAGLTYNNYLSIAAKTVRAALKTEFQTAQVLSRSKSEAKFIKFENGTPS-DPIPL 59

Query: 61 KE 62
          K+
Sbjct: 60 KK 61

>TDEL0G04650 Chr7 (850149..850337) [189 bp, 62 aa] {ON} Anc_6.6
          YPL271W
          Length = 62

 Score = 91.3 bits (225), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 42/62 (67%), Positives = 54/62 (87%)

Query: 1  MSAWRKAGLTYNNYMAIAAQTVRSALKKEAQTARVLDRSKTEARFVKYENGTATAESQPL 60
          M+AWRKAGLTYN Y+++AA+TVR+ALK E Q ARVL RSKT+AR+VKYE G+A ++S PL
Sbjct: 1  MAAWRKAGLTYNTYLSVAARTVRAALKPELQDARVLARSKTDARYVKYEKGSAASDSVPL 60

Query: 61 KE 62
          +E
Sbjct: 61 QE 62

>Klac_YGOB_Anc_6.6 Chr4 complement(72752..72937) [186 bp, 61 aa]
          {ON} ANNOTATED BY YGOB -
          Length = 61

 Score = 85.1 bits (209), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 40/62 (64%), Positives = 51/62 (82%), Gaps = 1/62 (1%)

Query: 1  MSAWRKAGLTYNNYMAIAAQTVRSALKKEAQTARVLDRSKTEARFVKYENGTATAESQPL 60
          MS WRKAGLT+NNY+++AA TVR+ALK E QT  VL RSK+EA+F+K+ENG A+ E  PL
Sbjct: 1  MSTWRKAGLTFNNYVSVAANTVRAALKPELQTNSVLARSKSEAKFIKFENGVAS-EPVPL 59

Query: 61 KE 62
          K+
Sbjct: 60 KK 61

>TBLA0A07200 Chr1 complement(1795871..1796068) [198 bp, 65 aa]
          {ON} Anc_6.6 YPL271W
          Length = 65

 Score = 85.1 bits (209), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 42/62 (67%), Positives = 49/62 (79%)

Query: 1  MSAWRKAGLTYNNYMAIAAQTVRSALKKEAQTARVLDRSKTEARFVKYENGTATAESQPL 60
          MSAWRKAG+TYN Y+AIAA+TVR+ALK E QTA V+DRS TEARF KY  G+  A+   L
Sbjct: 1  MSAWRKAGITYNAYIAIAAKTVRNALKPELQTAAVIDRSFTEARFTKYTKGSPDADPALL 60

Query: 61 KE 62
          KE
Sbjct: 61 KE 62

>Kpol_1045.82 s1045 (192421..192609) [189 bp, 62 aa] {ON}
          (192423..192611) [189 nt, 63 aa]
          Length = 62

 Score = 83.2 bits (204), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 39/62 (62%), Positives = 47/62 (75%)

Query: 1  MSAWRKAGLTYNNYMAIAAQTVRSALKKEAQTARVLDRSKTEARFVKYENGTATAESQPL 60
          MSAWRKAG+TYN Y+ IAAQTVR ALK E +T  VL RSKTEA+FV +ENG    E  P+
Sbjct: 1  MSAWRKAGITYNGYVNIAAQTVRKALKNELKTNTVLARSKTEAKFVSFENGAPKGEPVPI 60

Query: 61 KE 62
          ++
Sbjct: 61 QQ 62

>ZYRO0F00418g Chr6 complement(41813..42001) [189 bp, 62 aa] {ON}
          similar to uniprot|P21306 Saccharomyces cerevisiae
          YPL271W ATP15 Epsilon subunit of the F1 sector of
          mitochondrial F1F0 ATP synthase which is a large
          evolutionarily conserved enzyme complex required for
          ATP synthesis
          Length = 62

 Score = 80.9 bits (198), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 47/60 (78%)

Query: 1  MSAWRKAGLTYNNYMAIAAQTVRSALKKEAQTARVLDRSKTEARFVKYENGTATAESQPL 60
          MSAWRKAGLTYN Y+++AA+TVRSALK EAQTA VL R + ++++ K+E G    E +PL
Sbjct: 1  MSAWRKAGLTYNAYLSVAAKTVRSALKPEAQTAAVLSRDRVDSKYTKFEKGEPQGEPKPL 60

>Skud_16.6 Chr16 (9212..9397) [186 bp, 62 aa] {ON} YPL271W (REAL)
          Length = 62

 Score = 79.0 bits (193), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 47/60 (78%)

Query: 1  MSAWRKAGLTYNNYMAIAAQTVRSALKKEAQTARVLDRSKTEARFVKYENGTATAESQPL 60
          MSAWRKAG++Y  Y+ +AAQT+RS+LK E QTA VL RSKT+A + KY+NG A +E  P+
Sbjct: 1  MSAWRKAGISYAAYLNVAAQTIRSSLKTELQTASVLSRSKTDAFYTKYKNGAAASEPTPI 60

>YPL271W Chr16 (30079..30267) [189 bp, 62 aa] {ON}  ATP15Epsilon
          subunit of the F1 sector of mitochondrial F1F0 ATP
          synthase, which is a large, evolutionarily conserved
          enzyme complex required for ATP synthesis;
          phosphorylated
          Length = 62

 Score = 76.6 bits (187), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 34/60 (56%), Positives = 48/60 (80%)

Query: 1  MSAWRKAGLTYNNYMAIAAQTVRSALKKEAQTARVLDRSKTEARFVKYENGTATAESQPL 60
          MSAWRKAG++Y  Y+ +AAQ +RS+LK E QTA VL+RS+T+A + +Y+NGTA +E  P+
Sbjct: 1  MSAWRKAGISYAAYLNVAAQAIRSSLKTELQTASVLNRSQTDAFYTQYKNGTAASEPTPI 60

>Suva_16.34 Chr16 (45660..45845) [186 bp, 62 aa] {ON} YPL271W
          (REAL)
          Length = 62

 Score = 76.3 bits (186), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 35/56 (62%), Positives = 46/56 (82%)

Query: 1  MSAWRKAGLTYNNYMAIAAQTVRSALKKEAQTARVLDRSKTEARFVKYENGTATAE 56
          MSAWRKAG++Y  Y+ +AAQT+RS+LK E QTA VL RS+T+A + KY+NGTA +E
Sbjct: 1  MSAWRKAGVSYAAYLNVAAQTIRSSLKTELQTANVLSRSRTDAYYTKYKNGTAASE 56

>CAGL0A01111g Chr1 (111480..111689) [210 bp, 69 aa] {ON} highly
          similar to uniprot|P21306 Saccharomyces cerevisiae
          YPL271w ATP15
          Length = 69

 Score = 74.3 bits (181), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 48/61 (78%)

Query: 2  SAWRKAGLTYNNYMAIAAQTVRSALKKEAQTARVLDRSKTEARFVKYENGTATAESQPLK 61
          +AWRKAGL+Y++++AIAA+TVR +LKKE QT  V+ R KT+A + KYE G+  ++  PL+
Sbjct: 9  TAWRKAGLSYSSFLAIAARTVRESLKKELQTPAVMGRGKTDAAYTKYEKGSPKSDPIPLQ 68

Query: 62 E 62
          E
Sbjct: 69 E 69

>Smik_6.479 Chr6 complement(790945..791130) [186 bp, 62 aa] {ON}
          YPL271W (REAL)
          Length = 62

 Score = 73.9 bits (180), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 46/60 (76%)

Query: 1  MSAWRKAGLTYNNYMAIAAQTVRSALKKEAQTARVLDRSKTEARFVKYENGTATAESQPL 60
          MSAWRKAG++Y  Y+ +AA+ +RS+LK E QTA VL RSKT+A + +Y+NG A +E  P+
Sbjct: 1  MSAWRKAGISYAAYLNVAAKAIRSSLKTELQTASVLSRSKTDAFYTQYKNGAAASEPTPI 60

>TPHA0J00230 Chr10 complement(54347..54535) [189 bp, 62 aa] {ON}
          Anc_6.6 YPL271W
          Length = 62

 Score = 72.4 bits (176), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 32/62 (51%), Positives = 46/62 (74%)

Query: 1  MSAWRKAGLTYNNYMAIAAQTVRSALKKEAQTARVLDRSKTEARFVKYENGTATAESQPL 60
          MS WRKAGLTY+NY+A+AA+TVR +LK + +T  VL RSKT+ ++  +E GTA +E   +
Sbjct: 1  MSTWRKAGLTYSNYLAVAAKTVRQSLKNDLKTNSVLSRSKTDIKYTIFEKGTAKSEPTSI 60

Query: 61 KE 62
           +
Sbjct: 61 SD 62

>KNAG0E02790 Chr5 (561923..562120) [198 bp, 65 aa] {ON} Anc_6.6
          YPL271W
          Length = 65

 Score = 68.9 bits (167), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 34/63 (53%), Positives = 44/63 (69%), Gaps = 1/63 (1%)

Query: 1  MSA-WRKAGLTYNNYMAIAAQTVRSALKKEAQTARVLDRSKTEARFVKYENGTATAESQP 59
          MSA W+KAG+TY  Y+ + A+T+RSALK E QT  VL R  T+A +  YE GT  A+ QP
Sbjct: 1  MSAYWKKAGITYATYLNVTAKTLRSALKNELQTQNVLSRGTTDAAYTVYEKGTPKADPQP 60

Query: 60 LKE 62
          L+E
Sbjct: 61 LQE 63

>NDAI0I02740 Chr9 complement(643557..643757) [201 bp, 66 aa] {ON}
          Anc_6.6 YPL271W
          Length = 66

 Score = 68.9 bits (167), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 31/59 (52%), Positives = 46/59 (77%)

Query: 4  WRKAGLTYNNYMAIAAQTVRSALKKEAQTARVLDRSKTEARFVKYENGTATAESQPLKE 62
          WRKAG+TY+ Y++IAA+T+R+ALK E QTA V+ RS T+A F KY++G   +E + L++
Sbjct: 7  WRKAGITYSAYLSIAARTLRAALKPELQTATVMARSHTDAYFTKYKDGAPASEPESLQK 65

>KAFR0B06490 Chr2 complement(1346858..1347058) [201 bp, 66 aa]
          {ON} Anc_6.6 YPL271W
          Length = 66

 Score = 67.8 bits (164), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 31/61 (50%), Positives = 44/61 (72%)

Query: 2  SAWRKAGLTYNNYMAIAAQTVRSALKKEAQTARVLDRSKTEARFVKYENGTATAESQPLK 61
          S WRKAGLTY +Y++IA++T+R  LK E QTA V  RS TEA    Y+NG+  ++ +PL+
Sbjct: 3  SVWRKAGLTYASYLSIASKTLREVLKTEYQTAAVASRSVTEAHVTNYKNGSPLSDPEPLQ 62

Query: 62 E 62
          +
Sbjct: 63 K 63

>ACR021W Chr3 (394894..395082) [189 bp, 62 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YPL271W (ATP15)
          Length = 62

 Score = 63.2 bits (152), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 37/62 (59%), Positives = 51/62 (82%)

Query: 1  MSAWRKAGLTYNNYMAIAAQTVRSALKKEAQTARVLDRSKTEARFVKYENGTATAESQPL 60
          MSAWRKAGLTYN+Y+A+AA+TVR+ALKKE Q+  VL+RS TEA+ + Y +  + AE+ PL
Sbjct: 1  MSAWRKAGLTYNSYLAVAARTVRAALKKELQSPAVLNRSVTEAKVIDYASKGSAAEAVPL 60

Query: 61 KE 62
          ++
Sbjct: 61 RK 62

>Ecym_3008 Chr3 complement(17404..17589) [186 bp, 61 aa] {ON}
          similar to Ashbya gossypii ACR021W
          Length = 61

 Score = 60.8 bits (146), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 37/62 (59%), Positives = 49/62 (79%), Gaps = 1/62 (1%)

Query: 1  MSAWRKAGLTYNNYMAIAAQTVRSALKKEAQTARVLDRSKTEARFVKYENGTATAESQPL 60
          MSAWRKAGL+YN YMA+AA+ VRSALK E + A VL RS TEA+ + Y++G A+ ++ PL
Sbjct: 1  MSAWRKAGLSYNTYMAVAARAVRSALKPELKNAAVLSRSNTEAKVINYKDGAAS-DAVPL 59

Query: 61 KE 62
          K+
Sbjct: 60 KK 61

>NCAS0D02200 Chr4 (410202..410459) [258 bp, 85 aa] {ON} Anc_6.6
          YPL271W
          Length = 85

 Score = 61.6 bits (148), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 27/58 (46%), Positives = 41/58 (70%)

Query: 4  WRKAGLTYNNYMAIAAQTVRSALKKEAQTARVLDRSKTEARFVKYENGTATAESQPLK 61
           RKAG+TY  Y+ +A++T+R++LK E QT  V+ RS T+A + KYE G+  A+  PL+
Sbjct: 24 LRKAGVTYAQYLCVASRTLRASLKTELQTPVVMARSNTDAYYTKYEKGSPIADPAPLQ 81

>Ecym_4761 Chr4 (1479649..1482045) [2397 bp, 798 aa] {ON} similar to
           Ashbya gossypii AER402C
          Length = 798

 Score = 25.8 bits (55), Expect = 6.8,   Method: Composition-based stats.
 Identities = 15/42 (35%), Positives = 26/42 (61%), Gaps = 1/42 (2%)

Query: 8   GLTYNNYMAIAA-QTVRSALKKEAQTARVLDRSKTEARFVKY 48
            +TY+N  A +A +T  S +  +A+T+R++ R K  A  +KY
Sbjct: 734 AVTYHNLSATSATRTEGSDVSIQARTSRIVTRPKNNATVLKY 775

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.310    0.118    0.316 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 5,157,766
Number of extensions: 114592
Number of successful extensions: 241
Number of sequences better than 10.0: 21
Number of HSP's gapped: 241
Number of HSP's successfully gapped: 21
Length of query: 62
Length of database: 53,481,399
Length adjustment: 35
Effective length of query: 27
Effective length of database: 49,468,089
Effective search space: 1335638403
Effective search space used: 1335638403
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 59 (27.3 bits)