Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_56.223296.5ON77677640280.0
KLTH0C11616g6.5ON74075528080.0
SAKL0E00748g6.5ON77465225130.0
KLLA0D00748g6.5ON78970823500.0
Ecym_30076.5ON76970523350.0
ACR022W6.5ON75469522710.0
TDEL0G046606.5ON73963522050.0
Kpol_1045.836.5ON74864121530.0
ZYRO0F00396g6.5ON73262821480.0
TPHA0J002206.5ON74068321450.0
YPL270W (MDL2)6.5ON77366821340.0
Suva_16.356.5ON76766021220.0
TBLA0A071906.5ON79464921210.0
CAGL0A01133g6.5ON80164321220.0
Skud_16.76.5ON77361821120.0
Smik_6.4786.5ON77362921030.0
NCAS0D022106.5ON77369220940.0
NDAI0I027306.5ON83261720900.0
KNAG0E028006.5ON74168019220.0
KAFR0B064806.5ON75163017750.0
TPHA0B046201.67ON72064615120.0
Ecym_10721.67ON68360114310.0
ZYRO0F17050g1.67ON71468414280.0
NCAS0B087001.67ON71564214270.0
TDEL0C063501.67ON69367114240.0
KLLA0C01991g1.67ON70662914130.0
Kpol_2000.791.67ON70761014120.0
NDAI0A005601.67ON71463614100.0
SAKL0C02244g1.67ON71267114070.0
YLR188W (MDL1)1.67ON69563313880.0
Skud_12.2531.67ON69260513860.0
Suva_10.2841.67ON69361013850.0
Smik_12.2481.67ON69662513681e-179
AFR683C1.67ON67765113561e-177
KLTH0F02024g1.67ON73466513581e-177
Kwal_33.133081.67ON70665313541e-177
CAGL0E00385g1.67ON60859313071e-171
TBLA0A053001.67ON70760512641e-163
TBLA0B100701.527ON12965655171e-53
YKL209C (STE6)1.527ON12905345124e-53
SAKL0H00968g5.20ON7006534954e-52
SAKL0A10208g1.527ON13105665001e-51
Skud_13.4755.20ON6915914857e-51
Smik_13.5185.20ON6875924857e-51
Suva_13.4915.20ON6936024858e-51
Kwal_26.94805.20ON7193824851e-50
KNAG0E013205.20ON6953824831e-50
AGL335W5.20ON6914154821e-50
NCAS0D024305.20ON7023944832e-50
KNAG0G001901.527ON12755294893e-50
Skud_11.111.527ON12955224884e-50
ZYRO0G02244g1.527ON12735224841e-49
KLLA0A10131g5.20ON7205864752e-49
YMR301C (ATM1)5.20ON6903964732e-49
KLTH0B09482g5.20ON6943264723e-49
KAFR0E002301.527ON12705634813e-49
TDEL0F003401.527ON12575214813e-49
Suva_11.111.527ON12905404771e-48
KAFR0I025805.20ON7094184663e-48
TBLA0C070005.20ON7253834602e-47
TDEL0G004305.20ON6964254557e-47
Kpol_1018.1851.527ON12765214601e-46
Kpol_513.235.20ON7083394522e-46
CAGL0M13739g5.20ON7275824513e-46
NDAI0D015401.527ON12934424556e-46
NDAI0I024405.20ON7303974471e-45
KLLA0B14256g1.527ON12715354512e-45
TPHA0L022705.20ON7114094424e-45
Ecym_56495.20ON6963494405e-45
TPHA0O001601.527ON12535194432e-44
ZYRO0D07106g5.20ON7093934362e-44
Kwal_33.155611.527ON12975264413e-44
KLTH0B01100g1.527ON12985194396e-44
Ecym_36121.527ON13155314396e-44
NCAS0G035101.527ON12885324333e-43
CAGL0K00363g1.527ON12275314272e-42
TDEL0E056104.52ON15355614272e-42
SAKL0H26026g4.6ON16536814263e-42
AFR432W1.527ON12845114245e-42
ZYRO0G07612g4.6ON16956874229e-42
Ecym_42658.303ON15055374211e-41
NCAS0J00160singletonON16545524173e-41
Smik_11.141.527ON13165364139e-41
KNAG0E011204.6ON17175664085e-40
NCAS0C059304.6ON16575634068e-40
Suva_10.234.6ON16616704041e-39
CAGL0C03289g4.6ON16485694004e-39
NDAI0B006405.10ON14915523942e-38
Ecym_84184.6ON16785533933e-38
Kwal_34.157704.6ON14367073933e-38
KLTH0H16038g4.6ON16497043924e-38
Skud_12.224.6ON16616823881e-37
KNAG0J027304.52ON15375483881e-37
YLL048C (YBT1)4.6ON16616833881e-37
Smik_12.114.6ON16617353881e-37
Suva_8.164.6ON15996983872e-37
CAGL0E03982g4.6ON16595643872e-37
CAGL0E03355g4.52ON15355583844e-37
TDEL0G018504.6ON16426913835e-37
Kpol_311.34.6ON16575203782e-36
Smik_8.64.6ON15855713754e-36
YHL035C (VMR1)4.6ON15925283755e-36
KLLA0E00529g4.6ON16506923746e-36
NCAS0E041605.10ON15065483711e-35
TPHA0C009608.303ON15235583702e-35
Suva_10.60singletonON9905593631e-34
Smik_12.484.52ON15575533641e-34
Suva_10.594.52ON15615593641e-34
NDAI0H001904.6ON16825363641e-34
Skud_7.6145.10ON14776603631e-34
KLTH0C09240gna 1ON15465473622e-34
Skud_12.524.52ON15615563613e-34
Suva_7.5775.10ON14785453577e-34
TPHA0F001804.6ON16465073578e-34
NDAI0J011508.303ON15175243551e-33
TPHA0K023104.6ON16496243552e-33
TBLA0G007104.6ON16915503532e-33
ZYRO0G22176g4.52ON15705723489e-33
Smik_16.275.10ON14776583471e-32
Skud_8.94.6ON15875563425e-32
KAFR0I013004.52ON15365533425e-32
YGR281W (YOR1)5.10ON14775523417e-32
Kwal_56.22747na 1ON15385493409e-32
YDR135C (YCF1)8.303ON15155753409e-32
ZYRO0D06160g8.303ON15256463391e-31
Suva_2.2978.303ON15165783391e-31
Kpol_1060.75.10ON14605423372e-31
KAFR0C065105.10ON14572673363e-31
NCAS0B034708.303ON15124953363e-31
CAGL0G00242g5.10ON14775563363e-31
KNAG0K001705.10ON14425473345e-31
KAFR0L001904.6ON16535193345e-31
ACL072C4.6ON16275223329e-31
KAFR0B056308.303ON15155873319e-31
Skud_4.3958.303ON15165793301e-30
Smik_4.3808.303ON15165733301e-30
KLLA0D04059g4.52ON15685503292e-30
YLL015W (BPT1)4.52ON15595553282e-30
KLLA0C14234g5.10ON14545463273e-30
SAKL0H16016g8.303ON14995433273e-30
SAKL0H00704g5.10ON14395713231e-29
KNAG0I009908.303ON15356213221e-29
SAKL0H23958g4.52ON15585613212e-29
Smik_11.367na 2ON15955593212e-29
Skud_18.2singletonON15805563202e-29
TPHA0F004104.52ON15705673175e-29
Kwal_56.238448.303ON14945573175e-29
KLTH0G12716g8.303ON15004983166e-29
Kpol_1033.288.303ON15315583166e-29
Kpol_YGOB_1041.454.52ON15685583158e-29
Kpol_1041.45singletonOFF15965583159e-29
KLLA0F20075g8.303ON15165803141e-28
TPHA0A056205.10ON14775793131e-28
KLTH0B00396gsingletonON15075473131e-28
TDEL0F043008.303ON15145413122e-28
YKR104WsingletonON3062962942e-28
AGR047W8.303ON14925133095e-28
Kwal_26.95325.10ON14715273014e-27
TBLA0A06840singletonON10585602996e-27
CAGL0L06402g8.303ON15355572989e-27
TDEL0G003305.10ON14652502962e-26
TBLA0C06400singletonON13775332943e-26
TBLA0C071005.10ON14855462934e-26
Zrou_YGOB_Anc_5.105.10ON9925262844e-25
KLTH0B09724g5.10ON14865552801e-24
AGL346W5.10ON14002432773e-24
TBLA0A038008.303ON15464642622e-22
Ecym_56605.10ON15362572112e-16
YKR103W (NFT1)na 2ON12181861942e-14
Kpol_175.1singletonON13772521924e-14
Kwal_26.87308.661ON8312921817e-13
SAKL0F01606g3.534ON6081871772e-12
ZYRO0E04092g1.427ON10622921763e-12
YER036C (ARB1)3.534ON6102421744e-12
AFR232C3.534ON6072421735e-12
Smik_5.1593.534ON6101881726e-12
Skud_5.1453.534ON6101881718e-12
Ecym_11943.534ON6091871718e-12
TPHA0A058903.534ON6102401718e-12
Suva_5.1343.534ON6101881718e-12
SAKL0D10208g1.366ON7522471711e-11
YOL075C3.133ON12942381711e-11
TPHA0A008403.133ON13123041701e-11
SAKL0H21010gsingletonON14472401674e-11
TBLA0I033303.534ON6101871654e-11
TPHA0D011708.661ON9152161656e-11
CAGL0K10472g1.366ON7522111647e-11
NCAS0A085701.427ON10602571648e-11
CAGL0C02343g3.534ON7201901638e-11
ZYRO0G01144g1.366ON7522761639e-11
ZYRO0E08800g3.534ON6102431621e-10
TDEL0D060203.534ON6101871611e-10
Kwal_47.191163.534ON6072411611e-10
KLTH0D10890g8.661ON8302011612e-10
KNAG0K009503.133ON12842711612e-10
Suva_2.5835.500ON15372401612e-10
NCAS0E004803.534ON6101871592e-10
Smik_15.843.133ON12952241602e-10
TBLA0D043501.427ON11192381602e-10
Suva_15.913.133ON13022361593e-10
NCAS0A120605.500ON15432341593e-10
TDEL0B057601.427ON10362571584e-10
KLLA0A01452g3.534ON6072241574e-10
Skud_4.6805.500ON14452321584e-10
Skud_4.681na 3ON14452321584e-10
KAFR0A037908.661ON8762161575e-10
KLLA0A10857g1.366ON7522291566e-10
KNAG0C019601.366ON7522331566e-10
KAFR0C052205.500ON14992341576e-10
YDR406W (PDR15)5.500ON15292361577e-10
NDAI0C012205.500ON15092101568e-10
KAFR0C045401.366ON7522501559e-10
Smik_7.3131.366ON7522321541e-09
Smik_4.6785.500ON15332321551e-09
KNAG0B038705.500ON15132281551e-09
Kwal_0.3271.427ON10192471541e-09
ZYRO0D11880g5.500ON14982251541e-09
YFR009W (GCN20)1.366ON7522321531e-09
KAFR0C05210na 3ON14932281541e-09
KLTH0H13442g1.366ON7522291531e-09
TPHA0D04700singletonON15102331541e-09
ZYRO0B05588g3.133ON12702221541e-09
AEL032W1.366ON7532401531e-09
KNAG0G010407.123aON14012831541e-09
NDAI0I030203.534ON6092421522e-09
Kpol_1050.263.534ON6101871522e-09
KLTH0G01452g3.534ON6072321522e-09
CAGL0I04862g3.220ON15072421532e-09
Kpol_1049.234.6ON110941372e-09
TPHA0A023101.366ON7522111522e-09
ZYRO0B14762gsingletonON15152331522e-09
Kpol_1053.483.133ON12882271522e-09
KNAG0I005301.427ON10472491522e-09
TBLA0D01820singletonON15512101513e-09
CAGL0M01760gsingletonON14992371513e-09
SAKL0D09394g1.427ON10272671503e-09
Suva_6.841.366ON7522101503e-09
NDAI0G050201.427ON10972751503e-09
Kpol_1043.431.366ON7522361503e-09
ACR128C8.661ON8271891503e-09
CAGL0F02717g5.500ON15422191504e-09
Kpol_1050.161.427ON10472531504e-09
TBLA0D017805.500ON15952101504e-09
YOR328W (PDR10)na 4ON15642311504e-09
Kwal_34.162401.366ON7522291485e-09
Skud_6.951.366ON7522321485e-09
TPHA0A042203.220ON14842331495e-09
NDAI0A042005.500ON15512331495e-09
NDAI0B028703.133ON12672361486e-09
Smik_15.3335.500ON15102211487e-09
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_56.22329
         (776 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_56.22329 s56 complement(50448..52778) [2331 bp, 776 aa] {ON...  1556   0.0  
KLTH0C11616g Chr3 (956011..958233) [2223 bp, 740 aa] {ON} simila...  1086   0.0  
SAKL0E00748g Chr5 complement(50683..53007) [2325 bp, 774 aa] {ON...   972   0.0  
KLLA0D00748g Chr4 complement(69839..72208) [2370 bp, 789 aa] {ON...   909   0.0  
Ecym_3007 Chr3 complement(14335..16644) [2310 bp, 769 aa] {ON} s...   904   0.0  
ACR022W Chr3 (395427..397691) [2265 bp, 754 aa] {ON} Syntenic ho...   879   0.0  
TDEL0G04660 Chr7 (850475..852694) [2220 bp, 739 aa] {ON} Anc_6.5...   853   0.0  
Kpol_1045.83 s1045 (193070..195316) [2247 bp, 748 aa] {ON} (1930...   833   0.0  
ZYRO0F00396g Chr6 complement(39330..41528) [2199 bp, 732 aa] {ON...   832   0.0  
TPHA0J00220 Chr10 complement(51873..54095) [2223 bp, 740 aa] {ON...   830   0.0  
YPL270W Chr16 (30482..32803) [2322 bp, 773 aa] {ON}  MDL2Mitocho...   826   0.0  
Suva_16.35 Chr16 (46072..48375) [2304 bp, 767 aa] {ON} YPL270W (...   822   0.0  
TBLA0A07190 Chr1 complement(1792994..1795378) [2385 bp, 794 aa] ...   821   0.0  
CAGL0A01133g Chr1 (112037..114442) [2406 bp, 801 aa] {ON} simila...   822   0.0  
Skud_16.7 Chr16 (9624..11945) [2322 bp, 773 aa] {ON} YPL270W (REAL)   818   0.0  
Smik_6.478 Chr6 complement(788399..790720) [2322 bp, 773 aa] {ON...   814   0.0  
NCAS0D02210 Chr4 (410709..413030) [2322 bp, 773 aa] {ON} Anc_6.5      811   0.0  
NDAI0I02730 Chr9 complement(640429..642927) [2499 bp, 832 aa] {O...   809   0.0  
KNAG0E02800 Chr5 (562361..564586) [2226 bp, 741 aa] {ON} Anc_6.5...   744   0.0  
KAFR0B06480 Chr2 complement(1344413..1346668) [2256 bp, 751 aa] ...   688   0.0  
TPHA0B04620 Chr2 complement(1085725..1087887) [2163 bp, 720 aa] ...   587   0.0  
Ecym_1072 Chr1 (137296..139347) [2052 bp, 683 aa] {ON} similar t...   555   0.0  
ZYRO0F17050g Chr6 complement(1417445..1419589) [2145 bp, 714 aa]...   554   0.0  
NCAS0B08700 Chr2 (1674262..1676409) [2148 bp, 715 aa] {ON} Anc_1...   554   0.0  
TDEL0C06350 Chr3 complement(1159576..1161657) [2082 bp, 693 aa] ...   553   0.0  
KLLA0C01991g Chr3 (160778..162898) [2121 bp, 706 aa] {ON} simila...   548   0.0  
Kpol_2000.79 s2000 complement(175048..177171) [2124 bp, 707 aa] ...   548   0.0  
NDAI0A00560 Chr1 complement(100930..103074) [2145 bp, 714 aa] {O...   547   0.0  
SAKL0C02244g Chr3 (201281..203419) [2139 bp, 712 aa] {ON} simila...   546   0.0  
YLR188W Chr12 (528300..530387) [2088 bp, 695 aa] {ON}  MDL1Mitoc...   539   0.0  
Skud_12.253 Chr12 (474886..476964) [2079 bp, 692 aa] {ON} YLR188...   538   0.0  
Suva_10.284 Chr10 (500972..503053) [2082 bp, 693 aa] {ON} YLR188...   538   0.0  
Smik_12.248 Chr12 (475233..477323) [2091 bp, 696 aa] {ON} YLR188...   531   e-179
AFR683C Chr6 complement(1697786..1699819) [2034 bp, 677 aa] {ON}...   526   e-177
KLTH0F02024g Chr6 (161423..163627) [2205 bp, 734 aa] {ON} simila...   527   e-177
Kwal_33.13308 s33 (166479..168599) [2121 bp, 706 aa] {ON} YLR188...   526   e-177
CAGL0E00385g Chr5 (31960..33786) [1827 bp, 608 aa] {ON} similar ...   508   e-171
TBLA0A05300 Chr1 (1297764..1299887) [2124 bp, 707 aa] {ON} Anc_1...   491   e-163
TBLA0B10070 Chr2 (2422767..2426657) [3891 bp, 1296 aa] {ON} Anc_...   203   1e-53
YKL209C Chr11 complement(42423..46295) [3873 bp, 1290 aa] {ON}  ...   201   4e-53
SAKL0H00968g Chr8 (107767..109869) [2103 bp, 700 aa] {ON} highly...   195   4e-52
SAKL0A10208g Chr1 (894334..898266) [3933 bp, 1310 aa] {ON} simil...   197   1e-51
Skud_13.475 Chr13 complement(841033..843108) [2076 bp, 691 aa] {...   191   7e-51
Smik_13.518 Chr13 complement(850174..852237) [2064 bp, 687 aa] {...   191   7e-51
Suva_13.491 Chr13 complement(849300..851381) [2082 bp, 693 aa] {...   191   8e-51
Kwal_26.9480 s26 complement(1236178..1238337) [2160 bp, 719 aa] ...   191   1e-50
KNAG0E01320 Chr5 (261901..263988) [2088 bp, 695 aa] {ON} Anc_5.2...   190   1e-50
AGL335W Chr7 (82640..84715) [2076 bp, 691 aa] {ON} Syntenic homo...   190   1e-50
NCAS0D02430 Chr4 (462683..464791) [2109 bp, 702 aa] {ON} Anc_5.20     190   2e-50
KNAG0G00190 Chr7 complement(20457..24284) [3828 bp, 1275 aa] {ON...   192   3e-50
Skud_11.11 Chr11 complement(25896..29783) [3888 bp, 1295 aa] {ON...   192   4e-50
ZYRO0G02244g Chr7 (169369..173190) [3822 bp, 1273 aa] {ON} simil...   191   1e-49
KLLA0A10131g Chr1 complement(889688..891850) [2163 bp, 720 aa] {...   187   2e-49
YMR301C Chr13 complement(867555..869627) [2073 bp, 690 aa] {ON} ...   186   2e-49
KLTH0B09482g Chr2 complement(777282..779366) [2085 bp, 694 aa] {...   186   3e-49
KAFR0E00230 Chr5 complement(47473..51285) [3813 bp, 1270 aa] {ON...   189   3e-49
TDEL0F00340 Chr6 complement(53876..57649) [3774 bp, 1257 aa] {ON...   189   3e-49
Suva_11.11 Chr11 complement(26032..29904) [3873 bp, 1290 aa] {ON...   188   1e-48
KAFR0I02580 Chr9 complement(520294..522423) [2130 bp, 709 aa] {O...   184   3e-48
TBLA0C07000 Chr3 complement(1688965..1691142) [2178 bp, 725 aa] ...   181   2e-47
TDEL0G00430 Chr7 (89431..91521) [2091 bp, 696 aa] {ON} Anc_5.20 ...   179   7e-47
Kpol_1018.185 s1018 (464370..468200) [3831 bp, 1276 aa] {ON} (46...   181   1e-46
Kpol_513.23 s513 complement(65118..67244) [2127 bp, 708 aa] {ON}...   178   2e-46
CAGL0M13739g Chr13 complement(1347781..1349964) [2184 bp, 727 aa...   178   3e-46
NDAI0D01540 Chr4 (369687..373568) [3882 bp, 1293 aa] {ON} Anc_1....   179   6e-46
NDAI0I02440 Chr9 complement(556154..558346) [2193 bp, 730 aa] {O...   176   1e-45
KLLA0B14256g Chr2 (1248654..1252469) [3816 bp, 1271 aa] {ON} sim...   178   2e-45
TPHA0L02270 Chr12 complement(473597..475732) [2136 bp, 711 aa] {...   174   4e-45
Ecym_5649 Chr5 complement(1310682..1312772) [2091 bp, 696 aa] {O...   174   5e-45
TPHA0O00160 Chr15 complement(16002..19763) [3762 bp, 1253 aa] {O...   175   2e-44
ZYRO0D07106g Chr4 (616125..618254) [2130 bp, 709 aa] {ON} simila...   172   2e-44
Kwal_33.15561 s33 (1157299..1161192) [3894 bp, 1297 aa] {ON} YKL...   174   3e-44
KLTH0B01100g Chr2 complement(94260..98156) [3897 bp, 1298 aa] {O...   173   6e-44
Ecym_3612 Chr3 (1167419..1171366) [3948 bp, 1315 aa] {ON} simila...   173   6e-44
NCAS0G03510 Chr7 (652949..656815) [3867 bp, 1288 aa] {ON} Anc_1....   171   3e-43
CAGL0K00363g Chr11 complement(38281..41964) [3684 bp, 1227 aa] {...   169   2e-42
TDEL0E05610 Chr5 (1038912..1043519) [4608 bp, 1535 aa] {ON} Anc_...   169   2e-42
SAKL0H26026g Chr8 (2287664..2292625) [4962 bp, 1653 aa] {ON} sim...   168   3e-42
AFR432W Chr6 (1213211..1217065) [3855 bp, 1284 aa] {ON} Syntenic...   167   5e-42
ZYRO0G07612g Chr7 complement(601181..606268) [5088 bp, 1695 aa] ...   167   9e-42
Ecym_4265 Chr4 (560254..564771) [4518 bp, 1505 aa] {ON} similar ...   166   1e-41
NCAS0J00160 Chr10 complement(12361..17325) [4965 bp, 1654 aa] {O...   165   3e-41
Smik_11.14 Chr11 complement(26603..30553) [3951 bp, 1316 aa] {ON...   163   9e-41
KNAG0E01120 Chr5 (214592..219745) [5154 bp, 1717 aa] {ON} Anc_4....   161   5e-40
NCAS0C05930 Chr3 (1220180..1225153) [4974 bp, 1657 aa] {ON} Anc_...   160   8e-40
Suva_10.23 Chr10 complement(44719..49704) [4986 bp, 1661 aa] {ON...   160   1e-39
CAGL0C03289g Chr3 (328799..333745) [4947 bp, 1648 aa] {ON} simil...   158   4e-39
NDAI0B00640 Chr2 (141258..145733) [4476 bp, 1491 aa] {ON} Anc_5.10    156   2e-38
Ecym_8418 Chr8 (874901..879937) [5037 bp, 1678 aa] {ON} similar ...   155   3e-38
Kwal_34.15770 s34 complement(51755..56065) [4311 bp, 1436 aa] {O...   155   3e-38
KLTH0H16038g Chr8 (1376941..1381890) [4950 bp, 1649 aa] {ON} sim...   155   4e-38
Skud_12.22 Chr12 complement(31933..36918) [4986 bp, 1661 aa] {ON...   154   1e-37
KNAG0J02730 Chr10 complement(512373..516986) [4614 bp, 1537 aa] ...   154   1e-37
YLL048C Chr12 complement(41280..46265) [4986 bp, 1661 aa] {ON}  ...   154   1e-37
Smik_12.11 Chr12 complement(26055..31040) [4986 bp, 1661 aa] {ON...   154   1e-37
Suva_8.16 Chr8 complement(29573..34372) [4800 bp, 1599 aa] {ON} ...   153   2e-37
CAGL0E03982g Chr5 (378442..383421) [4980 bp, 1659 aa] {ON} simil...   153   2e-37
CAGL0E03355g Chr5 complement(307479..312086) [4608 bp, 1535 aa] ...   152   4e-37
TDEL0G01850 Chr7 (369839..374767) [4929 bp, 1642 aa] {ON} Anc_4....   152   5e-37
Kpol_311.3 s311 (5480..10453) [4974 bp, 1657 aa] {ON} (5480..104...   150   2e-36
Smik_8.6 Chr8 complement(11717..16474) [4758 bp, 1585 aa] {ON} Y...   149   4e-36
YHL035C Chr8 complement(27978..32756) [4779 bp, 1592 aa] {ON}  V...   149   5e-36
KLLA0E00529g Chr5 complement(39173..44125) [4953 bp, 1650 aa] {O...   148   6e-36
NCAS0E04160 Chr5 (818254..822774) [4521 bp, 1506 aa] {ON} Anc_5.10    147   1e-35
TPHA0C00960 Chr3 (204061..208632) [4572 bp, 1523 aa] {ON} Anc_8....   147   2e-35
Suva_10.60 Chr10 (123173..126145) [2973 bp, 990 aa] {ON} YLL015W...   144   1e-34
Smik_12.48 Chr12 (103624..108297) [4674 bp, 1557 aa] {ON} YLL015...   144   1e-34
Suva_10.59 Chr10 (121460..126142) [4683 bp, 1561 aa] {ON} YLL015...   144   1e-34
NDAI0H00190 Chr8 complement(20586..25634) [5049 bp, 1682 aa] {ON...   144   1e-34
Skud_7.614 Chr7 (1027230..1031663) [4434 bp, 1477 aa] {ON} YGR28...   144   1e-34
KLTH0C09240g Chr3 complement(766620..771260) [4641 bp, 1546 aa] ...   144   2e-34
Skud_12.52 Chr12 (107860..112545) [4686 bp, 1561 aa] {ON} YLL015...   143   3e-34
Suva_7.577 Chr7 (1007741..1012177) [4437 bp, 1478 aa] {ON} YGR28...   142   7e-34
TPHA0F00180 Chr6 complement(23050..27990) [4941 bp, 1646 aa] {ON...   142   8e-34
NDAI0J01150 Chr10 complement(262920..267473) [4554 bp, 1517 aa] ...   141   1e-33
TPHA0K02310 Chr11 (497267..502216) [4950 bp, 1649 aa] {ON} Anc_4...   141   2e-33
TBLA0G00710 Chr7 (157927..163002) [5076 bp, 1691 aa] {ON} Anc_4....   140   2e-33
ZYRO0G22176g Chr7 (1822665..1827377) [4713 bp, 1570 aa] {ON} sim...   138   9e-33
Smik_16.27 Chr16 complement(40287..44720) [4434 bp, 1477 aa] {ON...   138   1e-32
Skud_8.9 Chr8 complement(16026..20789) [4764 bp, 1587 aa] {ON} Y...   136   5e-32
KAFR0I01300 Chr9 complement(262852..267462) [4611 bp, 1536 aa] {...   136   5e-32
YGR281W Chr7 (1052824..1057257) [4434 bp, 1477 aa] {ON}  YOR1Pla...   135   7e-32
Kwal_56.22747 s56 (262824..267440) [4617 bp, 1538 aa] {ON} YLL01...   135   9e-32
YDR135C Chr4 complement(723004..727551) [4548 bp, 1515 aa] {ON} ...   135   9e-32
ZYRO0D06160g Chr4 (524435..529012) [4578 bp, 1525 aa] {ON} highl...   135   1e-31
Suva_2.297 Chr2 complement(518369..522919) [4551 bp, 1516 aa] {O...   135   1e-31
Kpol_1060.7 s1060 complement(13248..17630) [4383 bp, 1460 aa] {O...   134   2e-31
KAFR0C06510 Chr3 (1306097..1310470) [4374 bp, 1457 aa] {ON} Anc_...   134   3e-31
NCAS0B03470 Chr2 complement(606008..610546) [4539 bp, 1512 aa] {...   134   3e-31
CAGL0G00242g Chr7 complement(20428..24861) [4434 bp, 1477 aa] {O...   134   3e-31
KNAG0K00170 Chr11 complement(15700..20028) [4329 bp, 1442 aa] {O...   133   5e-31
KAFR0L00190 Chr12 complement(21836..26797) [4962 bp, 1653 aa] {O...   133   5e-31
ACL072C Chr3 complement(224562..229445) [4884 bp, 1627 aa] {ON} ...   132   9e-31
KAFR0B05630 Chr2 complement(1156621..1161168) [4548 bp, 1515 aa]...   132   9e-31
Skud_4.395 Chr4 complement(694806..699356) [4551 bp, 1516 aa] {O...   131   1e-30
Smik_4.380 Chr4 complement(684148..688698) [4551 bp, 1516 aa] {O...   131   1e-30
KLLA0D04059g Chr4 complement(338422..343128) [4707 bp, 1568 aa] ...   131   2e-30
YLL015W Chr12 (116432..121111) [4680 bp, 1559 aa] {ON}  BPT1ABC ...   130   2e-30
KLLA0C14234g Chr3 (1234598..1238962) [4365 bp, 1454 aa] {ON} sim...   130   3e-30
SAKL0H16016g Chr8 (1396707..1401206) [4500 bp, 1499 aa] {ON} sim...   130   3e-30
SAKL0H00704g Chr8 (85322..89641) [4320 bp, 1439 aa] {ON} similar...   129   1e-29
KNAG0I00990 Chr9 (188695..193302) [4608 bp, 1535 aa] {ON} Anc_8....   128   1e-29
SAKL0H23958g Chr8 complement(2062067..2066743) [4677 bp, 1558 aa...   128   2e-29
Smik_11.367 Chr11 (644116..648903) [4788 bp, 1595 aa] {ON} YKR10...   128   2e-29
Skud_18.2 Chr18 (5442..10184) [4743 bp, 1580 aa] {ON} YHL035C (R...   127   2e-29
TPHA0F00410 Chr6 (98503..103215) [4713 bp, 1570 aa] {ON} Anc_4.5...   126   5e-29
Kwal_56.23844 s56 complement(733654..738138) [4485 bp, 1494 aa] ...   126   5e-29
KLTH0G12716g Chr7 (1080818..1085320) [4503 bp, 1500 aa] {ON} hig...   126   6e-29
Kpol_1033.28 s1033 complement(69924..74519) [4596 bp, 1531 aa] {...   126   6e-29
Kpol_YGOB_1041.45 s1041 complement(118923..123629) [4707 bp, 156...   125   8e-29
Kpol_1041.45 s1041 complement(118923..123713) [4791 bp, 1596 aa]...   125   9e-29
KLLA0F20075g Chr6 complement(1868786..1873336) [4551 bp, 1516 aa...   125   1e-28
TPHA0A05620 Chr1 (1273220..1277653) [4434 bp, 1477 aa] {ON} Anc_...   125   1e-28
KLTH0B00396g Chr2 complement(38234..42757) [4524 bp, 1507 aa] {O...   125   1e-28
TDEL0F04300 Chr6 complement(802866..807410) [4545 bp, 1514 aa] {...   124   2e-28
YKR104W Chr11 (656836..657756) [921 bp, 306 aa] {ON} Putative tr...   117   2e-28
AGR047W Chr7 (802679..807157) [4479 bp, 1492 aa] {ON} Syntenic h...   123   5e-28
Kwal_26.9532 s26 complement(1256241..1260656) [4416 bp, 1471 aa]...   120   4e-27
TBLA0A06840 Chr1 (1666910..1670086) [3177 bp, 1058 aa] {ON} Anc_...   119   6e-27
CAGL0L06402g Chr12 (720723..725330) [4608 bp, 1535 aa] {ON} high...   119   9e-27
TDEL0G00330 Chr7 complement(58587..62984) [4398 bp, 1465 aa] {ON...   118   2e-26
TBLA0C06400 Chr3 complement(1545011..1549144) [4134 bp, 1377 aa]...   117   3e-26
TBLA0C07100 Chr3 (1721628..1726085) [4458 bp, 1485 aa] {ON}           117   4e-26
Zrou_YGOB_Anc_5.10 Chr3 complement(92067..95045) [2979 bp, 992 a...   114   4e-25
KLTH0B09724g Chr2 complement(796023..800483) [4461 bp, 1486 aa] ...   112   1e-24
AGL346W Chr7 (61232..65434) [4203 bp, 1400 aa] {ON} Syntenic hom...   111   3e-24
TBLA0A03800 Chr1 complement(947158..951798) [4641 bp, 1546 aa] {...   105   2e-22
Ecym_5660 Chr5 complement(1331316..1335926) [4611 bp, 1536 aa] {...    86   2e-16
YKR103W Chr11 (653080..656736) [3657 bp, 1218 aa] {ON}  NFT1Puta...    79   2e-14
Kpol_175.1 s175 complement(1..4131) [4131 bp, 1377 aa] {ON} comp...    79   4e-14
Kwal_26.8730 s26 complement(918498..920993) [2496 bp, 831 aa] {O...    74   7e-13
SAKL0F01606g Chr6 (133318..135144) [1827 bp, 608 aa] {ON} highly...    73   2e-12
ZYRO0E04092g Chr5 (308495..311683) [3189 bp, 1062 aa] {ON} simil...    72   3e-12
YER036C Chr5 complement(223367..225199) [1833 bp, 610 aa] {ON}  ...    72   4e-12
AFR232C Chr6 complement(859612..861435) [1824 bp, 607 aa] {ON} S...    71   5e-12
Smik_5.159 Chr5 complement(228179..230011) [1833 bp, 610 aa] {ON...    71   6e-12
Skud_5.145 Chr5 complement(221173..223005) [1833 bp, 610 aa] {ON...    70   8e-12
Ecym_1194 Chr1 (393697..395526) [1830 bp, 609 aa] {ON} similar t...    70   8e-12
TPHA0A05890 Chr1 complement(1334117..1335949) [1833 bp, 610 aa] ...    70   8e-12
Suva_5.134 Chr5 complement(199609..201441) [1833 bp, 610 aa] {ON...    70   8e-12
SAKL0D10208g Chr4 complement(855378..857636) [2259 bp, 752 aa] {...    70   1e-11
YOL075C Chr15 complement(189658..193542) [3885 bp, 1294 aa] {ON}...    70   1e-11
TPHA0A00840 Chr1 complement(163812..167750) [3939 bp, 1312 aa] {...    70   1e-11
SAKL0H21010g Chr8 (1835185..1839528) [4344 bp, 1447 aa] {ON} sim...    69   4e-11
TBLA0I03330 Chr9 complement(806242..808074) [1833 bp, 610 aa] {O...    68   4e-11
TPHA0D01170 Chr4 complement(245675..248422) [2748 bp, 915 aa] {O...    68   6e-11
CAGL0K10472g Chr11 (1020845..1023103) [2259 bp, 752 aa] {ON} hig...    68   7e-11
NCAS0A08570 Chr1 (1693304..1696486) [3183 bp, 1060 aa] {ON} Anc_...    68   8e-11
CAGL0C02343g Chr3 (236112..236391,236790..238672) [2163 bp, 720 ...    67   8e-11
ZYRO0G01144g Chr7 (89341..91599) [2259 bp, 752 aa] {ON} highly s...    67   9e-11
ZYRO0E08800g Chr5 complement(702554..704386) [1833 bp, 610 aa] {...    67   1e-10
TDEL0D06020 Chr4 complement(1087102..1088934) [1833 bp, 610 aa] ...    67   1e-10
Kwal_47.19116 s47 complement(1101559..1103382) [1824 bp, 607 aa]...    67   1e-10
KLTH0D10890g Chr4 complement(891012..893504) [2493 bp, 830 aa] {...    67   2e-10
KNAG0K00950 Chr11 complement(186381..190235) [3855 bp, 1284 aa] ...    67   2e-10
Suva_2.583 Chr2 (1030711..1035324) [4614 bp, 1537 aa] {ON} YDR40...    67   2e-10
NCAS0E00480 Chr5 (81549..83381) [1833 bp, 610 aa] {ON}                 66   2e-10
Smik_15.84 Chr15 complement(153969..157856) [3888 bp, 1295 aa] {...    66   2e-10
TBLA0D04350 Chr4 complement(1076344..1079703) [3360 bp, 1119 aa]...    66   2e-10
Suva_15.91 Chr15 complement(162469..166377) [3909 bp, 1302 aa] {...    66   3e-10
NCAS0A12060 Chr1 (2388467..2393098) [4632 bp, 1543 aa] {ON} Anc_...    66   3e-10
TDEL0B05760 Chr2 (1017816..1020926) [3111 bp, 1036 aa] {ON} Anc_...    65   4e-10
KLLA0A01452g Chr1 (130078..131901) [1824 bp, 607 aa] {ON} highly...    65   4e-10
Skud_4.680 Chr4 (1201243..1205580) [4338 bp, 1445 aa] {ON} YDR40...    65   4e-10
Skud_4.681 Chr4 (1201243..1205580) [4338 bp, 1445 aa] {ON} YDR40...    65   4e-10
KAFR0A03790 Chr1 complement(770906..773536) [2631 bp, 876 aa] {O...    65   5e-10
KLLA0A10857g Chr1 complement(941784..944042) [2259 bp, 752 aa] {...    65   6e-10
KNAG0C01960 Chr3 complement(380896..383154) [2259 bp, 752 aa] {O...    65   6e-10
KAFR0C05220 Chr3 (1042497..1046996) [4500 bp, 1499 aa] {ON} Anc_...    65   6e-10
YDR406W Chr4 (1279210..1283799) [4590 bp, 1529 aa] {ON}  PDR15Pl...    65   7e-10
NDAI0C01220 Chr3 (246762..251291) [4530 bp, 1509 aa] {ON} Anc_5....    65   8e-10
KAFR0C04540 Chr3 complement(907385..909643) [2259 bp, 752 aa] {O...    64   9e-10
Smik_7.313 Chr7 (524077..526335) [2259 bp, 752 aa] {ON} YFR009W ...    64   1e-09
Smik_4.678 Chr4 (1200036..1204637) [4602 bp, 1533 aa] {ON} YDR40...    64   1e-09
KNAG0B03870 Chr2 complement(741637..746178) [4542 bp, 1513 aa] {...    64   1e-09
Kwal_0.327 s0 complement(154643..157702) [3060 bp, 1019 aa] {ON}...    64   1e-09
ZYRO0D11880g Chr4 (1003647..1008143) [4497 bp, 1498 aa] {ON} sim...    64   1e-09
YFR009W Chr6 (162488..164746) [2259 bp, 752 aa] {ON}  GCN20Posit...    64   1e-09
KAFR0C05210 Chr3 (1037177..1041658) [4482 bp, 1493 aa] {ON}            64   1e-09
KLTH0H13442g Chr8 complement(1175860..1178118) [2259 bp, 752 aa]...    64   1e-09
TPHA0D04700 Chr4 (1026978..1031510) [4533 bp, 1510 aa] {ON}            64   1e-09
ZYRO0B05588g Chr2 (440556..444368) [3813 bp, 1270 aa] {ON} simil...    64   1e-09
AEL032W Chr5 (572196..574457) [2262 bp, 753 aa] {ON} Syntenic ho...    64   1e-09
KNAG0G01040 Chr7 (221426..225631) [4206 bp, 1401 aa] {ON}  YIL013C     64   1e-09
NDAI0I03020 Chr9 complement(713821..715650) [1830 bp, 609 aa] {O...    63   2e-09
Kpol_1050.26 s1050 complement(62452..64284) [1833 bp, 610 aa] {O...    63   2e-09
KLTH0G01452g Chr7 (105741..107564) [1824 bp, 607 aa] {ON} highly...    63   2e-09
CAGL0I04862g Chr9 complement(438338..442861) [4524 bp, 1507 aa] ...    64   2e-09
Kpol_1049.23 s1049 complement(67726..68058) [333 bp, 110 aa] {ON...    57   2e-09
TPHA0A02310 Chr1 (483447..485705) [2259 bp, 752 aa] {ON} Anc_1.3...    63   2e-09
ZYRO0B14762g Chr2 (1201028..1205575) [4548 bp, 1515 aa] {ON} sim...    63   2e-09
Kpol_1053.48 s1053 complement(92949..93236,93239..96817) [3867 b...    63   2e-09
KNAG0I00530 Chr9 (88076..91219) [3144 bp, 1047 aa] {ON} Anc_1.42...    63   2e-09
TBLA0D01820 Chr4 (448516..453171) [4656 bp, 1551 aa] {ON}              63   3e-09
CAGL0M01760g Chr13 (203616..208115) [4500 bp, 1499 aa] {ON} high...    63   3e-09
SAKL0D09394g Chr4 complement(780019..783102) [3084 bp, 1027 aa] ...    62   3e-09
Suva_6.84 Chr6 complement(145289..147547) [2259 bp, 752 aa] {ON}...    62   3e-09
NDAI0G05020 Chr7 (1217458..1220751) [3294 bp, 1097 aa] {ON} Anc_...    62   3e-09
Kpol_1043.43 s1043 complement(86642..88900) [2259 bp, 752 aa] {O...    62   3e-09
ACR128C Chr3 complement(573251..575734) [2484 bp, 827 aa] {ON} S...    62   3e-09
CAGL0F02717g Chr6 (261361..265989) [4629 bp, 1542 aa] {ON}             62   4e-09
Kpol_1050.16 s1050 complement(38346..41489) [3144 bp, 1047 aa] {...    62   4e-09
TBLA0D01780 Chr4 complement(438830..443617) [4788 bp, 1595 aa] {...    62   4e-09
YOR328W Chr15 (931803..936497) [4695 bp, 1564 aa] {ON}  PDR10ATP...    62   4e-09
Kwal_34.16240 s34 (257762..260020) [2259 bp, 752 aa] {ON} YFR009...    62   5e-09
Skud_6.95 Chr6 complement(175462..177720) [2259 bp, 752 aa] {ON}...    62   5e-09
TPHA0A04220 Chr1 complement(948357..952811) [4455 bp, 1484 aa] {...    62   5e-09
NDAI0A04200 Chr1 complement(948224..952879) [4656 bp, 1551 aa] {...    62   5e-09
NDAI0B02870 Chr2 complement(726822..730625) [3804 bp, 1267 aa] {...    62   6e-09
Smik_15.333 Chr15 (575791..580323) [4533 bp, 1510 aa] {ON} YOR15...    62   7e-09
Smik_3.97 Chr3 complement(133624..136773) [3150 bp, 1049 aa] {ON...    61   8e-09
KAFR0C00820 Chr3 (157878..162431) [4554 bp, 1517 aa] {ON}              61   8e-09
YPL147W Chr16 (273255..275867) [2613 bp, 870 aa] {ON}  PXA1Subun...    61   9e-09
KAFR0J02700 Chr10 complement(515978..517804) [1827 bp, 608 aa] {...    61   9e-09
TBLA0C01220 Chr3 complement(263093..265348) [2256 bp, 751 aa] {O...    61   1e-08
YOR153W Chr15 (619840..624375) [4536 bp, 1511 aa] {ON}  PDR5Plas...    61   1e-08
KLLA0D04554g Chr4 complement(385733..388801) [3069 bp, 1022 aa] ...    61   1e-08
NDAI0H03570 Chr8 complement(872905..875172) [2268 bp, 755 aa] {O...    61   1e-08
YDR011W Chr4 (465919..470424) [4506 bp, 1501 aa] {ON}  SNQ2Plasm...    61   1e-08
ZYRO0D11858g Chr4 (998646..1003157) [4512 bp, 1503 aa] {ON} high...    61   1e-08
SAKL0G08008g Chr7 complement(673391..678040) [4650 bp, 1549 aa] ...    61   1e-08
TDEL0A03640 Chr1 (646252..650781) [4530 bp, 1509 aa] {ON} Anc_5....    61   1e-08
TBLA0F01040 Chr6 (252002..255817) [3816 bp, 1271 aa] {ON} Anc_3....    61   1e-08
Smik_6.344 Chr6 complement(548373..550985) [2613 bp, 870 aa] {ON...    60   1e-08
NCAS0H02420 Chr8 (477754..482316) [4563 bp, 1520 aa] {ON} Anc_5....    61   1e-08
KNAG0A02980 Chr1 (363468..366083) [2616 bp, 871 aa] {ON} Anc_8.6...    60   1e-08
Suva_3.37 Chr3 complement(47453..50614) [3162 bp, 1053 aa] {ON} ...    60   1e-08
NCAS0B05300 Chr2 (980856..984677) [3822 bp, 1273 aa] {ON} Anc_3....    60   1e-08
TBLA0G02820 Chr7 (745762..750297) [4536 bp, 1511 aa] {ON} Anc_3....    60   1e-08
KNAG0C04500 Chr3 complement(882896..887563) [4668 bp, 1555 aa] {...    60   2e-08
Suva_16.163 Chr16 (282462..285074) [2613 bp, 870 aa] {ON} YPL147...    60   2e-08
KAFR0C01200 Chr3 (240350..244171) [3822 bp, 1273 aa] {ON} Anc_3....    60   2e-08
Kwal_27.9666 s27 complement(9636..14060) [4425 bp, 1474 aa] {ON}...    60   2e-08
SAKL0C11616g Chr3 complement(1041794..1046248) [4455 bp, 1484 aa...    60   2e-08
CAGL0L07744g Chr12 (851958..855125) [3168 bp, 1055 aa] {ON} simi...    60   2e-08
Suva_8.204 Chr8 (368920..373455) [4536 bp, 1511 aa] {ON} YOR153W...    60   2e-08
NCAS0E01630 Chr5 complement(308563..313260) [4698 bp, 1565 aa] {...    60   2e-08
KAFR0E03440 Chr5 complement(684043..688692) [4650 bp, 1549 aa] {...    60   2e-08
Skud_15.495 Chr15 (871539..876233) [4695 bp, 1564 aa] {ON} YOR32...    60   2e-08
Smik_4.244 Chr4 (445916..450421) [4506 bp, 1501 aa] {ON} YDR011W...    60   2e-08
YNR070W Chr14 (765375..769376) [4002 bp, 1333 aa] {ON}  PDR18Put...    60   2e-08
KAFR0G03010 Chr7 (623976..628094) [4119 bp, 1372 aa] {ON}  YIL013C     60   3e-08
TDEL0D04040 Chr4 complement(738550..743052) [4503 bp, 1500 aa] {...    59   3e-08
YCR011C Chr3 complement(133724..136873) [3150 bp, 1049 aa] {ON} ...    59   3e-08
TDEL0D02370 Chr4 (460691..462952) [2262 bp, 753 aa] {ON} Anc_1.3...    59   3e-08
Ecym_2410 Chr2 (797543..800029) [2487 bp, 828 aa] {ON} similar t...    59   4e-08
Smik_15.185 Chr15 (316883..321064) [4182 bp, 1393 aa] {ON} YNR07...    59   4e-08
ZYRO0A04114g Chr1 complement(328582..333138) [4557 bp, 1518 aa] ...    59   4e-08
TPHA0L01500 Chr12 (311715..316274) [4560 bp, 1519 aa] {ON} Anc_8...    59   4e-08
NCAS0B01530 Chr2 complement(249743..252349) [2607 bp, 868 aa] {O...    59   4e-08
Skud_15.317 Chr15 (568579..573117) [4539 bp, 1512 aa] {ON} YOR15...    59   4e-08
KLLA0F11484g Chr6 (1052991..1055528) [2538 bp, 845 aa] {ON} simi...    59   5e-08
KAFR0E03450 Chr5 complement(689571..694232) [4662 bp, 1553 aa] {...    59   5e-08
KLLA0D03476g Chr4 (296287..300969) [4683 bp, 1560 aa] {ON} simil...    59   5e-08
KLLA0D03432g Chr4 (287805..292256) [4452 bp, 1483 aa] {ON} simil...    59   5e-08
Skud_16.135 Chr16 (244860..247472) [2613 bp, 870 aa] {ON} YPL147...    59   6e-08
Ecym_8014 Chr8 (37756..42309) [4554 bp, 1517 aa] {ON} similar to...    59   6e-08
ZYRO0F07018g Chr6 complement(571276..573861) [2586 bp, 861 aa] {...    58   6e-08
ABR125C Chr2 complement(623888..628354) [4467 bp, 1488 aa] {ON} ...    59   6e-08
NDAI0E01240 Chr5 (244737..247430) [2694 bp, 897 aa] {ON} Anc_8.661     58   6e-08
NCAS0F00410 Chr6 (70678..75273) [4596 bp, 1531 aa] {ON}                59   6e-08
NCAS0E01650 Chr5 complement(319448..323914) [4467 bp, 1488 aa] {...    59   6e-08
KLLA0F21692g Chr6 complement(2014152..2018729) [4578 bp, 1525 aa...    59   7e-08
ZYRO0D17710g Chr4 complement(1466189..1470649) [4461 bp, 1486 aa...    59   7e-08
SAKL0C08074g Chr3 complement(747926..751699) [3774 bp, 1257 aa] ...    58   7e-08
KNAG0B00460 Chr2 (76565..78547) [1983 bp, 660 aa] {ON} Anc_3.534...    58   7e-08
NCAS0F00790 Chr6 complement(158502..162704) [4203 bp, 1400 aa] {...    58   7e-08
KAFR0E03480 Chr5 complement(701160..705818) [4659 bp, 1552 aa] {...    58   7e-08
TPHA0O01000 Chr15 (185595..188630) [3036 bp, 1011 aa] {ON} Anc_1...    58   8e-08
KAFR0E03460 Chr5 complement(695361..700001) [4641 bp, 1546 aa] {...    58   8e-08
KAFR0C00830 Chr3 (163830..168284) [4455 bp, 1484 aa] {ON} Anc_3....    58   8e-08
AER190W Chr5 (994534..997569) [3036 bp, 1011 aa] {ON} Syntenic h...    58   9e-08
NCAS0D00580 Chr4 (96350..98611) [2262 bp, 753 aa] {ON} Anc_1.366       57   1e-07
KLTH0G19448g Chr7 (1676895..1681355) [4461 bp, 1486 aa] {ON} sim...    58   1e-07
TDEL0A06070 Chr1 complement(1064071..1066689) [2619 bp, 872 aa] ...    57   1e-07
KNAG0K01350 Chr11 complement(265564..270069) [4506 bp, 1501 aa] ...    57   1e-07
Smik_15.508 Chr15 (881347..886047) [4701 bp, 1566 aa] {ON} YOR32...    57   1e-07
Kpol_1012.10 s1012 complement(20013..20741,21318..21326,21750..2...    57   1e-07
ZYRO0D11836g Chr4 (993707..998095) [4389 bp, 1462 aa] {ON} simil...    57   2e-07
KLTH0H12760g Chr8 complement(1083450..1086512) [3063 bp, 1020 aa...    57   2e-07
Ecym_3604 Chr3 complement(1143009..1147433) [4425 bp, 1474 aa] {...    57   2e-07
NCAS0E01640 Chr5 complement(313479..317987) [4509 bp, 1502 aa] {...    57   2e-07
KAFR0F01460 Chr6 (284981..288154) [3174 bp, 1057 aa] {ON} Anc_1....    57   2e-07
KNAG0L00680 Chr12 complement(105318..109460) [4143 bp, 1380 aa] ...    57   2e-07
Skud_4.262 Chr4 (456192..460697) [4506 bp, 1501 aa] {ON} YDR011W...    57   2e-07
Skud_14.404 Chr14 (733442..737716) [4275 bp, 1424 aa] {ON} YNR07...    57   2e-07
CAGL0M02387g Chr13 (280372..282942) [2571 bp, 856 aa] {ON} simil...    56   3e-07
Skud_15.174 Chr15 (310212..314393) [4182 bp, 1393 aa] {ON} YALI0...    56   3e-07
Smik_17.26 Chr17 complement(23946..28454) [4509 bp, 1502 aa] {ON...    56   3e-07
TBLA0C01780 Chr3 complement(421045..423711) [2667 bp, 888 aa] {O...    56   3e-07
Kwal_27.12711 s27 (1342807..1346547) [3741 bp, 1246 aa] {ON} YOL...    56   4e-07
Suva_15.188 Chr15 (324904..329088) [4185 bp, 1394 aa] {ON} YOR01...    56   4e-07
TBLA0I01760 Chr9 (392252..397147) [4896 bp, 1631 aa] {ON} Anc_3....    56   4e-07
SAKL0C06996g Chr3 complement(649424..654061) [4638 bp, 1545 aa] ...    55   5e-07
SAKL0H06908g Chr8 (605838..608348) [2511 bp, 836 aa] {ON} simila...    55   5e-07
CAGL0F01419g Chr6 complement(142623..146819) [4197 bp, 1398 aa] ...    55   5e-07
KLTH0E15796g Chr5 (1400194..1403937) [3744 bp, 1247 aa] {ON} sim...    55   6e-07
TBLA0A02440 Chr1 complement(582029..586894) [4866 bp, 1621 aa] {...    55   7e-07
Suva_8.379 Chr8 (672487..677184) [4698 bp, 1565 aa] {ON} YPL058C...    55   7e-07
Skud_3.76 Chr3 complement(116029..119199) [3171 bp, 1056 aa] {ON...    55   8e-07
Ecym_2737 Chr2 (1425670..1428726) [3057 bp, 1018 aa] {ON} simila...    55   8e-07
Ecym_2714 Chr2 (1380718..1382964) [2247 bp, 748 aa] {ON} similar...    54   1e-06
NDAI0G01850 Chr7 complement(409416..413918) [4503 bp, 1500 aa] {...    55   1e-06
Skud_15.78 Chr15 complement(148836..152720) [3885 bp, 1294 aa] {...    55   1e-06
CAGL0I08019g Chr9 complement(783133..786990) [3858 bp, 1285 aa] ...    54   1e-06
Kwal_23.5161 s23 (1040608..1045077) [4470 bp, 1489 aa] {ON} YDR0...    54   1e-06
YOR011W Chr15 (349679..353863) [4185 bp, 1394 aa] {ON}  AUS1Plas...    54   1e-06
TPHA0M00640 Chr13 complement(117604..122076) [4473 bp, 1490 aa] ...    54   1e-06
AGL142C Chr7 complement(434247..438740) [4494 bp, 1497 aa] {ON} ...    54   1e-06
KNAG0A02100 Chr1 complement(177773..182290) [4518 bp, 1505 aa] {...    54   1e-06
KLLA0C04477g Chr3 complement(409543..413304) [3762 bp, 1253 aa] ...    54   1e-06
KLTH0A01914g Chr1 complement(165071..169570) [4500 bp, 1499 aa] ...    54   1e-06
Ecym_1500 Chr1 (1027467..1028318) [852 bp, 283 aa] {ON} similar ...    52   2e-06
YPL058C Chr16 complement(445842..450377) [4536 bp, 1511 aa] {ON}...    54   2e-06
Smik_16.179 Chr16 complement(321239..325774) [4536 bp, 1511 aa] ...    54   2e-06
ABR126W Chr2 (628624..633162) [4539 bp, 1512 aa] {ON} Non-synten...    54   2e-06
NCAS0C02250 Chr3 complement(418244..422770) [4527 bp, 1508 aa] {...    54   2e-06
Suva_7.3 Chr7 complement(6379..10671) [4293 bp, 1430 aa] {ON} YN...    53   3e-06
NDAI0A03750 Chr1 complement(849511..851118) [1608 bp, 535 aa] {O...    52   3e-06
SAKL0C11704g Chr3 (1050447..1054979) [4533 bp, 1510 aa] {ON} sim...    53   3e-06
Kpol_1002.105 s1002 complement(266533..268176) [1644 bp, 547 aa]...    52   4e-06
CAGL0M07293g Chr13 complement(733072..737619) [4548 bp, 1515 aa]...    52   4e-06
ZYRO0B13266g Chr2 (1074171..1076639) [2469 bp, 822 aa] {ON} simi...    52   4e-06
Kpol_513.9 s513 (23141..27682) [4542 bp, 1513 aa] {ON} (23141..2...    52   5e-06
Kpol_1035.32 s1035 (76084..76926) [843 bp, 280 aa] {ON} (76084.....    50   6e-06
SAKL0C05654g Chr3 complement(532258..536787) [4530 bp, 1509 aa] ...    52   6e-06
SAKL0H10670g Chr8 complement(918091..922620) [4530 bp, 1509 aa] ...    52   7e-06
Kpol_1036.28 s1036 (70446..70928,73046..77023) [4461 bp, 1486 aa...    52   7e-06
Suva_16.256 Chr16 complement(448846..453387) [4542 bp, 1513 aa] ...    52   8e-06
Skud_16.225 Chr16 complement(410106..414641) [4536 bp, 1511 aa] ...    52   8e-06
NCAS0I00670 Chr9 (111140..115240) [4101 bp, 1366 aa] {ON}              51   9e-06
NDAI0G05180 Chr7 complement(1254531..1257665) [3135 bp, 1044 aa]...    51   1e-05
NDAI0E02950 Chr5 complement(620841..625379) [4539 bp, 1512 aa] {...    51   1e-05
Smik_14.399 Chr14 (709641..713906) [4266 bp, 1421 aa] {ON} YNR07...    51   1e-05
Suva_10.346 Chr10 (604006..607140) [3135 bp, 1044 aa] {ON} YLR24...    51   1e-05
Kwal_33.15623 s33 (1193685..1195373) [1689 bp, 562 aa] {ON} YFR0...    50   1e-05
KLLA0F08833g Chr6 (822039..822860) [822 bp, 273 aa] {ON} similar...    49   1e-05
TDEL0B01210 Chr2 complement(219068..223606) [4539 bp, 1512 aa] {...    50   2e-05
Suva_9.192 Chr9 complement(316679..320920) [4242 bp, 1413 aa] {O...    50   2e-05
Ecym_3605 Chr3 (1148339..1152817) [4479 bp, 1492 aa] {ON} simila...    50   2e-05
NDAI0G01840 Chr7 complement(404289..408797) [4509 bp, 1502 aa] {...    50   2e-05
KLLA0B09702g Chr2 complement(842245..846801) [4557 bp, 1518 aa] ...    50   2e-05
SAKL0D08316g Chr4 (695101..698235) [3135 bp, 1044 aa] {ON} highl...    50   2e-05
TBLA0H03470 Chr8 (847762..852312) [4551 bp, 1516 aa] {ON} Anc_8....    50   2e-05
YIL013C Chr9 complement(328207..332442) [4236 bp, 1411 aa] {ON} ...    49   4e-05
KAFR0A01180 Chr1 (225692..230218) [4527 bp, 1508 aa] {ON} Anc_8....    49   4e-05
ZYRO0F08866g Chr6 (709888..714450) [4563 bp, 1520 aa] {ON} highl...    49   4e-05
SAKL0B01518g Chr2 complement(148745..149542) [798 bp, 265 aa] {O...    48   4e-05
Kwal_56.24221 s56 complement(908983..912147) [3165 bp, 1054 aa] ...    49   5e-05
Kwal_YGOB_56.24219 s56 complement(908618..909109,909112..912147)...    49   5e-05
NDAI0H01280 Chr8 complement(308593..312771) [4179 bp, 1392 aa] {...    49   5e-05
Smik_6.431 Chr6 complement(699005..702574) [3570 bp, 1189 aa] {O...    49   5e-05
Smik_9.181 Chr9 complement(302896..307125) [4230 bp, 1409 aa] {O...    49   5e-05
YNL014W Chr14 (606319..609453) [3135 bp, 1044 aa] {ON}  HEF3Tran...    49   5e-05
NCAS0A08760 Chr1 complement(1729600..1732737) [3138 bp, 1045 aa]...    49   6e-05
Skud_12.330 Chr12 (583354..586488) [3135 bp, 1044 aa] {ON} YLR24...    49   7e-05
SAKL0A03586g Chr1 (328346..331885) [3540 bp, 1179 aa] {ON} simil...    49   7e-05
ZYRO0E05148g Chr5 complement(387268..390405) [3138 bp, 1045 aa] ...    49   7e-05
ZYRO0F08888g Chr6 (716318..720880) [4563 bp, 1520 aa] {ON} highl...    49   7e-05
Suva_6.30 Chr6 complement(52879..53748) [870 bp, 289 aa] {ON} YF...    47   7e-05
KLTH0H11902g Chr8 (1017096..1020230) [3135 bp, 1044 aa] {ON} hig...    48   8e-05
KAFR0A07090 Chr1 complement(1427525..1431157) [3633 bp, 1210 aa]...    48   8e-05
KAFR0C02740 Chr3 complement(537867..539465) [1599 bp, 532 aa] {O...    48   8e-05
Suva_16.80 Chr16 (131166..134702) [3537 bp, 1178 aa] {ON} YPL226...    48   9e-05
TPHA0H00120 Chr8 complement(11464..13092) [1629 bp, 542 aa] {ON}...    48   9e-05
TBLA0A01150 Chr1 (262829..266992) [4164 bp, 1387 aa] {ON}              48   9e-05
Kpol_1037.47 s1037 (114295..118818) [4524 bp, 1507 aa] {ON} (114...    48   9e-05
YLR249W Chr12 (636780..639914) [3135 bp, 1044 aa] {ON}  YEF3Gamm...    48   1e-04
KLLA0C16115g Chr3 (1405766..1409317) [3552 bp, 1183 aa] {ON} sim...    48   1e-04
KAFR0C03470 Chr3 (707203..708039) [837 bp, 278 aa] {ON} Anc_8.42...    47   1e-04
Suva_14.333 Chr14 (585838..588972) [3135 bp, 1044 aa] {ON} YNL01...    48   1e-04
NCAS0D03950 Chr4 (737216..740788) [3573 bp, 1190 aa] {ON} Anc_6....    48   1e-04
YPL226W Chr16 (121767..125357) [3591 bp, 1196 aa] {ON}  NEW1ATP ...    48   1e-04
KNAG0F01740 Chr6 (326444..329950) [3507 bp, 1168 aa] {ON} Anc_6....    48   1e-04
Smik_12.322 Chr12 (581596..584730) [3135 bp, 1044 aa] {ON} YLR24...    48   1e-04
TBLA0D04410 Chr4 complement(1093035..1096169) [3135 bp, 1044 aa]...    47   1e-04
TBLA0A05970 Chr1 (1471379..1474975) [3597 bp, 1198 aa] {ON} Anc_...    48   1e-04
TPHA0H01820 Chr8 complement(415382..418765) [3384 bp, 1127 aa] {...    47   1e-04
TDEL0E00840 Chr5 complement(172712..175192) [2481 bp, 826 aa] {O...    47   1e-04
KNAG0I01340 Chr9 complement(258887..262024) [3138 bp, 1045 aa] {...    47   1e-04
Skud_16.52 Chr16 (95317..98853) [3537 bp, 1178 aa] {ON} YPL226W ...    47   2e-04
Kpol_1002.29 s1002 (89520..93068) [3549 bp, 1182 aa] {ON} (89520...    47   2e-04
Kwal_0.167 s0 (88989..92123) [3135 bp, 1044 aa] {ON} YNL014W (HE...    47   2e-04
KLTH0H03300g Chr8 (295271..298801) [3531 bp, 1176 aa] {ON} simil...    47   2e-04
KAFR0K01230 Chr11 (254346..258488) [4143 bp, 1380 aa] {ON}  YIL013C    47   2e-04
CAGL0D03674g Chr4 (370066..373626) [3561 bp, 1186 aa] {ON} highl...    47   2e-04
Skud_14.314 Chr14 (573040..576174) [3135 bp, 1044 aa] {ON} YNL01...    47   2e-04
Ecym_3232 Chr3 complement(431386..433830) [2445 bp, 814 aa] {ON}...    47   2e-04
CAGL0B03487g Chr2 complement(345399..348536) [3138 bp, 1045 aa] ...    47   2e-04
Kpol_487.13 s487 complement(50878..54012) [3135 bp, 1044 aa] {ON...    47   3e-04
Skud_9.159 Chr9 complement(298165..302388) [4224 bp, 1407 aa] {O...    47   3e-04
KAFR0I02110 Chr9 (433759..436896) [3138 bp, 1045 aa] {ON} Anc_1....    47   3e-04
TDEL0B06150 Chr2 complement(1083103..1086237) [3135 bp, 1044 aa]...    47   3e-04
TBLA0G02050 Chr7 complement(537114..540098) [2985 bp, 994 aa] {O...    46   3e-04
AAL028W Chr1 (291808..294942) [3135 bp, 1044 aa] {ON} Syntenic h...    46   4e-04
KLTH0H07942g Chr8 complement(696683..698269) [1587 bp, 528 aa] {...    46   4e-04
ZYRO0F03234g Chr6 complement(273742..274569) [828 bp, 275 aa] {O...    45   5e-04
TPHA0O00680 Chr15 (128579..131713) [3135 bp, 1044 aa] {ON} Anc_1...    45   5e-04
NDAI0G03160 Chr7 complement(744284..745141) [858 bp, 285 aa] {ON...    45   5e-04
NDAI0I00960 Chr9 complement(226758..230396) [3639 bp, 1212 aa] {...    45   6e-04
YFL028C Chr6 complement(79344..80213) [870 bp, 289 aa] {ON}  CAF...    44   6e-04
YDR061W Chr4 (574164..575783) [1620 bp, 539 aa] {ON} Protein wit...    45   6e-04
KLLA0F12210g Chr6 (1125630..1128764) [3135 bp, 1044 aa] {ON} hig...    45   7e-04
NDAI0G00810 Chr7 (169366..172515) [3150 bp, 1049 aa] {ON} Anc_1....    45   7e-04
KLLA0C17556g Chr3 complement(1544404..1546227) [1824 bp, 607 aa]...    45   7e-04
CAGL0K12474g Chr11 (1218012..1218896) [885 bp, 294 aa] {ON} simi...    44   7e-04
TBLA0A08720 Chr1 complement(2139184..2140668) [1485 bp, 494 aa] ...    45   7e-04
SAKL0H19294g Chr8 complement(1703651..1705213) [1563 bp, 520 aa]...    45   9e-04
KAFR0G03410 Chr7 (702624..705056) [2433 bp, 810 aa] {ON} Anc_4.2...    45   9e-04
KAFR0H03200 Chr8 complement(610545..613694) [3150 bp, 1049 aa] {...    45   9e-04
Smik_14.315 Chr14 (564639..567773) [3135 bp, 1044 aa] {ON} YNL01...    45   0.001
AER091W Chr5 (809767..812172) [2406 bp, 801 aa] {ON} Syntenic ho...    45   0.001
NCAS0C03820 Chr3 complement(774039..774923) [885 bp, 294 aa] {ON...    44   0.001
Suva_2.220 Chr2 (374470..376092) [1623 bp, 540 aa] {ON} YDR061W ...    44   0.001
Ecym_1312 Chr1 complement(630006..633140) [3135 bp, 1044 aa] {ON...    44   0.001
TDEL0C00680 Chr3 complement(110674..111519) [846 bp, 281 aa] {ON...    44   0.001
ZYRO0E07634g Chr5 complement(593495..597025) [3531 bp, 1176 aa] ...    44   0.001
TDEL0F01870 Chr6 (348408..351950) [3543 bp, 1180 aa] {ON} Anc_6....    44   0.001
TDEL0B04340 Chr2 complement(764357..766018) [1662 bp, 553 aa] {O...    44   0.001
KNAG0E03270 Chr5 complement(655376..656218) [843 bp, 280 aa] {ON...    43   0.002
NCAS0A06310 Chr1 complement(1243683..1246823) [3141 bp, 1046 aa]...    44   0.002
KLTH0D15246g Chr4 (1257193..1259589) [2397 bp, 798 aa] {ON} simi...    44   0.002
AFL131W Chr6 (186656..190225) [3570 bp, 1189 aa] {ON} Syntenic h...    44   0.002
TBLA0D02530 Chr4 complement(629614..630444) [831 bp, 276 aa] {ON...    43   0.002
Smik_6.50 Chr6 complement(94583..95452) [870 bp, 289 aa] {ON} YF...    43   0.002
Kpol_1048.72 s1048 complement(202581..205715) [3135 bp, 1044 aa]...    44   0.002
Kwal_23.4045 s23 complement(543590..545875) [2286 bp, 761 aa] {O...    44   0.002
Skud_11.38 Chr11 complement(72504..75071) [2568 bp, 855 aa] {ON}...    43   0.003
Kwal_26.6702 s26 complement(29426..31279) [1854 bp, 617 aa] {ON}...    43   0.003
KLLA0B02563g Chr2 complement(222951..225377) [2427 bp, 808 aa] {...    43   0.003
Smik_4.299 Chr4 (540966..542588) [1623 bp, 540 aa] {ON} YDR061W ...    43   0.003
CAGL0D00352g Chr4 complement(42946..45531) [2586 bp, 861 aa] {ON...    43   0.003
Skud_4.316 Chr4 (550218..551840) [1623 bp, 540 aa] {ON} YDR061W ...    43   0.003
NDAI0D04610 Chr4 (1084921..1087599) [2679 bp, 892 aa] {ON} Anc_4...    43   0.003
NDAI0A08370 Chr1 complement(1924865..1929079) [4215 bp, 1404 aa]...    43   0.004
Suva_11.36 Chr11 complement(70977..73538) [2562 bp, 853 aa] {ON}...    43   0.004
SAKL0G16280g Chr7 (1408229..1410607) [2379 bp, 792 aa] {ON} simi...    43   0.004
Kpol_1055.54 s1055 complement(131851..134565) [2715 bp, 904 aa] ...    43   0.004
KNAG0D04550 Chr4 (824870..827338) [2469 bp, 822 aa] {ON} Anc_4.2...    42   0.005
NCAS0A02680 Chr1 (510902..513559) [2658 bp, 885 aa] {ON} Anc_4.287     42   0.005
Ecym_2164 Chr2 (314802..318317) [3516 bp, 1171 aa] {ON} similar ...    42   0.005
KNAG0D02010 Chr4 complement(335815..337413) [1599 bp, 532 aa] {O...    42   0.006
Smik_11.42 Chr11 complement(71610..74165) [2556 bp, 851 aa] {ON}...    42   0.006
AGR125W Chr7 (987077..988900) [1824 bp, 607 aa] {ON} Syntenic ho...    42   0.008
Skud_4.351 Chr4 complement(602770..604596) [1827 bp, 608 aa] {ON...    42   0.008
NCAS0B04350 Chr2 complement(786960..788561) [1602 bp, 533 aa] {O...    42   0.008
YDR091C Chr4 complement(626708..628534) [1827 bp, 608 aa] {ON}  ...    41   0.013
Kwal_14.2052 s14 complement(589149..590720) [1572 bp, 523 aa] {O...    41   0.013
ZYRO0G09130g Chr7 (732487..734034) [1548 bp, 515 aa] {ON} simila...    41   0.014
Kwal_56.23429 s56 complement(532382..533998) [1617 bp, 539 aa] {...    40   0.016
Kwal_YGOB_56.23429 s56 complement(532059..532313,532316..533998)...    40   0.016
TPHA0L00810 Chr12 (157823..161944) [4122 bp, 1373 aa] {ON}             41   0.018
YKL188C Chr11 complement(86225..88786) [2562 bp, 853 aa] {ON}  P...    40   0.019
TBLA0F03760 Chr6 complement(924333..926159) [1827 bp, 608 aa] {O...    40   0.025
Skud_6.42 Chr6 complement(82602..83471) [870 bp, 289 aa] {ON} YF...    39   0.026
Smik_4.334 Chr4 complement(592554..594380) [1827 bp, 608 aa] {ON...    40   0.029
Ecym_1297 Chr1 complement(603900..605381) [1482 bp, 493 aa] {ON}...    39   0.032
CAGL0G05093g Chr7 complement(483230..484864) [1635 bp, 544 aa] {...    40   0.033
TPHA0B01940 Chr2 (434881..437436) [2556 bp, 851 aa] {ON} Anc_4.2...    40   0.035
Kwal_14.1242 s14 (250275..251084) [810 bp, 269 aa] {ON} YFL028C ...    39   0.049
KNAG0H02970 Chr8 complement(548970..550802) [1833 bp, 610 aa] {O...    39   0.057
Suva_2.252 Chr2 complement(426492..428318) [1827 bp, 608 aa] {ON...    39   0.057
TPHA0D00450 Chr4 complement(76541..77377) [837 bp, 278 aa] {ON} ...    38   0.057
KLTH0G14520g Chr7 (1276585..1278411) [1827 bp, 608 aa] {ON} high...    39   0.058
SAKL0H17996g Chr8 (1607260..1609323) [2064 bp, 687 aa] {ON} high...    39   0.070
Ecym_1222 Chr1 complement(458018..462082) [4065 bp, 1354 aa] {ON...    39   0.081
TDEL0A01370 Chr1 (248469..250292) [1824 bp, 607 aa] {ON} Anc_8.2...    38   0.085
SAKL0D08668g Chr4 (721456..722937) [1482 bp, 493 aa] {ON} highly...    38   0.093
KLLA0D02156g Chr4 complement(184520..186085) [1566 bp, 521 aa] {...    38   0.10 
KLTH0G18326g Chr7 complement(1579374..1580183) [810 bp, 269 aa] ...    37   0.15 
TPHA0A01980 Chr1 (400671..402494) [1824 bp, 607 aa] {ON} Anc_8.2...    37   0.18 
CAGL0G08041g Chr7 complement(758811..760634) [1824 bp, 607 aa] {...    37   0.24 
ZYRO0B11616g Chr2 complement(910480..912303) [1824 bp, 607 aa] {...    36   0.32 
Ecym_5560 Chr5 complement(1134384..1136207) [1824 bp, 607 aa] {O...    36   0.40 
Kpol_1032.48 s1032 complement(108249..110072) [1824 bp, 607 aa] ...    36   0.49 
NCAS0B04030 Chr2 (730062..731888) [1827 bp, 608 aa] {ON} Anc_8.2...    36   0.51 
Suva_8.387 Chr8 (696078..698357) [2280 bp, 759 aa] {ON} YOR337W ...    35   0.62 
Suva_3.4 Chr3 complement(2913..4400) [1488 bp, 495 aa] {ON} YCL0...    35   0.64 
Ecym_5557 Chr5 (1126965..1128539) [1575 bp, 524 aa] {ON} similar...    35   0.65 
NDAI0A03440 Chr1 (789010..790836) [1827 bp, 608 aa] {ON} Anc_8.2...    35   0.66 
KLLA0D04928g Chr4 complement(422549..424042) [1494 bp, 497 aa] {...    35   0.69 
Kpol_364.12 s364 (26116..27537) [1422 bp, 473 aa] {ON} (26116..2...    35   0.71 
KAFR0A02430 Chr1 (508632..510455) [1824 bp, 607 aa] {ON} Anc_8.2...    35   0.89 
Skud_3.44 Chr3 complement(71745..73238) [1494 bp, 497 aa] {ON} Y...    35   0.99 
YCL017C Chr3 complement(92777..94270) [1494 bp, 497 aa] {ON}  NF...    34   1.2  
Smik_3.67 Chr3 complement(91180..92673) [1494 bp, 497 aa] {ON} Y...    34   1.3  
Kpol_1048.64 s1048 complement(183723..185216) [1494 bp, 497 aa] ...    34   1.6  
Kwal_27.12817 s27 (1386470..1389226) [2757 bp, 919 aa] {ON} YDR4...    34   1.7  
KNAG0I01270 Chr9 (243720..245261) [1542 bp, 513 aa] {ON} Anc_1.4...    33   2.9  
Kwal_0.227 s0 complement(112362..113798) [1437 bp, 478 aa] {ON} ...    33   2.9  
YOR337W Chr15 (954344..956623) [2280 bp, 759 aa] {ON}  TEA1Ty1 e...    33   3.6  
TPHA0B03720 Chr2 (876426..877982) [1557 bp, 518 aa] {ON} Anc_1.4...    33   3.7  
TPHA0B04430 Chr2 (1036315..1039527) [3213 bp, 1070 aa] {ON} Anc_...    33   3.7  
TBLA0D04500 Chr4 (1116012..1117865) [1854 bp, 617 aa] {ON} Anc_7...    32   5.0  
TPHA0A03200 Chr1 (700189..703593) [3405 bp, 1134 aa] {ON} Anc_7....    32   5.7  
KAFR0I02210 Chr9 complement(450996..452486) [1491 bp, 496 aa] {O...    32   6.4  
KAFR0C03280 Chr3 complement(666612..667646) [1035 bp, 344 aa] {O...    32   6.5  
NCAS0C04860 Chr3 (991499..993019) [1521 bp, 506 aa] {ON} Anc_1.4...    32   6.7  
NCAS0A13840 Chr1 complement(2715649..2719053) [3405 bp, 1134 aa]...    32   8.2  

>Kwal_56.22329 s56 complement(50448..52778) [2331 bp, 776 aa] {ON}
           YPL270W (MDL2) - ATP-binding cassette (ABC) transporter
           family member [contig 186] FULL
          Length = 776

 Score = 1556 bits (4028), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 762/776 (98%), Positives = 762/776 (98%)

Query: 1   MSHHLEINSRYPLRHIGQNSHVKTLEQMLLSSFSRPLRLGGTLSRLKSPLCAEFSQLKRG 60
           MSHHLEINSRYPLRHIGQNSHVKTLEQMLLSSFSRPLRLGGTLSRLKSPLCAEFSQLKRG
Sbjct: 1   MSHHLEINSRYPLRHIGQNSHVKTLEQMLLSSFSRPLRLGGTLSRLKSPLCAEFSQLKRG 60

Query: 61  TFGISAFHCQASHTNRTLTPRIQETRFETHSLRLSVPRTLQLTRLYSQKTVESQAKTPAD 120
           TFGISAFHCQASHTNRTLTPRIQETRFETHSLRLSVPRTLQLTRLYSQKTVESQAKTPAD
Sbjct: 61  TFGISAFHCQASHTNRTLTPRIQETRFETHSLRLSVPRTLQLTRLYSQKTVESQAKTPAD 120

Query: 121 KESQKSGTMEDEESPNMGYKEVIRLFKLATHDWKLLTFAIGLLAISSVIGMSIPKVIGMV 180
           KESQKSGTMEDEESPNMGYKEVIRLFKLATHDWKLLTFAIGLLAISSVIGMSIPKVIGMV
Sbjct: 121 KESQKSGTMEDEESPNMGYKEVIRLFKLATHDWKLLTFAIGLLAISSVIGMSIPKVIGMV 180

Query: 181 LDAIKNTYSSATGPVGLDDLPPIVNDLSMYEFLGIFAGALVIGTVANFGRIVLLRVLGEK 240
           LDAIKNTYSSATGPVGLDDLPPIVNDLSMYEFLGIFAGALVIGTVANFGRIVLLRVLGEK
Sbjct: 181 LDAIKNTYSSATGPVGLDDLPPIVNDLSMYEFLGIFAGALVIGTVANFGRIVLLRVLGEK 240

Query: 241 LVARLRSNVIRKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXX 300
           LVARLRSNVIRKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKA      
Sbjct: 241 LVARLRSNVIRKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAIICGGV 300

Query: 301 XXXXXXXXSISLTSALLMFAPPLLIGALIYGKRIRMISRDLQESTGNLTRVSEEQLSGVK 360
                   SISLTSALLMFAPPLLIGALIYGKRIRMISRDLQESTGNLTRVSEEQLSGVK
Sbjct: 301 GIGMMVNISISLTSALLMFAPPLLIGALIYGKRIRMISRDLQESTGNLTRVSEEQLSGVK 360

Query: 361 TIQSFVAEGKELQRYNTAIRKVFLYGKKEALTNATFFSSTNVLGDLSFLIVLAYGSHLVL 420
           TIQSFVAEGKELQRYNTAIRKVFLYGKKEALTNATFFSSTNVLGDLSFLIVLAYGSHLVL
Sbjct: 361 TIQSFVAEGKELQRYNTAIRKVFLYGKKEALTNATFFSSTNVLGDLSFLIVLAYGSHLVL 420

Query: 421 QGGLTVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHAPSIKPTAGKP 480
           QGGLTVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHAPSIKPTAGKP
Sbjct: 421 QGGLTVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHAPSIKPTAGKP 480

Query: 481 YVPGSGKISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYY 540
           YVPGSGKISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYY
Sbjct: 481 YVPGSGKISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYY 540

Query: 541 NPSSGQITIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSV 600
           NPSSGQITIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSV
Sbjct: 541 NPSSGQITIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSV 600

Query: 601 AKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDV 660
           AKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDV
Sbjct: 601 AKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDV 660

Query: 661 ESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQ 720
           ESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQ
Sbjct: 661 ESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQ 720

Query: 721 SELYKLLNDKKRDKPTPRVQSDPEKDREQEHQIDNQVREQVANDFNLDQKSSKLTP 776
           SELYKLLNDKKRDKPTPRVQSDPEKDREQEHQIDNQVREQVANDFNLDQKSSKLTP
Sbjct: 721 SELYKLLNDKKRDKPTPRVQSDPEKDREQEHQIDNQVREQVANDFNLDQKSSKLTP 776

>KLTH0C11616g Chr3 (956011..958233) [2223 bp, 740 aa] {ON} similar
           to uniprot|P33311 Saccharomyces cerevisiae YPL270W MDL2
           Half-type ATP-binding cassette (ABC) transporter of the
           inner mitochondrial membrane
          Length = 740

 Score = 1086 bits (2808), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 553/755 (73%), Positives = 627/755 (83%), Gaps = 21/755 (2%)

Query: 28  MLLSSFSRPLRLGGTLSRLKSPLCAEFSQLKRGTFGISAF-HCQASH----TNRTLTPRI 82
           MLL+ FSR  + GG  +RL  PL  +    +RG  G+ AF H   +     T+R L    
Sbjct: 1   MLLARFSR--QQGG--ARL--PLGVQLLSWRRGLSGVQAFIHLSPARYHGATHRPLGLLQ 54

Query: 83  QETRFETHSLRLSVPRTLQLTRLYSQKTVESQAKTPADKESQKSGTMEDEESPNMGYKEV 142
           + T+     L L  P +    R +SQ +  S   + ++    K+     EE     Y+E+
Sbjct: 55  RPTQ-----LDLRNPVSSSFIRYHSQNSPNSSTPSSSNDSGGKANNESTEEKSKTNYREI 109

Query: 143 IRLFKLATHDWKLLTFAIGLLAISSVIGMSIPKVIGMVLDAIKNTYSSATGPVGLDDLPP 202
           +RL +LA HDWKLL+ AIGLL ISS +GM+IPKVIG+VLDA+KN     +GP+ L+DLPP
Sbjct: 110 LRLIRLARHDWKLLSVAIGLLTISSTVGMTIPKVIGIVLDAVKNASGGFSGPMTLEDLPP 169

Query: 203 IVNDLSMYEFLGIFAGALVIGTVANFGRIVLLRVLGEKLVARLRSNVIRKIIHQDAEFFD 262
           I+  L M++FL IFAG LV GT+ANFGRIVLLRVLGEKLVARLRSNVI+KIIHQDAEFFD
Sbjct: 170 IIYGLGMFDFLAIFAGILVFGTIANFGRIVLLRVLGEKLVARLRSNVIKKIIHQDAEFFD 229

Query: 263 RNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTSALLMFAPP 322
           RNKVGDLISRLSSDAYVVSRSMTQNVSDGFKA              S SLTSAL +FAPP
Sbjct: 230 RNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAIICGGVGIGMMINISASLTSALFLFAPP 289

Query: 323 LLIGALIYGKRIRMISRDLQESTGNLTRVSEEQLSGVKTIQSFVAEGKELQRYNTAIRKV 382
           LL+GALIYGK+IRMISR+LQESTGNLT+VSEEQLSGVKTIQ+FVAEGKEL RYN AIRKV
Sbjct: 290 LLVGALIYGKKIRMISRELQESTGNLTKVSEEQLSGVKTIQAFVAEGKELHRYNNAIRKV 349

Query: 383 FLYGKKEALTNATFFSSTNVLGDLSFLIVLAYGSHLVLQGGLTVGDLTAFMLYTEYTGSA 442
           F +GKKEALTNATFFSST +LGDLSFLIVLAYGSHLVLQGGL+VGDLTAFMLYTEYTGSA
Sbjct: 350 FSFGKKEALTNATFFSSTGILGDLSFLIVLAYGSHLVLQGGLSVGDLTAFMLYTEYTGSA 409

Query: 443 VFGLSNFYSELMKGAGAASRLFEMTDHAPSIKPTAGKPYVPGSGKISFKDVSFSYPTRPG 502
           VFGLSNFYSELMKGAGAASRLFEMTDH   IKP++GKPYVP  G+I F+DVSFSYPTRPG
Sbjct: 410 VFGLSNFYSELMKGAGAASRLFEMTDHTSQIKPSSGKPYVPSWGEIKFEDVSFSYPTRPG 469

Query: 503 NQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSL 562
           NQIFNKLNFTIEPGSNVC+VGPSGRGKSTI SLLLRYY+P+SG+I ID Q+IS+LSCKSL
Sbjct: 470 NQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSL 529

Query: 563 RRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIG 622
           RRHLGVVQQEPMLMSGSI+YNLTYG+ SEV+MDEIRSVAKKCFCHGF+TKFP GY+T+IG
Sbjct: 530 RRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFITKFPEGYETVIG 589

Query: 623 PRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTII 682
           PRGASLSGGQKQRIAIARAL+KKPKILILDEATSALDVESEGAINYTLG+LM+S+ELTII
Sbjct: 590 PRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSRELTII 649

Query: 683 SIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQSELYKLLNDKKRDKPTPRVQSD 742
           SIAHRLSTIRRSENVIVLGNDGSVVE+GKFK+LYA+ QSEL+KLLNDK   KPT ++QS 
Sbjct: 650 SIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFKLLNDK---KPT-QLQSQ 705

Query: 743 PEKDRE-QEHQIDNQVREQVANDFNLDQKSSKLTP 776
                E +E+++D+QV EQVANDFNLDQKSSKLTP
Sbjct: 706 SRNSVETKENEVDDQVLEQVANDFNLDQKSSKLTP 740

>SAKL0E00748g Chr5 complement(50683..53007) [2325 bp, 774 aa] {ON}
           similar to uniprot|P33311 Saccharomyces cerevisiae
           YPL270W MDL2 Half-type ATP-binding cassette (ABC)
           transporter of the inner mitochondrial membrane
          Length = 774

 Score =  972 bits (2513), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 470/652 (72%), Positives = 550/652 (84%), Gaps = 13/652 (1%)

Query: 138 GYKEVIRLFKLATHDWKLLTFAIGLLAISSVIGMSIPKVIGMVLDAIKNTYSSATGPVGL 197
           GYKE+ RLF+LA HDWKLL  AI LL IS  IGM++PKVIGMVLD  KN  +S   P  L
Sbjct: 123 GYKEIFRLFRLARHDWKLLLVAISLLTISCSIGMAVPKVIGMVLDVAKNAITSDEKPKDL 182

Query: 198 DDLPPIVNDLSMYEFLGIFAGALVIGTVANFGRIVLLRVLGEKLVARLRSNVIRKIIHQD 257
            DLPP+V  L +Y+FL +FAGALV+ T ANFGR+VLLR+LGEKLVARLRSNVI+K IHQD
Sbjct: 183 RDLPPVVWGLGLYDFLAVFAGALVLSTFANFGRVVLLRILGEKLVARLRSNVIKKTIHQD 242

Query: 258 AEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTSALL 317
           AEFFDRNKVGDLISRLSSDAYVVSRSMTQN+SDGFKA              S +L +AL 
Sbjct: 243 AEFFDRNKVGDLISRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMMFHISSTLATALF 302

Query: 318 MFAPPLLIGALIYGKRIRMISRDLQESTGNLTRVSEEQLSGVKTIQSFVAEGKELQRYNT 377
           +FAPPLL+GA IYG++IR ISRDLQ+STGNLT+V+EEQLSGVKT+QSFVAE KE++RYN 
Sbjct: 303 LFAPPLLVGATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYNH 362

Query: 378 AIRKVFLYGKKEALTNATFFSSTNVLGDLSFLIVLAYGSHLVLQGGLTVGDLTAFMLYTE 437
           AIRKVF  GK+EALTNATFFSST+VLGD SFLIVLAYGSHLVLQG L++GDLTAFMLYTE
Sbjct: 363 AIRKVFDVGKREALTNATFFSSTSVLGDFSFLIVLAYGSHLVLQGSLSIGDLTAFMLYTE 422

Query: 438 YTGSAVFGLSNFYSELMKGAGAASRLFEMTDHAPSIKPTAGKPYVPGSGKISFKDVSFSY 497
           Y+GSAVFGLSNFYSELMKGAGAASRLFE+TDH PSI  T G PYVPG G+I F++VSFSY
Sbjct: 423 YSGSAVFGLSNFYSELMKGAGAASRLFELTDHQPSIYATKGVPYVPGKGEIKFENVSFSY 482

Query: 498 PTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRL 557
           PTR  NQIFN LNFTI+ GSNVC+VGPSGRGKSTI SLLL+YYNP+SG+ITID QDIS++
Sbjct: 483 PTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKI 542

Query: 558 SCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGY 617
           S KSLRRHLGVVQQEP+LMSGSI+ N+TYG+    ++DEIRSV+KKCFCH F+TKF +GY
Sbjct: 543 SAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHNFITKFSDGY 602

Query: 618 DTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSK 677
           +T+IGP+GA LSGGQKQRIAIARAL+KKP ILILDEATSALDVESEGAINYTLG+LMKS+
Sbjct: 603 ETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSR 662

Query: 678 ELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQSELYKLLNDKKRD---- 733
           ++TIISIAHRLSTIRRSENVIVLG+DGSVVE+GKFK+LYA ++S+LYKLLN+K +D    
Sbjct: 663 DITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKLLNEKAKDTTSK 722

Query: 734 ---------KPTPRVQSDPEKDREQEHQIDNQVREQVANDFNLDQKSSKLTP 776
                     P+P+ +   ++++E++ +I+ QV  QV +D N DQKS+ L P
Sbjct: 723 MNAETVEKNDPSPKTEKLNDEEKEEQRRIEEQVLNQVLDDMNYDQKSTSLRP 774

>KLLA0D00748g Chr4 complement(69839..72208) [2370 bp, 789 aa] {ON}
           similar to uniprot|P33311 Saccharomyces cerevisiae
           YPL270W MDL2 Half-type ATP-binding cassette (ABC)
           transporter of the inner mitochondrial membrane
          Length = 789

 Score =  909 bits (2350), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 458/708 (64%), Positives = 543/708 (76%), Gaps = 46/708 (6%)

Query: 109 KTVESQAKTPADKESQKSGTMEDEESPNMGYKEVIRLFKLATHDWKLLTFAIGLLAISSV 168
           K  E + KTP  K ++ S T+        G  +V RLF LA HDWK+L  A+ LL +S  
Sbjct: 88  KHQEGEDKTPDKKTNKPSSTVSG------GLADVKRLFYLARHDWKMLVLAVSLLTVSCT 141

Query: 169 IGMSIPKVIGMVLDAIKNTYSSA-----------TGPVGLDDLPPIVNDLSMYEFLGIFA 217
           IGM++PKVIG+VLDA KN  S +           +  + LDDLPPIV D+ +Y+F  +F 
Sbjct: 142 IGMAVPKVIGLVLDATKNALSGSNTNNGNGGLEDSKSLTLDDLPPIVGDIQLYDFFLLFG 201

Query: 218 GALVIGTVANFGRIVLLRVLGEKLVARLRSNVIRKIIHQDAEFFDRNKVGDLISRLSSDA 277
           GAL+IGT+ANFGR+VLL++LGE+LVARLRSNVI+K +H D EF+DRNKVGDL+SRL +DA
Sbjct: 202 GALLIGTMANFGRVVLLKILGERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADA 261

Query: 278 YVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTSALLMFAPPLLIGALIYGKRIRMI 337
           Y+VSRSMTQN+SDGFKA              S +L S L +FAPPLL+GA IYG +IR I
Sbjct: 262 YIVSRSMTQNISDGFKALICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAI 321

Query: 338 SRDLQESTGNLTRVSEEQLSGVKTIQSFVAEGKELQRYNTAIRKVFLYGKKEALTNATFF 397
           SR+LQ+++GNLT+V+EEQLSG+KT+QSFVAEGKE+ RYN A+R+VF  GKKEA TNATFF
Sbjct: 322 SRELQQASGNLTKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFF 381

Query: 398 SSTNVLGDLSFLIVLAYGSHLVLQGGLTVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGA 457
           SSTNVLGD SFL+VLAYGSHLVLQG LT+GDLTAFMLYTEYTGSAVFGLS FYSELMKGA
Sbjct: 382 SSTNVLGDFSFLLVLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGA 441

Query: 458 GAASRLFEMTDHAPSIKPTAGKPYVPGSGKISFKDVSFSYPTRPGNQIFNKLNFTIEPGS 517
           GAA+RLFE+ D+ P+IK T GK + P +GK+ F+ VSFSYPTR  NQIF  LNFTIEPGS
Sbjct: 442 GAATRLFELLDYKPTIKSTTGKAFKPLNGKVEFQHVSFSYPTRKTNQIFKDLNFTIEPGS 501

Query: 518 NVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRHLGVVQQEPMLMS 577
           NVCIVGPSGRGKSTI SLLLRYYNP+SG+I +D QDI++LS KSLRR LGVVQQEP+LMS
Sbjct: 502 NVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMS 561

Query: 578 GSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIA 637
           G+I+ N+TYG+  + SM+EIRSVAKKCFCH F++KFPNGY+TIIGPRGA LSGGQKQRIA
Sbjct: 562 GTIRENITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRGALLSGGQKQRIA 621

Query: 638 IARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSENV 697
           IARAL+ KPKILILDEATSALDVESEGAINYTLG+LMKSKELTIISIAHRLSTIRRSENV
Sbjct: 622 IARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAHRLSTIRRSENV 681

Query: 698 IVLGNDGSVVEVGKFKDLYADQQSELYKLLNDKKRDK---------PTPRVQSDPE---- 744
           IVLG DGSVVE+GKFKDLYA+  S L+KLL +    +         P    +S+P+    
Sbjct: 682 IVLGIDGSVVEMGKFKDLYANHDSALHKLLTEPSEQQHSQHQQYAPPAITQESEPQTEEN 741

Query: 745 ----------KDREQEHQIDNQVR------EQVANDFNLDQKSSKLTP 776
                      D E+  Q  N+ R       QV  D + DQK+S L P
Sbjct: 742 GKDDSGEDQNSDHEENSQDQNEKRLQEEVIHQVLEDISHDQKTSTLRP 789

>Ecym_3007 Chr3 complement(14335..16644) [2310 bp, 769 aa] {ON}
           similar to Ashbya gossypii ACR022W
          Length = 769

 Score =  904 bits (2335), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 448/705 (63%), Positives = 545/705 (77%), Gaps = 41/705 (5%)

Query: 113 SQAKTPADKESQKSGTMEDE------ESPNMGYKEVIRLFKLATHDWKLLTFAIGLLAIS 166
           S +KT  D +    G ++D+      +  ++G++EV+RL  LA HDWKLL  AIGLL++S
Sbjct: 65  SLSKTKKDNDGNGRGLLKDDNDTQVQKETSVGWREVLRLCSLAKHDWKLLAVAIGLLSVS 124

Query: 167 SVIGMSIPKVIGMVLDAIKNTYSSA-------------------TGPVG-LDDLPPIVND 206
             IGM++PKVIG+VLDA KNT  S+                    GP+  LD LPPIV  
Sbjct: 125 CTIGMAVPKVIGLVLDATKNTLKSSYEKGSQDLEGVNEDKESLIAGPIASLDALPPIVGT 184

Query: 207 LSMYEFLGIFAGALVIGTVANFGRIVLLRVLGEKLVARLRSNVIRKIIHQDAEFFDRNKV 266
           LS+ +F+GIFAGALV+G  ANFGR+VLL+++GE+LV+RLRS VI++ +H D EFFDRNKV
Sbjct: 185 LSITQFVGIFAGALVVGATANFGRVVLLKIIGERLVSRLRSQVIKRTMHHDIEFFDRNKV 244

Query: 267 GDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTSALLMFAPPLLIG 326
           GDLISR  SDAYVVSRSMTQNVSDGFKA              S +LTS +L+FAPPLL+G
Sbjct: 245 GDLISRFGSDAYVVSRSMTQNVSDGFKAIICGGVGMGMMFHISSTLTSVMLLFAPPLLVG 304

Query: 327 ALIYGKRIRMISRDLQESTGNLTRVSEEQLSGVKTIQSFVAEGKELQRYNTAIRKVFLYG 386
           A IYGK+I  ISR LQ+S+GNLTRV+EEQL+G++TI+SFVAE KE++RYN AIR++F  G
Sbjct: 305 AFIYGKKISAISRQLQQSSGNLTRVAEEQLNGIRTIKSFVAEKKEIRRYNDAIRQLFYVG 364

Query: 387 KKEALTNATFFSSTNVLGDLSFLIVLAYGSHLVLQGGLTVGDLTAFMLYTEYTGSAVFGL 446
           K+EA TNATFFSST +LGD+SF+IVL YG++LVLQG L++GDLTAFMLYTEYTGS+VFGL
Sbjct: 365 KREAFTNATFFSSTTILGDMSFVIVLLYGANLVLQGALSIGDLTAFMLYTEYTGSSVFGL 424

Query: 447 SNFYSELMKGAGAASRLFEMTDHAPSIKPTAGKPYVPGSGKISFKDVSFSYPTRPGNQIF 506
           S FYSELMKGAGAASRLFE+ DH  S++        P  GKI F+DVSFSYPTRP NQIF
Sbjct: 425 STFYSELMKGAGAASRLFELMDHKNSVRSNISHALTPTQGKIEFRDVSFSYPTRPSNQIF 484

Query: 507 NKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRHL 566
             ++FTIEPGSNVCIVGPSG+GKSTITSLLLR+Y+P+ G I ID+ DIS+ + KSLRRHL
Sbjct: 485 KHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHL 544

Query: 567 GVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGA 626
           GVVQQEP LMSG+I+ N+TYGL    +MDEIR V+K+CFCHGF+TKFP+GYDT+IGPRGA
Sbjct: 545 GVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSKQCFCHGFITKFPDGYDTVIGPRGA 604

Query: 627 SLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTIISIAH 686
           SLSGGQ+QRIAIARAL+KKPKILILDEATSALDVESEGAINYTLG LM+SKELTIISIAH
Sbjct: 605 SLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGTLMRSKELTIISIAH 664

Query: 687 RLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQSELYKLLNDKKRD-----KPTPRVQS 741
           RLSTIRRSEN+IV+GNDGSVVEVGKF  LY +++SEL+KLLN+K  D     + T  +  
Sbjct: 665 RLSTIRRSENIIVVGNDGSVVEVGKFDKLYRNEESELFKLLNEKDHDLVSKSENTSDIPP 724

Query: 742 DPEKDREQ---EH-------QIDNQVREQVANDFNLDQKSSKLTP 776
           D  K+ +    EH        I+++V + V ND   D+ SS L P
Sbjct: 725 DSPKNDDASGLEHLVAEDVASINDKVVKNVLNDITHDKNSSTLRP 769

>ACR022W Chr3 (395427..397691) [2265 bp, 754 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL270W (MDL2)
          Length = 754

 Score =  879 bits (2271), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 442/695 (63%), Positives = 541/695 (77%), Gaps = 15/695 (2%)

Query: 93  RLSVPRTLQLTRLYSQKTVESQAK-TPADKESQKSGTMED--------EESPNMGYKEVI 143
           RL+VP   Q +R YS   V  +   +P DKE ++   +E         + +   G+ EV 
Sbjct: 49  RLTVPVCRQ-SRAYSAARVGGEGTPSPRDKEHEQERKVEKRPAEPSRAQPAKPAGWHEVF 107

Query: 144 RLFKLATHDWKLLTFAIGLLAISSVIGMSIPKVIGMVLDAIKNTYSSA----TG-PVGLD 198
           RL +L   DWKLL  A+GLL IS  IGM++PKVIG+VLDA K+  + A    TG P+ L 
Sbjct: 108 RLLRLVKPDWKLLLAALGLLTISCSIGMAVPKVIGLVLDATKDAVAQAEKNETGAPMSLL 167

Query: 199 DLPPIVNDLSMYEFLGIFAGALVIGTVANFGRIVLLRVLGEKLVARLRSNVIRKIIHQDA 258
           D+P I+ + ++ + L  FAGAL++G+ ANFGR+ LL++LGE+LVARLR+ VI+K +H DA
Sbjct: 168 DMPSIIGNFTLVDVLAAFAGALLVGSAANFGRMFLLKMLGERLVARLRAQVIKKTLHHDA 227

Query: 259 EFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTSALLM 318
           EFFDRNKVGDLISRL SDAY+VSRSMT N+SDG KA              S +LTSA++M
Sbjct: 228 EFFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVKAALCGGVGVGMMFHISSTLTSAMIM 287

Query: 319 FAPPLLIGALIYGKRIRMISRDLQESTGNLTRVSEEQLSGVKTIQSFVAEGKELQRYNTA 378
           FAPPLLI A IYGKRIR ISR+LQ+STGNLTRVSEEQ +G+KTI+SFVAEGKE++RYNTA
Sbjct: 288 FAPPLLIAATIYGKRIRAISRELQQSTGNLTRVSEEQFNGIKTIKSFVAEGKEMRRYNTA 347

Query: 379 IRKVFLYGKKEALTNATFFSSTNVLGDLSFLIVLAYGSHLVLQGGLTVGDLTAFMLYTEY 438
           +R++F   K+E +T+ATFFS TNVLGD+SFL+VLAYGSHLVLQG L++G LTAFMLYTEY
Sbjct: 348 VRRLFNVAKREGITSATFFSGTNVLGDVSFLLVLAYGSHLVLQGELSLGSLTAFMLYTEY 407

Query: 439 TGSAVFGLSNFYSELMKGAGAASRLFEMTDHAPSIKPTAGKPYVPGSGKISFKDVSFSYP 498
           TGS+VFGLSNFYSELMKGAGAASRLFE+TD+  S+  T G+ +VP  G+I FKDVSFSYP
Sbjct: 408 TGSSVFGLSNFYSELMKGAGAASRLFELTDYKKSVPSTVGQTFVPRDGRIEFKDVSFSYP 467

Query: 499 TRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLS 558
           TRP +QIF KL  TI PGSNVCIVGPSGRGKSTI SLLLR+Y+ +SG I ID QDIS++S
Sbjct: 468 TRPTSQIFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVS 527

Query: 559 CKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYD 618
            KSLR+HLGVVQQEP+LMSG+I+ N+TYGL    SMDEIR+VAKKCFCH F+TKFP+GYD
Sbjct: 528 AKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFITKFPDGYD 587

Query: 619 TIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKE 678
           T+IGPRGA LSGGQ+QRIAIARAL+KKPKILILDEATSALDVESEGAINYTLG+LM+SKE
Sbjct: 588 TVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKE 647

Query: 679 LTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQSELYKLLNDKKRDKPTPR 738
           +TI+SIAHRLSTIRRSEN++VLGNDGSV+E GKF DLY D+ SEL+KLLN+   +   P 
Sbjct: 648 ITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADLYRDEDSELFKLLNEHASEPAKPE 707

Query: 739 VQSDPEKDREQEHQIDNQVREQVANDFNLDQKSSK 773
               P ++     Q  +  R+    +  L+++  K
Sbjct: 708 ASPAPAQEEASAPQAADIPRDIEGGNLRLNEEVIK 742

>TDEL0G04660 Chr7 (850475..852694) [2220 bp, 739 aa] {ON} Anc_6.5
           YPL270W
          Length = 739

 Score =  853 bits (2205), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 423/635 (66%), Positives = 503/635 (79%), Gaps = 15/635 (2%)

Query: 99  TLQLTRLYSQKTVESQAKTPADKESQKSGTMEDEESPNMGYKEVIRLFKLATHDWKLLTF 158
           T  LTR ++      QAK+P + E QKSG            K+V+RL  LA  DWKLL  
Sbjct: 63  TRPLTRSFTSSVRLLQAKSPKEAE-QKSG-----------LKDVVRLLMLAKPDWKLLVI 110

Query: 159 AIGLLAISSVIGMSIPKVIGMVLDAIKN---TYSSATGPVGLDDLPPIVNDLSMYEFLGI 215
           AI LL +S  IGM+IPKVIGM+LD +K    T     GP+ + D+PPI    S+YEFLG 
Sbjct: 111 AITLLTVSCGIGMTIPKVIGMILDVLKTGLETNEGKDGPISMADVPPIFMGYSIYEFLGG 170

Query: 216 FAGALVIGTVANFGRIVLLRVLGEKLVARLRSNVIRKIIHQDAEFFDRNKVGDLISRLSS 275
           FA  +V G VAN+GRIVLLR+L E++VARLR+NVI+K IHQD+EFFDR+KVGDLISRL S
Sbjct: 171 FAALMVFGIVANYGRIVLLRILSERVVARLRANVIKKTIHQDSEFFDRHKVGDLISRLGS 230

Query: 276 DAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTSALLMFAPPLLIGALIYGKRIR 335
           DAYVVSRSMTQ VSDGFKA              S  L+  LL+F PP+L  A I+G++IR
Sbjct: 231 DAYVVSRSMTQKVSDGFKALICGGVGVGMMVSISPQLSGLLLLFTPPVLFSASIFGRKIR 290

Query: 336 MISRDLQESTGNLTRVSEEQLSGVKTIQSFVAEGKELQRYNTAIRKVFLYGKKEALTNAT 395
             S DLQE+TG LTRVSEEQLSGV+T+QSFVAE KE+ RY+ AIR +F  GK+ A  NA 
Sbjct: 291 DTSTDLQEATGQLTRVSEEQLSGVRTVQSFVAEQKEIHRYSHAIRDIFNVGKRAAYINAQ 350

Query: 396 FFSSTNVLGDLSFLIVLAYGSHLVLQGGLTVGDLTAFMLYTEYTGSAVFGLSNFYSELMK 455
           FF++T+ LGD+SFL+VLAYGS+LVLQGGLT+GDLTAFMLYTEYTGS+VFGL++FYSELM+
Sbjct: 351 FFTATSSLGDISFLVVLAYGSYLVLQGGLTIGDLTAFMLYTEYTGSSVFGLTSFYSELMQ 410

Query: 456 GAGAASRLFEMTDHAPSIKPTAGKPYVPGSGKISFKDVSFSYPTRPGNQIFNKLNFTIEP 515
           G GAA+RLFE+TD  PSIKPT GK +VPG G+I FKDV+FSYPTRPGN IF  ++  I  
Sbjct: 411 GVGAATRLFELTDRVPSIKPTTGKKFVPGKGEIVFKDVTFSYPTRPGNVIFRDMDIKIPA 470

Query: 516 GSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRHLGVVQQEPML 575
           GSNVC+VGPSGRGKSTI  LLLR+YNPSSGQI ID QDIS+L+ KSLRRH+G+VQQEP+L
Sbjct: 471 GSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVL 530

Query: 576 MSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQR 635
           MSG+++ N+TYGL    S +EIR VAK+CFCH F+ KFP+GYDT+IGP+GA LSGGQKQR
Sbjct: 531 MSGTLRDNITYGLTETPSKEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQR 590

Query: 636 IAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSE 695
           IAIARAL+KKP IL+LDEATSALDVESEGAINYT G+LMKSK +TI+SIAHRLSTIRRSE
Sbjct: 591 IAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTIRRSE 650

Query: 696 NVIVLGNDGSVVEVGKFKDLYADQQSELYKLLNDK 730
           N+IVLGNDGSVVE GKFK+L+AD  SEL KLLN+K
Sbjct: 651 NIIVLGNDGSVVETGKFKELFADPSSELSKLLNEK 685

>Kpol_1045.83 s1045 (193070..195316) [2247 bp, 748 aa] {ON}
           (193072..195318) [2247 nt, 749 aa]
          Length = 748

 Score =  833 bits (2153), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 409/641 (63%), Positives = 500/641 (78%), Gaps = 3/641 (0%)

Query: 120 DKESQKSGTMEDEESPNMGYKEVIRLFKLATHDWKLLTFAIGLLAISSVIGMSIPKVIGM 179
           + + Q+S T  D  +      ++ RL +LA  DWKLL  AI LL++S +IGMS+PK+IG+
Sbjct: 80  NTKEQESSTHTDGSNDKFELSDLKRLARLAKRDWKLLLTAISLLSVSCLIGMSLPKIIGI 139

Query: 180 VLDAIKNTYSSATGPVGLDDLPPIVNDLSMYEFLGIFAGALVIGTVANFGRIVLLRVLGE 239
           VLD +K   S+    V  DD+P I   L++YEF+ +   +L++GT AN+GR++LLRVL E
Sbjct: 140 VLDELKQIMSNPDFTV--DDVPEIAFGLNLYEFISLVGVSLLVGTAANYGRVILLRVLSE 197

Query: 240 KLVARLRSNVIRKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXX 299
           ++VARLR+NVI+K +HQDAEFFD NKVGDLISRLSSDAYVVSRS+TQ VSDGFKA     
Sbjct: 198 RVVARLRANVIKKTMHQDAEFFDNNKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGS 257

Query: 300 XXXXXXXXXSISLTSALLMFAPPLLIGALIYGKRIRMISRDLQESTGNLTRVSEEQLSGV 359
                    S  L++ LL   PP+++ A  +G+ IR  SRDLQE+TG+LT+V+EEQ SG+
Sbjct: 258 VGIGMMISISPQLSAFLLFLTPPVMLSASYFGRLIRNNSRDLQEATGSLTKVAEEQFSGI 317

Query: 360 KTIQSFVAEGKELQRYNTAIRKVFLYGKKEALTNATFFSSTNVLGDLSFLIVLAYGSHLV 419
           KT+QSFVAE KE++RYN AIR +F  GK+ A  NA FFS T VLGD+SFL+VLAYGS+LV
Sbjct: 318 KTVQSFVAEQKEIKRYNHAIRHIFNVGKQSAFINAKFFSLTAVLGDMSFLVVLAYGSYLV 377

Query: 420 LQGGLTVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHAPSIKPTAGK 479
           L G L++GDLTA+M+YTEYTGS++FGLS FYSE+M+GAGAASRLFE+TD  PSI PT GK
Sbjct: 378 LHGSLSIGDLTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASRLFELTDRIPSISPTLGK 437

Query: 480 PYVPGSGKISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRY 539
            +VP  G+I FK+VSFSYPTR  NQIF  L+F I+ GSNVCIVGPSGRGKSTI SLLLRY
Sbjct: 438 KFVPNKGEIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRY 497

Query: 540 YNPSSGQITIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRS 599
           YNP++GQI +D QDIS++S KSLRRH+ +VQQEP+LMSG+I+ N+TYGL  + + DE+RS
Sbjct: 498 YNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRS 557

Query: 600 VAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALD 659
           + KKCFCH F+TKFPN YDTI+GP G  LSGGQKQRIAIARAL+KKP ILILDEATSALD
Sbjct: 558 ITKKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALD 617

Query: 660 VESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQ 719
           VESEGAINYT GKLMKSK +TIISIAHRLSTIRRSENVIVLGNDGSV EVGKFK+LYAD 
Sbjct: 618 VESEGAINYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADP 677

Query: 720 QSELYKLLNDKK-RDKPTPRVQSDPEKDREQEHQIDNQVRE 759
            SEL KLL++K  R +       D E D E+   I+N   E
Sbjct: 678 GSELSKLLHEKATRSERQQNTAEDQEIDPEETINIENSTPE 718

>ZYRO0F00396g Chr6 complement(39330..41528) [2199 bp, 732 aa] {ON}
           similar to uniprot|P33311 Saccharomyces cerevisiae
           YPL270W MDL2 Half-type ATP-binding cassette (ABC)
           transporter of the inner mitochondrial membrane
          Length = 732

 Score =  832 bits (2148), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/628 (64%), Positives = 493/628 (78%), Gaps = 2/628 (0%)

Query: 139 YKEVIRLFKLATHDWKLLTFAIGLLAISSVIGMSIPKVIGMVLDAI-KNTYSSATGPVGL 197
           YK+ +RLF LA  DW+LL  AI LL IS VIGMSIPKVIG+VLD + K         V +
Sbjct: 77  YKDAVRLFSLAKRDWRLLCAAIALLTISCVIGMSIPKVIGLVLDVLRKGIEGKDLQNVNM 136

Query: 198 DDLPPIVNDLSMYEFLGIFAGALVIGTVANFGRIVLLRVLGEKLVARLRSNVIRKIIHQD 257
           DDL PI   L++Y+FLG+FAG L++GT ANF RIV+LR+L E++VARLRS V+ K +HQD
Sbjct: 137 DDLGPIAFGLTIYQFLGVFAGLLLVGTAANFARIVMLRILSERVVARLRSGVMNKTLHQD 196

Query: 258 AEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTSALL 317
           +EF+D +KVGDLISRL SDAYVVSRSMTQ VSDGFKA              S  L+  LL
Sbjct: 197 SEFYDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGIGMMVSISPELSGVLL 256

Query: 318 MFAPPLLIGALIYGKRIRMISRDLQESTGNLTRVSEEQLSGVKTIQSFVAEGKELQRYNT 377
            FAPP+L  A ++GK+IR  S+DLQE+TG LTRV+EEQLSGVKT+QSFVAE +EL RYN 
Sbjct: 257 FFAPPILWSASVFGKKIRHTSKDLQEATGQLTRVAEEQLSGVKTVQSFVAEQRELHRYNG 316

Query: 378 AIRKVFLYGKKEALTNATFFSSTNVLGDLSFLIVLAYGSHLVLQGGLTVGDLTAFMLYTE 437
           AIR ++  G+K A  NA FF+ST +LGD+SF++VL YGS+LVLQG LT+GDLTAFMLYTE
Sbjct: 317 AIRGIYNVGRKAAFINAEFFTSTTMLGDMSFIVVLLYGSYLVLQGSLTIGDLTAFMLYTE 376

Query: 438 YTGSAVFGLSNFYSELMKGAGAASRLFEMTDHAPSIKPTAGKPYVPGSGKISFKDVSFSY 497
           YTGS+VFGL+ FYSELM+G GAASRLF++TDH  SI PT G+ Y+PG G I FK+VSFSY
Sbjct: 377 YTGSSVFGLTTFYSELMQGVGAASRLFDLTDHISSISPTKGQKYIPGKGDIEFKNVSFSY 436

Query: 498 PTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRL 557
           PTRP NQIF  +N  + PGSNVCIVGPSGRGKSTI  LLLRYYNP++GQI +D QDIS++
Sbjct: 437 PTRPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKV 496

Query: 558 SCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGY 617
           +CK+LRRH+G+VQQEP+LMSG+I+ N+TYGL    + +EIRSVAK+CFCH F+TKFP+GY
Sbjct: 497 NCKTLRRHIGLVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGY 556

Query: 618 DTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSK 677
           DT+IG +GA LSGGQ+QRIAIARAL+KKP IL+LDEATSALDVESEGAINYT G+LMKS 
Sbjct: 557 DTMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSG 616

Query: 678 ELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQSELYKLLNDKKRDKPTP 737
            +TI+SIAHRLSTI+RSENVIVLG DGSV+E GKFK+L+A+  SEL KLL +K       
Sbjct: 617 SMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNSELCKLLTEKSSRSDGN 676

Query: 738 RVQSDPEKDREQEHQIDNQVREQVANDF 765
                P  +  Q+  ++ Q+ E++   F
Sbjct: 677 DSLPPPPPNATQDKVVE-QIAEKILERF 703

>TPHA0J00220 Chr10 complement(51873..54095) [2223 bp, 740 aa] {ON}
           Anc_6.5 YPL270W
          Length = 740

 Score =  830 bits (2145), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 418/683 (61%), Positives = 505/683 (73%), Gaps = 31/683 (4%)

Query: 99  TLQLTRLYSQKTVESQAKTPADKESQKSGTMEDEESPNMGYKEVIRLFKLATHDWKLLTF 158
           T+   R  S KT   Q + P              +S N G  ++ RL  LA  DWKLL  
Sbjct: 49  TITTKRWSSSKTTAPQVRVP--------------KSRNDG-NDIKRLLSLAKKDWKLLCI 93

Query: 159 AIGLLAISSVIGMSIPKVIGMVLDAIKNTYS--------SATGPVGLDDLPPIVNDLSMY 210
           A+GLL +S  IGMS+PKVIGMVLD +KN  S        SA   +   +LPPI   LS+Y
Sbjct: 94  AVGLLTVSCTIGMSLPKVIGMVLDLLKNAISKSEDAELGSADLSIESSELPPIAFGLSLY 153

Query: 211 EFLGIFAGALVIGTVANFGRIVLLRVLGEKLVARLRSNVIRKIIHQDAEFFDRNKVGDLI 270
           EFLG    AL+IGT ANFGR+VLLRVL E++VARLRS VI+K IHQDAEFFD NKVGDLI
Sbjct: 154 EFLGCIGAALLIGTAANFGRVVLLRVLSERVVARLRSQVIKKTIHQDAEFFDNNKVGDLI 213

Query: 271 SRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTSALLMFAPPLLIGALIY 330
           SRL SDAYVVSRSMTQ VSDGFKA              S  L++ LL F PP+++ ++ +
Sbjct: 214 SRLGSDAYVVSRSMTQKVSDGFKALLCGGVGVGMMVSISPELSAFLLFFTPPVMLSSMYF 273

Query: 331 GKRIRMISRDLQESTGNLTRVSEEQLSGVKTIQSFVAEGKELQRYNTAIRKVFLYGKKEA 390
           G+ IR  SR LQE+TG LTRVSEEQ SGVKT+Q+FVAE +E++RYN  I+ V+  GK+ A
Sbjct: 274 GRLIRDNSRKLQEATGQLTRVSEEQFSGVKTVQAFVAEQREIKRYNNVIKDVYNVGKESA 333

Query: 391 LTNATFFSSTNVLGDLSFLIVLAYGSHLVLQGGLTVGDLTAFMLYTEYTGSAVFGLSNFY 450
             NA  F+ T+ LGD+SFL+VLAYGS+LVL GGL++GDLTA+M+YTE TGSAVFGLS+FY
Sbjct: 334 FINAKLFTITSSLGDMSFLLVLAYGSYLVLHGGLSIGDLTAYMMYTELTGSAVFGLSSFY 393

Query: 451 SELMKGAGAASRLFEMTDHAPSIKPTAGKPYVPGSGKISFKDVSFSYPTRPGNQIFNKLN 510
           SE+M+G GAASRLFE+TD  P I PT GK Y+PG G+I FK+VSF+YPTRPG+QIF  LN
Sbjct: 394 SEIMQGVGAASRLFELTDRIPMISPTTGKKYIPGKGEIEFKNVSFAYPTRPGSQIFKSLN 453

Query: 511 FTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRHLGVVQ 570
           F IEPGSNVCIVGPSGRGKSTI SLLL+YY P++G IT+D QDIS+L+ KSLRRH+G+VQ
Sbjct: 454 FKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQ 513

Query: 571 QEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSG 630
           QEP+LMSGSI+ N+TYGL  E + +EIR V K+CFCH F+TKFP+ Y TI+GP G  LSG
Sbjct: 514 QEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFITKFPDQYQTILGPNGTLLSG 573

Query: 631 GQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTIISIAHRLST 690
           GQKQRIAIARAL+KKP +LILDEATSALDVESE AINYT GKLMK KE+TIISIAHRLST
Sbjct: 574 GQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIAHRLST 633

Query: 691 IRRSENVIVLGNDGSVVEVGKFKDLYADQQSELYKLLNDKK-------RDKPTPRVQSDP 743
           IRRSE VIVLGNDGSVVE+GKFK L+ +  SEL +LLN+K         +KP    + + 
Sbjct: 634 IRRSEIVIVLGNDGSVVEIGKFKTLFGNPLSELSQLLNEKSTINERNPNEKPAETPEQES 693

Query: 744 EKDREQEHQIDNQVREQV-ANDF 765
           +K+   E  +D  + E++  ND 
Sbjct: 694 QKNAANESIVDVVLEEEILQNDI 716

>YPL270W Chr16 (30482..32803) [2322 bp, 773 aa] {ON}
           MDL2Mitochondrial inner membrane half-type ATP-binding
           cassette (ABC) transporter, required for respiratory
           growth at high temperature; similar to human TAP1 and
           TAP2 implicated in bare lymphocyte syndrome and
           Wegener-like granulomatosis
          Length = 773

 Score =  826 bits (2134), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 427/668 (63%), Positives = 505/668 (75%), Gaps = 20/668 (2%)

Query: 100 LQLTRLYSQKTVESQA---KTPADKESQKSGTMEDEESPNMGYKEVIRLFKLATHDWKLL 156
           LQ  R  S KTV   +    +P  K S +S   + E+S    YK++IRLF LA  DWKLL
Sbjct: 61  LQSFRCNSSKTVPETSLPSASPISKGSARSAHAK-EQSKTDDYKDIIRLFMLAKRDWKLL 119

Query: 157 TFAIGLLAISSVIGMSIPKVIGMVLDAIKNTYSSATGPVGLDDLPPIVNDLSMYEFLGIF 216
             AI LL IS  IGMSIPKVIG+VLD +K +  S        DL   +  L +YEFL  F
Sbjct: 120 LTAILLLTISCSIGMSIPKVIGIVLDTLKTSSGS-----DFFDLKIPIFSLPLYEFLSFF 174

Query: 217 AGALVIGTVANFGRIVLLRVLGEKLVARLRSNVIRKIIHQDAEFFDRNKVGDLISRLSSD 276
             AL+IG  ANFGR +LLR+L E++VARLR+NVI+K +HQDAEFFD +KVGDLISRL SD
Sbjct: 175 TVALLIGCAANFGRFILLRILSERVVARLRANVIKKTLHQDAEFFDNHKVGDLISRLGSD 234

Query: 277 AYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTSALLMFAPPLLIGALIYGKRIRM 336
           AYVVSRSMTQ VSDG KA              S  L+  LL F PP+L  A ++GK+IR 
Sbjct: 235 AYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRN 294

Query: 337 ISRDLQESTGNLTRVSEEQLSGVKTIQSFVAEGKELQRYNTAIRKVFLYGKKEALTNATF 396
            S+DLQE+TG LTRV+EEQLSG+KT+QSFVAEG EL RYN AIR +F  GK  A TNA F
Sbjct: 295 TSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGKTAAFTNAKF 354

Query: 397 FSSTNVLGDLSFLIVLAYGSHLVLQGGLTVGDLTAFMLYTEYTGSAVFGLSNFYSELMKG 456
           F++T++LGDLSFL VLAYGS+LVLQ  L++GDLTAFMLYTEYTG+AVFGLS FYSE+M+G
Sbjct: 355 FTTTSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQG 414

Query: 457 AGAASRLFEMTDHAPSIKPTAGKPYVPGSGKISFKDVSFSYPTRPGNQIFNKLNFTIEPG 516
           AGAASRLFE+TD  PSI PT G  Y P  G I FKDVSFSYPTRP  QIF  LNF I PG
Sbjct: 415 AGAASRLFELTDRKPSISPTVGHKYKPDRGVIEFKDVSFSYPTRPSVQIFKNLNFKIAPG 474

Query: 517 SNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRHLGVVQQEPMLM 576
           S+VCIVGPSGRGKSTI  LLLRYYNP++G ITID+QDIS+L+CKSLRRH+G+VQQEP+LM
Sbjct: 475 SSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLM 534

Query: 577 SGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRI 636
           SG+I+ N+TYGL    + +EIRSVAK+CFCH F+TKFPN YDT+IGP G  LSGGQKQRI
Sbjct: 535 SGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRI 594

Query: 637 AIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSEN 696
           AIARAL+KKP ILILDEATSALDVESEGAINYT G+LMKSK +TI+SIAHRLSTIRRSEN
Sbjct: 595 AIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSEN 654

Query: 697 VIVLGNDGSVVEVGKFKDLYADQQSELYKLLNDKKRDKPTPRVQSDPEKDREQEHQIDNQ 756
           VIVLG+DGSVVE+GKFK+LYA+  S L +LLN+K    P+           +Q+ QI+  
Sbjct: 655 VIVLGHDGSVVEMGKFKELYANPTSALSQLLNEKAAPGPS-----------DQQLQIEKV 703

Query: 757 VREQVAND 764
           + ++  N+
Sbjct: 704 IEKEDLNE 711

>Suva_16.35 Chr16 (46072..48375) [2304 bp, 767 aa] {ON} YPL270W
           (REAL)
          Length = 767

 Score =  822 bits (2122), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/660 (63%), Positives = 503/660 (76%), Gaps = 7/660 (1%)

Query: 101 QLTRLYSQKTVESQAKTPADKESQKSGTMEDEESPNMGYKEVIRLFKLATHDWKLLTFAI 160
           Q  R  S KT +     P+   S++       +S +  YK++IRLF LA  DWKLL  AI
Sbjct: 62  QFVRFNSTKTQQDIPPLPSTSASKQPAK-PAYQSKSDDYKDIIRLFMLAKRDWKLLLTAI 120

Query: 161 GLLAISSVIGMSIPKVIGMVLDAIKNTYSSATGPVGLDDLPPIVNDLSMYEFLGIFAGAL 220
            LL IS  IGMSIPKVIG+VLD +K +  S        DL   +  L +YEFL  F  AL
Sbjct: 121 LLLTISCSIGMSIPKVIGIVLDTLKTSSGS-----DFFDLKIPIFSLPLYEFLSFFTVAL 175

Query: 221 VIGTVANFGRIVLLRVLGEKLVARLRSNVIRKIIHQDAEFFDRNKVGDLISRLSSDAYVV 280
           +IG VANFGR +LLR+L E++VARLR++VI+K +HQDAEFFD +KVGDLISRL SDAYVV
Sbjct: 176 LIGCVANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVV 235

Query: 281 SRSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTSALLMFAPPLLIGALIYGKRIRMISRD 340
           SRSMTQ VSDG KA              S  L+  LL F PP+L  A ++GK+IR  S+D
Sbjct: 236 SRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSVLLLFFTPPVLFSASVFGKQIRNTSKD 295

Query: 341 LQESTGNLTRVSEEQLSGVKTIQSFVAEGKELQRYNTAIRKVFLYGKKEALTNATFFSST 400
           LQE+TG LTRV+EEQLSG+KT+QSFVAEG EL RYN AIR +F  GK  A TNA FF++T
Sbjct: 296 LQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGKTAAFTNAKFFTTT 355

Query: 401 NVLGDLSFLIVLAYGSHLVLQGGLTVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAA 460
           ++LGDLSFL VLAYGS+LVLQ  L++GDLTAFMLYTEYTG+AVFGLS FYSE+M+GAGAA
Sbjct: 356 SLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAA 415

Query: 461 SRLFEMTDHAPSIKPTAGKPYVPGSGKISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVC 520
           SRLFE+TD  PSI PT G  Y P  G I FKDVSFSYPTRP  QIF  LNF I PGS+VC
Sbjct: 416 SRLFELTDRKPSISPTVGHKYKPDRGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVC 475

Query: 521 IVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSI 580
           IVGPSGRGKSTI  LLLRYYNP++G I ID+QDI++++CKSLRRH+G+VQQEP+LMSG+I
Sbjct: 476 IVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTI 535

Query: 581 KYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIAR 640
           + N+TYGL    + +EIRSVAK+CFCH F+TKFPN YDT+IGP G  LSGGQKQRIAIAR
Sbjct: 536 RDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIAR 595

Query: 641 ALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSENVIVL 700
           AL+KKP +LILDEATSALDVESEGAINYT G+LMKSK +TI+SIAHRLSTIRRSENVIVL
Sbjct: 596 ALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVL 655

Query: 701 GNDGSVVEVGKFKDLYADQQSELYKLLNDKKRDKPTPRVQSDPEKDREQEHQIDNQVREQ 760
           G+DGSVVE+GKFK+LY++  S L +LLN++    P+ + Q   EKD E+E   +++  +Q
Sbjct: 656 GHDGSVVEMGKFKELYSNPTSALSQLLNERTAPVPSEQ-QQQVEKDNEKEEPNEDENHDQ 714

>TBLA0A07190 Chr1 complement(1792994..1795378) [2385 bp, 794 aa]
           {ON} Anc_6.5 YPL270W
          Length = 794

 Score =  821 bits (2121), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/649 (63%), Positives = 510/649 (78%), Gaps = 9/649 (1%)

Query: 107 SQKTVESQAKTPADKESQKSGTMEDEESPNMGYKEVIRLFKLATHDWKLLTFAIGLLAIS 166
           + K   S  ++P   ++  S   EDE+    G  E+ RL  +   DWKLL  AI LL IS
Sbjct: 116 TDKINPSSIRSPPPNKTNYSPRAEDEKK---GRSELARLVLMTLRDWKLLLLAITLLTIS 172

Query: 167 SVIGMSIPKVIGMVLDAIKNTYSSATGPVGLDDLPPIVNDLSMYEFLGIFAGALVIGTVA 226
             IGM+IPKVIG+VLDA+KN  + +   +   DLPPI   L++Y FLG FAGALVIGT+ 
Sbjct: 173 CSIGMAIPKVIGLVLDALKNVMTDSPSSLETSDLPPIAFGLTLYPFLGAFAGALVIGTMC 232

Query: 227 NFGRIVLLRVLGEKLVARLRSNVIRKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQ 286
           N+GR +LLR+L E++VARLRS+VI+K +HQDAEFFD+NKVGDLISRL SDAYVVSRS+TQ
Sbjct: 233 NYGRYILLRLLSERVVARLRSHVIKKTLHQDAEFFDQNKVGDLISRLGSDAYVVSRSLTQ 292

Query: 287 NVSDGFKAXXXXXXXXXXXXXXSISLTSALLMFAPPLLIGALIYGKRIRMISRDLQESTG 346
            VSDGFKA              S  L+S L++FAP ++I A I+GK+IR IS  LQE+TG
Sbjct: 293 KVSDGFKAILCGGAGIGMMISISPQLSSFLVIFAPAVVISASIFGKKIRDISTILQEATG 352

Query: 347 NLTRVSEEQLSGVKTIQSFVAEGKELQRYNTAIRKVFLYGKKEALTNATFFSSTNVLGDL 406
            LTRVSEEQL+GVKT+QSFVAE KE++RYN AIR ++  GK  A+ N+ F +ST+V+GD+
Sbjct: 353 QLTRVSEEQLNGVKTVQSFVAEQKEIRRYNNAIRDIYNIGKMSAVVNSKFSTSTSVIGDM 412

Query: 407 SFLIVLAYGSHLVLQGGLTVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEM 466
           SFL+VLAYGS+LVL G LT+GDLTAFMLYT+YT +++FGLSNFYSE+M+G GAA RLF++
Sbjct: 413 SFLVVLAYGSYLVLHGSLTIGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRLFDL 472

Query: 467 TDHAPSIKPTAGKPYVPGSGKISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSG 526
           TD  P+I+PT G+ ++PG G I F+++ F+YPTRP NQ+F  LNF IEPG++VCIVGPSG
Sbjct: 473 TDRIPAIRPTIGEKFIPGDGCIEFRNLGFAYPTRPENQVFKNLNFKIEPGTSVCIVGPSG 532

Query: 527 RGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLTY 586
           RGKSTI  LLLRYYNPSSGQI ID+QDI +L+ KSLR+++G+VQQEP+LMSGSI+ N+TY
Sbjct: 533 RGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITY 592

Query: 587 GLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKP 646
           GL+ E + DEIR V+K+CFCH F+TKFP+ Y+TIIGP G  LSGGQKQRIAIARAL+KKP
Sbjct: 593 GLKREATPDEIREVSKQCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKP 652

Query: 647 KILILDEATSALDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSV 706
           KILILDEATSALDVESEGAINYT GKLMKSK +TI+SIAHRLSTIRRSE +IVLGNDGSV
Sbjct: 653 KILILDEATSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSV 712

Query: 707 VEVGKFKDLYADQQSELYKLLNDK-----KRDKPTPRVQSDPEKDREQE 750
           VE GKFK+LYAD  SEL KLLN+K     K++ P P  QSD E   + E
Sbjct: 713 VETGKFKELYADPTSELSKLLNEKQSRANKKEAPLPP-QSDGENGDDFE 760

>CAGL0A01133g Chr1 (112037..114442) [2406 bp, 801 aa] {ON} similar
           to uniprot|P33311 Saccharomyces cerevisiae YPL270w MDL2
          Length = 801

 Score =  822 bits (2122), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/643 (62%), Positives = 498/643 (77%), Gaps = 9/643 (1%)

Query: 110 TVESQAKT-PADKESQKSGTMEDEESPNMG-----YKEVIRLFKLATHDWKLLTFAIGLL 163
           +V+SQ+ T   ++E +K    E EE          +++++RL  L   DWKLL  A+GLL
Sbjct: 82  SVKSQSATKEKNEEDRKYSKKEKEEQSETKENHSEFRDIVRLMLLVRRDWKLLLTAVGLL 141

Query: 164 AISSVIGMSIPKVIGMVLDAIKNTYSSAT---GPVGLDDLPPIVNDLSMYEFLGIFAGAL 220
            IS  IGM+IPKVIG++LD +KN  ++ +    PV +D LPPIV  LS YEFLG FA AL
Sbjct: 142 TISCSIGMTIPKVIGLILDQLKNALAANSVDGQPVSIDKLPPIVFGLSFYEFLGGFALAL 201

Query: 221 VIGTVANFGRIVLLRVLGEKLVARLRSNVIRKIIHQDAEFFDRNKVGDLISRLSSDAYVV 280
           ++G  AN+GRI+LLRVL E+LVARLR+ VI+K IHQDAEFFD +KVGDLISRL SDAYVV
Sbjct: 202 LVGIAANYGRIILLRVLSERLVARLRATVIKKTIHQDAEFFDTHKVGDLISRLGSDAYVV 261

Query: 281 SRSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTSALLMFAPPLLIGALIYGKRIRMISRD 340
           SRSMTQ VSDGFKA              S  L+  LL+F PP+++ A ++GK+I   SR+
Sbjct: 262 SRSMTQKVSDGFKALICGSVGIGMMLALSPQLSCLLLVFTPPVILSASVFGKQISTTSRE 321

Query: 341 LQESTGNLTRVSEEQLSGVKTIQSFVAEGKELQRYNTAIRKVFLYGKKEALTNATFFSST 400
           LQE+TG+LT+V+EEQLSG+KT+QSFVAE +E+ RYN AIR +F  GKK A+ NA FFSST
Sbjct: 322 LQEATGHLTKVAEEQLSGIKTVQSFVAEQREINRYNFAIRDIFNIGKKAAVINAKFFSST 381

Query: 401 NVLGDLSFLIVLAYGSHLVLQGGLTVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAA 460
           + +GDLSFL VL +GS+LVLQ  LT+GDLTAFM+YTEYTG+++FGLS FYSE+M+GAGAA
Sbjct: 382 SAMGDLSFLTVLGFGSYLVLQNSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQGAGAA 441

Query: 461 SRLFEMTDHAPSIKPTAGKPYVPGSGKISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVC 520
           SRLFE+TD  PSI  T G  Y PG+G+I FK+VSF+YPTRP N IF  LNF IE GSNVC
Sbjct: 442 SRLFELTDRVPSISTTKGVKYKPGNGEIEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVC 501

Query: 521 IVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSI 580
           IVGPSGRGKST+  LL +YY PSSG+I ID Q+I+ L+ KSLRRH+G+VQQEP+LMSG+I
Sbjct: 502 IVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPILMSGTI 561

Query: 581 KYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIAR 640
           + N+ YGL    + DEIR VAK+CFCH F+T+F + YDT+IGP G  LSGGQKQRIAIAR
Sbjct: 562 RDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQSSYDTVIGPHGTLLSGGQKQRIAIAR 621

Query: 641 ALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSENVIVL 700
           AL+KKP+ILILDEATSALDVESEGAINYT G+LMK KE+TI+SIAHRLSTIRRSENVIVL
Sbjct: 622 ALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVL 681

Query: 701 GNDGSVVEVGKFKDLYADQQSELYKLLNDKKRDKPTPRVQSDP 743
           G+DGSVVE+GKFK+L+ D  SEL +LLN+K     T  +   P
Sbjct: 682 GHDGSVVEMGKFKELWDDPTSELSQLLNEKSTPHQTTNITVTP 724

>Skud_16.7 Chr16 (9624..11945) [2322 bp, 773 aa] {ON} YPL270W (REAL)
          Length = 773

 Score =  818 bits (2112), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/618 (66%), Positives = 483/618 (78%), Gaps = 6/618 (0%)

Query: 139 YKEVIRLFKLATHDWKLLTFAIGLLAISSVIGMSIPKVIGMVLDAIKNTYSSATGPVGLD 198
           YK++IRLF LA  DWKLL  AI LL IS  IGMSIPKVIG+VLD +K +  S        
Sbjct: 102 YKDIIRLFMLAKRDWKLLLTAILLLTISCSIGMSIPKVIGIVLDTLKTSSGS-----DFF 156

Query: 199 DLPPIVNDLSMYEFLGIFAGALVIGTVANFGRIVLLRVLGEKLVARLRSNVIRKIIHQDA 258
           +L   +  L +YEFL  F  AL+IG  ANFGR +LLR+L E++VARLR++VI+K +HQDA
Sbjct: 157 ELKIPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAHVIKKTLHQDA 216

Query: 259 EFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTSALLM 318
           EFFD +KVGDLISRL SDAYVVSRSMTQ VSDG KA              S  L+  LL 
Sbjct: 217 EFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLF 276

Query: 319 FAPPLLIGALIYGKRIRMISRDLQESTGNLTRVSEEQLSGVKTIQSFVAEGKELQRYNTA 378
           F PP+L  A ++GK+IR  S+DLQE+TG LTRV+EEQLSG+KT+QSFVAEG EL RYN A
Sbjct: 277 FTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVA 336

Query: 379 IRKVFLYGKKEALTNATFFSSTNVLGDLSFLIVLAYGSHLVLQGGLTVGDLTAFMLYTEY 438
           IR +F  GK  A TNA FF++T++LGDLSFL VLAYGS+LVLQ  L++GDLTAFMLYTEY
Sbjct: 337 IRDIFQVGKTAAFTNAKFFTTTSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEY 396

Query: 439 TGSAVFGLSNFYSELMKGAGAASRLFEMTDHAPSIKPTAGKPYVPGSGKISFKDVSFSYP 498
           TG+AVFGLS FYSE+M+GAGAASRLFE+TD  PSI PTAG  Y P  G + FKDVSFSYP
Sbjct: 397 TGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTAGHKYKPHRGVVEFKDVSFSYP 456

Query: 499 TRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLS 558
           TRP  QIF  LNF I PGS+VCIVGPSGRGKSTI  LLLRYYNPS+G I IDDQDI++++
Sbjct: 457 TRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMN 516

Query: 559 CKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYD 618
           CKSLRRH+G+VQQEP+LMSG+I+ N+TYGL    + +EIRSVAK+CFCH F+TKFPN YD
Sbjct: 517 CKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYD 576

Query: 619 TIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKE 678
           T+IG RG  LSGGQKQRIAIARAL+KKP ILILDEATSALDVESEGAINYT G LMKSK 
Sbjct: 577 TVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGHLMKSKS 636

Query: 679 LTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQSELYKLLNDKKRDKPTPR 738
           +TIISIAHRLSTIRRSENVIVLG+DGSVVE+GKFK LYA+  S L +LLN++    P+ +
Sbjct: 637 MTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPTSALSQLLNERAAPGPSDQ 696

Query: 739 VQSDPEKDREQEHQIDNQ 756
            Q   EKD E E   + +
Sbjct: 697 -QQQIEKDNENEESTEEK 713

>Smik_6.478 Chr6 complement(788399..790720) [2322 bp, 773 aa] {ON}
           YPL270W (REAL)
          Length = 773

 Score =  814 bits (2103), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/629 (65%), Positives = 488/629 (77%), Gaps = 6/629 (0%)

Query: 132 EESPNMGYKEVIRLFKLATHDWKLLTFAIGLLAISSVIGMSIPKVIGMVLDAIKNTYSSA 191
           E+S    YK++IRLF LA  DWKLL  AI LL IS  IGMSIPKVIG+VLD +K +  S 
Sbjct: 95  EQSKTDDYKDIIRLFMLAKRDWKLLLTAILLLTISCSIGMSIPKVIGIVLDTLKTSSGS- 153

Query: 192 TGPVGLDDLPPIVNDLSMYEFLGIFAGALVIGTVANFGRIVLLRVLGEKLVARLRSNVIR 251
                  DL   +  L +YEFL  F  AL+IG  ANFGR +LLR+L E++VARLR++VI+
Sbjct: 154 ----DFFDLKIPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAHVIK 209

Query: 252 KIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSIS 311
           K +HQDAEFFD +KVGDLISRL SDAYVVSRSMTQ VSDG KA              S  
Sbjct: 210 KTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCSLSPQ 269

Query: 312 LTSALLMFAPPLLIGALIYGKRIRMISRDLQESTGNLTRVSEEQLSGVKTIQSFVAEGKE 371
           L+  LL F PP+L  A ++GK+IR  S+DLQE+TG LTRV+EEQLSG+KT+QSFVAEG E
Sbjct: 270 LSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNE 329

Query: 372 LQRYNTAIRKVFLYGKKEALTNATFFSSTNVLGDLSFLIVLAYGSHLVLQGGLTVGDLTA 431
           L RYN AIR +F  GK  A TNA FF++T++LGDLSFL VLAYGS+LVLQ  L++GDLTA
Sbjct: 330 LSRYNVAIRDIFQVGKTAAFTNAKFFTTTSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTA 389

Query: 432 FMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHAPSIKPTAGKPYVPGSGKISFK 491
           FMLYTEYTG+AVFGLS FYSE+M+GAGAASRLFE+TD  PSI PT G  Y P  G I FK
Sbjct: 390 FMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYQPERGVIEFK 449

Query: 492 DVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDD 551
           DVSFSYPTRP  QIF  LNF I PGS+VCIVGPSGRGKSTI  LLLRYYNP++G I ID+
Sbjct: 450 DVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDN 509

Query: 552 QDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVT 611
           QDI++L+CKSLRR +G+VQQEP+LMSG+I+ N+TYGL    + +EIRSVAK+CFCH F+T
Sbjct: 510 QDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFIT 569

Query: 612 KFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLG 671
           KFPN YDT+IGP G  LSGGQKQRIAIARAL+KKP ILILDEATSALDVESEGAINYT G
Sbjct: 570 KFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFG 629

Query: 672 KLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQSELYKLLNDKK 731
           +LMKSK +TI+SIAHRLSTIRRSENVIVLG+DGSVVE+GKFK+LYA+  S L +LLN++ 
Sbjct: 630 QLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQLLNERA 689

Query: 732 RDKPTPRVQSDPEKDREQEHQIDNQVREQ 760
              P+ + Q   EK  E+E   + +  +Q
Sbjct: 690 APGPSDQ-QLQIEKVEEKEDTNEGEKHDQ 717

>NCAS0D02210 Chr4 (410709..413030) [2322 bp, 773 aa] {ON} Anc_6.5
          Length = 773

 Score =  811 bits (2094), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/692 (60%), Positives = 526/692 (76%), Gaps = 17/692 (2%)

Query: 95  SVPRTLQLTRLYSQKTVESQAKTPADKESQKSGTMEDEESPNMGYKEVIRLFKLATHDWK 154
           S+   L +TRL S  TV +Q+K    + S +   +   E P   + +VIRLF L   DWK
Sbjct: 83  SLTSQLTITRLNS--TVSTQSKD-NKQPSLQGNPLSTSEEPKSNFSDVIRLFLLVKTDWK 139

Query: 155 LLTFAIGLLAISSVIGMSIPKVIGMVLDAIKNTYSSATGPVGLDDLPPIVN-DLSMYEFL 213
           LL  A+ LL IS VIGM IPKVIG++LD++K    +AT   G +  PPI+   L++YEFL
Sbjct: 140 LLLVALTLLTISCVIGMMIPKVIGIILDSLK--VQTATQSEGEEAPPPIMMFGLTIYEFL 197

Query: 214 GIFAGALVIGTVANFGRIVLLRVLGEKLVARLRSNVIRKIIHQDAEFFDRNKVGDLISRL 273
           G F+ AL+ G +ANFGR++LLR+L E+LVARLRS VI++ IHQDA+F+D +K GDLISRL
Sbjct: 198 GGFSIALLAGCMANFGRLILLRILSERLVARLRSTVIKRTIHQDAQFYDIHKTGDLISRL 257

Query: 274 SSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTSALLMFAPPLLIGALIYGKR 333
            +DAY+VSRS+TQ +SDGFK+              S+ L++ L +   P++I A I+GK+
Sbjct: 258 GADAYIVSRSITQKISDGFKSLICGGVGVGMMCSLSLDLSAVLGVLIIPVVISASIFGKQ 317

Query: 334 IRMISRDLQESTGNLTRVSEEQLSGVKTIQSFVAEGKELQRYNTAIRKVFLYGKKEALTN 393
           IR+ SR+LQ++TG LTRVSEEQL+GVKT+QSFVAE +E++R+N AIR +F  GK+ A  N
Sbjct: 318 IRINSRELQDATGQLTRVSEEQLNGVKTVQSFVAEQREIKRFNEAIRNIFHVGKRSAFIN 377

Query: 394 ATFFSSTNVLGDLSFLIVLAYGSHLVLQGGLTVGDLTAFMLYTEYTGSAVFGLSNFYSEL 453
           A FF+ST+++GDLSFL VL YGS+LVL G LT+GDLTAFMLYTEYTG+++FGLS FYSE+
Sbjct: 378 AKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEI 437

Query: 454 MKGAGAASRLFEMTDHAPSIKPTAGKPYVPGSGKISFKDVSFSYPTRPGNQIFNKLNFTI 513
           M+GAGAASRLFE+TD+ P I+PT GK Y+PG G+I FK+VSFSYPTRP NQIF  LNF I
Sbjct: 438 MQGAGAASRLFELTDYVPEIRPTLGKTYLPGKGEIEFKNVSFSYPTRPQNQIFKNLNFKI 497

Query: 514 EPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRHLGVVQQEP 573
           EPGSNVCIVGPSG+GKSTI  LLL YYNP+SGQI ID QDI++++ KSLRR LG+VQQEP
Sbjct: 498 EPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEP 557

Query: 574 MLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQK 633
           +LMSGSI+ N+TYGL    + +EIR VAK+CFCH F+TKFP+ YDT IGP G  LSGGQK
Sbjct: 558 VLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSGTLLSGGQK 617

Query: 634 QRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRR 693
           QRIAIARAL+KKP ILILDEATSALDVESEGAINYT G+LMK+K +TI+SIAHRLSTIRR
Sbjct: 618 QRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAHRLSTIRR 677

Query: 694 SENVIVLGNDGSVVEVGKFKDLYADQQSELYKLLNDK---KRDKPTPRVQSDPEKDR--- 747
           SENVIVLGNDGSV+E+GKFK+L++D  SEL KLLN+K   K+ K  P + S PE D    
Sbjct: 678 SENVIVLGNDGSVIEMGKFKELFSDPSSELSKLLNEKSSRKKTKSDP-ISSAPEVDADAT 736

Query: 748 -EQEHQIDNQVRE---QVANDFNLDQKSSKLT 775
            E    ID  + +    V ND   + K  K++
Sbjct: 737 GEPVEPIDPAIEDALHSVLNDVTSESKPIKMS 768

>NDAI0I02730 Chr9 complement(640429..642927) [2499 bp, 832 aa] {ON}
           Anc_6.5
          Length = 832

 Score =  809 bits (2090), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/617 (64%), Positives = 492/617 (79%), Gaps = 7/617 (1%)

Query: 122 ESQKSGTMEDEESPNMG---YKEVIRLFKLATHDWKLLTFAIGLLAISSVIGMSIPKVIG 178
           ES K+ T  +E  P+ G   +K+V RLF L   D+KLL  ++ LL IS  IGM IPK+IG
Sbjct: 140 ESTKASTEPNEIEPDQGESNFKDVFRLFLLVKKDYKLLIVSLTLLTISCTIGMMIPKIIG 199

Query: 179 MVLDAIKNTYSSATGPVGLDDLPP-IVNDLSMYEFLGIFAGALVIGTVANFGRIVLLRVL 237
           ++LDA+K   S AT P G    PP I+  L++YEFLG F+ AL IG  AN+GR++LLR+L
Sbjct: 200 LILDALK---SVATTPDGGSSPPPTIMFGLTLYEFLGGFSVALFIGCAANYGRLILLRIL 256

Query: 238 GEKLVARLRSNVIRKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXX 297
            E+LVARLRS V++  +HQD+EFFD +KVGDLISRL +D+Y+VSRS+TQ +SDG K+   
Sbjct: 257 SERLVARLRSVVMKHTLHQDSEFFDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLIC 316

Query: 298 XXXXXXXXXXXSISLTSALLMFAPPLLIGALIYGKRIRMISRDLQESTGNLTRVSEEQLS 357
                      S+ L+S L+ F  P+++ A I+GK+IR+ SR+LQ++TG LTRVSEEQL+
Sbjct: 317 GGVGIGMMLELSMDLSSVLVCFVIPVVLSASIFGKQIRINSRELQDATGQLTRVSEEQLN 376

Query: 358 GVKTIQSFVAEGKELQRYNTAIRKVFLYGKKEALTNATFFSSTNVLGDLSFLIVLAYGSH 417
           GV+T+QSFVAE +E++R+N +IR++F  GK+ A  NA FF+ST+++GDLSFL VL YGS+
Sbjct: 377 GVRTVQSFVAEQREIKRFNHSIREIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVYGSY 436

Query: 418 LVLQGGLTVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHAPSIKPTA 477
           LVL G LT+GDLTAFMLYTEYTG+A+FGLS FYSE+M+GAGAASRLFE+TD  P+I+PT 
Sbjct: 437 LVLHGSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTDRVPTIRPTL 496

Query: 478 GKPYVPGSGKISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLL 537
           GK Y PG G+I FK+VSF+YPTRP NQIF  LNF I+PGSNVCIVGPSG+GKSTI  LLL
Sbjct: 497 GKTYTPGKGEIEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLL 556

Query: 538 RYYNPSSGQITIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEI 597
            YYNP+SGQI ID QDI++L+ KSLRR + VVQQEP+LMSG+I+ N+TYGL  E + +EI
Sbjct: 557 HYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEI 616

Query: 598 RSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSA 657
           R+VAK+CFCH F+ KFP  YDT IGP G  LSGGQKQRIAIARAL+KKP ILILDEATSA
Sbjct: 617 RTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSA 676

Query: 658 LDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYA 717
           LDVESEGAINYT G+LMKSK +TI+SIAHRLSTIRRSEN+IVLGNDGSVVE+GKFK+L+A
Sbjct: 677 LDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMGKFKELFA 736

Query: 718 DQQSELYKLLNDKKRDK 734
           D  SEL KLLN+K   K
Sbjct: 737 DPTSELSKLLNEKSSRK 753

>KNAG0E02800 Chr5 (562361..564586) [2226 bp, 741 aa] {ON} Anc_6.5
           YPL270W
          Length = 741

 Score =  744 bits (1922), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/680 (56%), Positives = 489/680 (71%), Gaps = 15/680 (2%)

Query: 68  HCQASHTNRTLTPRIQETRFETHSLRLSVPRT----LQLTRLYSQKTVESQAKTPADKES 123
           H   S   RT    I   R  +H L ++  RT    ++ + L  ++ + S   TP + E 
Sbjct: 14  HTGPSLYKRTFVSPIWRFRAGSH-LNVNRVRTPLHFVKRSPLIPRRVLYSTDVTPKEPEK 72

Query: 124 QKSGTMEDEESPNMGYKEVIRLFKLATHDWKLLTFAIGLLAISSVIGMSIPKVIGMVLDA 183
           Q +  +  +      YK++ RLF L   DWKLL  A+ LL +S  IGM IPKVIG VLD+
Sbjct: 73  QPAVVVHPKPEDEGTYKDIWRLFLLVKSDWKLLMSALTLLTVSCGIGMCIPKVIGTVLDS 132

Query: 184 IKNTYSSATGPVGLDDLPPIVNDLSMYEFLGIFAGALVIGTVANFGRIVLLRVLGEKLVA 243
           +K+        +       ++ D+S+  F    +G L++G  AN+ R++LLR+L E LVA
Sbjct: 133 LKDIQGKEFSEL-------MIWDMSLKHFFYGLSGLLLLGCGANYVRVILLRILSENLVA 185

Query: 244 RLRSNVIRKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXX 303
           +LR+NVI+ IIHQDA+FFD  KVGDLISR+ +DA++VSRS+TQ +SDG KA         
Sbjct: 186 KLRANVIKHIIHQDAQFFDTYKVGDLISRVGNDAFIVSRSITQKISDGVKAVFIGSAGVG 245

Query: 304 XXXXXSISLT-SALLMFAPPLLIGALIYGKRIRMISRDLQESTGNLTRVSEEQLSGVKTI 362
                SI L+ S L++   PLL+ A ++GK+IR  S+ LQE T NLTRVSEEQ +G+KTI
Sbjct: 246 MMLSISIPLSCSILILMGSPLLLSAKVFGKQIRDNSKKLQEVTANLTRVSEEQFNGIKTI 305

Query: 363 QSFVAEGKELQRYNTAIRKVFLYGKKEALTNATFFSSTNVLGDLSFLIVLAYGSHLVLQG 422
           QSFVAE  E+ ++N +IRK+F  GK+ A  NA FF++ +++GDLSFL+VL+YGS LV Q 
Sbjct: 306 QSFVAEQSEMHKFNGSIRKIFAVGKEAAFINAKFFTTASIIGDLSFLVVLSYGSWLVFQQ 365

Query: 423 GLTVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHAPSIKPTAGKPYV 482
            L+VGDLTAFMLYTEYTG+A+F LS F+SE+M+GAGAASR+FE+TD  P I PT G  ++
Sbjct: 366 QLSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQGAGAASRIFELTDLKPRINPTRGSKFI 425

Query: 483 PGSG-KISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYN 541
           P  G +I FK+VSF+YPTRP   IF  LNF IE GSNVCIVGPSG+GKSTI  LLL YYN
Sbjct: 426 PAKGGEIEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYN 485

Query: 542 PSSGQITIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVA 601
           PS GQI ID QDIS LS KSLRRH+G+VQQEP+LMSG+I+ N+TYGL    + +EIRSVA
Sbjct: 486 PSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVA 545

Query: 602 KKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVE 661
           K+CFCH F+T+FP+ YDT IGP G  LSGGQKQRIAIARAL+KKP +LILDEATSALDVE
Sbjct: 546 KQCFCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVE 605

Query: 662 SEGAINYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQS 721
           SEGAINYT G+LMKSK +TI+SIAHRLSTIRRSENVIVLGNDGSVVE GKFK+L+A+  S
Sbjct: 606 SEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKELFANPAS 665

Query: 722 ELYKLLNDKKR-DKPTPRVQ 740
           EL KLL +K   +   P +Q
Sbjct: 666 ELSKLLREKSSGNNAAPEIQ 685

>KAFR0B06480 Chr2 complement(1344413..1346668) [2256 bp, 751 aa]
           {ON} Anc_6.5 YPL270W
          Length = 751

 Score =  688 bits (1775), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/630 (56%), Positives = 459/630 (72%), Gaps = 22/630 (3%)

Query: 139 YKEVIRLFKLATHDWKLLTFAIGLLAISSVIGMSIPKVIGMVLDAIKNTYSSATGPVGLD 198
           ++++ RL  L   D KLL  AI LL IS  IGM+IPK+IG +LD ++N Y + T    + 
Sbjct: 83  WRDLKRLTVLIKKDIKLLVLAIVLLTISCSIGMAIPKIIGTILDTLRNNYENLTSLSQIK 142

Query: 199 DLPPIVNDLSMYEFLGIFAGALVIGTVANFGRIVLLRVLGEKLVARLRSNVIRKIIHQDA 258
            L     ++ +  FL      L+ G  ANFGR+V+LR++ E+LV+RLRS V++ IIH+D 
Sbjct: 143 IL-----NIPLSTFLMGVGITLIFGCFANFGRVVILRIISERLVSRLRSQVVKNIIHKDL 197

Query: 259 EFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTSALLM 318
           EFFD  KVGDL+SR+ +DA+VVSRS+T  V+DG ++              S  LT AL  
Sbjct: 198 EFFDTFKVGDLMSRVGNDAFVVSRSITHKVADGVRSGFIGIFGIGLMLTLSRELTGALFA 257

Query: 319 FAPPLLIGALIYGKRIRMISRDLQESTGNLTRVSEEQLSGVKTIQSFVAEGKELQRYNTA 378
             PP++    ++GK+IRM S+ LQ+ TG+LTRV+EEQ +G++T+Q FVAE  E++R+N  
Sbjct: 258 ILPPIIWCTSVFGKQIRMNSKKLQDVTGDLTRVTEEQFNGIRTVQGFVAERNEIKRFNNV 317

Query: 379 IRKVFLYGKKEALTNATFFSSTNVLGDLSFLIVLAYGSHLVLQGGLTVGDLTAFMLYTEY 438
           +R++F  GK+ A  N  FF+S +++GDL FLIVL YGS+LV+ G +++GDLTAFMLYTEY
Sbjct: 318 LREIFQVGKESAFINGKFFTSASLIGDLGFLIVLTYGSYLVMHGSMSIGDLTAFMLYTEY 377

Query: 439 TGSAVFGLSNFYSELMKGAGAASRLFEMTDHAPSIKPTAGKP-YVP----GSGKISFKDV 493
           TG+A+FGLS+FYSELM+G GAASR+FE+ D  P IK T G+  + P    G  +I FK+V
Sbjct: 378 TGNAIFGLSSFYSELMQGVGAASRIFEINDKEPKIKSTTGEAKFKPLNEVGGCEIEFKNV 437

Query: 494 SFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQD 553
           SF YPTRP NQIF  LNF +  GSNVCIVGPSGRGKSTI SLLL +YN  SGQI ID QD
Sbjct: 438 SFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQD 497

Query: 554 ISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKF 613
           I+ L+ KSLRR +G+VQQEP+LMSG+I+ N+TYGL  E S +EIR VAK+CFCH F+TKF
Sbjct: 498 IATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFITKF 557

Query: 614 PNGYD--TIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLG 671
           P+ YD     G  G SLSGGQKQRIAIARAL+KKP ILILDEATSALDVESEGAINYT G
Sbjct: 558 PDTYDTTIGSGSSGTSLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFG 617

Query: 672 KLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQSELYKLLNDKK 731
           ++MKSK +TI+SIAHRLSTIRR E+VIVLGNDGSVVE+GKFK+LY +  SEL KLLN+K 
Sbjct: 618 QIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKELYDNPTSELSKLLNEKS 677

Query: 732 RDK--------PTPRV--QSDPEKDREQEH 751
             K        P P +  Q++PE+ +E ++
Sbjct: 678 STKEATPQPVNPPPFIDLQTNPEEKKEADN 707

>TPHA0B04620 Chr2 complement(1085725..1087887) [2163 bp, 720 aa]
           {ON} Anc_1.67 YLR188W
          Length = 720

 Score =  587 bits (1512), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/646 (49%), Positives = 429/646 (66%), Gaps = 14/646 (2%)

Query: 100 LQLTRLYSQKTVESQAKTPADKESQKSGTMEDEESPNMGYKEVIRLFKLATHDWKLLTFA 159
           LQ TR  S         T   +  QK   +  EES N G+K+V RLF LA  +   +  A
Sbjct: 54  LQQTRFNSTNESSKGINTKLTETQQKLEKLSSEESTNTGFKDVKRLFTLAKPETAYIVLA 113

Query: 160 IGLLAISSVIGMSIPKVIGMVLDAIKNTYSSATGPVG----LDDLPPIVNDLSMYEFL-- 213
           + L+ ISS + M +P VIG +LD   NT +  TG       +D+     N+ ++Y F   
Sbjct: 114 LVLILISSTVSMVVPSVIGKLLDLSSNTSNDDTGDAKSKEKVDNKEDRDNN-TIYGFTHT 172

Query: 214 GIFAG---ALVIGTVANFGRIVLLRVLGEKLVARLRSNVIRKIIHQDAEFFDRNKVGDLI 270
             FAG     VIG +AN GRIV+L+V GEKLVARLR+  ++  + QDA F D N+VGDLI
Sbjct: 173 QFFAGLGIVFVIGAIANTGRIVILKVTGEKLVARLRTRTMKAALDQDATFLDSNRVGDLI 232

Query: 271 SRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTSALLMFAPPLLIGALIY 330
           SRLSSDA +V++S+T NVSDG +A              S  LTS +++  PPL I AL+Y
Sbjct: 233 SRLSSDASIVAKSVTMNVSDGTRAILQGFVGFSMMSYISFKLTSVMVLLIPPLGIMALVY 292

Query: 331 GKRIRMISRDLQESTGNLTRVSEEQLSGVKTIQSFVAEGKELQRYNTAIRKVFLYGKKEA 390
           GK+IR +SR LQ + G LT+V+EEQL+  KTIQ++  E KE++RY + +R VF  G KEA
Sbjct: 293 GKKIRNLSRQLQTAVGGLTKVAEEQLNATKTIQAYGGEKKEIRRYASEVRDVFDVGLKEA 352

Query: 391 LTNATFFSSTNVLGDLSFLIVLAYGSHLVLQGGLTVGDLTAFMLYTEYTGSAVFGLSNFY 450
           +T+  FF ST ++G+ + L +L  G++++  G LTVGDL++FM+Y  YTGS++FGLS+FY
Sbjct: 353 ITSGIFFGSTGLVGNAALLSLLLVGTNMISSGSLTVGDLSSFMMYAVYTGSSLFGLSSFY 412

Query: 451 SELMKGAGAASRLFEMTDHAPSIKPTAGKPYVPGSGK-ISFKDVSFSYPTRPGNQIFNKL 509
           SELMKGAGAA+R+FE+ D  P IKPT GK  V   GK I F+DVSF YPTRP +++FNK+
Sbjct: 413 SELMKGAGAAARVFELDDRKPLIKPTIGKDPVTLKGKAIIFQDVSFHYPTRPNHRVFNKI 472

Query: 510 NFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRHLGVV 569
           +F IEPG ++C VGPSG GKST++ LLLRYY+ + G I I + +I  LS +  R+ LGVV
Sbjct: 473 SFKIEPGEHICFVGPSGSGKSTVSQLLLRYYDATEGNILIGEDNIKSLSLRKYRKLLGVV 532

Query: 570 QQEPMLMSGSIKYNLTYGLQSEVS--MDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGAS 627
           QQEPML +G+I  N+ Y +  E++   +++    KK  C  F+  FP+G +TI+GPRG  
Sbjct: 533 QQEPMLFNGTIIDNILYNVPDEIASQKNKVDLAIKKSNCTKFLANFPDGLNTIVGPRGTQ 592

Query: 628 LSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTIISIAHR 687
           LSGGQKQRIAIAR+ +  P IL+LDEATSALD +SE  I  TL K  +++ LT ISIAHR
Sbjct: 593 LSGGQKQRIAIARSFLLDPSILLLDEATSALDTQSEDIIAMTLKK-REAEGLTTISIAHR 651

Query: 688 LSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQSELYKLLNDKKRD 733
           LSTI+ S  V+VL  +GSVVE GKF +L A+  SEL  LL+ + ++
Sbjct: 652 LSTIKYSSRVVVLNKNGSVVETGKFTELIANPTSELNLLLSKEGQE 697

>Ecym_1072 Chr1 (137296..139347) [2052 bp, 683 aa] {ON} similar to
           Ashbya gossypii AFR683C
          Length = 683

 Score =  555 bits (1431), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/601 (48%), Positives = 397/601 (66%), Gaps = 7/601 (1%)

Query: 133 ESPNMGYKEVIRLFKLATHDWKLLTFAIGLLAISSVIGMSIPKVIGMVLDAIKNTYSSAT 192
           +S   G+K V RLF+LA  + K L FA+ L+ IS  + M+IP VIG +LD  K   +   
Sbjct: 74  DSKEYGFKNVRRLFQLARPEAKSLAFALLLIVISGAVSMTIPSVIGKLLDISKEKEAGGD 133

Query: 193 GPVGLDDLPPIVNDLSMYEFLGIFAGALVIGTVANFGRIVLLRVLGEKLVARLRSNVIRK 252
           G    ++    +  L+  +F     G  VIG  AN GRIV+L+V GEKLVARLR+  ++ 
Sbjct: 134 GD---EEQETRIYGLTEKQFYTALGGVFVIGACANVGRIVILKVTGEKLVARLRTKTMKA 190

Query: 253 IIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSISL 312
            + QDA F D N+VGDLISRLSSDA +VS+S+TQN SDG +A              S  L
Sbjct: 191 ALQQDAAFLDYNRVGDLISRLSSDASIVSKSITQNTSDGARAVIQGMVGFGMMGYISAQL 250

Query: 313 TSALLMFAPPLLIGALIYGKRIRMISRDLQESTGNLTRVSEEQLSGVKTIQSFVAEGKEL 372
           T  +L+ APPL++ A++YG+RIR ++R+LQ   G LT+V+EEQL+  +TIQS+  E KE+
Sbjct: 251 TGVMLLLAPPLVLMAMVYGRRIRNLTRELQTRVGGLTKVAEEQLNATRTIQSYCGERKEI 310

Query: 373 QRYNTAIRKVFLYGKKEALTNATFFSSTNVLGDLSFLIVLAYGSHLVLQGGLTVGDLTAF 432
           +RY   +R VF  G +EA+T+  FF +T ++G+++ L +L  G+ ++  G +TVG+L++F
Sbjct: 311 RRYAEEVRSVFRVGLREAVTSGAFFGTTGLMGNMALLALLLTGTSMIRSGAITVGELSSF 370

Query: 433 MLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHAPSIKPTAGK-PYVPGSGKISFK 491
           M+Y  YTGS++FGLS+FYSELMKGAGAASR+FE+ D  P I PT GK P    + +I FK
Sbjct: 371 MMYAVYTGSSLFGLSSFYSELMKGAGAASRVFELNDRVPLIHPTKGKDPISLAAKEIEFK 430

Query: 492 DVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDD 551
           +V FSYP+R  + +F +LN  I PG +VC+VGPSG GKSTI+SLLLR+Y+  SG ITI  
Sbjct: 431 NVKFSYPSRSNHTVFTELNLKIIPGEHVCVVGPSGGGKSTISSLLLRFYDVDSGVITIGG 490

Query: 552 QDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDE--IRSVAKKCFCHGF 609
           Q+I   + +  RR LG+VQQEP+L +GSIK N+ Y L   +  D+  +    +   C  F
Sbjct: 491 QNIKDFNLRKYRRSLGIVQQEPLLFNGSIKDNICYALPPHIISDKHRVNRALEAANCTRF 550

Query: 610 VTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYT 669
           ++ FP+G DT++GPRG  LSGGQKQRIAIARA +  P ILILDEATSALD +SE  I   
Sbjct: 551 ISNFPDGLDTMVGPRGTQLSGGQKQRIAIARAFILDPSILILDEATSALDSQSEDIIAQA 610

Query: 670 LGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQSELYKLLND 729
           L    +S ++T ISIAHR+STI  S  VIVL  +G V E G F DL     S L KLL+ 
Sbjct: 611 LRARSESGKIT-ISIAHRISTIEHSNRVIVLSRNGGVSETGAFCDLINQPNSNLNKLLSK 669

Query: 730 K 730
           +
Sbjct: 670 E 670

>ZYRO0F17050g Chr6 complement(1417445..1419589) [2145 bp, 714 aa]
           {ON} similar to uniprot|P33310 Saccharomyces cerevisiae
           YLR188W MDL1 Half-type ATP-binding cassette (ABC)
           transporter of the inner mitochondrial membrane mediates
           export of peptides generated upon proteolysis of
           mitochondrial proteins plays a role in the regulation of
           cellular resistance to oxidative stress
          Length = 714

 Score =  554 bits (1428), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/684 (44%), Positives = 429/684 (62%), Gaps = 18/684 (2%)

Query: 86  RFETHSLRLSVPRTLQLTRLYSQKTVESQAKTPADKESQKSGTMED---EESPNMGYKEV 142
           R    ++R  +P +  L  L   +   S AK P    + K+G + +    E  + G++++
Sbjct: 35  RLRKLAIRTPMP-SKPLGSLMQARWNSSNAKQPNTTNTDKTGQIAELSSNEKNSSGFRDI 93

Query: 143 IRLFKLATHDWKLLTFAIGLLAISSVIGMSIPKVIGMVLDAIKNTY--------SSATGP 194
            RL  LA  +   +  A+ L+ ISS + M +P VIG +LD  K++         S     
Sbjct: 94  TRLLGLARPEVWYIMGALCLIVISSTVSMLLPSVIGKLLDLAKSSSPSENEKQESGDGDD 153

Query: 195 VGLDDLPPIVNDLSMYEFLGIFAGALVIGTVANFGRIVLLRVLGEKLVARLRSNVIRKII 254
              D     +   +  +F  I  G  V G  AN GRI++L+V GE+LVARLR+  ++  +
Sbjct: 154 KDKDKEEGTIYGFTPKQFCVIMGGIFVAGAFANCGRIIILKVTGERLVARLRTRTMKAAL 213

Query: 255 HQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTS 314
            QD+ F DRN+VGDLISRLSSD+ +V++S+TQNVSDG +A              S  LT 
Sbjct: 214 DQDSAFLDRNRVGDLISRLSSDSSIVAKSLTQNVSDGTRAVIQGFVGFGMMTYISWQLTC 273

Query: 315 ALLMFAPPLLIGALIYGKRIRMISRDLQESTGNLTRVSEEQLSGVKTIQSFVAEGKELQR 374
            + +  PP+   A+IYGK+IR +S+ LQ S G LT+V+EEQL   KTIQS+V E KE++R
Sbjct: 274 VMGLMLPPIGAMAIIYGKKIRNLSKQLQTSVGGLTKVAEEQLGATKTIQSYVGEKKEIRR 333

Query: 375 YNTAIRKVFLYGKKEALTNATFFSSTNVLGDLSFLIVLAYGSHLVLQGGLTVGDLTAFML 434
           Y   +R+VF  G KEALT+  FF ST  +G++S L +L  G+ ++  G +TVGDL++FM+
Sbjct: 334 YAKEVRQVFDIGLKEALTSGMFFGSTGFVGNISLLALLMSGASMIQSGLITVGDLSSFMM 393

Query: 435 YTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHAPSIKPTAGK-PYVPGSGKISFKDV 493
           Y  YTG ++FGLSNFYSELMKGAGAA+R+FE+ D  P+I PT GK P    +  ISFKDV
Sbjct: 394 YAVYTGGSMFGLSNFYSELMKGAGAAARVFELNDRKPAIAPTLGKGPTSIRNLPISFKDV 453

Query: 494 SFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQD 553
           SF+YPTR   +IFN LN TI+PG ++CI GPSG GKSTI SLL+RYY+   G I+I D D
Sbjct: 454 SFTYPTRLNKKIFNHLNLTIQPGEHICIAGPSGSGKSTIASLLVRYYDVDQGGISIGDTD 513

Query: 554 ISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAK--KCFCHGFVT 611
           +   + +  RR +GVV QEP+L +G+I  N+ Y +   V+ DE R  A   K  C  F++
Sbjct: 514 LRTFNLRKYRRLIGVVHQEPVLFNGTILENILYAVPPSVAQDERRVSAAIGKANCSKFLS 573

Query: 612 KFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLG 671
            FP+G +T++GPRGA LSGGQKQR+A+ARA +  P +L+LDEATSALD +SE  +  TL 
Sbjct: 574 NFPDGLETLVGPRGAQLSGGQKQRVALARAFLLDPALLVLDEATSALDSQSEEIVARTLQ 633

Query: 672 KLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQSELYKLLNDKK 731
           + ++ + LT ISIAHR+STI  S  V+VLG DG VVE G F++L     SEL  LL+ ++
Sbjct: 634 ERVR-RGLTTISIAHRISTIAHSTRVVVLGRDGFVVESGPFQELIDRPNSELNYLLSLQQ 692

Query: 732 RDKPTPRVQSDPEKDREQEHQIDN 755
            ++    ++ +P + RE +    N
Sbjct: 693 DER--EEIKENPSEPREIQPNTRN 714

>NCAS0B08700 Chr2 (1674262..1676409) [2148 bp, 715 aa] {ON} Anc_1.67
          Length = 715

 Score =  554 bits (1427), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/642 (46%), Positives = 422/642 (65%), Gaps = 11/642 (1%)

Query: 98  RTLQLTRLYSQKTVESQAKTPADKESQKSGTMEDEESPNMGYKEVIRLFKLATHDWKLLT 157
           +TL++ R ++   V+ + K  +   S +   + +E S + G K++ RLFKLA  + K + 
Sbjct: 53  KTLEIRR-WNSSIVDVKKKRSSPPPSIEVQKLSNEVSKSNGMKDIKRLFKLAKPEAKYIL 111

Query: 158 FAIGLLAISSVIGMSIPKVIGMVLDAIKNTYSSATGPVGLDDLPPIVNDLSMYEFLGIFA 217
            A+  + ISS + M+IP +IG +LD  K       G         ++  L+  +F     
Sbjct: 112 LALLFIVISSSVSMTIPTIIGKLLDLAKADNDDEDGDNNAKKEKLMIFGLTKPQFYTALG 171

Query: 218 GALVIGTVANFGRIVLLRVLGEKLVARLRSNVIRKIIHQDAEFFDRNKVGDLISRLSSDA 277
           G  + G +AN  RIV+L+V GE+LVARLR+  ++  ++QDA F D N+VGDLISRLSSDA
Sbjct: 172 GLFLAGAIANASRIVILKVTGERLVARLRTRTMKAALYQDASFLDTNRVGDLISRLSSDA 231

Query: 278 YVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTSALLMFAPPLLIGALIYGKRIRMI 337
            +V++++TQNVSDG +A              S  LT  +++  PPL + AL+YG++IR +
Sbjct: 232 SIVAKAVTQNVSDGSRAVIQGFVGFGMMSFISWKLTCVMMIMVPPLGVMALVYGRKIRTL 291

Query: 338 SRDLQESTGNLTRVSEEQLSGVKTIQSFVAEGKELQRYNTAIRKVFLYGKKEALTNATFF 397
           SR LQ S G LT+V+EEQL+  +TIQ++  E  E+ RY T +RKVF  G KEA+T+  FF
Sbjct: 292 SRQLQASVGGLTKVAEEQLNATRTIQAYGGEALEIHRYATEVRKVFDVGLKEAVTSGLFF 351

Query: 398 SSTNVLGDLSFLIVLAYGSHLVLQGGLTVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGA 457
            ST ++G+++ + +L  G+ ++  G LTVGDL++FM+Y  YTGS++FGLS FYSELMKGA
Sbjct: 352 GSTGLVGNIAMISLLLVGTSMIQYGTLTVGDLSSFMMYAVYTGSSLFGLSGFYSELMKGA 411

Query: 458 GAASRLFEMTDHAPSIKPTAGKPYVPGS--GK-ISFKDVSFSYPTRPGNQIFNKLNFTIE 514
           GAA+R+FE+ D  P IKPT G  Y P S  GK I F++VSF+YPTRP + I N L+ +I+
Sbjct: 412 GAATRVFELNDRKPLIKPTIG--YDPKSLLGKSIEFQNVSFAYPTRPTHSILNNLSISIQ 469

Query: 515 PGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRHLGVVQQEPM 574
           PG +VCIVGPSG GKST++SLLLRYY+ S+G I ID Q+I   + +  RR LGVVQQEPM
Sbjct: 470 PGEHVCIVGPSGSGKSTVSSLLLRYYDVSTGSIKIDGQNIKEFNLRKYRRLLGVVQQEPM 529

Query: 575 LMSGSIKYNLTYGLQSEVSMD----EIRSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSG 630
           L +G+I  N+ Y + S+ ++     +++   ++  C  F+  FP G +T++GPRG  LSG
Sbjct: 530 LFNGTILDNILYAVLSKETLTANSPDVKRALEQANCTKFLKNFPEGVNTLVGPRGTQLSG 589

Query: 631 GQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTIISIAHRLST 690
           GQKQRIA+ARA +  P +LILDEATSALD +SE  +   L + ++   LT ISIAHRLST
Sbjct: 590 GQKQRIALARAFLLHPALLILDEATSALDSQSEEIVAKNLSERVELG-LTTISIAHRLST 648

Query: 691 IRRSENVIVLGNDGSVVEVGKFKDLYADQQSELYKLLNDKKR 732
           I+ S  VIVL   GSVVE G F++L    +SEL  LL+ + +
Sbjct: 649 IKHSTRVIVLDKSGSVVETGPFEELVDYSRSELNMLLSQQHK 690

>TDEL0C06350 Chr3 complement(1159576..1161657) [2082 bp, 693 aa]
           {ON} Anc_1.67 YLR188W
          Length = 693

 Score =  553 bits (1424), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/671 (45%), Positives = 432/671 (64%), Gaps = 22/671 (3%)

Query: 81  RIQETRF-------ETHSLRLSVPRTLQLTRLYSQKTVESQAKTPADKESQKSGTM--ED 131
           R+  TRF       +   ++   P+ +QLT +  Q    S  + P +  S  S T   E 
Sbjct: 21  RLHSTRFNAVHYMIDRQWMKTVAPK-IQLT-VERQVRWNSTQRAPVNVNSNASVTAVKEA 78

Query: 132 EESPN----MGYKEVIRLFKLATHDWKLLTFAIGLLAISSVIGMSIPKVIGMVLDAIKNT 187
           + SP+     G+K++ RLF+LA  +   +  A+ L+ ISS + M+IP ++G +LD  K+ 
Sbjct: 79  KLSPSDLNGSGFKDIKRLFRLAKPETLQIALALVLILISSAVSMTIPTIVGKLLDIAKDR 138

Query: 188 YSSATGPVGLDDLPPIVNDLSMYEFLGIFAGALVIGTVANFGRIVLLRVLGEKLVARLRS 247
             +       +   P +  ++  +F        ++G  AN GRIV+L++ GE+LVARLR+
Sbjct: 139 KDADDTTEDDEG--PKIFGMTTKQFCTALLAVFLVGAAANAGRIVILKITGERLVARLRT 196

Query: 248 NVIRKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXX 307
             ++  + QDA F D N+VGDLIS LSSDA +V++S+TQNVSDG +A             
Sbjct: 197 RTMKAALDQDATFLDTNRVGDLISCLSSDASIVAKSVTQNVSDGTRAVIQGFVGFGMMGY 256

Query: 308 XSISLTSALLMFAPPLLIGALIYGKRIRMISRDLQESTGNLTRVSEEQLSGVKTIQSFVA 367
            S  LTS +++  PPL I A++YG++IR +SR LQ S G LT+VSEEQL  VKTIQS+V 
Sbjct: 257 ISWQLTSVMILMIPPLGIMAVVYGRKIRNLSRQLQTSVGGLTKVSEEQLGAVKTIQSYVG 316

Query: 368 EGKELQRYNTAIRKVFLYGKKEALTNATFFSSTNVLGDLSFLIVLAYGSHLVLQGGLTVG 427
           E KE+ RY T +R VF  G KEALT+  FF ST ++G++S L +L  G++++  G +TVG
Sbjct: 317 EKKEIHRYATEVRNVFNIGLKEALTSGVFFGSTGLVGNISLLALLMVGTNMIQNGLITVG 376

Query: 428 DLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHAPSIKPTAGK-PYVPGSG 486
           DL++FM+Y  YTGS++FGLS+FYSELMKGAGAA+R+FE+ D  P I PT G+ P    + 
Sbjct: 377 DLSSFMMYAVYTGSSMFGLSSFYSELMKGAGAAARVFELKDRKPLIPPTIGQDPVTLANK 436

Query: 487 KISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQ 546
            I F++VSF+YPTR   +IF+ L+ T+EPG +VCIVGPSG GKST+ SLLLRYY+ + G+
Sbjct: 437 TIRFENVSFTYPTRLNQKIFDGLDITVEPGEHVCIVGPSGSGKSTVASLLLRYYDTNEGR 496

Query: 547 ITIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVS--MDEIRSVAKKC 604
           I I D +I+  + +  RR LG+VQQEP L +G+I  N+ Y +  E +   D I +   + 
Sbjct: 497 IMIGDHNINSFNVRKYRRLLGIVQQEPQLFNGTILDNILYTVPPERADNDDLISTAIGQA 556

Query: 605 FCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVESEG 664
            C  F+  FP+G  T++GPRGA LSGGQKQRIA+ARA +  P +LILDEATSALD +SE 
Sbjct: 557 NCSKFLANFPDGLQTLVGPRGAQLSGGQKQRIALARAFLLDPSLLILDEATSALDSQSEE 616

Query: 665 AINYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQSELY 724
            +  TL ++   + LT ISIAHRLSTI+    V+VLG  G VVE G F++L  +  SEL 
Sbjct: 617 IVAQTL-RVRVQRGLTTISIAHRLSTIKNCTRVVVLGKCGQVVESGPFEELLRNPLSELS 675

Query: 725 KLLNDKKRDKP 735
            LL+ +++D+P
Sbjct: 676 ILLS-QQQDEP 685

>KLLA0C01991g Chr3 (160778..162898) [2121 bp, 706 aa] {ON} similar
           to uniprot|P33310 Saccharomyces cerevisiae YLR188W MDL1
           Half-type ATP-binding cassette (ABC) transporter of the
           inner mitochondrial membrane mediates export of peptides
           generated upon proteolysis of mitochondrial proteins
           plays a role in the regulation of cellular resistance to
           oxidative stress
          Length = 706

 Score =  548 bits (1413), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/629 (47%), Positives = 401/629 (63%), Gaps = 9/629 (1%)

Query: 118 PADKESQKSGTMEDEESPNMGYKEVIRLFKLATHDWKLLTFAIGLLAISSVIGMSIPKVI 177
           P+   + K   +   +S   G++++ RLF LA  + + +  A+ L+ +SS + M++P VI
Sbjct: 62  PSLTATVKGLRLSPHDSKASGWQDIKRLFLLAKPETRSMFIALILIILSSAVSMAVPTVI 121

Query: 178 GMVLDAIKNTYSSATGPVGLDDLPPIVNDLSMYEFLGIFAGALVIGTVANFGRIVLLRVL 237
           G +LD  +  +          +   ++  L+  +F     G  V+G +AN GRIV+L+V 
Sbjct: 122 GKLLDIAREEHEQPE-----TEKETMIFGLTSTQFYTALGGVFVVGALANVGRIVILKVT 176

Query: 238 GEKLVARLRSNVIRKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXX 297
           GE+LVARLR+  ++  + QDA F D N+VGDLISRLSSDA +VS+S+TQN+SDG +A   
Sbjct: 177 GERLVARLRTRTMKAALEQDATFLDHNRVGDLISRLSSDAGIVSKSVTQNLSDGTRAVIQ 236

Query: 298 XXXXXXXXXXXSISLTSALLMFAPPLLIGALIYGKRIRMISRDLQESTGNLTRVSEEQLS 357
                      S  LT  +++ APPL + AL+YGKRIR +SR LQ S G LT+VSEEQLS
Sbjct: 237 GFVGFGMMSFISWKLTCVMMLLAPPLGVMALVYGKRIRNLSRQLQTSVGELTKVSEEQLS 296

Query: 358 GVKTIQSFVAEGKELQRYNTAIRKVFLYGKKEALTNATFFSSTNVLGDLSFLIVLAYGSH 417
             KTIQ++  E KE+ RY   +RKVF  G KEALT+  FF  T  +G+++ L +L  G+ 
Sbjct: 297 ATKTIQAYCGEKKEIHRYADEVRKVFHVGLKEALTSGAFFGVTGFVGNVALLALLLTGTS 356

Query: 418 LVLQGGLTVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHAPSIKPTA 477
           ++  G +TVGDL++FM+Y  YTGS++FGLS+FYSELMKGAGAA+R+FE+ D  P I PT 
Sbjct: 357 MIKTGLMTVGDLSSFMMYAVYTGSSLFGLSSFYSELMKGAGAAARVFELNDRKPLIHPTI 416

Query: 478 GK-PYVPGSGKISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLL 536
           GK P    +  I F  V FSYPTRP + IF  LNFT+ PG +VCIVGPSG GKST+ SLL
Sbjct: 417 GKDPVTLENKSIHFNHVKFSYPTRPQHHIFEDLNFTVRPGEHVCIVGPSGGGKSTVASLL 476

Query: 537 LRYYNPSSGQITIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDE 596
           LRYY+  SG+I + + +I   + +  RR LGVVQQEPML SG+I  N+TY +  E+  DE
Sbjct: 477 LRYYDIGSGEIKLGNDNIRDFNLRKYRRLLGVVQQEPMLFSGTILDNITYAVPQELVNDE 536

Query: 597 IR--SVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEA 654
            R      +  C  F+  FP+G  T +GPRG  LSGGQKQRIA+ARA +  P ILILDEA
Sbjct: 537 TRISRAIGQANCTKFLANFPDGLQTTVGPRGTQLSGGQKQRIALARAFLLDPSILILDEA 596

Query: 655 TSALDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKD 714
           TSALD +SE  +  +L +   ++  T ISIAHR+STI+ S  VIVL   G+V E G F  
Sbjct: 597 TSALDSQSEEVVAQSLQQ-RSARGKTTISIAHRVSTIQHSSRVIVLNRHGTVAETGSFDK 655

Query: 715 LYADQQSELYKLLNDKKRDKPTPRVQSDP 743
           L A   S L KLL+ ++  +       DP
Sbjct: 656 LIAIPDSSLNKLLSKEQEVEEESHEPHDP 684

>Kpol_2000.79 s2000 complement(175048..177171) [2124 bp, 707 aa]
           {ON} complement(175048..177171) [2124 nt, 708 aa]
          Length = 707

 Score =  548 bits (1412), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/610 (47%), Positives = 398/610 (65%), Gaps = 11/610 (1%)

Query: 132 EESPNMGYKEVIRLFKLATHDWKLLTFAIGLLAISSVIGMSIPKVIGMVLDAIKNTYSSA 191
           +ES   G+K+V RLF+LA  +   ++ A+ L+ ISS + M +P VIG +LD  K   +  
Sbjct: 90  DESGRSGFKDVKRLFELARPETFYISIALLLIFISSAVSMVVPSVIGKLLDIAKPPSADE 149

Query: 192 TGPVGL-------DDLPPIVNDLSMYEFLGIFAGALVIGTVANFGRIVLLRVLGEKLVAR 244
               G+       +D    +  L+  +F         +G +AN GRI++L+V GE+LVAR
Sbjct: 150 ENGKGVSEKLKEKEDEDKKIYGLTALQFYTALGVVFTVGALANTGRIIILKVTGERLVAR 209

Query: 245 LRSNVIRKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXX 304
           LR+  ++  + Q+A F D NKVGDLISRLS+DA +V++S+TQNVSDG +A          
Sbjct: 210 LRTRTMKAALEQEAAFLDSNKVGDLISRLSTDASIVAKSVTQNVSDGTRAILQGFVGFGM 269

Query: 305 XXXXSISLTSALLMFAPPLLIGALIYGKRIRMISRDLQESTGNLTRVSEEQLSGVKTIQS 364
               S  LTS +L+  PPL   A+IYG++IR +SR LQ S G LT+V+EEQL+  +TIQ+
Sbjct: 270 MSYISWQLTSVMLLLIPPLGAMAIIYGRKIRNLSRQLQTSVGGLTKVAEEQLNATRTIQA 329

Query: 365 FVAEGKELQRYNTAIRKVFLYGKKEALTNATFFSSTNVLGDLSFLIVLAYGSHLVLQGGL 424
           +  E KE+ RY T +R VF  G KEA+T+  FF ST ++G+ + L +L  G++++  G L
Sbjct: 330 YGGEKKEIHRYATEVRNVFDIGYKEAVTSGLFFGSTGLVGNTALLSLLVVGTNMISSGAL 389

Query: 425 TVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHAPSIKPTAGKPYVPG 484
           TVG+L++FM+Y  YTGS++FGLS FYSELMKGAGAA+R+FE++D  P+IKPT GK  +  
Sbjct: 390 TVGELSSFMMYAVYTGSSLFGLSTFYSELMKGAGAAARVFELSDRKPAIKPTIGKDPITL 449

Query: 485 SGK-ISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPS 543
            GK + FK+VSF YPTRP  QIF   +  IEPG +VC VGPSG GKST++SLLLRYY+ +
Sbjct: 450 FGKTVEFKNVSFWYPTRPKQQIFQDFSIKIEPGEHVCFVGPSGSGKSTVSSLLLRYYDVA 509

Query: 544 SGQITIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMD--EIRSVA 601
            G I +  +DI   S +  RR LGVVQQEPML +G+I  N+ Y +  E++ +   I    
Sbjct: 510 KGSILVGGEDIKNFSLRKYRRLLGVVQQEPMLFNGTILENILYSVPEEIANEPGRIERAI 569

Query: 602 KKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVE 661
           +   C  F+  FP+G +T++GPRG  LSGGQKQRIA+AR  +  P ILILDEATSALD +
Sbjct: 570 ESANCSKFLNNFPDGLNTLVGPRGTQLSGGQKQRIALARTFLLDPSILILDEATSALDSQ 629

Query: 662 SEGAINYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQS 721
           SE  I   L +    K  T ISIAHRLSTI+ S  V+VLG +G VVE G F++L ++  S
Sbjct: 630 SEDIIAQNL-QARNEKGQTTISIAHRLSTIKHSSRVVVLGKNGCVVETGTFQELISNPSS 688

Query: 722 ELYKLLNDKK 731
            L  LL  ++
Sbjct: 689 GLNILLTQEE 698

>NDAI0A00560 Chr1 complement(100930..103074) [2145 bp, 714 aa] {ON}
           Anc_1.67
          Length = 714

 Score =  547 bits (1410), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/636 (45%), Positives = 414/636 (65%), Gaps = 20/636 (3%)

Query: 133 ESPNMGYKEVIRLFKLATHDWKLLTFAIGLLAISSVIGMSIPKVIGMVLDAIKNTYSSAT 192
           +S + G+K++ RLF LA  + + +  A+  + ISS + M++P +IG +LDA K       
Sbjct: 88  DSKSSGFKDIQRLFSLARPELRYIALALLFILISSSVSMTVPSIIGKLLDAAKKGQKENE 147

Query: 193 GPVGLDDLPPIVNDLSMY-----EFLGIFAGALVIGTVANFGRIVLLRVLGEKLVARLRS 247
                +D   IV D++ +     +F        ++G +AN GRI++L+V GE+LVARLR+
Sbjct: 148 E----EDSKTIVPDITFFGLTRTQFYTALGVLFLVGAIANTGRIIILKVTGERLVARLRT 203

Query: 248 NVIRKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXX 307
             ++  + QDA F D N+VGDLISRLSSDA +VS+++TQNVSDG +A             
Sbjct: 204 RTMKAALDQDATFLDANRVGDLISRLSSDAAIVSKAVTQNVSDGTRAIIQGFVGFGMMGY 263

Query: 308 XSISLTSALLMFAPPLLIGALIYGKRIRMISRDLQESTGNLTRVSEEQLSGVKTIQSFVA 367
            S  LT  +++  PPL I AL+YG++IR +S+ LQES G L++V+EEQL+  KTIQ++V 
Sbjct: 264 LSWKLTGVMMLMVPPLGIMALVYGRKIRNLSKQLQESVGGLSKVAEEQLNATKTIQAYVG 323

Query: 368 EGKELQRYNTAIRKVFLYGKKEALTNATFFSSTNVLGDLSFLIVLAYGSHLVLQGGLTVG 427
           E  E+ RY T +R VF  G KEA+T+  FF ST ++G+++ + +L  G++++  G LTVG
Sbjct: 324 ERLEIHRYATEVRNVFRIGLKEAVTSGLFFGSTGLVGNIAMISLLLVGTNMIQSGTLTVG 383

Query: 428 DLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHAPSIKPTAG-KPYVPGSG 486
           +L++FM+Y  YTGS++FGLS+FYSELMKGAGAASR+FE+ D  P IK T G  P      
Sbjct: 384 ELSSFMMYAVYTGSSLFGLSSFYSELMKGAGAASRVFELNDRKPLIKSTVGIDPKTLFGK 443

Query: 487 KISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQ 546
            I F++VSF+YP+RP ++IF+ LN  I PG +VCIVG SG GKSTI SLLLRYY+ ++G 
Sbjct: 444 SIKFENVSFTYPSRPNHKIFDNLNLEINPGEHVCIVGFSGSGKSTIASLLLRYYDVNNGS 503

Query: 547 ITIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLTYG----LQSEVSMDEIRSVAK 602
           I I D DI   S +  RR +G VQQEP L +GSI  N+ Y     L SE   + ++   K
Sbjct: 504 IRIGDNDIRNFSLRKYRRLIGTVQQEPSLFNGSILDNIIYAIPPELTSEKQHERVQLAIK 563

Query: 603 KCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVES 662
           +  C+ F+ KFP+G  T++GPRGA LSGGQKQRIA+ARA +  P +LILDE+TSALD  S
Sbjct: 564 QANCNIFLGKFPDGLQTLVGPRGAQLSGGQKQRIALARAFLLDPTLLILDESTSALDSLS 623

Query: 663 EGAINYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQSE 722
           E  +  TL +   ++ LT ISIAHRLSTI+ S  VIV+G  GSVVE G F  L  + +SE
Sbjct: 624 EELVAKTL-QARSARGLTTISIAHRLSTIKHSSRVIVIGKYGSVVESGPFDRLIDNPKSE 682

Query: 723 LYKLLNDKKRDKPTPRVQSDPEKDREQEHQIDNQVR 758
           L  LL+ +        +  DP +++++  ++  + R
Sbjct: 683 LNMLLSQQNE-----HIDEDPSQEKQEPEEVTLEKR 713

>SAKL0C02244g Chr3 (201281..203419) [2139 bp, 712 aa] {ON} similar
           to uniprot|P33310 Saccharomyces cerevisiae YLR188W MDL1
           Half-type ATP-binding cassette (ABC) transporter of the
           inner mitochondrial membrane mediates export of peptides
           generated upon proteolysis of mitochondrial proteins
           plays a role in the regulation of cellular resistance to
           oxidative stress
          Length = 712

 Score =  546 bits (1407), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/671 (45%), Positives = 424/671 (63%), Gaps = 27/671 (4%)

Query: 72  SHTNRTLTPRIQETRFETHSLRLSVPRTLQLTRLYSQKTVESQAKTPADKESQKSGTMED 131
           + + R   PRIQ TR    S +L   R L  +    QKT+++           K+  +  
Sbjct: 46  TRSYRPPIPRIQ-TRPPALSHQLLQARRLNTSTEQDQKTLQTL----------KTLKLSP 94

Query: 132 EESPNMGYKEVIRLFKLATHDWKLLTFAIGLLAISSVIGMSIPKVIGMVLDAIKNTY--- 188
            +S   G+K++ RLF LA  +   +  A+  + IS  + M+IP VIG +LDA K  +   
Sbjct: 95  HDSKASGFKDIKRLFLLAKPETNSMILALVFILISGAVSMTIPSVIGKLLDAAKEGHLAG 154

Query: 189 SSATGP-VGLDDLPP--------IVNDLSMYEFLGIFAGALVIGTVANFGRIVLLRVLGE 239
            SA+G  VG  D           ++  L+  +F        V+G  AN GRIVLL+V GE
Sbjct: 155 VSASGEGVGSSDSSDNQEDSSDRLIYGLTFPQFYTALGTIFVVGAFANMGRIVLLKVTGE 214

Query: 240 KLVARLRSNVIRKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXX 299
           KLVARLR+  ++  + QDA F D N+VGDLISRLSSDA +VS+S+TQN+SDG +A     
Sbjct: 215 KLVARLRTRTMKAALQQDATFLDNNRVGDLISRLSSDASIVSKSVTQNLSDGARAVIQGA 274

Query: 300 XXXXXXXXXSISLTSALLMFAPPLLIGALIYGKRIRMISRDLQESTGNLTRVSEEQLSGV 359
                    S  LT  + + APPL + A++YGK+IR +SR LQ S G LT+V+EEQLS  
Sbjct: 275 VGFGMMSFISWKLTCVMTLMAPPLAVMAMVYGKKIRNLSRQLQTSVGGLTKVAEEQLSAA 334

Query: 360 KTIQSFVAEGKELQRYNTAIRKVFLYGKKEALTNATFFSSTNVLGDLSFLIVLAYGSHLV 419
           +T+Q++  E +E++RY   +R VF  G KEALT+  FF  T  +G+++ L +L  G+ ++
Sbjct: 335 RTVQAYGGEKQEIRRYAGEVRNVFNIGLKEALTSGVFFGVTGFVGNVALLALLLTGTSMI 394

Query: 420 LQGGLTVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHAPSIKPTAGK 479
             G +TVGDL++FM+Y  YTGS++FGLS+FYSELMKGAGAA+R+FE+ D  P I PT G 
Sbjct: 395 RSGAITVGDLSSFMMYAVYTGSSLFGLSSFYSELMKGAGAAARVFELNDRKPLIHPTKGV 454

Query: 480 PYVPGSGK-ISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLR 538
             V   GK I F++V+F+YPTR  N+IF+ L+  I+PG +VCIVGPSG GKSTI SLLLR
Sbjct: 455 DPVTLQGKTIEFRNVAFAYPTRRENRIFDGLSLDIQPGEHVCIVGPSGGGKSTIASLLLR 514

Query: 539 YYNPSSGQITIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIR 598
           YY+  +G+I I  QDI R + +  RR LGVVQQEP+L +G+I  N+TY +  E++ D+ R
Sbjct: 515 YYDVDAGRIAIGGQDIRRFNLRKYRRLLGVVQQEPLLFNGTILDNITYAVPGELAGDDSR 574

Query: 599 --SVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATS 656
                 +  C  F+  FP+G +T++GPRGA +SGGQKQRIA+ARA +  P +LILDEATS
Sbjct: 575 VSRAIGQANCTKFLANFPDGLETLVGPRGAQMSGGQKQRIALARAFLLDPAVLILDEATS 634

Query: 657 ALDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLY 716
           ALD +SE  +  +L +    +  T +SIAHRLSTI+ S  VIVL   G V E G F++L 
Sbjct: 635 ALDSQSEEVVAQSL-RSRSRRGKTTVSIAHRLSTIQHSSRVIVLDRHGGVGETGSFRELI 693

Query: 717 ADQQSELYKLL 727
           +D  S L +LL
Sbjct: 694 SDPDSHLTQLL 704

>YLR188W Chr12 (528300..530387) [2088 bp, 695 aa] {ON}
           MDL1Mitochondrial inner membrane half-type ATP-binding
           cassette (ABC) transporter, mediates export of peptides
           generated upon proteolysis of mitochondrial proteins,
           plays a role in the regulation of cellular resistance to
           oxidative stress
          Length = 695

 Score =  539 bits (1388), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/633 (46%), Positives = 412/633 (65%), Gaps = 15/633 (2%)

Query: 109 KTVESQAKTPADKESQK-SGTMEDEESPNMGYKEVIRLFKLATHDWKLLTFAIGLLAISS 167
           +++  Q+     K+S K +  + +  S + G+K++ RLF L+  + K +  A+ L+ ISS
Sbjct: 55  RSIRLQSDIAQGKKSTKPTLKLSNANSKSSGFKDIKRLFVLSKPESKYIGLALLLILISS 114

Query: 168 VIGMSIPKVIGMVLDAIKNTYSSATGPVGLDDLPPIVNDLSMY---EFLGIFAGALVIGT 224
            + M++P VIG +LD        A+   G D+     N L  +   +F        +IG 
Sbjct: 115 SVSMAVPSVIGKLLDL-------ASESDGEDEEGSKSNKLYGFTKKQFFTALGAVFIIGA 167

Query: 225 VANFGRIVLLRVLGEKLVARLRSNVIRKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSM 284
           VAN  RI++L+V GE+LVARLR+  ++  + QDA F D N+VGDLISRLSSDA +V++S+
Sbjct: 168 VANASRIIILKVTGERLVARLRTRTMKAALDQDATFLDTNRVGDLISRLSSDASIVAKSV 227

Query: 285 TQNVSDGFKAXXXXXXXXXXXXXXSISLTSALLMFAPPLLIGALIYGKRIRMISRDLQES 344
           TQNVSDG +A              S  LT  +++ APPL   ALIYG++IR +SR LQ S
Sbjct: 228 TQNVSDGTRAIIQGFVGFGMMSFLSWKLTCVMMILAPPLGAMALIYGRKIRNLSRQLQTS 287

Query: 345 TGNLTRVSEEQLSGVKTIQSFVAEGKELQRYNTAIRKVFLYGKKEALTNATFFSSTNVLG 404
            G LT+V+EEQL+  +TIQ++  E  E++RY   +R VF  G KEA+T+  FF ST ++G
Sbjct: 288 VGGLTKVAEEQLNATRTIQAYGGEKNEVRRYAKEVRNVFHIGLKEAVTSGLFFGSTGLVG 347

Query: 405 DLSFLIVLAYGSHLVLQGGLTVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLF 464
           + + L +L  G+ ++  G +TVG+L++FM+Y  YTGS++FGLS+FYSELMKGAGAA+R+F
Sbjct: 348 NTAMLSLLLVGTSMIQSGSMTVGELSSFMMYAVYTGSSLFGLSSFYSELMKGAGAAARVF 407

Query: 465 EMTDHAPSIKPTAGK-PYVPGSGKISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVG 523
           E+ D  P I+PT GK P       I FK+VSF+YPTRP +QIF  LN TI+PG +VC VG
Sbjct: 408 ELNDRKPLIRPTIGKDPVSLAQKPIVFKNVSFTYPTRPKHQIFKDLNITIKPGEHVCAVG 467

Query: 524 PSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYN 583
           PSG GKSTI SLLLRYY+ +SG I   D+DI   + +  RR +G VQQEP+L +G+I  N
Sbjct: 468 PSGSGKSTIASLLLRYYDVNSGSIEFGDEDIRNFNLRKYRRLIGYVQQEPLLFNGTILDN 527

Query: 584 LTYGLQSEVSM--DEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARA 641
           + Y +  E++   D IR    K  C  F+  FP+G  T++G RGA LSGGQKQRIA+ARA
Sbjct: 528 ILYCIPPEIAEQDDRIRRAIGKANCTKFLANFPDGLQTMVGARGAQLSGGQKQRIALARA 587

Query: 642 LMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLG 701
            +  P +LILDEATSALD +SE  +   L + ++ +  T ISIAHRLSTI+ S  VIVLG
Sbjct: 588 FLLDPAVLILDEATSALDSQSEEIVAKNLQRRVE-RGFTTISIAHRLSTIKHSTRVIVLG 646

Query: 702 NDGSVVEVGKFKDLYADQQSELYKLLNDKKRDK 734
             GSVVE G F+DL A   SEL  LL +++ ++
Sbjct: 647 KHGSVVETGSFRDLIAIPNSELNALLAEQQDEE 679

>Skud_12.253 Chr12 (474886..476964) [2079 bp, 692 aa] {ON} YLR188W
           (REAL)
          Length = 692

 Score =  538 bits (1386), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/605 (47%), Positives = 398/605 (65%), Gaps = 7/605 (1%)

Query: 129 MEDEESPNMGYKEVIRLFKLATHDWKLLTFAIGLLAISSVIGMSIPKVIGMVLDAIKNTY 188
           + D  S + G+K++ RLF L+  + K +  A+ L+ ISS + M++P VIG +LD    + 
Sbjct: 76  LSDANSKSSGFKDIKRLFVLSRPESKYIGLALLLILISSSVSMAVPSVIGKLLDVASESD 135

Query: 189 SSATGPVGLDDLPPIVNDLSMYEFLGIFAGALVIGTVANFGRIVLLRVLGEKLVARLRSN 248
                    D     +  L+  +F        VIG VAN  RI++L++ GE+LVARLR+ 
Sbjct: 136 DEEDEEKARDSK---LYGLTKKQFFTALGLVFVIGAVANASRIIILKITGERLVARLRTR 192

Query: 249 VIRKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXX 308
            ++  + QDA F D N+VGDLISRLSSDA +V++S+TQNVSDG +A              
Sbjct: 193 TMKAALDQDATFLDTNRVGDLISRLSSDASIVAKSVTQNVSDGTRAIIQGFVGFGMMSFL 252

Query: 309 SISLTSALLMFAPPLLIGALIYGKRIRMISRDLQESTGNLTRVSEEQLSGVKTIQSFVAE 368
           S  LT  +++ APPL   AL+YGK+IR +SR LQ S G LT+V+EEQL+  +TIQ++  E
Sbjct: 253 SWKLTCVMMLLAPPLGAMALVYGKKIRNLSRQLQTSVGGLTKVAEEQLNATRTIQAYGGE 312

Query: 369 GKELQRYNTAIRKVFLYGKKEALTNATFFSSTNVLGDLSFLIVLAYGSHLVLQGGLTVGD 428
             E+ RY   +R VF  G KEA+T+  FF ST ++G+ + L +L  G++++  G +T+G+
Sbjct: 313 KNEVHRYAKEVRNVFHIGLKEAVTSGLFFGSTGLVGNTAMLSLLLVGTNMIQSGVMTIGE 372

Query: 429 LTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHAPSIKPTAGK-PYVPGSGK 487
           L++FM+Y  YTGS++FGLS+FYSELMKGAGAA+R+FE+ D  P I PT GK P       
Sbjct: 373 LSSFMMYAVYTGSSLFGLSSFYSELMKGAGAAARVFELNDRKPLIHPTIGKDPISLAHKP 432

Query: 488 ISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQI 547
           + FK+VSF+YPTRP +QIF  LN TI+PG +VC VGPSG GKSTI SLLLRYY+ +SG I
Sbjct: 433 VVFKNVSFTYPTRPKHQIFKDLNITIKPGEHVCAVGPSGSGKSTIASLLLRYYDVNSGSI 492

Query: 548 TIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVS--MDEIRSVAKKCF 605
             DD+D+   + +  RR +G VQQEP+L +G+I  N+ Y + SE++   D +    ++  
Sbjct: 493 EFDDEDVRNFNLRKYRRLIGYVQQEPLLFNGTILDNILYCIPSEIAEREDRVARAIEQAN 552

Query: 606 CHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGA 665
           C  F+  FP+G  T++G RGA LSGGQKQRIA+ARA +  P +LILDEATSALD +SE  
Sbjct: 553 CTKFLANFPDGLQTMVGARGAQLSGGQKQRIALARAFLLDPALLILDEATSALDSQSEEI 612

Query: 666 INYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQSELYK 725
           +   L K ++ + LT ISIAHRLSTI+ S  +IVLG  GSVVE G F+DL A   SEL  
Sbjct: 613 VAKNLQKRVE-RGLTTISIAHRLSTIKHSTRIIVLGKHGSVVETGSFRDLIAIPDSELNA 671

Query: 726 LLNDK 730
           LL ++
Sbjct: 672 LLAEQ 676

>Suva_10.284 Chr10 (500972..503053) [2082 bp, 693 aa] {ON} YLR188W
           (REAL)
          Length = 693

 Score =  538 bits (1385), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/610 (48%), Positives = 406/610 (66%), Gaps = 9/610 (1%)

Query: 129 MEDEESPNMGYKEVIRLFKLATHDWKLLTFAIGLLAISSVIGMSIPKVIGMVLDAIKNTY 188
           + D +S + G+K++ RLF L+  +   +  A+ L+ ISS + M++P VIG +LD   +  
Sbjct: 75  LSDADSKSSGFKDIKRLFVLSRPESGYIGLALLLILISSSVSMAVPSVIGKLLDLASDDD 134

Query: 189 SSATGPVGLDDLPPIVNDLSMYEFLGIFAGALVIGTVANFGRIVLLRVLGEKLVARLRSN 248
                    D+    +  LS  +F        +IG +AN  RI++L+V GE+LVARLR+ 
Sbjct: 135 DEEDAKETKDNK---LYGLSKRQFFTALGAVFLIGAIANASRIIILKVTGERLVARLRTR 191

Query: 249 VIRKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXX 308
            ++  + QDA F D N+VGDLISRLSSDA +V++S+TQNVSDG +A              
Sbjct: 192 TMKAALDQDATFLDTNRVGDLISRLSSDASIVAKSVTQNVSDGTRAIIQGFVGFGMMSFL 251

Query: 309 SISLTSALLMFAPPLLIGALIYGKRIRMISRDLQESTGNLTRVSEEQLSGVKTIQSFVAE 368
           S  LT  +++ APPL   ALIYG++IR +SR LQ S G LT+V+EEQL+  +TIQ++  E
Sbjct: 252 SWKLTCVMMVLAPPLGAMALIYGRKIRNLSRQLQTSVGGLTKVAEEQLNATRTIQAYGGE 311

Query: 369 GKELQRYNTAIRKVFLYGKKEALTNATFFSSTNVLGDLSFLIVLAYGSHLVLQGGLTVGD 428
             E++RY   +R VF  G KEA+T+  FF ST ++G+ + L +L  G++++  G +TVG+
Sbjct: 312 KNEVRRYAKEVRNVFHVGLKEAVTSGLFFGSTGLVGNAAMLSLLLVGTNMIQSGAMTVGE 371

Query: 429 LTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHAPSIKPTAGKPYVPGSGK- 487
           LT+FM+Y  YTGS++FGLS+FYSELMKGAGAA+R+FE+ D  P I+PT GK  V  + K 
Sbjct: 372 LTSFMMYAVYTGSSLFGLSSFYSELMKGAGAAARVFELNDRKPLIRPTIGKDPVSLAHKP 431

Query: 488 ISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQI 547
           I FKDVSF+YPTRP +QIF  LN TI+PG +VC VGPSG GKSTI SLLLRYY+ S+G I
Sbjct: 432 IVFKDVSFTYPTRPKHQIFKDLNITIKPGEHVCAVGPSGSGKSTIASLLLRYYDTSAGSI 491

Query: 548 TIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAK---KC 604
              D+DI   + +  RR +G VQQEP+L +G+I  N+ Y +  E++  E R VA+   + 
Sbjct: 492 DFGDEDIKNFNLRKYRRLMGYVQQEPLLFNGTILDNILYCIPPEIAEQEDR-VARAIGQA 550

Query: 605 FCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVESEG 664
            C  F+  FP+G  T++G RGA LSGGQKQRIA+ARA +  P +LILDEATSALD +SE 
Sbjct: 551 NCTKFLANFPDGLQTMVGARGAQLSGGQKQRIALARAFLLDPAVLILDEATSALDSQSEE 610

Query: 665 AINYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQSELY 724
            +   L + +K + LT ISIAHRLSTI+ S  VIVLG  GSVVE G F+DL +   SEL 
Sbjct: 611 VVAKNLQRRVK-RGLTTISIAHRLSTIKHSTRVIVLGKHGSVVETGSFQDLISIPGSELN 669

Query: 725 KLLNDKKRDK 734
            LL +++ D+
Sbjct: 670 ALLAEQQDDE 679

>Smik_12.248 Chr12 (475233..477323) [2091 bp, 696 aa] {ON} YLR188W
           (REAL)
          Length = 696

 Score =  531 bits (1368), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 293/625 (46%), Positives = 403/625 (64%), Gaps = 8/625 (1%)

Query: 129 MEDEESPNMGYKEVIRLFKLATHDWKLLTFAIGLLAISSVIGMSIPKVIGMVLDAIKNTY 188
           + D  S + G+K++ RLF L+  + K +  A+ L+ ISS + M++P VIG +LD    T 
Sbjct: 76  LSDANSKSSGFKDIKRLFVLSKPESKYIGLALLLILISSSVSMAVPSVIGKLLDLASETE 135

Query: 189 SSATGPVGLDDLPPIVNDLSMYEFLGIFAGALVIGTVANFGRIVLLRVLGEKLVARLRSN 248
                     +    +  L+  +F        +IG VAN  RI++L+V GE+LVARLR+ 
Sbjct: 136 DEEKEEKAKSNK---LYGLTKRQFFTALGLVFIIGAVANASRIIILKVTGERLVARLRTR 192

Query: 249 VIRKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXX 308
            ++  + QDA F D N+VGDLISRLSSDA +V++S+TQNVSDG +A              
Sbjct: 193 TMKAALDQDATFLDTNRVGDLISRLSSDASIVAKSVTQNVSDGTRAIIQGFVGFGMMSFL 252

Query: 309 SISLTSALLMFAPPLLIGALIYGKRIRMISRDLQESTGNLTRVSEEQLSGVKTIQSFVAE 368
           S  LT  +++ APPL   ALIYG++IR +SR LQ S G LT+V+EEQL+  +TIQ++  E
Sbjct: 253 SWKLTCVMMVLAPPLGAMALIYGRKIRNLSRQLQTSVGGLTKVAEEQLNATRTIQAYGGE 312

Query: 369 GKELQRYNTAIRKVFLYGKKEALTNATFFSSTNVLGDLSFLIVLAYGSHLVLQGGLTVGD 428
             E++RY   +R VF  G KEA+T+  FF ST ++G+ + L +L  G+ ++  G +TVG+
Sbjct: 313 KNEVRRYAKEVRNVFHIGLKEAVTSGLFFGSTGLVGNTAMLSLLLVGTSMIQSGSMTVGE 372

Query: 429 LTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHAPSIKPTAGK-PYVPGSGK 487
           L++FM+Y  YTGS++FGLS+FYSELMKGAGAA+R+FE+ D  P I+PT GK P       
Sbjct: 373 LSSFMMYAVYTGSSLFGLSSFYSELMKGAGAAARVFELNDRKPLIRPTIGKDPVSLAQKP 432

Query: 488 ISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQI 547
           I FK+VSF+YPTRP +QIF  LN TI PG +VC VGPSG GKSTI SLLLRYY+ +SG I
Sbjct: 433 IVFKNVSFTYPTRPKHQIFKDLNITINPGEHVCAVGPSGSGKSTIASLLLRYYDVNSGSI 492

Query: 548 TIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVS--MDEIRSVAKKCF 605
              D+DI   + +  RR +G VQQEP+L +G+I  N+ Y +  E++   D I     +  
Sbjct: 493 EFGDEDIRSFNLRKYRRLIGYVQQEPLLFNGTILDNILYCIPPEIAEQEDRIGRAIGQAN 552

Query: 606 CHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGA 665
           C  F+  FP+G  T +G RGA LSGGQKQRIA+ARA +  P +LILDEATSALD +SE  
Sbjct: 553 CTKFLANFPDGLQTTVGARGAQLSGGQKQRIALARAFLLDPAVLILDEATSALDSQSEEI 612

Query: 666 INYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQSELYK 725
           +   L + ++ + LT ISIAHRLSTI+ S  V+VLG  GSVVE G F+DL A   SEL  
Sbjct: 613 VAKNLQRRVE-RGLTTISIAHRLSTIKHSTRVVVLGKHGSVVETGSFQDLIAIPNSELNA 671

Query: 726 LLNDKKRDKPTPRVQSDPEKDREQE 750
           LL +++ D+      +D ++   QE
Sbjct: 672 LLAEQQ-DEEQKEGTADLDRGITQE 695

>AFR683C Chr6 complement(1697786..1699819) [2034 bp, 677 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR188W
           (MDL1)
          Length = 677

 Score =  526 bits (1356), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 292/651 (44%), Positives = 408/651 (62%), Gaps = 17/651 (2%)

Query: 83  QETRFETHSLRLSVPRTLQLTRLYSQKTVESQAKTPADKESQKSGTMEDEESPNMGYKEV 142
           Q TRF       S    +Q TRL S  T   +A T  +K  Q+   +        G K+V
Sbjct: 35  QRTRFS-----FSASTRIQ-TRLNS--TANPRAST-EEKPHQERLELSTATGNASGAKDV 85

Query: 143 IRLFKLATHDWKLLTFAIGLLAISSVIGMSIPKVIGMVLDAIKNTYSSATGPVGLDDLPP 202
            RLF+LA  + K L  A+ L+ IS  + M+IP VIG +LD  +      +G    D+   
Sbjct: 86  RRLFQLARPELKSLVCALVLIVISGAVSMTIPSVIGKLLDVAREDVEQESG----DEEEA 141

Query: 203 IVNDLSMYEFLGIFAGALVIGTVANFGRIVLLRVLGEKLVARLRSNVIRKIIHQDAEFFD 262
           ++  L   +F    +G   +G +AN GRIV+L+  GE+LVARLR+  ++  + Q+  F D
Sbjct: 142 VLYGLPEKQFYLALSGIFAVGALANMGRIVVLKTTGERLVARLRTRTMKAALEQEGAFLD 201

Query: 263 RNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTSALLMFAPP 322
            N+VGDLISRLSSDA +VS+S+TQN SDG +A              S  LT+ + + APP
Sbjct: 202 SNRVGDLISRLSSDASIVSKSITQNTSDGARAVIQGAVGFGMMSYISWQLTAVMTLLAPP 261

Query: 323 LLIGALIYGKRIRMISRDLQESTGNLTRVSEEQLSGVKTIQSFVAEGKELQRYNTAIRKV 382
           L++ A  YG+R+R +SR+LQ   G LT+V+EEQL+  +T+Q++  E +E++RY T +R V
Sbjct: 262 LVLMAAFYGRRVRNLSRELQTKVGGLTKVAEEQLNATRTVQAYCGERREIRRYATEVRNV 321

Query: 383 FLYGKKEALTNATFFSSTNVLGDLSFLIVLAYGSHLVLQGGLTVGDLTAFMLYTEYTGSA 442
           F  G KEAL + +FF +T  +G+ + L +L  G+ ++  GG++VG+L++FM+Y  YTGS+
Sbjct: 322 FDVGLKEALISGSFFGATGFVGNATLLALLLTGTSMIKGGGISVGELSSFMMYAVYTGSS 381

Query: 443 VFGLSNFYSELMKGAGAASRLFEMTDHAPSIKPTAGKPYVPGSGK-ISFKDVSFSYPTRP 501
           +F LS+FYSELMKGAGAA R+FE+ D  P I PT GK  V  +GK I+F  V+F+YPTRP
Sbjct: 382 LFNLSSFYSELMKGAGAAVRVFELNDRKPLIHPTIGKDPVSLTGKTIAFNSVNFAYPTRP 441

Query: 502 GNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKS 561
            +Q+F  ++ +I PG +VCIVGPSG GKST+ SLLLR+Y+P SG ITI  +DI   +   
Sbjct: 442 HHQVFAGMDLSICPGEHVCIVGPSGGGKSTVASLLLRFYDPISGSITIGGEDIRLFNLSK 501

Query: 562 LRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIR--SVAKKCFCHGFVTKFPNGYDT 619
            RR +G+VQQEP+L + SI  N+TY L   ++ D  R     +   C  FV  FP G  T
Sbjct: 502 YRRMMGIVQQEPVLFNASILENITYALPLHLTKDPARIDRALRLSNCSAFVGSFPEGLQT 561

Query: 620 IIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKEL 679
            +GPRG  LSGGQKQR+A+ARA ++ P ILILDEATSALD +SE  +  TL +  +  ++
Sbjct: 562 AVGPRGTQLSGGQKQRVALARAFLQDPAILILDEATSALDSKSEDIVASTLLQRCQEAKI 621

Query: 680 TIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQSELYKLLNDK 730
           T ISIAHR STI+ S  VIVL   G V+E G ++ L  D  S L  LL+ +
Sbjct: 622 T-ISIAHRKSTIQHSTRVIVLDKLGHVLETGTYQQLIGDPGSSLSGLLSKE 671

>KLTH0F02024g Chr6 (161423..163627) [2205 bp, 734 aa] {ON} similar
           to uniprot|P33310 Saccharomyces cerevisiae YLR188W MDL1
           Half-type ATP-binding cassette (ABC) transporter of the
           inner mitochondrial membrane mediates export of peptides
           generated upon proteolysis of mitochondrial proteins
           plays a role in the regulation of cellular resistance to
           oxidative stress
          Length = 734

 Score =  527 bits (1358), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 293/665 (44%), Positives = 421/665 (63%), Gaps = 24/665 (3%)

Query: 90  HSLRLSVPRTLQLTRLYSQKTVESQAKTPADKESQKSGTMEDEESPNMGYKEVIRLFKLA 149
           H+ + S  R  QL  +   +T+  Q +      S+ S T+  EE  +  +K++ RLF+LA
Sbjct: 37  HNGKTSFER--QLAAMLQNRTIMRQVRWQHSNASKPSTTLTSEEQNSSSWKDIKRLFQLA 94

Query: 150 THDWKLLTFAIGLLAISSVIGMSIPKVIGMVLDAIKNTYSSAT--------------GPV 195
             + K + FA+ L+ +SS + M +P VIG ++D  K   +S++              G  
Sbjct: 95  RPESKSMFFALVLIILSSSVSMLVPGVIGKLMDVAKEDGTSSSEADGKRGDATDKTDGST 154

Query: 196 GLD-DLPPIVNDLSMYEFLGIFAGALVIGTVANFGRIVLLRVLGEKLVARLRSNVIRKII 254
             D D   ++  L++ +F G      V+G  AN GRIV+L+V GEKLVARLR+  ++  +
Sbjct: 155 AADTDSEKLILGLTLPQFYGGLFSLFVVGAAANMGRIVILKVTGEKLVARLRTRTLKAAL 214

Query: 255 HQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTS 314
            QDA F D NKVGDLISRLSSDA +VS+S+TQN+SDG ++              S  LT 
Sbjct: 215 QQDASFLDNNKVGDLISRLSSDASIVSKSLTQNMSDGTRSLIQGFVGFGMMSYISWKLTC 274

Query: 315 ALLMFAPPLLIGALIYGKRIRMISRDLQESTGNLTRVSEEQLSGVKTIQSFVAEGKELQR 374
            +++ APPL + AL+YG++IR +SR LQ S G LT+ +EEQLS  +TIQ++  E + ++ 
Sbjct: 275 VMMLLAPPLAVMALVYGRKIRNLSRTLQASVGGLTKAAEEQLSATRTIQAYGGEKQAIRH 334

Query: 375 YNTAIRKVFLYGKKEALTNATFFSSTNVLGDLSFLIVLAYGSHLVLQGGLTVGDLTAFML 434
           Y   +R+V+  G KEALT+  FF  T ++G+ + L +L  G+ ++  G +TVGDL++FM+
Sbjct: 335 YAKEVRQVYQVGLKEALTSGGFFGLTGLVGNSAVLALLLTGTSMISTGAMTVGDLSSFMI 394

Query: 435 YTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHAPSIKPTAGK-PYVPGSGKISFKDV 493
           Y  YTGS++FG+S+FYSELMKGAGAA+R+FE+ D  P+I PT G+ P       + FK V
Sbjct: 395 YAVYTGSSLFGMSSFYSELMKGAGAAARVFELNDRKPAIHPTKGRDPVSLARKPVEFKKV 454

Query: 494 SFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQD 553
            F+YPTR  + IF  L+  I+PG +VCIVGPSG GKST+ SLLLR+Y+  +G I I  Q+
Sbjct: 455 HFAYPTRRQHVIFEDLSLRIDPGEHVCIVGPSGGGKSTVASLLLRFYDVDAGAILIGGQN 514

Query: 554 ISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAK---KCFCHGFV 610
           I+  + +  RR +G+VQQEPML +G+I  N+ Y +   +  +E   VA+   +  C  F+
Sbjct: 515 IADFNLRKYRRLVGIVQQEPMLFNGTILENILYTVPQRLLNEEDGRVARAIGQANCSAFL 574

Query: 611 TKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTL 670
           + FP+G  T++GPRG  LSGGQKQRIA+ARA +  P +LILDEATSALD  SE  I  TL
Sbjct: 575 SSFPDGLQTMVGPRGTQLSGGQKQRIALARAFLLDPDLLILDEATSALDSRSEEVIARTL 634

Query: 671 GKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQSELYKLLNDK 730
                ++  T ISIAHR+STI+ S  VIVLG +G VVE G F +L ++  S+L KLL  +
Sbjct: 635 HS-RTTRGKTTISIAHRVSTIQHSTRVIVLGRNGGVVETGTFDELASNTDSQLNKLL--R 691

Query: 731 KRDKP 735
           K ++P
Sbjct: 692 KEEEP 696

>Kwal_33.13308 s33 (166479..168599) [2121 bp, 706 aa] {ON} YLR188W
           (MDL1) - ATP-binding cassette (ABC) transporter family
           member [contig 118] FULL
          Length = 706

 Score =  526 bits (1354), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 294/653 (45%), Positives = 411/653 (62%), Gaps = 12/653 (1%)

Query: 111 VESQAKTPADKESQKSGTMEDEESPNMGYKEVIRLFKLATHDWKLLTFAIGLLAISSVIG 170
           V  Q +    +  Q S T+  EE  +  +K++ RLF+LA  + + + FA+ L+ ISS + 
Sbjct: 56  VSRQIRWNHAESRQPSSTLTPEEHNSSSWKDIKRLFQLARPESRSMFFALALIIISSSVS 115

Query: 171 MSIPKVIGMVLDAIKNTYSSA------TGPVGLDDLPPIVNDLSMYEFLGIFAGALVIGT 224
           M +P VIG ++DA K+   ++      +     D     +  L+M +F G+     V+G 
Sbjct: 116 MLVPGVIGKLMDAAKDDQQASKLVENDSDAAAPDADGRQIFGLTMPQFYGVLFSVFVVGA 175

Query: 225 VANFGRIVLLRVLGEKLVARLRSNVIRKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSM 284
            AN GRIV+L+V GEKLVARLR+  ++  + QDA F D NKVGDLISRLSSDA +VS+S+
Sbjct: 176 AANMGRIVILKVTGEKLVARLRTRTLKASLQQDASFLDNNKVGDLISRLSSDASIVSKSL 235

Query: 285 TQNVSDGFKAXXXXXXXXXXXXXXSISLTSALLMFAPPLLIGALIYGKRIRMISRDLQES 344
           TQN+SDG ++              S  LT  +++ APPL   ALIYGKRIR +SR LQ S
Sbjct: 236 TQNMSDGTRSLIQGFVGFGMMSYISWKLTCVMMLLAPPLAAMALIYGKRIRNLSRTLQAS 295

Query: 345 TGNLTRVSEEQLSGVKTIQSFVAEGKELQRYNTAIRKVFLYGKKEALTNATFFSSTNVLG 404
            G LT+ +EEQLS  +TIQ++  E   + +Y   +R+V+  G KEALT+  FF  T ++G
Sbjct: 296 VGGLTKAAEEQLSATRTIQAYGGEKHAIHQYAKEVRQVYQVGLKEALTSGAFFGLTGLVG 355

Query: 405 DLSFLIVLAYGSHLVLQGGLTVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLF 464
           +++ L +L  G+ ++  G +T+GDL++FM+Y  YTGS++FG+S+FYSELMKGAGAA+R+F
Sbjct: 356 NVAVLALLLTGTSMIRTGAMTLGDLSSFMIYAVYTGSSLFGMSSFYSELMKGAGAAARVF 415

Query: 465 EMTDHAPSIKPTAGKPYVPGSGK-ISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVG 523
           E+ D  P+I PT G   V  +GK + F++V F+YPTR  + IF  L F I  G +VCIVG
Sbjct: 416 ELNDRRPAIHPTRGIDPVSLAGKPVEFQNVKFAYPTRHQHTIFENLTFRINAGEHVCIVG 475

Query: 524 PSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYN 583
           PSG GKST+ SLLLR+Y+  +G ITI  Q I+  + +  RR LGVVQQEPML +G+I  N
Sbjct: 476 PSGGGKSTVASLLLRFYDVDTGAITIGGQSIASFNLRKYRRMLGVVQQEPMLFNGTILDN 535

Query: 584 LTYGLQSEVSMDEIRSVAK---KCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIAR 640
           + Y +   +  DE R VA+   +  C  F++ FP+G  T++GPRG  LSGGQKQRIA+AR
Sbjct: 536 IVYSVPQSLLNDENR-VARAIGQANCSAFLSSFPDGLQTLVGPRGTQLSGGQKQRIALAR 594

Query: 641 ALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSENVIVL 700
           A +  P +LILDEATSALD  SE  +   L     ++  T ISIAHR+STI+ S  VIVL
Sbjct: 595 AFLLDPDLLILDEATSALDSRSEEVVARALYS-RSTRGKTTISIAHRVSTIQHSSRVIVL 653

Query: 701 GNDGSVVEVGKFKDLYADQQSELYKLLNDKKRDKPTPRVQSDPEKDREQEHQI 753
           G  G VVE G F +L +D  S+L  LL  ++         S   ++  Q  Q+
Sbjct: 654 GRSGYVVETGTFDELISDPDSQLNLLLRKEEEPSSEETTDSHVPENTSQGQQV 706

>CAGL0E00385g Chr5 (31960..33786) [1827 bp, 608 aa] {ON} similar to
           uniprot|P33310 Saccharomyces cerevisiae YLR188w MDL1 or
           uniprot|P33311 Saccharomyces cerevisiae YPL270w MDL2
          Length = 608

 Score =  508 bits (1307), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 275/593 (46%), Positives = 387/593 (65%), Gaps = 23/593 (3%)

Query: 139 YKEVIRLFKLATHDWKLLTFAIGLLAISSVIGMSIPKVIGMVLDAIKNTYSSATGPVGLD 198
           + +V +L +LA  + K +  A+GL+A+SS + MS+P VIG ++D        A+ P    
Sbjct: 31  WTQVKQLLRLAKPERKYIAGAVGLIAVSSAVSMSLPSVIGTLID-------HASTP---- 79

Query: 199 DLPPIVNDLSMYEFLGIFAGALVIGTVANFGRIVLLRVLGEKLVARLRSNVIRKIIHQDA 258
           D P  +  L+  +FL       V+G +AN GRI++L++ GEKLVARLR+  ++ ++ QDA
Sbjct: 80  DAP--IYGLTRNQFLLALGSVFVVGAIANSGRIIILKITGEKLVARLRTKTMKSMLSQDA 137

Query: 259 EFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTSALLM 318
            F D+++VGDLISRLSSDA +VS+S+T N+SDG +A              S+ LT+ + M
Sbjct: 138 TFLDKHRVGDLISRLSSDASIVSKSVTSNLSDGCRATLQGVVGIGMMTYISLKLTTVMTM 197

Query: 319 FAPPLLIGALIYGKRIRMISRDLQESTGNLTRVSEEQLSGVKTIQSFVAEGKELQRYNTA 378
             PPL I A++YG +I+ ISR LQ+  G L++ SEEQL+ +KT+Q++  E KELQRY+  
Sbjct: 198 MVPPLGILAMLYGGKIKKISRQLQDKVGQLSKTSEEQLNSLKTVQAYAGERKELQRYSNE 257

Query: 379 IRKVFLYGKKEALTNATFFSSTNVLGDLSFLIVLAYGSHLVLQGGLTVGDLTAFMLYTEY 438
           +R VF  G KEA+ +A FF ST ++G+++ + +L  G+       +T+G+L++FM+Y  Y
Sbjct: 258 VRSVFNIGVKEAVASALFFGSTGLIGNIAMIGLLLVGTA---DSSITLGELSSFMMYGVY 314

Query: 439 TGSAVFGLSNFYSELMKGAGAASRLFEMTDHAPSIKPTAG--KPYVPGSGKISFKDVSFS 496
           TGS+VFGL+ FYSELMKG GAA R+ E+ +    I PT G   P       I+F +VSF+
Sbjct: 315 TGSSVFGLTGFYSELMKGCGAAERVLELQNMKTKISPTKGISPPKTLKGLPITFNNVSFA 374

Query: 497 YPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISR 556
           Y    G  + +++NF I PG +VC VG SG GKSTI+SLLLRYY   SG I+I + DIS 
Sbjct: 375 YSN--GKSVLSEMNFQIHPGEHVCFVGGSGCGKSTISSLLLRYYRTGSGNISIGNYDISA 432

Query: 557 LSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNG 616
            + +  RR LGVVQQEP+L +G+I  N+TYGL  + S+ ++    K   C  F+ +   G
Sbjct: 433 FNLRKYRRMLGVVQQEPLLFNGTILDNITYGLHDK-SLTDLNMALKAANCDQFIKESHMG 491

Query: 617 YDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKS 676
            DT++GPRGA LSGGQ+QRIA+AR  ++ P ILILDEATSALD +SE  IN  L +  ++
Sbjct: 492 LDTLVGPRGAQLSGGQRQRIALARVFLQNPDILILDEATSALDTKSEDIINKELQRRQEA 551

Query: 677 KELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQSELYKLLND 729
             +T ISIAHRLSTIR S  VIV+  DG VVE G F  L + + SEL KLL +
Sbjct: 552 G-MTTISIAHRLSTIRHSSRVIVI-EDGRVVESGSFDQLRSTRDSELNKLLKE 602

>TBLA0A05300 Chr1 (1297764..1299887) [2124 bp, 707 aa] {ON} Anc_1.67
           YLR188W
          Length = 707

 Score =  491 bits (1264), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 266/605 (43%), Positives = 386/605 (63%), Gaps = 18/605 (2%)

Query: 140 KEVIRLFKLATHDWKLLTFAIGLLAISSVIGMSIPKVIGMVLDAI----------KNTYS 189
           +++  LFKLA  +   +  ++GL+ I+S + M +P VIG +LD            +N  S
Sbjct: 97  EDIYNLFKLAKPEKWYIIASMGLIFITSAVSMLVPSVIGKLLDISTGIEFASNKDENDES 156

Query: 190 SATGPVGLDDLPPIVNDLSM-YEFLGIFAG---ALVIGTVANFGRIVLLRVLGEKLVARL 245
           S       ++       L   Y  L  F+G     V+G +AN GRI++L++ GE++VARL
Sbjct: 157 SKEDKNENENENENKQTLIYGYTPLVFFSGLGVIFVVGAIANTGRIIILKLTGERIVARL 216

Query: 246 RSNVIRKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXX 305
           R+  ++ I+ QD +F D NKVGDLISRLSSD+ +VS ++T+NVSDG +A           
Sbjct: 217 RTRTMKNILKQDGKFQDSNKVGDLISRLSSDSSIVSNAVTRNVSDGARAVIQGCVGVGMM 276

Query: 306 XXXSISLTSALLMFAPPLLIGALIYGKRIRMISRDLQESTGNLTRVSEEQLSGVKTIQSF 365
              S+ L+  +L   PP+ + A+IYG++IR IS+ LQES G+LT++SEEQL+G +TIQS+
Sbjct: 277 SFISLKLSGVMLFMVPPIGVLAMIYGRKIRNISKKLQESVGSLTKISEEQLNGTRTIQSY 336

Query: 366 VAEGKELQRYNTAIRKVFLYGKKEALTNATFFSSTNVLGDLSFLIVLAYGSHLVLQGGLT 425
           V E  E+ +Y   +RKV+  G  EA+ +  FF  T ++G+ + L +L  G +++  G L+
Sbjct: 337 VGEKLEIHKYAKEVRKVYHVGLNEAVASGLFFGVTGLIGNGAMLSLLYVGCNMISNGTLS 396

Query: 426 VGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHAPSIKPTAG-KPYVPG 484
           +G L++FM+Y  YTGS++FGLS+FYSE+MKG+GAASR+FE+  + P I  T G  P    
Sbjct: 397 IGGLSSFMMYAVYTGSSLFGLSSFYSEIMKGSGAASRIFEINKYVPDINATKGIDPISFQ 456

Query: 485 SGKISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSS 544
              I F+ + F+YPTR G+ IF  LN  I PG +VCI+GPSG GKSTI+SLLLRYY+P +
Sbjct: 457 DKPIEFEHIKFAYPTRSGHMIFQDLNIKINPGEHVCIIGPSGSGKSTISSLLLRYYDPLA 516

Query: 545 GQITIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIR--SVAK 602
           G I+I  +DI   S +  R+ +GVV QEP+L +G+I  N+ Y +  E++ D+ R  +  +
Sbjct: 517 GTISIGGKDIKEYSLRKYRKLMGVVHQEPVLFNGTILENILYNVPEEIANDKERLSNAIE 576

Query: 603 KCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVES 662
              C+ F+   P G +T +GPRG  LSGGQKQR+A+ARA + +P +L+LDEATSALD  S
Sbjct: 577 SSNCNKFLNTLPLGLETPVGPRGTQLSGGQKQRVALARAFLLEPTLLVLDEATSALDPRS 636

Query: 663 EGAINYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQSE 722
           E  +  TL K   +K  T ISIAHR+STI+ S  V+VL   G VVE G +++L   + S 
Sbjct: 637 ESIVAQTL-KQRCAKGFTTISIAHRVSTIKHSSRVVVLDKVGHVVETGPYEELLGIKDSA 695

Query: 723 LYKLL 727
           L KLL
Sbjct: 696 LNKLL 700

>TBLA0B10070 Chr2 (2422767..2426657) [3891 bp, 1296 aa] {ON} Anc_1.527
            YKL209C
          Length = 1296

 Score =  203 bits (517), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 165/565 (29%), Positives = 267/565 (47%), Gaps = 35/565 (6%)

Query: 188  YSSATGPVG-------LDDLPPIVNDLSMYEFL----GIFAGALVIGTVANFGRIVLLRV 236
            ++ AT P+        L  + P + D+    +L     I  G  +I  ++NF +  LL +
Sbjct: 736  FAGATNPIFSWAFSYLLAGIAPTLKDIGSVHYLIKWSCIVIGITIIDGISNFFKGFLLGI 795

Query: 237  LGEKLVARLRSNVIRKIIHQDAEFF--DRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKA 294
              E  +  LR   +++I+ +  ++F  ++ +  ++ + + +D     R +   VS+   A
Sbjct: 796  CSEYWIMDLRDKFMKEILRKKIQWFSDEKYQTAEMSALILNDL----RDLRSLVSEFMSA 851

Query: 295  XXXXXXXXXXXXXXSI----SLTSALLMFAPPLLIGALIYGKRIRMISRDLQESTGNLTR 350
                          ++     L    +   P ++I + IYG  ++    D + S  NL  
Sbjct: 852  MATFIVVSLFGLIWALVTGWKLALVCIAMFPLIIIFSAIYGAVLQKSETDYKSSVANLEN 911

Query: 351  VSEEQLSGVKTIQSFVAEGKELQRYNTAIRKVFLYGKKEALTNATFFSSTNVLGDLSFLI 410
            +  + +S +KTI+S   EG     Y  A  K+     K ++      S TN +      I
Sbjct: 912  IEFDIVSNIKTIKSLQLEGHFYHNYKVAETKLKNVATKRSIYTGLGISITNTITMCIQAI 971

Query: 411  VLAYGSHLVLQGGLTVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHA 470
            +  YG  L++ G  TV  +        +T      L N   ++ +G  AAS ++ +   +
Sbjct: 972  LYYYGFKLIMDGEYTVKQMFTTFTLLLFTVMTCNSLVNQIPDMSRGQRAASWVYSILQQS 1031

Query: 471  PSIKPTAG-KPYVPGSGKIS-------FKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIV 522
               K        +  +  IS        K+++F+Y + P  ++ + L   + PG  + I 
Sbjct: 1032 DDTKEVNDPNSIIVDNNTISNDFPILDIKNLTFAYESTPSIKVLDGLTLKLFPGDKLAIA 1091

Query: 523  GPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKY 582
            G SG GK+T+ SLL+++Y+    QI  + +DI     +SLR  + +V+Q+P ++SGSI+ 
Sbjct: 1092 GESGCGKTTLLSLLVKFYDVDPNQIYFNGKDILNYEFESLRDAIVIVEQKPSVLSGSIRD 1151

Query: 583  NLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARAL 642
            NL    +  +S  E+  V K      F+   P+G DTII      LSGGQ QRI IARAL
Sbjct: 1152 NLLGNNKRLISDYELYDVLKLTGIFDFIETLPSGIDTIIDT--TLLSGGQAQRICIARAL 1209

Query: 643  MKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGN 702
            ++KPKILILDE TSALD  S   IN  + K +    +TIISI H  S +   +NV VL N
Sbjct: 1210 LRKPKILILDECTSALDAMSADIINNLVSKELNG--VTIISITHSESMMTSCQNVAVLKN 1267

Query: 703  DGSVVEVGKFKDLYADQQSELYKLL 727
             G +VEVG +  L A   S L KLL
Sbjct: 1268 -GKIVEVGTYDSL-ATSSSHLGKLL 1290

 Score =  192 bits (487), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 138/502 (27%), Positives = 248/502 (49%), Gaps = 15/502 (2%)

Query: 237 LGEKLVARLRSNVIRKIIHQDAEFFDRNKV--GDLISRLSSDAYVVSRSMTQNVSDGFKA 294
           +GE+   ++R+ ++   + Q   ++D N+   GD  ++L      +  S  +  +  F+ 
Sbjct: 106 IGERQGIKVRTKILNNYLTQSMTWYDLNEQLQGDF-TQLHRCVEELRSSSAEASAVTFQN 164

Query: 295 XXXXXXXXXXXXXXSISLTSALLMFAPPLLIGALIYGKRIRMISRDLQESTGNLTRVSEE 354
                         S SLT  +L   P + I ++ +   I+  +      T    ++  E
Sbjct: 165 CIAIIALIATSFYYSWSLTLIILCSTPIICIFSICFSIMIQKFANLENNETTVSAQIFTE 224

Query: 355 QLSGVKTIQSFVAEGKELQRYNTAIRKVFLYGKKEALTNATFFSSTNVLGDLSFLIVLAY 414
            +  ++ I+    + K+L ++ T+I K   +  +  L  +   S    L  L F+    +
Sbjct: 225 TIQNIQLIKLNNLQLKKLMKFQTSISKCNKFFIQMCLYVSLNTSILRTLTLLMFVQGFWF 284

Query: 415 GSHLVLQGGLTVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHAPSIK 474
           GS ++ +G L + ++          GS +    +    L KG  A  ++ +  D A    
Sbjct: 285 GSTMIRKGHLKIDEVITCFSSCLLLGSIISNTLHQIVVLQKGEVALQKIVDFLDEADDPL 344

Query: 475 PTAGKPYVPGSGKISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITS 534
                P    +  ISF+++SF+YP+RP   I N++N   +  +   IVG SG GKST+++
Sbjct: 345 EINSAPITLINSNISFQNISFAYPSRPNENILNQINLYFQNSATTFIVGKSGSGKSTLSN 404

Query: 535 LLLRYYNPSSGQITIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSM 594
           LLL++Y    G I ID+ +I  L+ K+L  ++ +V+Q+  L + +I+ N+ +G+ +  + 
Sbjct: 405 LLLKFYETYKGDILIDNINIKNLNQKNLLDNIMIVEQKCTLFNDTIRNNILFGVSNFTNQ 464

Query: 595 ---------DEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKK 645
                    + +++         F+   PNG DT+IG  G +LSGGQ+QR+A+ARA M+ 
Sbjct: 465 YASNRPNLNERLKNACTFALLDHFLIDLPNGIDTVIGTGGITLSGGQQQRVALARAYMRD 524

Query: 646 PKILILDEATSALDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGS 705
           P ILILDEA SALDV     +   + KL +S + TII + H L+ I   + + V+ + G 
Sbjct: 525 PPILILDEAVSALDVNIRELLMKAI-KLWRSNKTTII-LTHDLTQIDNDDFLYVIKH-GR 581

Query: 706 VVEVGKFKDLYADQQSELYKLL 727
           ++E GK K+L  D  +E +KL+
Sbjct: 582 IIEHGKRKELITDPNTEFHKLV 603

>YKL209C Chr11 complement(42423..46295) [3873 bp, 1290 aa] {ON}
            STE6Plasma membrane ATP-binding cassette (ABC)
            transporter required for the export of a-factor,
            catalyzes ATP hydrolysis coupled to a-factor transport;
            contains 12 transmembrane domains and two ATP binding
            domains; expressed only in MATa cells
          Length = 1290

 Score =  201 bits (512), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 159/534 (29%), Positives = 256/534 (47%), Gaps = 33/534 (6%)

Query: 220  LVIGTVA-----NFGRIVLLRVLGEKLVARLRSNVIRKIIHQDAEFF--DRNKVGDLISR 272
            LV+G  A     NF +  LL    E  V  LR+ V+ K+  ++ ++F  + NK  ++ + 
Sbjct: 765  LVLGVAAADGIFNFAKGFLLDCCSEYWVMDLRNEVMEKLTRKNMDWFSGENNKASEISAL 824

Query: 273  LSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSI----SLTSALLMFAPPLLIGAL 328
            + +D     R +   VS+   A              ++     L+   +   P ++I + 
Sbjct: 825  VLNDL----RDLRSLVSEFLSAMTSFVTVSTIGLIWALVSGWKLSLVCISMFPLIIIFSA 880

Query: 329  IYGKRIRMISRDLQESTGNLTRVSEEQLSGVKTIQSFVAEGKELQRYNTAIRKVFLYGKK 388
            IYG  ++    D + S   L     + ++ +KTI+   AE      Y+    K+     K
Sbjct: 881  IYGGILQKCETDYKTSVAQLENCLYQIVTNIKTIKCLQAEFHFQLTYHDLKIKMQQIASK 940

Query: 389  EALTNATFFSSTNVLGDLSFLIVLAYGSHLVLQGGLTVGDLTAFMLYTEYTGSAVFGLSN 448
             A+      S TN++      I+  YG  LV+    T  ++        +T  +   L +
Sbjct: 941  RAIATGFGISMTNMIVMCIQAIIYYYGLKLVMIHEYTSKEMFTTFTLLLFTIMSCTSLVS 1000

Query: 449  FYSELMKGAGAASRLFEMTDHAPSIKPT----------AGKPYVPGSGK--ISFKDVSFS 496
               ++ +G  AAS ++ + D   +              AG  Y     K  +S ++++F+
Sbjct: 1001 QIPDISRGQRAASWIYRILDEKHNTLEVENNNARTVGIAGHTYHGKEKKPIVSIQNLTFA 1060

Query: 497  YPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISR 556
            YP+ P   ++  +NF +  G  + I+G SG GKST+  LL + YN   G+I ID  D++ 
Sbjct: 1061 YPSAPTAFVYKNMNFDMFCGQTLGIIGESGTGKSTLVLLLTKLYNCEVGKIKIDGTDVND 1120

Query: 557  LSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNG 616
             +  SLR+ + VV+Q+P+L +G+I+ NLTYGLQ E+   E+    K    H FV   P G
Sbjct: 1121 WNLTSLRKEISVVEQKPLLFNGTIRDNLTYGLQDEILEIEMYDALKYVGIHDFVISSPQG 1180

Query: 617  YDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKS 676
             DT I      LSGGQ QR+ IARAL++K KILILDE TSALD  S   IN  + K    
Sbjct: 1181 LDTRIDT--TLLSGGQAQRLCIARALLRKSKILILDECTSALDSVSSSIINEIVKK--GP 1236

Query: 677  KELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQSELYKLLNDK 730
              L  + I H    +R   ++ VL  DG VVE G F  LY + + EL+++++++
Sbjct: 1237 PALLTMVITHSEQMMRSCNSIAVL-KDGKVVERGNFDTLY-NNRGELFQIVSNQ 1288

 Score =  170 bits (431), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 142/545 (26%), Positives = 252/545 (46%), Gaps = 40/545 (7%)

Query: 237 LGEKLVARLRSNVIRKIIHQD-AEFFDRNK--VGDLISRLSSDAYVVSRSMTQNVSDGFK 293
           +GE+   R+RS ++   + +   E++D N+  +GD  ++++     +  S  +  +  F+
Sbjct: 99  IGERQGFRIRSQILEAYLEEKPMEWYDNNEKLLGDF-TQINRCVEELRSSSAEASAITFQ 157

Query: 294 AXXXXXXXXXXXXXXSISLTSALLMFAPPLLIGALIYGKRIRMISRDLQESTGNLTRVSE 353
                          S SLT  +L  +P +   A+++ + I + S      T    ++  
Sbjct: 158 NLVAICALLGTSFYYSWSLTLIILCSSPIITFFAVVFSRMIHVYSEKENSETSKAAQLLT 217

Query: 354 EQLSGVKTIQSFVAEGKELQRYNTAIRKVFLYGKKEALTNATFFSSTNVLGDLSFLIV-- 411
             ++  + ++ +  +  E +++   I     +  K     + FF + N  G L FL +  
Sbjct: 218 WSMNAAQLVRLYCTQRLERKKFKEIILNCNTFFIK-----SCFFVAANA-GILRFLTLTM 271

Query: 412 ----LAYGSHLVLQGGLTVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEM- 466
                 +GS ++ +G L + D+          GS +    +    L KG  A  ++  + 
Sbjct: 272 FVQGFWFGSAMIKKGKLNINDVITCFHSCIMLGSTLNNTLHQIVVLQKGGVAMEKIMTLL 331

Query: 467 ---TDHAPSIKPTAGK-PYVPGSGKISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIV 522
              +   P  K  A + P    +  ++F +VSFSYP+RP   +   ++     G    IV
Sbjct: 332 KDGSKRNPLNKTVAHQFPLDYATSDLTFANVSFSYPSRPSEAVLKNVSLNFSAGQFTFIV 391

Query: 523 GPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKY 582
           G SG GKST+++LLLR+Y+  +G I+I+  +I  +  K L  ++ VV+Q   L + +++ 
Sbjct: 392 GKSGSGKSTLSNLLLRFYDGYNGSISINGHNIQTIDQKLLIENITVVEQRCTLFNDTLRK 451

Query: 583 NLTYG-----LQSEVSMDE----IRSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQK 633
           N+  G       ++ S +E    I+   +      F+   P+G +T+IG  G +LSGGQ+
Sbjct: 452 NILLGSTDSVRNADCSTNENRHLIKDACQMALLDRFILDLPDGLETLIGTGGVTLSGGQQ 511

Query: 634 QRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRR 693
           QR+AIARA ++   IL LDEA SALD+     +   +    K K  T I + H LS I  
Sbjct: 512 QRVAIARAFIRDTPILFLDEAVSALDIVHRNLLMKAIRHWRKGK--TTIILTHELSQI-E 568

Query: 694 SENVIVLGNDGSVVEVGKFKDLYADQQ---SELYKLLNDKKRDKPTPRVQSDPEKDREQE 750
           S++ + L  +G VVE G   +L AD     S  Y L ND    K       D E + +  
Sbjct: 569 SDDYLYLMKEGEVVESGTQSELLADPTTTFSTWYHLQNDYSDAKTIV----DTETEEKSI 624

Query: 751 HQIDN 755
           H +++
Sbjct: 625 HTVES 629

>SAKL0H00968g Chr8 (107767..109869) [2103 bp, 700 aa] {ON} highly
           similar to uniprot|P40416 Saccharomyces cerevisiae
           YMR301C ATM1 Mitochondrial inner membrane transporter
           exports mitochondrially synthesized precursors of
           iron-sulfur (Fe/S) clusters to the cytosol member of the
           ATP-binding cassette (ABC) transporter family
          Length = 700

 Score =  195 bits (495), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 173/653 (26%), Positives = 294/653 (45%), Gaps = 56/653 (8%)

Query: 122 ESQKSGTMEDEESPNMGYKEVIR-LFKLATHDW---------KLLTFAIGLLAISSVIGM 171
           E+ K+      ++P +   ++++ LFK   + W         ++LT A+ LL  + ++ +
Sbjct: 78  EAPKTKVTSKSKAPTISELKILKDLFK---YIWPSGDNKVRFRVLT-ALALLIGAKLLNV 133

Query: 172 SIPKVIGMVLDAIKNTYSSATGPVGLDDLPPIVNDLSMYEFLGIFAGALVIGTVANFGRI 231
            +P      +D++   +S AT  +      PI   L++  +     GA++ G + N    
Sbjct: 134 QVPFFFKDAVDSMNIEWSDATTVL------PIAITLTVLSYGAARFGAVLFGEIRN---- 183

Query: 232 VLLRVLGEKLVARLRSNVIRKIIHQDAEFFDRNKVGDLISRLSSD------------AYV 279
                    + A +  N IRK+  Q  +   R  +G  +SR +              +YV
Sbjct: 184 --------AVFASVAQNAIRKVSLQTFQHLMRLDLGWHLSRQTGGLTRAMDRGTKGISYV 235

Query: 280 VSRSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTSALLMFAPPLLIGALIYGKRIRMISR 339
           +S  +   +   F+                 ++T A ++           +    R   R
Sbjct: 236 LSAMVFHIIPIAFEISVVCGILTYQFGTSFAAVTFATMLLYSIFTFKTTAWRTEFR---R 292

Query: 340 DLQESTGNLTRVSEEQLSGVKTIQSFVAEGKELQRYNTAIRKVFLYGKKEALTNATFFSS 399
               +      V+ + L   + ++ F  E     +Y+ ++        K A + A   S 
Sbjct: 293 SANRADNKAASVALDSLINFEAVKYFNNERYLADKYHNSLTNYTNSQIKVAQSLAFLNSG 352

Query: 400 TNVLGDLSFLIVLAYGSHLVLQGGLTVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGA 459
            N++   +   ++  G   V+ G L+VGDL             +  L + Y EL +    
Sbjct: 353 QNLIFTSALTAMMYMGCTGVMSGDLSVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLID 412

Query: 460 ASRLFEMTDHAPSIKPTAGKPYVPGS--GKISFKDVSFSYPTRPGNQIFNKLNFTIEPGS 517
              LF++  +  +I+ +     +P     +I F++V+F Y   P  +I    NFT+  G 
Sbjct: 413 MESLFKLQKNKVNIQNSKTPLMLPKDKPCEIKFENVTFGY--HPDRKILENANFTLPAGW 470

Query: 518 NVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRHLGVVQQEPMLMS 577
              IVGPSG GKSTI  L+ R+Y+P  G+I ID +DI  L  KSLRR +GVV Q+  L +
Sbjct: 471 KTAIVGPSGSGKSTILKLVFRFYDPQEGRILIDGKDIRELDLKSLRRAIGVVPQDTPLFN 530

Query: 578 GSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIA 637
            +I  N+ +G +   + D+IR    K      +   P G +TI+G RG  +SGG+KQR+A
Sbjct: 531 DTIWENVKFG-KITATDDDIRKAIDKAQLAPLIHSLPQGSETIVGERGLMISGGEKQRLA 589

Query: 638 IARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSENV 697
           IAR L+K   I+  DEATSALD  +E A+  T+ +       T I IAHRL TI  ++ +
Sbjct: 590 IARVLLKDTPIMFFDEATSALDTHTEQALLRTIKENFAGNSRTSIYIAHRLRTIADADKI 649

Query: 698 IVLGNDGSVVEVGKFKDLYADQQSELYKLLNDKKRDKPTPRVQSDPEKDREQE 750
           +VL N G V E GK  +L +   S   +L N ++       ++ + E D++Q+
Sbjct: 650 VVLEN-GRVKEEGKHAELLSKPTSLYSELWNIQEN---LDLLEEEIEMDKKQQ 698

>SAKL0A10208g Chr1 (894334..898266) [3933 bp, 1310 aa] {ON} similar to
            uniprot|P12866 Saccharomyces cerevisiae YKL209C STE6
            ATP-binding cassette (ABC) transporter required for the
            export of a-factor catalyzes ATP hydrolysis coupled to
            a-factor transport contains 12 transmembrane domains and
            two ATP binding domains expressed only in MATa cells
          Length = 1310

 Score =  197 bits (500), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 163/566 (28%), Positives = 262/566 (46%), Gaps = 28/566 (4%)

Query: 180  VLDAIKNTYSSATGPVGLDDLPPIVNDLSMYEFLGIFAGAL----VIGTVANFGRIVLLR 235
            ++  I N   S T    L  + P  N++   ++L  ++G +    V+ +   F +   L 
Sbjct: 756  LMAGIANPIFSYTFSKLLSGIVPQNNEIGSPKYLIKWSGIVLFIAVLDSTFTFLKNFFLG 815

Query: 236  VLGEKLVARLRSNVIRKIIHQDAEFF--DRNKVGDLISRLSSDAYVVSRSMTQNVSDGFK 293
               E  +  LR   IRKI  QD  +F  D NK  ++ + + +D   +   +++ +S    
Sbjct: 816  YCSEYWIRDLRMLAIRKITAQDLHWFSLDMNKSSEISALVLNDLRDLRSLVSEFLSSIST 875

Query: 294  AXXXXXXXXXXXXXXSISLTSALLMFAPPLLIGALIYGKRIRMISRDLQESTGNLTRVSE 353
                              L+   +   P  ++ +  YG  ++    D +     L     
Sbjct: 876  LIIVSSVGIVWAFISGWKLSLVCISLFPIFILFSCFYGGLLQRYETDYKTKVAELENQLH 935

Query: 354  EQLSGVKTIQSFVAEGKELQRYNTAIRKVFLYGKKEALTNATFFSSTNVLGDLSFLIVLA 413
            E   G+ TI+    E + L++Y    +K+    KK A+T     +++N L      I+  
Sbjct: 936  EIFRGITTIRYLKLEYQFLEKYYNLEKKMRRASKKRAITIGFGVAASNTLTLAVQAILFY 995

Query: 414  YGSHLVLQGGLTVGDLT---AFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDH- 469
            YG  LV  G  +   +      +L+T  T  ++ G      ++ +G  AA+ +F + D+ 
Sbjct: 996  YGIKLVTTGSYSTEKMFETFTLLLFTVMTCVSLIGQ---IPDISRGQRAATYIFRIIDNQ 1052

Query: 470  APSIKPTAGKPYVPGSGK------ISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVG 523
            +P+ K    K     S K      IS K++SFSYP+ P   I+  L   +  G  + +VG
Sbjct: 1053 SPAAKDEKKKI---ASYKFTHDPLISVKNLSFSYPSAPSTAIYKGLKLDVFSGETIAVVG 1109

Query: 524  PSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYN 583
             SG GKST+T L+   Y   +G I ID  DI+R     LR  + VV+Q+P    G++  N
Sbjct: 1110 ESGSGKSTLTLLISALYEVPNGSIEIDGIDINRWDTNKLRTIISVVEQKPQFFDGTVGEN 1169

Query: 584  LTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALM 643
            L YG+   V+  +++          FV   P G DT I    + +SGGQ QR++IARA++
Sbjct: 1170 LLYGISGRVTQIQVKEALCLAGVQDFVFSLPEGLDTRIDT--SLISGGQAQRLSIARAML 1227

Query: 644  KKPKILILDEATSALDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGND 703
            +KPKIL LDE TSALD  +  AI   + K      +T I I H    +R  E + VL N 
Sbjct: 1228 RKPKILFLDECTSALDTSNTHAIANLIKKHFCG--ITTIVITHNEQMMRACERIAVLQN- 1284

Query: 704  GSVVEVGKFKDLYADQQSELYKLLND 729
            G V E G F DLYA Q+ E ++++N+
Sbjct: 1285 GKVAEDGSFDDLYA-QRGEFFRIMNN 1309

 Score =  149 bits (377), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 147/622 (23%), Positives = 275/622 (44%), Gaps = 44/622 (7%)

Query: 151 HDWKLLTFAIGLLAISSVIGMSIPKVIGMVLDAIKNTYSSATGPVGLDDLPPIVNDLSMY 210
            DW     A+ ++ +++++   +P +  ++   I N   + +   G D  P    ++++ 
Sbjct: 25  EDW----LALLVILVTTILNGLVPAITSILTGKIFNLLQTFSRH-GFDSNPTFKREVTLK 79

Query: 211 EFLGIFAGALVIGTVANFGRIVLLRVLGEKLVARLRSNVIRKIIHQDAEFFDRN-KVGDL 269
               +  G   +     +  I     LGEK   R+R  ++   + +   ++D++ +    
Sbjct: 80  SMSLMLTGVACLPIC--WLSIYTWMDLGEKQGLRVRRKLLNTYLDKPLTWYDKSEQASGE 137

Query: 270 ISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTSALLMFAPPLLIGALI 329
            ++L+     +  S  ++ +  F+               S SLT  ++   P +++ ++I
Sbjct: 138 FTQLNRCVEELRSSCAESSAITFQNVVTVFALTITSFYYSWSLTLVIMAGVPIIIVFSVI 197

Query: 330 YGKRIRMISRDLQESTGNLTRVSEEQLSGVKTIQSFVAEGKELQRYNTAIRKVFLYGKKE 389
             K I   +R     +    ++        + I+ F  +  E++++  +++K   Y  + 
Sbjct: 198 LSKLIERFTRLENMESSRAAQMVSWSFDAAEMIRLFCTQQFEIEKFELSVKKCTKYFIRI 257

Query: 390 ALTNATFFSSTNVLGDLSFLIVLAYGSHLVLQGGLTVGDLTAFMLYTEYTGSAVFG--LS 447
           +L ++  ++         F+    +G+ ++ QG LT GD+      T ++   + G  L+
Sbjct: 258 SLFSSASYAMLRFFTLCMFIQGFWFGNKMIRQGVLTTGDVI-----TCFSSCLLLGNTLN 312

Query: 448 NFYSELM---KGAGAASRLFEMT-------DHAPSIKPTA-------GKPYVPGSGKISF 490
           N   +++   KG  A  ++   T       DH   I   A          +  G G+ISF
Sbjct: 313 NTLQQVITMQKGKVALGKILMFTSEENDFPDHRNEIISDAFILNHINANKFRCG-GEISF 371

Query: 491 KDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITID 550
           K+VSFSYPTRP   +   ++          IVG SG GKSTI  LLL+ Y   +G I +D
Sbjct: 372 KNVSFSYPTRPNYHVLKNVSLNFPKNKTTFIVGKSGSGKSTIGKLLLKSYGGYTGAIEVD 431

Query: 551 DQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDE-IRSVAKKCFCHGF 609
             DI  +    L  ++ +V+Q   L + +IK N+  G + +   D  +R   +       
Sbjct: 432 GIDIQHIKTSWLAENITLVEQSCTLFNDTIKNNILLGCKGKAYGDSLVREACQMALLDRL 491

Query: 610 VTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYT 669
           +   PNG DT++G  G SLSGGQKQR+A+ARA ++   ILILDEA S +D+     +   
Sbjct: 492 IFDLPNGLDTVLGSGGVSLSGGQKQRVALARARVRDSPILILDEAISGMDIIHRDLLVEA 551

Query: 670 LGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQSELYKLLND 729
           + K  K   +T + + H L+ I   E+ +    +G + E G   +L  ++ S   +L   
Sbjct: 552 IKKWRKG--MTTVIVTHELTQI-SDEDYLYFMEEGQIRESGFKCNLEKNENSHFNRLWRL 608

Query: 730 KK-------RDKPTPRVQSDPE 744
           +K       R   T  ++  PE
Sbjct: 609 QKAKTGFSRRSVSTSNLEKFPE 630

>Skud_13.475 Chr13 complement(841033..843108) [2076 bp, 691 aa] {ON}
           YMR301C (REAL)
          Length = 691

 Score =  191 bits (485), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 166/591 (28%), Positives = 273/591 (46%), Gaps = 48/591 (8%)

Query: 159 AIGLLAISSVIGMSIPKVIGMVLDAIKNTYSSATGPVGLDDLPPIVNDLSMYEFLGIFAG 218
           A+GLL  + V+ + +P      +D++  T+   T  V L    P    L++  +      
Sbjct: 115 ALGLLISAKVLNVQVPFFFKQTIDSMNITWDDPT--VAL----PAAIGLTIISY------ 162

Query: 219 ALVIGTVANFGRIVLLRVLGEKLVARLRSNVIRKIIHQDAEFFDRNKVGDLISRLSSDAY 278
                 VA FG  VL   L   + A++  N IR +  Q  +   +  +G  +SR +    
Sbjct: 163 -----GVARFGS-VLFGELRNAVFAKVAQNAIRTVSLQTFQHLMKLDLGWHLSRQTGG-- 214

Query: 279 VVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTSALLMFAPPLLIGALIYGKRI---- 334
            ++R+M +  + G                  IS+   +L +       A+ +   +    
Sbjct: 215 -LTRAMDRG-TKGISQVLTAMVFHIIPISFEISVVCGILTYQFGASFAAITFSTMLLYSI 272

Query: 335 ---------RMISRDLQESTGNLTRVSEEQLSGVKTIQSFVAEGKELQRYNTAIRKVFLY 385
                        RD   +      V+ + L   + ++ F  E     +YN+++      
Sbjct: 273 FTIKTTAWRTHFRRDANRADNKAASVALDSLINFEAVKYFNNEKYLSSKYNSSLMNYRDS 332

Query: 386 GKKEALTNATFFSSTNVLGDLSFLIVLAYGSHLVLQGGLTVGDLTAFMLYTEYTGSAVFG 445
             K + + A   S  N++   +   ++  G   V+ G LTVGDL             +  
Sbjct: 333 QIKVSQSLAFLNSGQNLIFTTALTAMMYMGCTGVIGGDLTVGDLVLINQLVFQLSVPLNF 392

Query: 446 LSNFYSELMKGAGAASRLFEMTDHAPSIK----PTAGKPYVPGSGKISFKDVSFSYPTRP 501
           L + Y +L +       LF++  +   IK    P     +VP   +I+F++V+F Y   P
Sbjct: 393 LGSVYRDLKQSLIDMETLFKLRKNEVKIKSVERPLMLPEHVPY--EITFENVTFGY--HP 448

Query: 502 GNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKS 561
             +I    +FTI  G    IVG SG GKSTI  L+ R+Y+P SG+I I+ +DI      +
Sbjct: 449 DRKILKNASFTIPAGWKTAIVGSSGSGKSTILKLVFRFYDPESGRILINGRDIKEYDIDA 508

Query: 562 LRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTII 621
           LRR +GVV Q+  L + +I  N+ +G + + + +E+++  +K      + K P G++TI+
Sbjct: 509 LRRVIGVVPQDTPLFNDTIWENVKFG-RIDATDEEVKTAVQKAQLAPLIKKLPQGFETIV 567

Query: 622 GPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTI 681
           G RG  +SGG+KQR+AIAR L+K  +I+  DEATSALD  +E A+  T+     S   T 
Sbjct: 568 GERGLMISGGEKQRLAIARVLLKNARIMFFDEATSALDTHTEQALLRTIRSNFPSGSRTS 627

Query: 682 ISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQS---ELYKLLND 729
           + IAHRL TI  ++ +IVL N G+V E GK  +L A   S   EL+ +  D
Sbjct: 628 VYIAHRLRTIADADKIIVLDN-GTVKEDGKHIELLATPGSLYRELWTIQED 677

>Smik_13.518 Chr13 complement(850174..852237) [2064 bp, 687 aa] {ON}
           YMR301C (REAL)
          Length = 687

 Score =  191 bits (485), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 171/592 (28%), Positives = 276/592 (46%), Gaps = 50/592 (8%)

Query: 159 AIGLLAISSVIGMSIPKVIGMVLDAIKNTYSSATGPVGLDDLPPIVNDLSMYEFLGIFAG 218
           A+GLL  + ++ + +P      +D++          +  DD  P V   ++   +G+   
Sbjct: 114 ALGLLISAKILNVQVPFFFKQTIDSMN---------IAWDD--PTV---ALPAAIGL--- 156

Query: 219 ALVIGTVANFGRIVLLRVLGEKLVARLRSNVIRKIIHQDAEFFDRNKVGDLISRLSSDAY 278
            ++   VA FG  VL   L   + AR+  N IR +  Q  +   +  +G  +SR +    
Sbjct: 157 TILCYGVARFGS-VLFGELRNAVFARVAQNAIRTVSLQTFQHLMKLDLGWHLSRQTGG-- 213

Query: 279 VVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTSALLM------FAPPLLIGALIY-- 330
            ++R+M +  + G                  IS+   +L       FA       L+Y  
Sbjct: 214 -LTRAMDRG-TKGISQVLTAMVFHIIPISFEISVVCGILTYQFGASFAAITFSTMLLYSM 271

Query: 331 ------GKRIRMISRDLQESTGNLTRVSEEQLSGVKTIQSFVAEGKELQRYNTAIRKVFL 384
                   R +   RD  ++      V+ + L   + ++ F  E     +YN+++     
Sbjct: 272 FTIKTTAWRTKF-RRDANKADNKAASVALDSLINFEAVKYFNNEKYLSDKYNSSLISYRD 330

Query: 385 YGKKEALTNATFFSSTNVLGDLSFLIVLAYGSHLVLQGGLTVGDLTAFMLYTEYTGSAVF 444
              K + + A   S  N++   +   ++  G   V+ G LTVGDL             + 
Sbjct: 331 SQIKVSQSLAFLNSGQNLIFTTALTAMMYMGCTGVIGGNLTVGDLVLINQLVFQLSVPLN 390

Query: 445 GLSNFYSELMKGAGAASRLFEMTDHAPSIK----PTAGKPYVPGSGKISFKDVSFSYPTR 500
            L + Y +L +       LF++  +   IK    P     +VP    I+F++V+F Y   
Sbjct: 391 FLGSVYRDLKQSLIDMETLFKLRRNEVKIKNAERPLMLPEHVPYD--ITFENVTFGY--H 446

Query: 501 PGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCK 560
           P  +I    +FTI  G    IVG SG GKSTI  L+ R+Y+P SG+I I+ +DI      
Sbjct: 447 PDRKILKNASFTIPAGWKTAIVGSSGSGKSTILKLVFRFYDPESGRILINGRDIREYDIN 506

Query: 561 SLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTI 620
           +LR+ +GVV Q+  L + +I  N+ +G + + + +E+ +V +K      + K P G+DTI
Sbjct: 507 ALRKVIGVVPQDTPLFNDTIWENVKFG-RIDATDEEVMTVVEKAQLAPLIKKLPQGFDTI 565

Query: 621 IGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELT 680
           +G RG  +SGG+KQR+AIAR L+K  KI+  DEATSALD  +E A+  T+     S   T
Sbjct: 566 VGERGLMISGGEKQRLAIARVLLKNAKIMFFDEATSALDTHTEQALLRTIRSNFTSGSRT 625

Query: 681 IISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQS---ELYKLLND 729
            + IAHRL TI  ++ +IVL N G V E GK  +L A   S   EL+ +  D
Sbjct: 626 SVYIAHRLRTIADADKIIVLDN-GRVREEGKHLELLATPNSLYRELWTIQED 676

>Suva_13.491 Chr13 complement(849300..851381) [2082 bp, 693 aa] {ON}
           YMR301C (REAL)
          Length = 693

 Score =  191 bits (485), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 167/602 (27%), Positives = 274/602 (45%), Gaps = 53/602 (8%)

Query: 159 AIGLLAISSVIGMSIPKVIGMVLDAIKNTYSSATGPVGLDDLPPIVNDLSMYEFLGIFAG 218
           A+GLL  + ++ + +P      +D++  T+   T              +++   +G+   
Sbjct: 117 ALGLLISAKILNVQVPFFFKQTIDSMNITWDDPT--------------IALPAAIGL--T 160

Query: 219 ALVIGTVANFGRIVLLRVLGEKLVARLRSNVIRKIIHQDAEFFDRNKVGDLISRLSSD-- 276
            L  GT A FG  VL   L   + AR+  N IR +  Q      +  +G  +SR +    
Sbjct: 161 ILCYGT-ARFGS-VLFGELRNAVFARVAQNAIRTVSLQTFRHLMKLDLGWHLSRQTGGLT 218

Query: 277 ----------AYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTSALLMFAPPLLIG 326
                     +YV++  +   +   F+                 ++T + ++      I 
Sbjct: 219 RAMDRGTKGISYVLTAMVFHIIPISFEISVVCGILTYQFGASFAAITFSTMLLYSMFTIK 278

Query: 327 ALIYGKRIRMISRDLQESTGNLTRVSEEQLSGVKTIQSFVAEGKELQRYNTAIRKVFLYG 386
              +    R   RD   +      V+ + L   + ++ F  E     +YN ++       
Sbjct: 279 TTAWRTNFR---RDANRADNKAASVALDSLINFEAVKYFNNEKYLADKYNGSLINYRDSQ 335

Query: 387 KKEALTNATFFSSTNVLGDLSFLIVLAYGSHLVLQGGLTVGDLTAFMLYTEYTGSAVFGL 446
            K + + A   S  N++   +   ++  G   V+ G LTVGDL             +  L
Sbjct: 336 IKVSQSLAFLNSGQNLIFTSALTAMMYMGCTGVIGGDLTVGDLVLINQLVFQLSVPLNFL 395

Query: 447 SNFYSELMKGAGAASRLFEMTDHAPSIK----PTAGKPYVPGSGKISFKDVSFSYPTRPG 502
            + Y EL +       LF++  +   IK    P     +VP    I+F++V+F Y   P 
Sbjct: 396 GSVYRELKQSLIDMEALFKLRKNEIKIKNAERPLMLPEHVPYD--ITFQNVTFGY--HPD 451

Query: 503 NQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSL 562
            +I    +FTI  GS   IVG SG GKSTI  L+ R+Y+P SG+I I+ +DI      +L
Sbjct: 452 RKILKNASFTIPAGSKTAIVGSSGSGKSTILKLVFRFYDPESGRILINGRDIKEYDIDAL 511

Query: 563 RRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIG 622
           R+ +GVV Q+  L + +I  N+ +G + + + +E+ +V +K      + K P G++TI+G
Sbjct: 512 RKVIGVVPQDTPLFNDTIWENVKFG-RIDATDEEVNTVVEKAQLAPLIKKLPQGFNTIVG 570

Query: 623 PRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTII 682
            RG  +SGG+KQR+AIAR L+K  +I+  DEATSALD  +E A+  T+     S   T +
Sbjct: 571 ERGLMISGGEKQRLAIARVLLKNARIMFFDEATSALDTHTEQALLRTIRSNFPSGSRTSV 630

Query: 683 SIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQ----------QSELYKLLNDKKR 732
            IAHRL TI  ++ +IV  N G V E GK  +L A            Q +L+ L N+ K 
Sbjct: 631 YIAHRLRTIADADKIIVFDN-GKVREEGKHLELLATPGSLYRELWTIQEDLHHLENELKD 689

Query: 733 DK 734
           D+
Sbjct: 690 DQ 691

>Kwal_26.9480 s26 complement(1236178..1238337) [2160 bp, 719 aa]
           {ON} YMR301C (ATM1) - mitochondrial ABC transporter
           protein [contig 73] FULL
          Length = 719

 Score =  191 bits (485), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 133/382 (34%), Positives = 197/382 (51%), Gaps = 10/382 (2%)

Query: 351 VSEEQLSGVKTIQSFVAEGKELQRYNTAIRKVFLYGKKEALTNATFFSSTNVLGDLSFLI 410
           V+ + L   + ++ F  E     +Y+ ++ +      K A + A   S  N++   +   
Sbjct: 324 VAVDSLINFEAVKYFNNEQYLANKYHKSLAQYRDSQIKVAQSLAFLNSGQNLIFTSALTA 383

Query: 411 VLAYGSHLVLQGGLTVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHA 470
           ++  G   V+ G L+VGDL             +  L + Y EL +       LF++  + 
Sbjct: 384 MMYMGCTGVMSGELSVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMESLFQLQRNK 443

Query: 471 PSI----KPTAGKPYVPGSGKISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSG 526
            SI    KP    P VP   +I FK+VSF Y   P   I    +FTI  GS   IVGPSG
Sbjct: 444 VSIQNSKKPLMLPPNVPS--EIVFKNVSFGYD--PDRLILKNASFTIPTGSKTAIVGPSG 499

Query: 527 RGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLTY 586
            GKSTI  L+ R+Y+P  G+I +D +D+  L  +SLRR +GVV Q+  L + SI  N+ +
Sbjct: 500 SGKSTILKLVFRFYDPIEGRILLDGKDVRELDIESLRRSIGVVPQDTPLFNESIWDNVKF 559

Query: 587 GLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKP 646
           G + + +  EI     +      + + P G DTI+G RG  +SGG+KQR+AIAR L+K  
Sbjct: 560 G-RIDATDQEIERAIDRAQLRALIRQLPKGRDTIVGERGLMISGGEKQRLAIARVLLKDA 618

Query: 647 KILILDEATSALDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSV 706
            I+  DEATSALD  +E A+  T+ +   +   T + IAHRL TI  ++ +IVL   G V
Sbjct: 619 PIMFFDEATSALDTHTEQALLRTIKENFTTGSKTSVYIAHRLRTIADADKIIVL-EHGRV 677

Query: 707 VEVGKFKDLYADQQSELYKLLN 728
            E GK  +L A  +S   +L N
Sbjct: 678 KEEGKHAELLATPKSLYAELWN 699

>KNAG0E01320 Chr5 (261901..263988) [2088 bp, 695 aa] {ON} Anc_5.20
           YMR301C
          Length = 695

 Score =  190 bits (483), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 130/382 (34%), Positives = 195/382 (51%), Gaps = 8/382 (2%)

Query: 351 VSEEQLSGVKTIQSFVAEGKELQRYNTAIRKVFLYGKKEALTNATFFSSTNVLGDLSFLI 410
           ++ + L   + ++ F  E     +YN A+        K + + A   S  N++   +   
Sbjct: 287 IALDSLINFEAVKYFNNESYLASKYNNALMTYRDAQIKVSQSLAFLNSGQNLIFTSALTA 346

Query: 411 VLAYGSHLVLQGGLTVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHA 470
           ++  G   +L G LTVGDL             +  L + Y EL +       LF++  + 
Sbjct: 347 MMYMGCTGILGGNLTVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMESLFKLRRNE 406

Query: 471 PSIKPTAGKPYVPGSGK---ISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGR 527
             IK       +P  GK   I F++V+F Y   P   I    +F I  G  + IVGPSG 
Sbjct: 407 VVIKNVEQPKMLPADGKPFEIRFENVTFGY--EPDRTILKNASFVIAAGKKIAIVGPSGS 464

Query: 528 GKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLTYG 587
           GKSTI  L+ R+Y+P  G+I I+  D+  +   SLR+ +GVV Q+  L + +I  N+ +G
Sbjct: 465 GKSTILKLVFRFYDPQEGRILINGIDVKEIDLDSLRKVIGVVPQDTPLFNDTIWENVRFG 524

Query: 588 LQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPK 647
            + + + +E+ +  +K      ++K   G DTI+G RG  +SGG+KQR+AIAR L+K   
Sbjct: 525 -RIDATDEEVWAAVEKAHLSPLISKLSRGTDTIVGERGLMISGGEKQRLAIARVLLKNAD 583

Query: 648 ILILDEATSALDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVV 707
           I+  DEATSALD  +E  +  T+    K+   T I IAHRL TI  ++ +IVL  DGSV 
Sbjct: 584 IMFFDEATSALDTHTEQNLLKTIRANFKTGSKTSIYIAHRLRTIADADKIIVL-EDGSVK 642

Query: 708 EVGKFKDLYADQQSELYKLLND 729
           E G   +L A   S LYK L D
Sbjct: 643 EEGTHTELLARDHS-LYKDLWD 663

>AGL335W Chr7 (82640..84715) [2076 bp, 691 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YMR301C (ATM1)
          Length = 691

 Score =  190 bits (482), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 136/415 (32%), Positives = 208/415 (50%), Gaps = 10/415 (2%)

Query: 339 RDLQESTGNLTRVSEEQLSGVKTIQSFVAEGKELQRYNTAIRKVFLYGKKEALTNATFFS 398
           RD  ++      V+ + L   + ++ F  E     +Y+T++ K      K + + A   +
Sbjct: 284 RDANKADNKAASVALDSLINFEAVKYFNNEKYLADKYHTSLMKYRDSQIKVSQSLAFLNT 343

Query: 399 STNVLGDLSFLIVLAYGSHLVLQGGLTVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAG 458
             N++   +   ++    + V+QG LTVGDL             +  L + Y +L +   
Sbjct: 344 GQNLIFTTALTAMMYMACNGVMQGSLTVGDLVLINQLVFQLSVPLNFLGSVYRDLKQSLI 403

Query: 459 AASRLFEMTDHAPSIK--PTAGKPYVPGSGKISFKDVSFSYPTRPGNQIFNKLNFTIEPG 516
               LF++  +  +IK  P A    +     I F++V+F Y   P  +I N ++FTI  G
Sbjct: 404 DMESLFKLQKNQVTIKNSPNAQNLPIHKPLDIRFENVTFGYD--PERRILNNVSFTIPAG 461

Query: 517 SNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRHLGVVQQEPMLM 576
               IVGPSG GKSTI  L+ R+Y P  G+I +   DI  L   SLR+ +GVV Q+  L 
Sbjct: 462 MKTAIVGPSGSGKSTILKLVFRFYEPEQGRILVGGTDIRDLDLLSLRKAIGVVPQDTPLF 521

Query: 577 SGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRI 636
           + +I  N+ +G  S  S DEI    +K      +   P G  T++G RG  +SGG+KQR+
Sbjct: 522 NDTIWENVKFGNISS-SDDEILRAIEKAQLTKLLQNLPKGASTVVGERGLMISGGEKQRL 580

Query: 637 AIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSEN 696
           AIAR L+K   ++  DEATSALD  +E A+ +T+ +   S   T + +AHRL TI  ++ 
Sbjct: 581 AIARVLLKDAPLMFFDEATSALDTHTEQALLHTIQQNFSSNSKTSVYVAHRLRTIADADK 640

Query: 697 VIVLGNDGSVVEVGKFKDLYADQQSELYKLLNDKKRDKPTPRVQSDPEKDREQEH 751
           +IVL   GSV E G    L A Q S LY+ L D + +   P     PE+    +H
Sbjct: 641 IIVL-EQGSVREEGTHSSLLASQGS-LYRGLWDIQENLTLPE---RPEQSTGSQH 690

>NCAS0D02430 Chr4 (462683..464791) [2109 bp, 702 aa] {ON} Anc_5.20
          Length = 702

 Score =  190 bits (483), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 132/394 (33%), Positives = 204/394 (51%), Gaps = 9/394 (2%)

Query: 339 RDLQESTGNLTRVSEEQLSGVKTIQSFVAEGKELQRYNTAIRKVFLYGKKEALTNATFFS 398
           RD  ++      V+ + L   + ++ F  E     +Y+T++ K      K + + A   S
Sbjct: 284 RDANKADNKGASVALDSLINFEAVKYFNNEKYLADKYHTSLIKYRDSQIKVSQSLAYLNS 343

Query: 399 STNVLGDLSFLIVLAYGSHLVLQGGLTVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAG 458
             N++   +   ++  G   V+ G LTVGDL             +  L + Y EL +   
Sbjct: 344 GQNLIFTSALTAMMYMGCTGVIGGDLTVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLI 403

Query: 459 AASRLFEMTDHAPSIKPTAGKPYV----PGSGKISFKDVSFSYPTRPGNQIFNKLNFTIE 514
               LF++  +   I+     P V     G  +I+F++V+F Y ++   +I N  +FTI 
Sbjct: 404 DMESLFQLRKNEIKIE-NGTNPIVLKASDGPFEITFENVTFGYDSK--RKILNNASFTIP 460

Query: 515 PGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRHLGVVQQEPM 574
            G    +VGPSG GKSTI  L+ R+Y+P  G+I I+  D+      SLRR +GVV Q+  
Sbjct: 461 GGLKTAVVGPSGSGKSTILKLVFRFYDPEQGRILINGVDVKEYDVDSLRRVMGVVPQDTP 520

Query: 575 LMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQ 634
           L + +I  N+ +G + + + +E+ +V +K      + K P GY+TI+G RG  +SGG+KQ
Sbjct: 521 LFNDTIWENVKFG-RIDATDEEVHTVIEKAQLAPLIKKLPQGYETIVGERGMMISGGEKQ 579

Query: 635 RIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRRS 694
           R+AIAR L+K  KI+  DEATSALD  +E A+  T+    +S   T + IAHRL TI  +
Sbjct: 580 RLAIARVLLKNAKIMFFDEATSALDTHTEQALLTTIRANFESGSRTSVYIAHRLRTIADA 639

Query: 695 ENVIVLGNDGSVVEVGKFKDLYADQQSELYKLLN 728
           + +IVL  DG+V E G    L A   S    L N
Sbjct: 640 DKIIVL-EDGAVKEEGTHSGLLATPGSLYANLWN 672

>KNAG0G00190 Chr7 complement(20457..24284) [3828 bp, 1275 aa] {ON}
            Anc_1.527 YKL209C
          Length = 1275

 Score =  192 bits (489), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 152/529 (28%), Positives = 251/529 (47%), Gaps = 21/529 (3%)

Query: 215  IFAGALVIGTVANFGRIVLLRVLGEKLVARLRSNVIRKIIHQDAEFFD--RNKVGDLISR 272
            I     +I     F +  ++    E  +  LR  V+R I +   E+F    NK  ++ + 
Sbjct: 755  IVLSVAIIDAFCTFSKTFIMGYCSEYWIMDLRKKVMRTITYNKFEWFQLAENKPSEVSAL 814

Query: 273  LSSDAYVVSRSMTQNVSDG--FKAXXXXXXXXXXXXXXSISLTSALLMFAPPLLIGALIY 330
              +D   +   +T+ ++    F                 +SL S + MF P +++ + +Y
Sbjct: 815  ALNDLRDLRTLVTEFLATASTFLVVSTCGLIWALVAGWKLSLVS-ISMF-PLIIVFSGVY 872

Query: 331  GKRIRMISRDLQESTGNLTRVSEEQLSGVKTIQSFVAEGKELQRYNTAIRKVFLYGKKEA 390
            G  ++    D + +   L     E +  +KTI+    +     RY+   +++   G++ +
Sbjct: 873  GAALQKCETDYKSAVAQLENCLYEVVVSMKTIRCLQLQTHFQNRYDRRKQRMLSLGRRRS 932

Query: 391  LTNATFFSSTNVLGDLSFLIVLAYGSHLVLQGGLTVGDLTAFMLYTEYTGSAVFGLSNFY 450
            +      + T+ L      I+  YG  LV+ G  T   +        +T      L N  
Sbjct: 933  VITGCGIAITHTLTLCIQAILYYYGIKLVIDGKYTSKKMFEVFTLILFTIMTCTNLINQI 992

Query: 451  SELMKGAGAASRLFEMTDHAPSIKPTAGK-----PYVPGSGK---ISFKDVSFSYPTRPG 502
             E+ +G  AA+ ++ +   A + +          P    S K   +  KD++F+YP  P 
Sbjct: 993  PEVTRGQRAATYIYRILKEAAATREHQDMHNRTLPISNTSEKDTMVLVKDLTFAYPATPS 1052

Query: 503  NQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSL 562
              ++  LN  ++  ++V +VG SG GKSTI SLL + Y+     I +D  D+S     SL
Sbjct: 1053 KHVYEHLNLNLKSDTSVALVGESGSGKSTIISLLTKLYDVPEKHIYVDGTDLSEWDTNSL 1112

Query: 563  RRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMD-EIRSVAKKCFCHGFVTKFPNGYDTII 621
            R  + VV+Q   L++G+I+ NLTYGL  E + + ++  + K    + FV++ PNG DTI+
Sbjct: 1113 RNQISVVEQSANLLNGTIRENLTYGLPEEDTTEVDLIGILKLVSIYDFVSRLPNGIDTIV 1172

Query: 622  GPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTI 681
                  LSGGQ QR+ IARAL+K  +ILILDE TSALD  S   I   + K + +    I
Sbjct: 1173 DRD--LLSGGQAQRLCIARALVKPHRILILDECTSALDALSTNIIIDIVRKGIPNT--LI 1228

Query: 682  ISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQSELYKLLNDK 730
            I+I H    +R  E+V++L N G++VE G F +L   Q SE  K LN +
Sbjct: 1229 IAITHDEHMMRSCESVLLLKN-GAIVEQGSFVEL-MQQDSEFKKCLNGR 1275

 Score =  147 bits (371), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 126/501 (25%), Positives = 234/501 (46%), Gaps = 21/501 (4%)

Query: 237 LGEKLVARLRSNVIRKIIHQDAEFFDRNK---VGDLISRLSSDAYVVSRSMTQNVSDGFK 293
           LGE    R+R N++   + +   ++D N    +G+  ++LS     V +S +++ +   +
Sbjct: 88  LGEVQGDRIRINMLGSYLSKSWTWYDGNGKRLLGEF-TQLSRCIEEVRQSSSESAAITLQ 146

Query: 294 AXXXXXXXXXXXXXXSISLTSALLMFAPPLLIGALIYGKRIRMISRDLQ-ESTGNLTRVS 352
           +              S SLT  +++ + P++    IY  ++     DL+ + T     + 
Sbjct: 147 SFVSVLSLIGTSFYYSWSLT-LIILCSTPIITAIAIYFAKLTNKYTDLENKETSYAAELL 205

Query: 353 EEQLSGVKTIQSFVAEGKELQRYNTAIRKVFLYGKKEALTNATFFSSTNVLGDLSFLIVL 412
              +     ++ + A+ +E+ +++T++ +      K  L +A   S    L    F+   
Sbjct: 206 TWSMRFNDMVKFYTAQNEEISKFDTSVTRCNSLFIKACLYSALNSSIIRFLTLCMFVQGF 265

Query: 413 AYGSHLVLQGGLTVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRL--FEMTDHA 470
            +G+ ++ +  L + D+          G+ V    +  + + KG  A  +L  F   +  
Sbjct: 266 WFGATMIRRNKLDINDVITCFHSCLMLGATVSEAMSQVTVIQKGHVANKKLEGFLELEGK 325

Query: 471 PSIKPTAGKPYVPGSGKISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKS 530
             ++     P    S  I+F ++SF YP R  N     ++  +E G    I+G SG GKS
Sbjct: 326 TIMQAALKCPPKGNSLSITFNNISFKYPCRTSNSAVENVSLRLESGKMTFIIGKSGSGKS 385

Query: 531 TITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQS 590
           T+  LLLR+Y   SG IT+D+  I  L+ + L  ++ VV+Q   L + +++ N+  G ++
Sbjct: 386 TLAKLLLRFYEEYSGSITVDNISICDLNQEWLLSNITVVEQNCTLFNDTLRNNILLGSEN 445

Query: 591 E---VSMDEI----RSVAKKC---FCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIAR 640
           +     M+ I    R + K C     +  +    +G DT+IG  G  LSGGQ+QR+A+AR
Sbjct: 446 QSEPARMESIEERERKLRKACNFALLNEMLADLTDGLDTVIGSGGVELSGGQRQRVALAR 505

Query: 641 ALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSENVIVL 700
           A ++   I+I DE+ SALDV     +   +    + K  T I + H LS I  ++ + ++
Sbjct: 506 AFLRNTPIMIFDESVSALDVAHRKLLMKAIRSWRQGK--TTIVLTHELSQINPTDFIYIM 563

Query: 701 GNDGSVVEVGKFKDLYADQQS 721
            + G V E G  +DL   + S
Sbjct: 564 EH-GRVCEYGYQEDLLKSETS 583

>Skud_11.11 Chr11 complement(25896..29783) [3888 bp, 1295 aa] {ON}
            YKL209C (REAL)
          Length = 1295

 Score =  192 bits (488), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 152/522 (29%), Positives = 243/522 (46%), Gaps = 28/522 (5%)

Query: 225  VANFGRIVLLRVLGEKLVARLRSNVIRKIIHQDAEFF--DRNKVGDLISRLSSDAYVVSR 282
            + NF +  LL    E  +  LR+ ++ K+  ++  +F  + NK  ++ + + +D     R
Sbjct: 776  IFNFAKGFLLGYCSEYWIMDLRNEIMEKVTRKNINWFSGENNKAAEISALVMNDL----R 831

Query: 283  SMTQNVSDGFKAXXXXXXXXXXXXXXSI----SLTSALLMFAPPLLIGALIYGKRIRMIS 338
             +   VS+   A              ++     L+   +   P ++I ++IYG  ++   
Sbjct: 832  DLRSLVSEFLSAMTSFITVSTIGLVWALISGWKLSLVCISMFPLIIIFSVIYGSSLQTYE 891

Query: 339  RDLQESTGNLTRVSEEQLSGVKTIQSFVAEGKELQRYNTAIRKVFLYGKKEALTNATFFS 398
             D + S   L     + ++ +KTI+   AE      Y+    K+     K A+      S
Sbjct: 892  TDYKSSVAQLENCLYQIVTSIKTIKCLQAEFHFQLTYHDMKTKMEGIASKRAIATGFGVS 951

Query: 399  STNVLGDLSFLIVLAYGSHLVLQGGLTVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAG 458
             TN++      I+  YG  LV+    T   + A      +T  +   L     ++ +G  
Sbjct: 952  MTNMIAMCIQAILYYYGLKLVMVHEYTSKKMFATFTLLLFTIMSCTTLVGQIPDISRGQR 1011

Query: 459  AASRLFEMTDHAPS----------IKPTAGKPYVPGSGK--ISFKDVSFSYPTRPGNQIF 506
            AAS ++ + D A            +   +G  Y   S K  +S ++++F+YP+ P   I+
Sbjct: 1012 AASWIYRILDEAECTLEIEDNNGRVLGISGGTYYGNSNKPIVSIQNLTFAYPSAPNISIY 1071

Query: 507  NKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRHL 566
             +++  +  G  V IVG SG GKST+  LL   Y    G I ID  D++  +  SLRR +
Sbjct: 1072 KRMDLNMFCGQTVGIVGESGSGKSTLVLLLTGLYACKVGCIEIDGTDVNDWNLTSLRREI 1131

Query: 567  GVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGA 626
             VV+Q+P L  GSI+ NLTYG   ++   E+    K    + FV   P   DT I     
Sbjct: 1132 SVVEQKPSLFDGSIRDNLTYGCLGQMPDFELYDALKYVGIYDFVASLPQSLDTRIDTN-- 1189

Query: 627  SLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTIISIAH 686
             LSGGQ QR+ IARAL++K KILILDE TSALD  S   IN  + K      L  + I H
Sbjct: 1190 LLSGGQAQRLCIARALLRKSKILILDECTSALDSVSSRIINDIVKK--GPPALLTMVITH 1247

Query: 687  RLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQSELYKLLN 728
                +R   +V+V   DG +VE G F  LY D + EL+++++
Sbjct: 1248 NEEMMRCCSSVVVF-KDGKIVEEGSFDTLYNDHK-ELFRIIS 1287

 Score =  159 bits (402), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 138/549 (25%), Positives = 257/549 (46%), Gaps = 39/549 (7%)

Query: 237 LGEKLVARLRSNVIRKIIHQD-AEFFDRNK--VGDLISRLSSDAYVVSRSMTQNVSDGFK 293
           +GE+   R+RS ++   + +   E++D N+  +GD  ++++     +  S  +  +  F+
Sbjct: 100 IGERQGFRIRSMLLEAYLKKKPIEWYDANETLLGDF-TQINRCVEELRSSSAEASAITFQ 158

Query: 294 AXXXXXXXXXXXXXXSISLTSALLMFAPPLLIGALIYGKRIRMISRDLQESTGNLTRVSE 353
                          S SLT  +L  +P + + A+ + + I + ++     TG   ++  
Sbjct: 159 NLVAICALIGTSFFYSWSLTLIILCSSPIIALFAVAFCRMIHIYTKKENTETGKAAQLLT 218

Query: 354 EQLSGVKTIQSFVAEGKELQRYNTAIRKVFLYGKKEALTNATFFSSTNVLGDLSFLIV-- 411
             ++  + ++ +  +  E +++   +     +  K     + F+ + N  G L FL +  
Sbjct: 219 WSMNAAQLVRLYCTQPLERKKFEEIVSNCNTFFIK-----SCFYLAANA-GVLRFLTLTM 272

Query: 412 ----LAYGSHLVLQGGLTVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMT 467
                 +GS ++ +G L + D+          G+ +    +    L KG  A  ++  + 
Sbjct: 273 FVQGFWFGSTMIRKGRLNINDVITCFHSCIMLGTTLNNTLHQIVVLQKGEVALEKIMTLL 332

Query: 468 DHAPSIKPTAG--KPYVP----GSGKISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCI 521
           ++ P  + T+   + Y P     +G + F++VSF+YP+RP   I          G    I
Sbjct: 333 ENGPK-RNTSNTIELYQPLIDYATGDLVFENVSFAYPSRPTETILQNAGIKFPGGQFTFI 391

Query: 522 VGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIK 581
           VG SG GKSTI++LLL++Y+   G I+I+ ++I  +  KSL  ++ VV+Q   L + ++K
Sbjct: 392 VGKSGSGKSTISNLLLKFYDGYDGSISINGRNIQTIPQKSLIENITVVEQRCTLFNNTLK 451

Query: 582 YNLTYGLQSEV------SMDE---IRSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQ 632
            N+  G    +      ++D    I+   +       +   P+G +TIIG  G +LSGGQ
Sbjct: 452 NNILLGSTGSIRNADSNTIDNNNLIKEACRMALLDRLILDLPDGLETIIGSGGITLSGGQ 511

Query: 633 KQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTIISIAHRLSTIR 692
           +QR+AIARA ++   IL LDEA SALD+     +   +    K K  T I + H+LS I 
Sbjct: 512 QQRVAIARAFIRDTPILFLDEAISALDIVHRNLLMKAIRHWRKGK--TTIILTHQLSQI- 568

Query: 693 RSENVIVLGNDGSVVEVGKFKDLYADQQ---SELYKLLNDKKRDKPTPRVQSDPEKDREQ 749
            +++ + L  DG V+E G   +L  D     S+ Y L  D    K     +++ EK    
Sbjct: 569 EADDYLYLMQDGKVIESGIQSELLVDSTTTFSKWYHLQEDYFDAKTVVNTKTE-EKSIST 627

Query: 750 EHQIDNQVR 758
               ++Q++
Sbjct: 628 MESFNSQLK 636

>ZYRO0G02244g Chr7 (169369..173190) [3822 bp, 1273 aa] {ON} similar to
            uniprot|P12866 Saccharomyces cerevisiae YKL209C STE6
            ATP-binding cassette (ABC) transporter required for the
            export of a-factor catalyzes ATP hydrolysis coupled to
            a-factor transport contains 12 transmembrane domains and
            two ATP binding domains expressed only in MATa cells
          Length = 1273

 Score =  191 bits (484), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 154/522 (29%), Positives = 246/522 (47%), Gaps = 20/522 (3%)

Query: 220  LVIGTVANFGRIVLLR--VLG---EKLVARLRSNVIRKIIHQDAEFF--DRNKVGDLISR 272
            +V+G  A    + LL+  +LG   E  +  LR + +RKI +   E+   D NK  +L + 
Sbjct: 753  IVMGIAAADSGLTLLKEFILGYHSEIYIRTLRDDAMRKITYNRIEWLTQDNNKPSELSAL 812

Query: 273  LSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTSALLMFAPPLLIGALIYGK 332
            L +D   +  S +  +S                      L+   +   P L+I ++IYG 
Sbjct: 813  LMNDLRDLRTSTSNFISFVSSFVIVSSVGLIWAIVTGWKLSLVCISMFPLLVIFSMIYGI 872

Query: 333  RIRMISRDLQESTGNLTRVSEEQLSGVKTIQSFVAEGKELQRYNTAIRKVFLYGKKEALT 392
             ++    + + +   L  V  E ++G+KTI+    E     ++N   +   L G++ A+ 
Sbjct: 873  LLKKYETEYKNTIAKLENVQYEVVTGMKTIRCLQIEDHFKAKFNVLKQTAKLMGQRRAIV 932

Query: 393  NATFFSSTNVLGDLSFLIVLAYGSHLVLQGGLTVGDLTAFMLYTEYTGSAVFGLSNFYSE 452
                 + +N L      I+  Y   LV+ G  T   +        +T      L N   +
Sbjct: 933  TGFGVAVSNGLTMSIQGILYYYAIKLVIHGEYTTKKMFETFTLLLFTIMTCNNLVNQIPD 992

Query: 453  LMKGAGAAS---RLFEMTDHAPSIKPTAGK--PYV--PGSGKISFKDVSFSYPTRPGNQI 505
            + +G  AAS   R+ E  D +   +    +  P V  P    I F D+SF+YPT P  +I
Sbjct: 993  IRRGQRAASKIYRILEGIDESECFETEGHRIVPIVENPTGPIIRFNDLSFAYPTAPTVKI 1052

Query: 506  FNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRH 565
               L+  I  G  + IVG SG GKST+ +++ R Y   S  + +D+ D++  +   LR  
Sbjct: 1053 LKHLSMEIYSGDRIAIVGESGCGKSTLVNIITRLYECPSNSLFVDNTDVNDWALPKLREQ 1112

Query: 566  LGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRG 625
            + VV+Q+P L  G+I+ NL YG     +  ++ ++ K    + F    P G +T I    
Sbjct: 1113 IAVVEQKPTLFKGTIRENLVYGSPLGTADVDVFNMLKYVGIYDFFATLPEGLETKID--S 1170

Query: 626  ASLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTIISIA 685
              LSGGQ QR+ IARAL+++PKILILDE TSALD  S   IN  + +      +  ISI 
Sbjct: 1171 GLLSGGQNQRLCIARALLQRPKILILDECTSALDTMSSHIINEIIRE--GPPTMLTISIT 1228

Query: 686  HRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQSELYKLL 727
            H    +R    V VL + G +VE+G  +DL   Q+ +L+KL+
Sbjct: 1229 HDEQMVRACNKVAVL-DQGHIVEMGNREDLLR-QKGQLWKLV 1268

 Score =  171 bits (433), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 154/602 (25%), Positives = 283/602 (47%), Gaps = 26/602 (4%)

Query: 137 MGYKEVIRLFKLATHDWKLLTFAIGLLAISSVIGMSIPKVIGMVLDAIKNTYSSATGPVG 196
           MG+   I  +     D  LL F       S ++  ++  + G V + + N Y+  + P+ 
Sbjct: 1   MGFHNNIYSYLQGKKDVILLGFVSASTIASGLVPAALSILTGRVFNLL-NEYTQWSDPIH 59

Query: 197 LDDLPPIVNDLSMYEFLGIFAGALVIGTVANFGRIVLLRVLGEKLVARLRSNVIRKIIHQ 256
              L  +V        L + AG++VI  +     I    +LGE+   R+R+ +I   + +
Sbjct: 60  ELRLRSMV-------ILALGAGSIVIIWIC----ISSWMLLGERQNFRVRTQLIDSYLQK 108

Query: 257 DAEFFDRNKV--GDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTS 314
             +++D N    GDL ++ +     +  S  +  +  +K               S SLT 
Sbjct: 109 PMKWYDDNDTLTGDL-TQTNRCVEELRSSSAEASALTWKNLVTILALTVTSFYYSWSLTL 167

Query: 315 ALLMFAPPLLIGALIYGKRIRMISRDLQESTGNLTRVSEEQLSGVKTIQSFVAEGKELQR 374
             +  AP +++ A+ + + I + S      T   +++    +   + ++    +  E+Q 
Sbjct: 168 VTMCGAPVIVLCAIFFSRLIHIYSEKENSHTAISSQLLSWSMEAAQLVRLSCMQLVEVQN 227

Query: 375 YNTAIRKVFLYGKKEALTNATFFSSTNVLGDLSFLIVLAYGSHLVLQGGLTVGDLTAFML 434
           +  A++K      K  L  +   +    L    F+    +GS ++ +  L + D+     
Sbjct: 228 FQLAVKKCSKNFMKMCLYASANTAILKFLTLTIFVQAFWFGSTMIRKHKLRIEDVITCFQ 287

Query: 435 YTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHAPSIKP---TAGKPYVPG--SGKIS 489
                G+ + G  +    L KG      + E       +K       + Y+ G  S KI 
Sbjct: 288 SCVLLGATINGTLHQIVILQKGKVGVINVNEFLKKDEYLKEDFKNNRRFYLDGGISEKIE 347

Query: 490 FKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITI 549
            ++V F+YP+RP       ++ T+  G    +VG SG GKS++ +LLL+ Y+  +G I+I
Sbjct: 348 LRNVQFNYPSRPTVPALKNVSLTLPVGKITYVVGKSGSGKSSLGNLLLKLYDDYNGSISI 407

Query: 550 DDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQ--SEVSMDE-IRSVAKKCFC 606
           D  DI  +  KS+ +++ +V+Q   L + +++ N+ +G +   E+  DE +++  +    
Sbjct: 408 DGIDIKGIDQKSILKNITLVEQRCTLFNDTLRNNILFGSKETDELVRDESLKAACRISLL 467

Query: 607 HGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAI 666
             F+   P G DT+IG  G + SGGQ+QRIAIARA M+   IL+LDEA SALD+   G +
Sbjct: 468 DNFIYDLPEGLDTLIGTGGITPSGGQQQRIAIARAYMRDTPILVLDEAVSALDIIHRGLL 527

Query: 667 NYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQSELYKL 726
              + +  +S++ TII + H LS I   +++I L  DG VVE G+ ++L  +QQ   + +
Sbjct: 528 MNAI-RNWRSEKTTII-LTHDLSEI-GPDDMIYLLEDGEVVEQGQQRNLLLNQQGRFFNM 584

Query: 727 LN 728
           ++
Sbjct: 585 VS 586

>KLLA0A10131g Chr1 complement(889688..891850) [2163 bp, 720 aa] {ON}
           similar to uniprot|P40416 Saccharomyces cerevisiae
           YMR301C ATM1 Mitochondrial inner membrane transporter
           exports mitochondrially synthesized precursors of iron-
           sulfur (Fe/S) clusters to the cytosol member of the ATP-
           binding cassette (ABC) transporter family
          Length = 720

 Score =  187 bits (475), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 161/586 (27%), Positives = 267/586 (45%), Gaps = 42/586 (7%)

Query: 159 AIGLLAISSVIGMSIPKVIGMVLDAIKNTYSSATGPVGLDDLPPIVNDLSMYEFLGIFAG 218
           A+ LL  + ++ + +P      +D++   +    GP  +  + P+   +++  +     G
Sbjct: 133 ALALLIGAKLLNVQVPFFFKQTIDSMNIEW----GP-DVATVLPVAITMTILSYGAARFG 187

Query: 219 ALVIGTVANFGRIVLLRVLGEKLVARLRSNVIRKIIHQDAEFFDRNKVGDLISRLSSDAY 278
           A++ G + N             + A++  N IRK+  Q  +   +  +G  +SR +    
Sbjct: 188 AVMFGELRN------------AVFAKVAQNAIRKVSLQTFQHLMKLDLGWHLSRQTGG-- 233

Query: 279 VVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTSALLM------FAPPLLIGALIY-- 330
            ++R+M +  + G                  IS+   +L       FA    +  L+Y  
Sbjct: 234 -LTRAMDRG-TKGISYVLSAMVFHMIPITFEISVVCGILTYQFGSSFAAMTFVTMLLYSF 291

Query: 331 ------GKRIRMISRDLQESTGNLTRVSEEQLSGVKTIQSFVAEGKELQRYNTAIRKVFL 384
                   R     R    +      V+ + L   + ++ F  E     +Y+ ++ K   
Sbjct: 292 FTFKTTAWRTEF-RRSANRADNKAASVALDSLINFEAVKYFNNEEYLANKYHQSLSKYRD 350

Query: 385 YGKKEALTNATFFSSTNVLGDLSFLIVLAYGSHLVLQGGLTVGDLTAFMLYTEYTGSAVF 444
              K A + A   +  N +   +   ++  G+  V++G LTVGDL             + 
Sbjct: 351 SQIKVAQSLAFLNAGQNFIFTSALTAMMYMGASGVMEGALTVGDLVLINQLVFQLSVPLN 410

Query: 445 GLSNFYSELMKGAGAASRLFEMTDHAPSIKPTAGKPYVPGS--GKISFKDVSFSYPTRPG 502
            L + Y EL +       LF++  +   IK T     +P     +I F++V+F Y  +P 
Sbjct: 411 FLGSVYRELKQSLIDMESLFKLQKNPILIKNTERPLMLPEHLPCEIKFENVTFGY--QPD 468

Query: 503 NQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSL 562
             I     FTI PG    IVGPSG GKSTI  L+ R+Y+P  G+I +D +DI  L    L
Sbjct: 469 RNILKNATFTIAPGKKTAIVGPSGSGKSTILRLVFRFYDPQQGRILLDGKDIRELDLDEL 528

Query: 563 RRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIG 622
           RR +GVV Q+  L + +I  N+ +G +   + +EI +  +K      + K P G +TI+G
Sbjct: 529 RRIVGVVPQDTPLFNDTIWENVKFG-RINATDNEIVTAIEKAQLSDLIHKLPKGTETIVG 587

Query: 623 PRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTII 682
            RG  +SGG+KQR+AIAR L+K   I+  DEATSALD  +E ++  T+ +       T +
Sbjct: 588 ERGLMISGGEKQRLAIARVLLKDTPIMFFDEATSALDTHTEQSLLKTIKENFSDVAKTSV 647

Query: 683 SIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQSELYKLLN 728
            IAHRL TI  ++ +IVL N G+V E G    L A+  S   +L N
Sbjct: 648 YIAHRLRTIADADKIIVLEN-GAVREEGTHNALLANPNSLYSELWN 692

>YMR301C Chr13 complement(867555..869627) [2073 bp, 690 aa] {ON}
           ATM1Mitochondrial inner membrane ATP-binding cassette
           (ABC) transporter, exports mitochondrially synthesized
           precursors of iron-sulfur (Fe/S) clusters to the cytosol
          Length = 690

 Score =  186 bits (473), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 130/396 (32%), Positives = 203/396 (51%), Gaps = 9/396 (2%)

Query: 339 RDLQESTGNLTRVSEEQLSGVKTIQSFVAEGKELQRYNTAIRKVFLYGKKEALTNATFFS 398
           RD  ++      V+ + L   + ++ F  E     +YN ++        K + + A   S
Sbjct: 285 RDANKADNKAASVALDSLINFEAVKYFNNEKYLADKYNGSLMNYRDSQIKVSQSLAFLNS 344

Query: 399 STNVLGDLSFLIVLAYGSHLVLQGGLTVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAG 458
             N++   +   ++  G   V+ G LTVGDL             +  L + Y +L +   
Sbjct: 345 GQNLIFTTALTAMMYMGCTGVIGGNLTVGDLVLINQLVFQLSVPLNFLGSVYRDLKQSLI 404

Query: 459 AASRLFEMTDHAPSIKPTAGKPYVPGS--GKISFKDVSFSYPTRPGNQIFNKLNFTIEPG 516
               LF++  +   IK       +P +    I+F++V+F Y   P  +I    +FTI  G
Sbjct: 405 DMETLFKLRKNEVKIKNAERPLMLPENVPYDITFENVTFGY--HPDRKILKNASFTIPAG 462

Query: 517 SNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRHLGVVQQEPMLM 576
               IVG SG GKSTI  L+ R+Y+P SG+I I+ +DI      +LR+ +GVV Q+  L 
Sbjct: 463 WKTAIVGSSGSGKSTILKLVFRFYDPESGRILINGRDIKEYDIDALRKVIGVVPQDTPLF 522

Query: 577 SGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRI 636
           + +I  N+ +G + + + +E+ +V +K      + K P G+DTI+G RG  +SGG+KQR+
Sbjct: 523 NDTIWENVKFG-RIDATDEEVITVVEKAQLAPLIKKLPQGFDTIVGERGLMISGGEKQRL 581

Query: 637 AIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSEN 696
           AIAR L+K  +I+  DEATSALD  +E A+  T+     S   T + IAHRL TI  ++ 
Sbjct: 582 AIARVLLKNARIMFFDEATSALDTHTEQALLRTIRDNFTSGSRTSVYIAHRLRTIADADK 641

Query: 697 VIVLGNDGSVVEVGKFKDLYADQQS---ELYKLLND 729
           +IVL N G V E GK  +L A   S   EL+ +  D
Sbjct: 642 IIVLDN-GRVREEGKHLELLAMPGSLYRELWTIQED 676

>KLTH0B09482g Chr2 complement(777282..779366) [2085 bp, 694 aa] {ON}
           similar to uniprot|P40416 Saccharomyces cerevisiae
           YMR301C ATM1 Mitochondrial inner membrane transporter
           exports mitochondrially synthesized precursors of iron-
           sulfur (Fe/S) clusters to the cytosol member of the ATP-
           binding cassette (ABC) transporter family
          Length = 694

 Score =  186 bits (472), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 124/326 (38%), Positives = 173/326 (53%), Gaps = 9/326 (2%)

Query: 407 SFLIVLAY-GSHLVLQGGLTVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFE 465
           S L  + Y G   V+ G L+VGDL             +  L + Y EL +       LF+
Sbjct: 351 SALTAMMYMGCTGVISGTLSVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMESLFQ 410

Query: 466 MTDHAPSIKPTAGKPYVPGS---GKISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIV 522
           +  +   I+    KP +  S    KI F++VSF Y   P   I    +FT+  G    IV
Sbjct: 411 LQRNKVKIQ-NKEKPLMLSSQRPSKIVFENVSFGYD--PDRMILKNSSFTMPAGWKTAIV 467

Query: 523 GPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKY 582
           GPSG GKSTI  L+ R+Y+P  G+I +D +D+  L  +SLRR +GVV Q+  L + SI  
Sbjct: 468 GPSGSGKSTILKLVFRFYDPQEGRILVDGKDVRELDIESLRRAIGVVPQDTPLFNDSIWE 527

Query: 583 NLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARAL 642
           N+ +G +   S +EIR   +K      V + P G DTI+G RG  +SGG+KQR+AIAR L
Sbjct: 528 NVRFG-KISASDEEIRLAVEKAQLESLVDQLPKGRDTIVGERGLMISGGEKQRLAIARVL 586

Query: 643 MKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGN 702
           +K   I+  DEATSALD  +E A+  T+     +   T + IAHRL TI  ++ +IV+  
Sbjct: 587 LKDAPIMFFDEATSALDTHTEQALLRTIKDNFPTGSKTSVYIAHRLRTIADADKIIVI-Q 645

Query: 703 DGSVVEVGKFKDLYADQQSELYKLLN 728
            G V E GK  +L A   S   +L N
Sbjct: 646 QGQVKEEGKHAELLAKPGSLYAELWN 671

>KAFR0E00230 Chr5 complement(47473..51285) [3813 bp, 1270 aa] {ON}
            Anc_1.527 YKL209C
          Length = 1270

 Score =  189 bits (481), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 167/563 (29%), Positives = 257/563 (45%), Gaps = 35/563 (6%)

Query: 176  VIGMVLDAIKNTYSSATGPVGLDDLPPIVNDLSMYEFLGIFAGALVIGTVA------NFG 229
            VI  ++  I N   S T    LD + P V+ +    +L     ++++  VA       F 
Sbjct: 707  VISAIIAGIANPVFSFTFSYLLDGIVPKVDGVGSSHYL--LKWSVIVLCVAFTDGISTFL 764

Query: 230  RIVLLRVLGEKLVARLRSNVIRKIIHQDAEFF--DRNKVGDLISRLSSDAYVVSRSMTQN 287
            +   L  + E  +  LR+  +  I +++ E+F  D NK  +L + + +D     R +   
Sbjct: 765  KSFSLGFVSENWIMDLRNKAMESITNKELEWFYKDENKSSELAALVLNDL----RDLRSL 820

Query: 288  VSDGFKAXXXXXXXXXXXXXXSIS----LTSALLMFAPPLLIGALIYGKRIRMISRDLQE 343
            +S+   A              +++    L+   +   P +++ + IYG  ++      + 
Sbjct: 821  ISEFISAMSTFIVVSLAGLIWALTTGWKLSLVCIAMFPLIILFSAIYGSILQRYETTYKT 880

Query: 344  STGNLTRVSEEQLSGVKTIQSFVAEGKELQRYNTAIRKVFLYGKKEALTNATFFSSTNVL 403
            +  +L     E + G+KTI+    E   +QRY+    ++   G+K A+      + T  L
Sbjct: 881  TVADLENCVYEIMLGIKTIRCLQLEQHFIQRYSVLEARMKHIGRKRAIATGFGIAITTAL 940

Query: 404  GDLSFLIVLAYGSHLVLQGGLTVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRL 463
                  I+  YG  LV  G  T   +        +T      L N   ++ +G  AASR+
Sbjct: 941  VMCIEAILFYYGLKLVFIGEYTTMKMFKTFTLLLFTIMTCTSLINQIPDVTRGQRAASRI 1000

Query: 464  FEMTDHAPSIKP-------TAGKPYVPG-SGKISFKDVSFSYPTRPGNQIFNKLNFTIEP 515
            F + D +            T G P        I+  ++ F YP+   + +FN+LN  I  
Sbjct: 1001 FRILDESDRFLEDSDEHGRTRGIPKNNSIKSIITINNLQFHYPSAESSNVFNRLNLQIAD 1060

Query: 516  GSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRHLGVVQQEPML 575
               V +V  SG GKST+  LL R Y      I ID  DI+     SLR  + +V+Q+P L
Sbjct: 1061 NQTVAVVAESGSGKSTLLYLLTRLYKVDFNSIFIDGTDINEWQLTSLRNLIAIVEQKPTL 1120

Query: 576  MSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQR 635
              GSI+ NL YG + E+   +I  V K+     FVT  PNG DT +    + LSGGQ QR
Sbjct: 1121 FEGSIRKNLIYGNKLEIMDMDIYDVLKQVGIFDFVTSLPNGIDTNVDT--SLLSGGQAQR 1178

Query: 636  IAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKS--KELTIISIAHRLSTIRR 693
            I IARAL++K KILILDE TSALD ES     + +  L+KS    +  I+I H    +R 
Sbjct: 1179 ICIARALLRKSKILILDECTSALDAESA----FVIQNLVKSGLPGVLTIAITHSEPMMRA 1234

Query: 694  SENVIVLGNDGSVVEVGKFKDLY 716
              NVIVL  DG   + G F +LY
Sbjct: 1235 CGNVIVL-QDGETAQQGTFDELY 1256

 Score =  127 bits (320), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 125/518 (24%), Positives = 241/518 (46%), Gaps = 30/518 (5%)

Query: 237 LGEKLVARLRSNVIRKIIHQDAEFFDRNK--VGDLISRLSSDAYVVSRSMTQNVSDGFKA 294
           +GE    R+R  ++   + +  E+FD N   +GD +        V S S  +  +  F+ 
Sbjct: 96  IGETQSFRIRRTILLSYLKKPMEWFDENDQLLGDFVQMHRCVEEVRSGS-AEASAITFQN 154

Query: 295 XXXXXXXXXXXXXXSISLTSALLMFAPPLLIGALIYGKRIRMISRDLQESTGNLTRVSEE 354
                         S SLT  +L  +P L++ A  + + I   ++   + TG   +    
Sbjct: 155 FVAIIALVCTSFYYSWSLTLIILCSSPLLIVLAAFFSRMIENFTKLENDETGIAAQSLTW 214

Query: 355 QLSGVKTIQSFVAEGKELQRYNTAIRKVFLYGKKEALTNATFFSSTN--VLGDLS---FL 409
            ++  + ++ +  +  E++++   + +       +   NA F+ S N  +L  LS   F+
Sbjct: 215 SMNAAQLVKLYCTQDFEIKKFKEIVIRC-----NDYFINAWFYVSANTSILRFLSLAMFV 269

Query: 410 IVLAYGSHLVLQGGLTVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDH 469
               +GS ++ +  ++V  +          GS +         L K     +R+ +  + 
Sbjct: 270 QGFWFGSTMIKKNKMSVDQVITCFSSCLMLGSILNTTLPQIVLLQKAHVGLNRVQDFLED 329

Query: 470 APSI------KPTAGKPYVPGSGKISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVG 523
              +      + +     VP S  ISF  +SF YP+RP + +   ++   +P     IVG
Sbjct: 330 KSEMATDRDRQTSINLDNVPIS--ISFDAISFCYPSRPDDMVLKNISMNFDPNKTTFIVG 387

Query: 524 PSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYN 583
            SG GKST+++LLL++YN  +G I ++  ++  +    + +++ +V+Q+  L + +++ N
Sbjct: 388 KSGSGKSTMSNLLLKFYNGYNGCIKVNGVNVQSIDRHWITKNVTLVEQKCTLFNDTLRNN 447

Query: 584 LTYGLQSEVSMDE-----IRSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAI 638
           L  GL S +S  E     ++   +       + K P+G DT +G  G SLSGGQ+QR+A+
Sbjct: 448 LLIGL-SHISAAEDVDSRLQEACRFALLDNVIEKLPSGLDTKVGSGGVSLSGGQQQRVAL 506

Query: 639 ARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSENVI 698
           ARA ++   ++ILDEA SALD  +   +   +    +SK  T I + H L+ I  S+ + 
Sbjct: 507 ARAYLRDTPVVILDEAISALDARNRRQLMENIRIWTRSK--TAIILTHELNQILPSDFLY 564

Query: 699 VLGNDGSVVEVGKFKDLYADQQSELYKLLNDKKRDKPT 736
           ++ N G + E G   +L  + +S   K  + +  ++ +
Sbjct: 565 LMEN-GQIKEEGYQNELIENVESTFCKFFHLQNSNRES 601

>TDEL0F00340 Chr6 complement(53876..57649) [3774 bp, 1257 aa] {ON}
            Anc_1.527 YKL209C
          Length = 1257

 Score =  189 bits (481), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 146/521 (28%), Positives = 246/521 (47%), Gaps = 36/521 (6%)

Query: 215  IFAGALVIGTVANFGRIVLLRVLGEKLVARLRSNVIRKIIHQDAEFF--DRNKVGDLISR 272
            I  G  +   + NF +  L     E  + +LR+ V+++I  ++ ++F  +R+K  ++ + 
Sbjct: 738  IVIGVAIADAILNFLQYFLFGYCSEYWILQLRNQVMQRISFEELDWFQRERHKASEVSAL 797

Query: 273  ----------LSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTSALLMFAPP 322
                      L+SD  +   S     S G                    L+   +   P 
Sbjct: 798  LLNDLRDLRALASDFLIAVSSFAVVSSVGI----------IWALIIGWKLSLVCISMFPL 847

Query: 323  LLIGALIYGKRIRMISRDLQESTGNLTRVSEEQLSGVKTIQSFVAEGKELQRYNTAIRKV 382
            ++I + +YG  ++      + +  +L  +  E  +G+KTI+    E   L++Y      +
Sbjct: 848  IVIFSAVYGMALQRQETQYKSAVVDLENLLYEVATGIKTIRRLQLETNFLRQYKRLESHM 907

Query: 383  FLYGKKEALTNATFFSSTNVLGDLSFLIVLAYGSHLVLQGGLTVGDLTAFMLYTEYTGSA 442
             +   + A+T     +    L      I+  Y   LV+ G  T   +   +    +T   
Sbjct: 908  RVIASRRAITTGLGVAVIEALAMSIQAILFYYALKLVIDGQYTTKKMFETLTLLLFTIMT 967

Query: 443  VFGLSNFYSELMKGAGAASRLFEMTD--------HAPSIKPTAGKPYVPGSGKISFKDVS 494
               L +   ++ +G  AA+R+ +M D        H    + T+G      S  IS ++V+
Sbjct: 968  CNILISQVPDISRGQRAANRILQMLDEKLEREKPHQEKKQTTSGS-VSESSAVISLQNVT 1026

Query: 495  FSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDI 554
            F+YP+ P   IF+ L   +  G    +VG SG GKST+ +LL + Y P+SG + ++++D+
Sbjct: 1027 FAYPSAPSIHIFDSLYLELPIGRTFALVGQSGSGKSTLVTLLTQLYRPTSGTVLVENKDV 1086

Query: 555  SRLSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFP 614
            +  + + LRR + VV+Q P + SG+++ NL YGL  +    E+  V +    H F++K P
Sbjct: 1087 NEWNIRDLRRQMSVVEQTPTIFSGTVRENLLYGLHHDPLEVEMYDVLRYVGIHDFISKLP 1146

Query: 615  NGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLM 674
             G DT I      LSGGQ QR+ IARA++K+PKILILDE TSALD  S   IN  + +  
Sbjct: 1147 LGLDTTIDID--LLSGGQLQRLCIARAILKRPKILILDECTSALDPFSSHVINNIVRRGC 1204

Query: 675  KSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDL 715
             +  LT ISI H +  ++  + +I L N G V   G F  L
Sbjct: 1205 PAP-LT-ISITHNVDMMKACDEIIFLKN-GRVAGTGSFDAL 1242

 Score =  129 bits (324), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 117/430 (27%), Positives = 214/430 (49%), Gaps = 12/430 (2%)

Query: 309 SISLTSALLMFAPPLLIGALIYGKRIRMISRDLQESTGNLTRVSEEQLSGVKTIQSFVAE 368
           S SLT   L  AP +++    + ++++  +    E T   +++ +  ++  + I+    E
Sbjct: 158 SWSLTLVTLCSAPLIIMCGWFFSRKVQRYADLENEQTSKASQLLDWSMTAAQFIRLSGTE 217

Query: 369 GKELQRYNTAIRKVFLYGKKEALTNATFFSSTNVLGDLSFLIVLAYGSHLVLQGGLTVGD 428
            +E++ +   ++       K    ++   ++   L    F+    +GS ++ +G + +GD
Sbjct: 218 LREIKSFKNCVQNCTNNFVKMCQYSSINLATLKFLSLAMFVQAFWFGSTMIRKGKMNIGD 277

Query: 429 LTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRL--FEMTDHAPS--IKPTAGKPYVPG 484
           +          GS + G       + KG+ A + +  F   D   +  I+     P+   
Sbjct: 278 VITCFHSCILLGSTISGTLQQLVIIQKGSVAVNIVSKFLADDKTATTDIRRWQDVPFPEL 337

Query: 485 SGKISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSS 544
            G I F++V FSYP+RP + +   ++     G    ++G SG GKS++++LLL++Y   +
Sbjct: 338 KGDIRFQNVEFSYPSRPDHNVLRSISLNFRAGKTTFLLGKSGSGKSSLSNLLLKFYENYT 397

Query: 545 GQITIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGL---QSEVSMDEIRSVA 601
           G I++D ++I  +    L +++ VV+Q   + +G++K N+  G+     E  + +++ V 
Sbjct: 398 GVISVDGRNIKHIDQSQLIKNITVVEQRCNVFNGTLKENIIIGIDGADEEEILTKLKLVC 457

Query: 602 KKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVE 661
           +      F+    +G +T+IG  G SLSGGQ+Q++AIARALMK P+ILILDE+ SALDV 
Sbjct: 458 RISLLENFIHDLSDGLNTLIGSGGISLSGGQQQKVAIARALMKDPQILILDESLSALDVL 517

Query: 662 SEGAINYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQS 721
             G I   +      KE T I + H L+ I  S +   L   G  +E G  + L  D  +
Sbjct: 518 QRGLILRAIRT--HRKEKTTIILTHELNQI-GSNDFCYLIESGQCIEHGLEETLVNDPST 574

Query: 722 EL--YKLLND 729
               +K L+D
Sbjct: 575 RFHSWKHLHD 584

>Suva_11.11 Chr11 complement(26032..29904) [3873 bp, 1290 aa] {ON}
            YKL209C (REAL)
          Length = 1290

 Score =  188 bits (477), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 157/540 (29%), Positives = 257/540 (47%), Gaps = 45/540 (8%)

Query: 220  LVIGTVA-----NFGRIVLLRVLGEKLVARLRSNVIRKIIHQDAEFF--DRNKVGDLISR 272
            +V+G  A     NF +  LL    E  +  LR+ ++ K+  ++  +F  + NK  ++ + 
Sbjct: 766  IVLGVAAADGFFNFAKGFLLGYCSEYWIMDLRNKIMDKLTRKNINWFSGESNKASEITAL 825

Query: 273  LSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSI----SLTSALLMFAPPLLIGAL 328
            + +D     R +   VS+   A              ++     L+   +   P ++I + 
Sbjct: 826  VLNDL----RDLRSLVSEFLSAMTSFVTVSTIGLVWALVSGWKLSLVCISMFPLIVIFSA 881

Query: 329  IYGKRIRMISRDLQESTGNLTRVSEEQLSGVKTIQSFVAEGKELQRYNTAIRKVFLYGKK 388
            IYG  ++    D + S   L     + ++ +KTI+   AE      Y+   +K+     K
Sbjct: 882  IYGGILQKYETDYKTSVAQLENCLYQIMTSIKTIKCLQAEFHFQLSYHDLKKKMEQIAYK 941

Query: 389  EALTNATFFSSTNVLGDLSFLIVLAYGSHLVLQGGLT---VGDLTAFMLYTEYTGSAVFG 445
             A+      S TN++      I+  YG  LVL    T   + +    +L+T  + +++ G
Sbjct: 942  RAIATGFGISVTNMIAMCIQAILYYYGLKLVLVHEYTSKKMFETFTLLLFTIMSCTSLVG 1001

Query: 446  LSNFYSELMKGAGAASRLFEMTDH-----------APSIKPTAGKPY----VPGSGKISF 490
                  ++ +G  AAS ++ + D            A ++  +  + Y    +P    IS 
Sbjct: 1002 Q---IPDISRGQRAASWIYRILDEEEDTLEIENNDARALDISGAEYYGDRNIP---IISI 1055

Query: 491  KDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITID 550
            +++SF+YP+ P   IF  ++  +     + IVG SG GKST+  LL R YN  +  I ID
Sbjct: 1056 RNLSFAYPSAPNVPIFKHMDLDMFCEQTIGIVGESGSGKSTLALLLTRLYNCEANSIIID 1115

Query: 551  DQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFV 610
              D++  +  SLR+ + VV+Q+P    GSI+ NLTYG   E+   EI  V K    + FV
Sbjct: 1116 GTDVNDWNLTSLRKQISVVEQKPSFFDGSIRDNLTYGCLGEMLEVEIYDVLKYVGIYDFV 1175

Query: 611  TKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTL 670
               P G DT +      LSGGQ QR+ IARAL++K KILILDE TSALD  S   IN  +
Sbjct: 1176 ASLPQGLDTRVDTN--LLSGGQAQRLCIARALLRKSKILILDECTSALDSVSSRIINDIV 1233

Query: 671  GKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQSELYKLLNDK 730
             K      L  + I H    +R   ++ VL + G VVE G F +LY +++ EL++++ +K
Sbjct: 1234 RK--GPPGLLTLVITHSEQMMRCCNSIAVLKH-GKVVEEGNFDNLY-NKEGELFRIVCNK 1289

 Score =  145 bits (366), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 123/453 (27%), Positives = 208/453 (45%), Gaps = 20/453 (4%)

Query: 309 SISLTSALLMFAPPLLIGALIYGKRIRMISRDLQESTGNLTRVSEEQLSGVKTIQSFVAE 368
           S SLT  +L  +P + I A+I+ + I   ++     T N  ++    ++  + ++ +  +
Sbjct: 174 SWSLTLIILCSSPVITIFAVIFSRLIHTYTQKENTETSNAAQLFTWSMNAAQLVRLYCTQ 233

Query: 369 GKELQRYNTAIRKVFLYGKKEALTNATFFSSTNVLGDLSFLIVLAYGSHLVLQGGLTVGD 428
             E Q++   I     +  K  L  A        L    F+    +GS ++ +G L + D
Sbjct: 234 PLERQKFQEIILSCNTFFIKSCLYVAANAGILRFLTLTMFVQGFWFGSTMIRKGKLNIND 293

Query: 429 LTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTD-----HAPSIKPTAGKPYVP 483
           +          GS +    +    L KG  A  ++  + +     +A + +     P   
Sbjct: 294 VITCFHSCIMLGSTLNSTLHQIVVLQKGEVALQKIMALLESGSKQNASNTREHLQPPLNF 353

Query: 484 GSGKISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPS 543
            +  + F++VSF+YP+RP   +   +N     G    IVG SG GKSTI++LLL +Y+  
Sbjct: 354 ATSDLVFENVSFAYPSRPSETVLQNVNLKFPSGQFTFIVGKSGSGKSTISNLLLNFYDNY 413

Query: 544 SGQITIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDE------- 596
            G I I+ ++   +  K L  ++ VV+Q   L + ++K N+  G    +   +       
Sbjct: 414 DGSILINGRNTQSIQQKLLVSNITVVEQRCTLFNDTLKKNILLGSTGSIGNADTNTIGNN 473

Query: 597 --IRSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEA 654
             I+   +       +   P+G +T+IG  G SLSGGQ+QR+AIARA ++   IL LDEA
Sbjct: 474 NLIKDACRMALLDRLILDLPDGLETLIGSGGVSLSGGQQQRVAIARAFIRDTPILFLDEA 533

Query: 655 TSALDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKD 714
            SALD+     +   +    K K  T I + H LS I   +++ V+  +G VVE G   +
Sbjct: 534 VSALDIVHRNLLMKAIRHWRKGK--TTIILTHELSQIESDDHLYVM-QEGRVVESGIQSE 590

Query: 715 LYADQQ---SELYKLLNDKKRDKPTPRVQSDPE 744
           L AD     S+ Y L ND    K     +++ E
Sbjct: 591 LLADSATTFSKWYYLQNDFSDAKTIINTETEEE 623

>KAFR0I02580 Chr9 complement(520294..522423) [2130 bp, 709 aa] {ON}
           Anc_5.20 YMR301C
          Length = 709

 Score =  184 bits (466), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 138/418 (33%), Positives = 208/418 (49%), Gaps = 22/418 (5%)

Query: 339 RDLQESTGNLTRVSEEQLSGVKTIQSFVAEGKELQRYNTAIRKVFLYGKKEALTNATFFS 398
           RD  ++      ++ + L   + ++ F  E     +YN+A+        K + + A   S
Sbjct: 302 RDANKADNKGASIALDSLINFEAVKYFNNENYLSSKYNSALIDYRNSQIKISKSLAFLNS 361

Query: 399 STNVLGDLSFLIVLAYGSHLVLQGGLTVGDLTAFMLYTEYTGSAVFGLS---NF----YS 451
             N++   +   ++  G   V+ G LTVGDL             VF LS   NF    Y 
Sbjct: 362 GQNLIFTTALTGMMYLGCTGVIGGNLTVGDLVLI-------NQLVFQLSVPLNFLGSVYR 414

Query: 452 ELMKGAGAASRLFEMTDHAPSIKPTAGKPYV---PGSGKISFKDVSFSYPTRPGNQIFNK 508
           EL +       LF++  +   I        +    G  +I+F++V+F Y      +I   
Sbjct: 415 ELKQSLIDMESLFKLRKNEVKIHNIENPKIILKEDGPFEITFENVTFGY--HADRKILKN 472

Query: 509 LNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRHLGV 568
            +FTI  G    IVGPSG GKSTI  L+ R+Y+P  G+I I+  D+  +   SLR+ +GV
Sbjct: 473 ASFTIPAGWKTAIVGPSGSGKSTILKLVFRFYDPEEGRILINGIDVREIELDSLRKLIGV 532

Query: 569 VQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGASL 628
           V Q+  L + SI  N+ +G + +    EI  V +K      + K P  Y+TI+G RG  +
Sbjct: 533 VPQDTPLFNDSIWENVKFG-RIDALDSEIYEVIEKAQLDSLIRKLPQSYETIVGERGLMI 591

Query: 629 SGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTIISIAHRL 688
           SGG+KQR+AIAR L+K   ++  DEATSALD  +E A+  T+    K+   T I IAHRL
Sbjct: 592 SGGEKQRLAIARVLLKDASVMFFDEATSALDTHTEQALLKTIRANFKTGSRTSIYIAHRL 651

Query: 689 STIRRSENVIVLGNDGSVVEVGKFKDLYADQQSELYKLLNDKKRDKPTPRVQSDPEKD 746
            TI  ++ +IVL  DG+V E G   +L A   S LYK L + + +      + + EKD
Sbjct: 652 RTIADADKIIVL-EDGTVREEGTHNELLAKSTS-LYKELWNVQENLDLIEREIEIEKD 707

>TBLA0C07000 Chr3 complement(1688965..1691142) [2178 bp, 725 aa]
           {ON} Anc_5.20 YMR301C
          Length = 725

 Score =  181 bits (460), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 131/383 (34%), Positives = 197/383 (51%), Gaps = 13/383 (3%)

Query: 351 VSEEQLSGVKTIQSFVAEGKELQRYNTAIRKVFLYGKKEALTNATFFSSTNVLGDLSFLI 410
           ++ + L   + ++ F  E    Q+Y+  + +      K A + A   S  N++   +  +
Sbjct: 317 IALDSLINFEAVKYFNNEEYLAQKYHKTLSQYRDSQIKVAQSLAFLNSGQNLIFTSALTV 376

Query: 411 VLAYGSHLVLQGGLTVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHA 470
           ++  G   ++ G LTVGDL             +  L + Y EL +       LF++  + 
Sbjct: 377 MMYMGCTGIIGGNLTVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMEYLFQLKKNP 436

Query: 471 PSIKPT------AGKPYVPGSGKISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGP 524
             IK        A K ++P +  I F++V+F Y  +   +I    +F IE G    IVGP
Sbjct: 437 IIIKNVEKPLMLAEKGHMPMT--IRFENVTFGYDKQ--RKILKNASFQIESGQKTAIVGP 492

Query: 525 SGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNL 584
           SG GKSTI  LL R+Y+P  G+I ++  D       SLR+ +GVV Q+  L + +I  N+
Sbjct: 493 SGSGKSTILKLLFRFYDPEEGRILVNGVDAREYDIDSLRKVIGVVPQDTPLFNDTIWENV 552

Query: 585 TYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMK 644
            +G +   S DEI  V  K      + K P G +TI+G RG  +SGG+KQR+AIAR L+K
Sbjct: 553 RFG-RIGASDDEITQVINKAQLGPLLVKLPQGRETIVGERGLMISGGEKQRLAIARVLLK 611

Query: 645 KPKILILDEATSALDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDG 704
              I+  DEATSALD  +E A+  T+ +  K    T + IAHRL TI  ++ +IVL  +G
Sbjct: 612 DADIMFFDEATSALDTHTEQALLKTINENFKKGSRTSVYIAHRLRTIADADKIIVL-QEG 670

Query: 705 SVVEVGKFKDLYADQQSELYKLL 727
           +V E GK  +L A   S LYK L
Sbjct: 671 TVREEGKHSELLARSGS-LYKEL 692

>TDEL0G00430 Chr7 (89431..91521) [2091 bp, 696 aa] {ON} Anc_5.20
           YMR301C
          Length = 696

 Score =  179 bits (455), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 128/425 (30%), Positives = 214/425 (50%), Gaps = 14/425 (3%)

Query: 339 RDLQESTGNLTRVSEEQLSGVKTIQSFVAEGKELQRYNTAIRKVFLYGKKEALTNATFFS 398
           RD  ++      V+ + L   + ++ F  E     +Y+ ++ K      K A + A   +
Sbjct: 281 RDANKADNKAASVALDSLINFEAVKHFNNENYLAGKYHNSLMKYRDSQVKIAQSLAFLNA 340

Query: 399 STNVLGDLSFLIVLAYGSHLVLQGGLTVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAG 458
             N +   +   ++  G   V+ G LTVGDL             +  L + Y EL +   
Sbjct: 341 GQNFIFTSALSAMMYMGCTGVIGGDLTVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLI 400

Query: 459 AASRLFEMTDHAPSIKPTAGKPYVP---GSGKISFKDVSFSYPTRPGNQIFNKLNFTIEP 515
               LF + ++   I        +P   G  +I F++V+F Y TR   +I    +FTI  
Sbjct: 401 DMEALFNLRNNKIKIHNNDKPLMLPENAGPFEIKFENVTFGYDTR--RKILRNASFTIPA 458

Query: 516 GSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRHLGVVQQEPML 575
           G    IVGPSG GKSTI  L+ R+Y+P SG++ ++ +D+      S R+ +GVV Q+  L
Sbjct: 459 GVKTAIVGPSGSGKSTILKLVFRFYDPESGRVLVNGKDVREYDLDSFRKVIGVVPQDTPL 518

Query: 576 MSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQR 635
            + +I  N+ +G + + + DE+ +  +K      + K P G  TI+G RG  +SGG+KQR
Sbjct: 519 FNDTIWENVKFG-RIDATDDEVTNAIEKAQLAPLIHKLPVGSATIVGERGLMISGGEKQR 577

Query: 636 IAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSE 695
           +AIAR L+K  +I+  DEATSALD  +E ++  T+ +       T + +AHRL TI  ++
Sbjct: 578 LAIARVLLKNSQIMFFDEATSALDTHTEQSLLKTIRENFDRGSRTSVYVAHRLRTIADAD 637

Query: 696 NVIVLGNDGSVVEVGKFKDLYADQQSELYKLLNDKKRDKPTPRVQSDPEKDREQEHQIDN 755
            ++VL  +G V E G   +L +   S LYK L D + +          +++ +QE Q+++
Sbjct: 638 KILVL-EEGCVREEGSHTELLSRPNS-LYKQLWDIQENLDV------IDQEIKQERQLED 689

Query: 756 QVREQ 760
           Q+ + 
Sbjct: 690 QLNQH 694

>Kpol_1018.185 s1018 (464370..468200) [3831 bp, 1276 aa] {ON}
            (464370..468200) [3831 nt, 1277 aa]
          Length = 1276

 Score =  181 bits (460), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 151/521 (28%), Positives = 248/521 (47%), Gaps = 29/521 (5%)

Query: 225  VANFGRIVLLRVLGEKLVARLRSNVIRKIIHQDAEFFDR--NKVGDLISRLSSDAYVVSR 282
            V+NF +  +L    E  +  LR+  + +I  +  E+F R  NK  ++ + L +D   +  
Sbjct: 763  VSNFLKTFILGYCSEYWIMDLRNRAMEEIAQKKLEWFSREENKSPEIAALLMNDLRDLRS 822

Query: 283  SMTQ--NVSDGFKAXXXXXXXXXXXXXXSISLTSALLMFAPPLLIGALIYGKRIRMISRD 340
             ++Q  +V   F                 +SL   + MF P ++I ++IYG  ++     
Sbjct: 823  LVSQFLSVISTFLTVSLVGLIWAIATGWKLSLV-CISMF-PLIVIFSIIYGTVLKNYETT 880

Query: 341  LQESTGNLTRVSEEQLSGVKTIQSFVAEGKELQRYNTAIRKVFLYGKKEALTNATFFSST 400
             +    NL  +  E ++GVKTI+    +    + Y+    ++    +K A+      + T
Sbjct: 881  YKTKVANLENLEYEIITGVKTIKCLQLQNHFKKCYHKLKDEMGQIARKRAIVTGLGIAIT 940

Query: 401  NVLGDLSFLIVLAYGSHLVLQGGL---TVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGA 457
              +      I+  YG  LV+ G     T+      +L+T  T ++   L +   ++ +G 
Sbjct: 941  TAIATTIQSILYYYGLKLVMDGEYSTRTMFQTFTLLLFTVMTCNS---LISQIPDISRGQ 997

Query: 458  GAASRLFEMTDHAPSIKP---TAGKPYVPGSGK--------ISFKDVSFSYPTRPGNQIF 506
             AAS ++ + + +   K    T G+      G+        +S  ++ F+YPT     I+
Sbjct: 998  RAASWIYRIIEESEDTKEQTITDGRFDEIHCGEKVDKTQPLVSIHNLEFAYPTALDVNIY 1057

Query: 507  NKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRHL 566
            + L+  +  G  V IVG SG GKST+  LL + Y  +   I ID  D++    ++LRR +
Sbjct: 1058 DNLSLDLNVGQTVAIVGESGSGKSTLVYLLTKLYQVADNCIDIDGTDVNEWDNETLRRQI 1117

Query: 567  GVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGA 626
             VV+Q+P+L  G+++ NL YGL       +I  + K    + F+   P G +T +    +
Sbjct: 1118 SVVEQKPVLFPGTVRENLIYGLYFSPLEIDIIDILKYVGVYDFIESLPEGLETSVDT--S 1175

Query: 627  SLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTIISIAH 686
             +SGGQ QR+ IARAL++KPKILILDE TSALD  S   IN  + K      L  ISI H
Sbjct: 1176 LISGGQAQRLCIARALLRKPKILILDECTSALDANSSKIINDIVAK--GPPSLLTISITH 1233

Query: 687  RLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQSELYKLL 727
                +R    V VL  DG + E G F  L+    +ELYK++
Sbjct: 1234 NEQMMRSCNTVAVL-KDGKICETGPFNKLFK-PGNELYKVV 1272

 Score =  161 bits (408), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 156/610 (25%), Positives = 264/610 (43%), Gaps = 47/610 (7%)

Query: 139 YKEVIRLFKLATHDWKLLTFAIGLLAISSVIGMSIPKVI----GMVLDAIKNTYSSATGP 194
           +KE I ++     DW L    I  + ++++    +P V     G V D +K+        
Sbjct: 9   WKENIYMYVQFKRDWLL----IATMVLTTIANGLVPAVTSILTGKVFDLLKDFAD----- 59

Query: 195 VGLDDLPPIVNDLSMYEFLGIFAGALVIGTVANF----GRIVLLRVLGEKLVARLRSNVI 250
                 P I  D ++Y  L + + +L+      F      I      GE     +R  ++
Sbjct: 60  ------PNIPKDHNLYHQLVLRSMSLMALAACAFPLIWTSISTWMSFGEGQGFTVRYRML 113

Query: 251 RKIIHQDAEFFDR--NKVGDL------ISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXX 302
              + +  E++D+  N  GD       +  L + +   S    QN+S             
Sbjct: 114 NSYLDKSMEWYDKKENLSGDFTQLNRCVEELRASSAEASAITLQNISSMLS-------LI 166

Query: 303 XXXXXXSISLTSALLMFAPPLLIGALIYGKRIRMISRDLQESTGNLTRVSEEQLSGVKTI 362
                 S SLT  +L   P L+I A I+ + I+  +      +G    +    ++  + I
Sbjct: 167 GVSFYYSWSLTLIILCGTPLLIILAFIFSRSIQKYAALENTESGLAADLLAWSMNSAQMI 226

Query: 363 QSFVAEGKELQRYNTAIRKVFLYGKKEALTNATFFSSTNVLGDLSFLIVLAYGSHLVLQG 422
           +    + KE++ +     K   Y  K +L  A   S+   L    F+    +G+  + +G
Sbjct: 227 KLSCTQLKEIESFEELTLKCNDYFIKLSLYVAANISTLRFLSLAMFVQGFWFGNTEIRKG 286

Query: 423 GLTVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFE-MTDHAPSIKPTAGKPY 481
            L + D+          GS +     +   L KG  A  ++   + D+   I  +A K  
Sbjct: 287 NLNISDVITCFSSCLMLGSTLNTTLGYLIFLQKGQVALRKIQSFLNDNKVEIDESALKQI 346

Query: 482 VPGSGKISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYN 541
                 ISF+ VSFSYP+RP + + N ++     G    IVG SG GKST+++LLL+ Y+
Sbjct: 347 DISKADISFRHVSFSYPSRPADDVLNDISIDFLSGKTTFIVGRSGSGKSTLSNLLLKLYD 406

Query: 542 PSSGQITIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSE-----VSMDE 596
              G I+I    I  +  + L +++ VV+Q   L + ++  N+  G Q E     V   +
Sbjct: 407 EYDGYISIGSTHIREIDQQVLIKNITVVEQRCTLFNDTLVNNILLGSQDEDKSSPVVQKK 466

Query: 597 IRSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATS 656
           ++   K       +    NG DTI+G  G SLSGGQ+QR+A+ARA M+  ++LILDEA S
Sbjct: 467 LKEAIKMACLESVIDSLSNGLDTILGTGGISLSGGQQQRVALARAYMRDTEVLILDEAVS 526

Query: 657 ALDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLY 716
           ALD+     +   + K  + +  T I + H LS I   + + V+  +G ++E G    L 
Sbjct: 527 ALDIVHREQLMSNITKWRQGR--TTIILTHELSQISIQDYLYVV-EEGRIIESGFQGQLM 583

Query: 717 ADQQSELYKL 726
            D  S   ++
Sbjct: 584 YDPDSAFCRM 593

>Kpol_513.23 s513 complement(65118..67244) [2127 bp, 708 aa] {ON}
           complement(65118..67244) [2127 nt, 709 aa]
          Length = 708

 Score =  178 bits (452), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 116/339 (34%), Positives = 175/339 (51%), Gaps = 17/339 (5%)

Query: 398 SSTNVLGDLSFLIVLAYGSHLVLQGGLTVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGA 457
           S  N++   +   ++  G   V+ G LTVGDL             +  L + Y EL +  
Sbjct: 357 SGQNLIFTSALTAIMYLGCTGVIGGNLTVGDLVLINQLVFQLSVPLNFLGSVYRELKQSL 416

Query: 458 GAASRLFEMTD--------HAPSIKPTAGKPYVPGSGKISFKDVSFSYPTRPGNQIFNKL 509
                LF++          H P + P    P+     +I F++V+F Y      +I    
Sbjct: 417 IDMESLFKLRKNEIKIQNVHRPLMLPNELTPF-----EIKFENVTFGYDKE--RKILKNA 469

Query: 510 NFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRHLGVV 569
           +FTI  G    +VGPSG GKSTI  L+ R+Y+P  G+I ++  DI  +   SLR+ +GVV
Sbjct: 470 SFTIPAGWKTAVVGPSGSGKSTILKLVFRFYDPEEGRILLNGTDIKEIDLASLRKVIGVV 529

Query: 570 QQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGASLS 629
            Q+  L + +I  N+ +G + E + +EI    +K      + K P G +TI+G RG  +S
Sbjct: 530 PQDTPLFNDTIWENVKFG-RIEATDNEILQAIEKAQLAPLIKKLPKGRETIVGERGLMIS 588

Query: 630 GGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTIISIAHRLS 689
           GG+KQR+AIAR L+K   I+  DEATSALD  +E ++  T+ +       T + IAHRL 
Sbjct: 589 GGEKQRLAIARVLLKNSGIMFFDEATSALDTHTEQSLLRTIKENFDGSSRTSVYIAHRLR 648

Query: 690 TIRRSENVIVLGNDGSVVEVGKFKDLYADQQSELYKLLN 728
           TI  ++ +IVL  DG V E G  + L A ++S   +L N
Sbjct: 649 TIADADKIIVL-KDGQVEEEGTHRQLIAKKESLYSELWN 686

>CAGL0M13739g Chr13 complement(1347781..1349964) [2184 bp, 727 aa]
           {ON} similar to uniprot|P40416 Saccharomyces cerevisiae
           YMR301c ATM1
          Length = 727

 Score =  178 bits (451), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 155/582 (26%), Positives = 262/582 (45%), Gaps = 43/582 (7%)

Query: 166 SSVIGMSIPKVIGMVLDAIKNTYSSATGPVGLDDLPPIVNDLSMYEFLGIFAGALVIGTV 225
           + V+ + +P     ++D +   +S AT       LP  +    M   L  F GA++ G +
Sbjct: 149 AKVLNVQVPFFFKQIIDGMNVDWSDATVA-----LPAALGLTIMCYGLARF-GAVLFGEL 202

Query: 226 ANFGRIVLLRVLGEKLVARLRSNVIRKIIHQDAEFFDRNKVGDLISRLSSD--------- 276
            N             + AR+  N IR +  Q  E   +  +G  +SR +           
Sbjct: 203 RN------------AIFARVAQNAIRNVSLQTFEHLMKLDLGWHLSRQTGGLTRAMDRGT 250

Query: 277 ---AYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTSALLMFAPPLLIGALIYGKR 333
              +YV+S  +   +   F+                  +T   ++      I    +  R
Sbjct: 251 KGISYVLSAMVFHIIPITFEISVVCGILTYQFGASFAGITFTTMLLYSIFTIRTTAWRTR 310

Query: 334 IRMISRDLQESTGNLTRVSEEQLSGVKTIQSFVAEGKELQRYNTAIRKVFLYGKKEALTN 393
            R   ++  ++      V+ + L   + ++ F  E     +Y+ ++ K      K A + 
Sbjct: 311 FR---KEANKADNKGASVALDSLINFEAVKYFNNESYLANKYHNSLIKYRDSQVKVAQSL 367

Query: 394 ATFFSSTNVLGDLSFLIVLAYGSHLVLQGGLTVGDLTAFMLYTEYTGSAVFGLSNFYSEL 453
           A   S  +++   +   ++  G   V+ G LTVGDL             +  L + Y EL
Sbjct: 368 AFLNSGQSLIFTTALTGMMYMGCTGVIGGDLTVGDLVLINQLVFQLSVPLNFLGSVYREL 427

Query: 454 MKGAGAASRLFEMTDHAPSIKPTAGKPYVP---GSGKISFKDVSFSYPTRPGNQIFNKLN 510
            +       LF++  +   I+  +    +    G  +I F++V+F Y  +   +I    +
Sbjct: 428 KQSLIDMESLFKLRKNQVKIQNCSQPKSISKSDGPFEIKFENVTFGYDGQ--RKILKNAS 485

Query: 511 FTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRHLGVVQ 570
           FTI  G    I GPSG GKST+  L+ R+Y+P  G++ ++  D+       LR+ +GVV 
Sbjct: 486 FTIPAGMKTAIAGPSGSGKSTVLKLVFRFYDPEEGRVLVNGVDVREYDIDQLRKAIGVVP 545

Query: 571 QEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSG 630
           Q+  L + +I  N+ +G + E S +EI  V  K      + K P G  TI+G RG  +SG
Sbjct: 546 QDTPLFNDTIWENVKFG-RIEASDEEITRVIDKAQLSDLIAKLPQGSSTIVGERGLMISG 604

Query: 631 GQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTIISIAHRLST 690
           G+KQR+AIAR L+K   I+  DEATSALD  +E ++  T+ +   S E T + IAHRL T
Sbjct: 605 GEKQRLAIARVLLKDADIMFFDEATSALDTHTEQSLLRTIRRNFNSGEKTSVYIAHRLRT 664

Query: 691 IRRSENVIVLGNDGSVVEVGKFKDLYADQQS---ELYKLLND 729
           I  ++ +IVL  +G+V E G  ++L A + S   EL+++  D
Sbjct: 665 IADADKIIVL-EEGTVREEGTHQELLARENSLYKELWRIQED 705

>NDAI0D01540 Chr4 (369687..373568) [3882 bp, 1293 aa] {ON} Anc_1.527
           YKL209C
          Length = 1293

 Score =  179 bits (455), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 130/442 (29%), Positives = 227/442 (51%), Gaps = 27/442 (6%)

Query: 309 SISLTSALLMFAPPLLIGALIYGKRIRMISRDLQESTGNLTRVSEEQLSGVKTIQSFVAE 368
           S SLT  +L  AP +++ A+++   I   +      TG   ++    ++  + ++ +  +
Sbjct: 173 SWSLTLIILCSAPLIILFAILFSHMIHKYTELENSETGKAAQLLNWSMNSAQLVKLYCTQ 232

Query: 369 GKELQRYNTAIRKVFLYGKKEALTNATFFSSTN--VLGDLS---FLIVLAYGSHLVLQGG 423
             E+  +   + +       +    + F+ S N  +L  LS   F+    +G+ +V +G 
Sbjct: 233 AYEIHSFKELVGQC-----NDLFIKSCFYVSANTSILRFLSLSMFVQGFWFGAIMVKKGK 287

Query: 424 LTVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEM---TDHAPSIKPTAGKP 480
           L++ D+          GS +         L KG  A  ++ +    +  +PS++P   +P
Sbjct: 288 LSIKDVITCFHSCLMLGSTLNNTLQQIVVLQKGDVALKKILDFISFSQRSPSLEPPY-EP 346

Query: 481 YVPGS-GKISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRY 539
            VP S G+ISF+++SF+YPTRP   +   ++ T +PG +  I+G SG GKST+ +LLL++
Sbjct: 347 SVPISNGEISFQNISFAYPTRPHQTVLKDVSITFQPGRSTFIIGKSGSGKSTLANLLLKF 406

Query: 540 YNPSSGQITIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQS---EVSMDE 596
           YN   G I I + ++ +++   L  ++ VV+Q   L + +++ NL  G+ +   +V  D+
Sbjct: 407 YNDYQGSIKIGNTNVKKINKNWLFENITVVEQRCTLFNDTLRNNLLLGISNSNQKVEQDD 466

Query: 597 I------RSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILI 650
           I      +   +       + + P+G DTIIG  G SLSGGQ+QR+AIARA +K   +LI
Sbjct: 467 IEISQRLKDACRIAMLEELIRELPDGLDTIIGAGGVSLSGGQQQRVAIARAYIKDSSVLI 526

Query: 651 LDEATSALDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVG 710
           LDEA SALD+     I   + K  +S + TII + H LS +   + + V   DG V E G
Sbjct: 527 LDEAVSALDIIHRELIMKAI-KNWRSGKTTII-LTHDLSQLDYDDFLYVF-EDGEVKESG 583

Query: 711 KFKDLYADQQSELYKLLNDKKR 732
             + L  D+++   KL + + R
Sbjct: 584 YQQALLQDEKTIFSKLYDIQMR 605

 Score =  158 bits (400), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 147/569 (25%), Positives = 255/569 (44%), Gaps = 37/569 (6%)

Query: 189  SSATGPVG-------LDDLPPIVN-----DLSMYEFLGIFAGALVIGTVANFGRIVLLRV 236
            + AT P+        L+ + P+ N      L + ++  I  G      ++NF +  +L  
Sbjct: 732  AGATNPIFSYCFSYLLNGIVPMTNGQYRSQLYLLKWSFIVLGISAADAISNFLKSYILGY 791

Query: 237  LGEKLVARLRSNVIRKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXX 296
              E  +  LR+  +  I+++  ++F + +     S LS+      R +   VS+   A  
Sbjct: 792  CSELWIMDLRNEAMAAIMNKRLDWFSKEENKS--SELSALLLNDLRDLRSLVSEFLSAMT 849

Query: 297  XXXXXXXXXXXXSI----SLTSALLMFAPPLLIGALIYGKRIRMISRDLQESTGNLTRVS 352
                        ++     L+   +   P +++ + IYG  ++      + +   L    
Sbjct: 850  TFIVVSLVGLIWALVSGWKLSLVCISMFPLIILVSGIYGSTLQRYETMYKTAVAELENHE 909

Query: 353  EEQLSGVKTIQSFVAEGKELQRYNTAIRKVFLYGKKEALTNATFFSSTNVLGDLSFLIVL 412
             E ++ +KTI+   A    ++ Y      +     K ++      S TN +      I+ 
Sbjct: 910  YEIMTKIKTIRYLQASKYFIKNYKVLENNLKKIAHKRSIATGFGISITNTIAVCIQSILY 969

Query: 413  AYGSHLVLQGGLTVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLF----EMTD 468
             YG  LV +G  +   +        +T  +   L +   ++ +G  AAS L+    E  D
Sbjct: 970  YYGLRLVFKGEYSSKKMFETFTLLLFTIISCTSLVSQIPDISRGQRAASWLYRILDESDD 1029

Query: 469  HAPSIKPTAGKPYVPGSGK------ISFKDVSFSYPTRPGNQIFNKLNFTIEPGS-NVCI 521
            +  S+   +    +  SG       IS K++ FSYP+    +I+  +   +      + I
Sbjct: 1030 NKESVDSGSRSADIIISGNTNSVPLISIKNLRFSYPSAQTVEIYKNITLHVTSSQKTIGI 1089

Query: 522  VGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIK 581
            VG SG GKST+  LL + Y   +  I ID  D++      LR+ + VV+Q P L  G+++
Sbjct: 1090 VGESGSGKSTLMYLLTKLYKTPANSIYIDGTDVNEWDTLKLRKQISVVEQNPTLFEGTVR 1149

Query: 582  YNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARA 641
             NL YG  +++S  EI  V K    + F+   P G D+ I  +   +SGGQ QR+ IARA
Sbjct: 1150 DNLVYGTLNDISEIEIYDVLKYLGIYEFIENLPMGLDSRIDTK--LVSGGQAQRLCIARA 1207

Query: 642  LMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTIISIAHRLS-TIRRSENVIVL 700
            L++KP ILILDE TSALD  S   IN     L+K+   T+++I    S  +  + N + +
Sbjct: 1208 LLRKPTILILDECTSALDAASAHLIN----NLVKNGLPTVLTIVITHSKQMMEACNSLAV 1263

Query: 701  GNDGSVVEVGKFKDLYADQQSELYKLLND 729
              DG + E G F +L  +  SEL +++N+
Sbjct: 1264 IKDGRLAEQGNFAELMKN-NSELRRIINE 1291

>NDAI0I02440 Chr9 complement(556154..558346) [2193 bp, 730 aa] {ON}
           Anc_5.20 YMR301C
          Length = 730

 Score =  176 bits (447), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 128/397 (32%), Positives = 197/397 (49%), Gaps = 12/397 (3%)

Query: 339 RDLQESTGNLTRVSEEQLSGVKTIQSFVAEGKELQRYNTAIRKVFLYGKKEALTNATFFS 398
           RD  ++      V+ + L   + ++ F  E     +Y+ ++ +      K A + A   S
Sbjct: 316 RDANKADNKGASVALDSLINFEAVKYFNNETYLSNKYHDSLLQYRDSTIKVAQSLAFLNS 375

Query: 399 STNVLGDLSFLIVLAYGSHLVLQGGLTVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAG 458
             N++   +  +++  G   V++G LTVGDL             +  L + Y EL +   
Sbjct: 376 GQNLIFTSALTMMMYLGCTGVIEGNLTVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLI 435

Query: 459 AASRLFEMTDHAPSIKPTAGKPYVP-------GSGKISFKDVSFSYPTRPGNQIFNKLNF 511
               LF++  +   I+     P  P       G  +I F++V+F Y T    +I    +F
Sbjct: 436 DMESLFQLRKNPIKIQNAKTGP-APIMLKSSDGPFEIKFENVTFGYDT--NRKILKNASF 492

Query: 512 TIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRHLGVVQQ 571
            I  G    +VGPSG GKSTI  L+ R+Y+P  G++ I+  ++ R    SLRR +GVV Q
Sbjct: 493 IIPAGLKTAVVGPSGSGKSTILKLVFRFYDPEEGRVLINGINVQRYDIDSLRRVMGVVPQ 552

Query: 572 EPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGG 631
           +  L + +I  N+ +G +   + +EI+ V +K      + K P    TI+G RG  +SGG
Sbjct: 553 DTPLFNDTIWENVKFG-RINANDEEIKQVIEKAQLAPLIEKLPQREKTIVGERGLMISGG 611

Query: 632 QKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTIISIAHRLSTI 691
           +KQR+AIAR L+K   I+  DEATSALD  +E A+  T+     S   T I IAHRL TI
Sbjct: 612 EKQRLAIARVLLKDANIMFFDEATSALDTHTEQALLNTIRANFPSGTRTSIYIAHRLRTI 671

Query: 692 RRSENVIVLGNDGSVVEVGKFKDLYADQQSELYKLLN 728
             ++ +IVL  DG V E G   +L A + S    L N
Sbjct: 672 ADADKIIVL-EDGKVKEEGSHNELLATKGSLYSNLWN 707

>KLLA0B14256g Chr2 (1248654..1252469) [3816 bp, 1271 aa] {ON} similar
            to uniprot|P12866 Saccharomyces cerevisiae YKL209C STE6
            ATP-binding cassette (ABC) transporter required for the
            export of a-factor catalyzes ATP hydrolysis coupled to
            a-factor transport contains 12 transmembrane domains and
            two ATP binding domains expressed only in MATa cells
          Length = 1271

 Score =  178 bits (451), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 150/535 (28%), Positives = 261/535 (48%), Gaps = 58/535 (10%)

Query: 225  VANFGRIVLLRVLGEKLVARLRSNVIRKIIHQDAEFFD--------------------RN 264
            ++ F +  +L    E  + RLR + + KI  +  ++F                     R 
Sbjct: 760  ISTFLKDFILGYCSEVWIERLRVDAMAKISSKSLDWFKLPTNNSSELNSLMMNDLRDLRG 819

Query: 265  KVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTSALLMFAPPLL 324
               + +S +++  +V S  +   +  G+K                ISL  A ++F+    
Sbjct: 820  LASEFLSAITTLVFVASIGLIWALVSGWK-----------LSLVCISLFPAFILFSG--- 865

Query: 325  IGALIYGKRIRMISRDLQESTGNL-TRVSEEQLSGVKTIQSFVAEGKELQRYNTAIRKVF 383
                IYG  +++     +     L TRV E  +S +KTI+    +      + T + KV 
Sbjct: 866  ----IYGSLLQVYETAYKTEIAELETRVHELVIS-MKTIKLLQLQQHFEGSFKTQLAKVR 920

Query: 384  LYGKKEALTNATFFSSTNVLGDLSFLIVLAYGSHLVLQGGLTVGDLTAFMLYTEYTGSAV 443
            +  KK ++      + TN L  +   I+  +G  LV+QG  +V  +        ++    
Sbjct: 921  IVCKKRSVAVGFGIAVTNALAMVVQAILFFFGIKLVIQGEYSVAQMFETFTLLLFSIMTC 980

Query: 444  FGLSNFYSELMKGAGAASRLFEMTDHAPSIK-----PTAGKPYVPGSGK---ISFKDVSF 495
              L N   E+ +G  AA+ +F++ + + S+      P+  + +   +G    I   ++SF
Sbjct: 981  VSLINQVPEISRGQRAATYIFKVLEDSGSVDTSKPDPSQNQSFFSTAGNRETIKISNLSF 1040

Query: 496  SYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDIS 555
            ++ + P N+IFN L+  I     V IVG SG GKST++ LL R Y   SG++ I   DI+
Sbjct: 1041 AFSSAPMNKIFNSLSCEICLNETVGIVGESGSGKSTLSLLLTRLYPVPSGKVYIGGIDIN 1100

Query: 556  RLSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPN 615
            +    +LRR + +V+Q+P    G+++ NL YGL+  VS  E+RSV K      FV   PN
Sbjct: 1101 KWDEYALRRTISIVEQKPKFFDGTVRENLVYGLKRNVSNSELRSVLKSVDLLSFVQTLPN 1160

Query: 616  GYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMK 675
              +T +      +SGGQ QR++IAR L+++PKI+ILDE TSALD     A ++ + +L++
Sbjct: 1161 DLNTRV--HDGLMSGGQAQRLSIARTLLRQPKIIILDECTSALD----AANSFAIAELIR 1214

Query: 676  S--KELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQSELYKLLN 728
            +  K +T+I I H    ++  + V+VL   G V E G + +L+ + + ELY++++
Sbjct: 1215 TVLKNVTVIVITHSEQLMQICDRVLVL-KKGKVKEEGSYAELF-ESRGELYRIVS 1267

 Score =  172 bits (437), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 160/603 (26%), Positives = 274/603 (45%), Gaps = 27/603 (4%)

Query: 157 TFAIGLLAISSVIGMSIPKVIGMVLDAIKNTYSSATGPVGLDDLPPIVNDLSMYEFLGIF 216
            F + + A+S+V    +P VI ++   + N   S  G          V++L++  F    
Sbjct: 14  CFVLIVTAVSTVANGLVPVVISILTGRVFNLLQS-LGTDTYKTKSEFVHELTVRSFSIAA 72

Query: 217 AGALVIGTVANFGRIVLLRVLGEKLVARLRSNVIRKIIHQDAEFFDRNK--VGDLISRLS 274
             A VI    ++  +     LGE+   R+R+++I     +D +++D N+   GD I +++
Sbjct: 73  VAACVIPI--SWVSLSTWMTLGERQGFRIRNSLIMFYFEKDLKWYDSNENLEGDFI-QIN 129

Query: 275 SDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTSALLMFAPPLLIGALIYGKRI 334
                V  S  +  +  F+               S SLT  +L   P L   A+    ++
Sbjct: 130 RCIEEVRASSAEASAIFFQNVISIIALIATSMYYSWSLTLIILCSLPLLATLAVFLSMKV 189

Query: 335 RMISRDLQESTGNLTRVSEEQLSGVKTIQSFVAEGKELQRYNTAIRKVFLYGKKEALTNA 394
              S+     +   + V    L   + I+ F     E +++ T + K   +  K  L +A
Sbjct: 190 EKFSKLENLESSKASSVLAWSLDAFQMIRLFNTSYWEQKKFETLVSKCNKHFVKSCLYSA 249

Query: 395 TFFSSTNVLGDLSFLIVLAYGSHLVLQGGLTVGDLTAFMLYTEYTGSAVFGLSNFYSELM 454
              SS   L    F+    +G+  + +G +  GD+          GS++         + 
Sbjct: 250 LNASSLRFLTLCMFVQGFWFGNTQIKRGKMKAGDVITCFSSCLLLGSSLSSTLQQIVTIQ 309

Query: 455 KGAGAASRL--------------FEMTDHAPSIKPTAGKPYVPGSGKISFKDVSFSYPTR 500
           KG  A  R+              +E      S   + G   +   G I F+DVSF+YPTR
Sbjct: 310 KGKAAIQRINQFLVPNSKSAVGEWEKRSSLISTSSSIGLAPIFCDGDIEFRDVSFAYPTR 369

Query: 501 PGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCK 560
           P + +   ++  I+ G+   IVG SG GKST+ SLLL+ Y   +G+I   + +I  L   
Sbjct: 370 PDDYVLKNVSIKIKSGATCFIVGKSGSGKSTLASLLLKMYGEYTGEIKFGEYEIDSLDDS 429

Query: 561 SLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTI 620
            L  ++ +V+Q   L +G++K NLT  +    S  E++   +    +  +   PNG DT+
Sbjct: 430 WLVENITLVEQRCTLFNGTLKDNLTI-VNKYASCTEVKQACQFALLNTVLLNLPNGIDTL 488

Query: 621 IGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELT 680
           +G  G +LSGGQ+QR+A+ARA ++   +LILDE+ SALD+ S   I   +    K K  T
Sbjct: 489 LGRHGVTLSGGQQQRVALARAYLRNTPVLILDESLSALDIMSRELIVEAIRHWRKGK--T 546

Query: 681 IISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQSELYKL--LNDKKRDKP-TP 737
            I + H  + I+  E V ++ ++G+VVE G   DL  +  S   +L  L + + + P +P
Sbjct: 547 TIILTHEYTQIKDDEYVYLM-SEGTVVESGFKYDLLENPDSYFAQLNSLQETRYEVPVSP 605

Query: 738 RVQ 740
            V+
Sbjct: 606 DVE 608

>TPHA0L02270 Chr12 complement(473597..475732) [2136 bp, 711 aa] {ON}
           Anc_5.20 YMR301C
          Length = 711

 Score =  174 bits (442), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 122/409 (29%), Positives = 200/409 (48%), Gaps = 30/409 (7%)

Query: 351 VSEEQLSGVKTIQSFVAEGKELQRYNTAIRKVFLYGKKEALTNATFFSSTNVLGDLSFLI 410
           ++ + L   + ++ F  E     +YNT+++       K A + A   S  N++   +   
Sbjct: 314 IALDSLINFEAVKYFNNEQYLASKYNTSLKSYTEAQVKVAQSLAFLNSGQNLIFTSALTA 373

Query: 411 VLAYGSHLVLQGGLTVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEM---- 466
           ++  G   +L G L+VGDL             +  L + Y +L +       LF++    
Sbjct: 374 MMYMGCTGILGGNLSVGDLVLINQLVFQLSVPLNFLGSVYRDLKQSLIDMESLFKLRKNE 433

Query: 467 ----TDHAPSIKPTAGKPYVPGSGKISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIV 522
                +  P+I      P+      I FK+V+F Y   P  +I    +F I  G    +V
Sbjct: 434 VKILNNKNPAILSLKDGPF-----NIEFKNVTFGYD--PNRKILRNASFIIPAGVKTAVV 486

Query: 523 GPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKY 582
           GPSG GKSTI  L+ R+Y+P  G++ ++  D+      SLRR +GVV Q+  L + +I  
Sbjct: 487 GPSGSGKSTILKLVFRFYDPEEGRVLVNGIDVRDYDLDSLRRAIGVVPQDTPLFNDTIWE 546

Query: 583 NLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARAL 642
           N+ +G     + ++I +  +K      + K P  Y+TI+G RG  +SGG+KQR+AIAR L
Sbjct: 547 NVKFG-DVTATDEQILNAVEKAQLGTLIEKLPKKYETIVGERGLMISGGEKQRLAIARVL 605

Query: 643 MKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGN 702
           +K   I+  DEATSALD  +E  +  T+         T + IAHRL T+  S+ +IVL  
Sbjct: 606 LKNAPIMFFDEATSALDTHTEQELLKTIKNNFDKGSRTSVYIAHRLRTVADSDKIIVL-K 664

Query: 703 DGSVVEVGK-----------FKDLYADQQSELYKLLNDKKRDKPTPRVQ 740
           +GS+ E G            +KDL+  Q++    ++ND  + KP  +++
Sbjct: 665 EGSIFEEGTHLGLLSKPNSLYKDLWNIQEN--LDMINDSLKVKPVGKLR 711

>Ecym_5649 Chr5 complement(1310682..1312772) [2091 bp, 696 aa] {ON}
           similar to Ashbya gossypii AGL335W
          Length = 696

 Score =  174 bits (440), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 119/349 (34%), Positives = 177/349 (50%), Gaps = 23/349 (6%)

Query: 398 SSTNVLGDLSFLIVLAYGSHLVLQGGLTVGDLTAFMLYTEYTGSAVFGLS---NF----Y 450
           S  N++   +   V+      V++G LTVGDL             +F LS   NF    Y
Sbjct: 352 SGQNLIFTSALTAVMYMACSGVMEGSLTVGDLVLI-------NQLIFQLSLPLNFLGSVY 404

Query: 451 SELMKGAGAASRLFEMTDHAPSIKPTAGKPYVPGS--GKISFKDVSFSYPTRPGNQIFNK 508
            EL +       LF +  +  +IK       +P      I F++V+F Y   P  +I   
Sbjct: 405 RELKQSLIDMESLFRLQKNKITIKNVLNPQMLPEKLPSDIRFENVTFGYD--PERKILKN 462

Query: 509 LNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRHLGV 568
             FTI  G    IVGPSG GKSTI  L+ R+Y P  G+I ID +DI  +   SLR+ +GV
Sbjct: 463 ATFTIPAGKKTAIVGPSGSGKSTILRLVFRFYEPEQGRILIDGKDIREVDLDSLRKSIGV 522

Query: 569 VQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGASL 628
           V Q+  L + +I  N+ +G + + S  +I +  ++      +   P G +TI+G RG  +
Sbjct: 523 VPQDTPLFNDTIWENVKFG-RIDASDKDITNAIERAQLTKLIQNLPKGINTIVGERGLMI 581

Query: 629 SGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTIISIAHRL 688
           SGG+KQR+AI+R L+K   ++  DEATSALD  +E ++  T+ +  + +  T + IAHRL
Sbjct: 582 SGGEKQRLAISRVLLKDCPLMFFDEATSALDTHTEQSLLKTINENFEGQSKTSVYIAHRL 641

Query: 689 STIRRSENVIVLGNDGSVVEVGKFKDLY---ADQQSELYKLLNDKKRDK 734
            TI  ++ +IVL N+  V E G  K L        SEL+ +      DK
Sbjct: 642 RTIADADKIIVL-NNSRVHEEGDHKTLLKTPGSLYSELWNIQESMTVDK 689

>TPHA0O00160 Chr15 complement(16002..19763) [3762 bp, 1253 aa] {ON}
            Anc_1.527 YKL209C
          Length = 1253

 Score =  175 bits (443), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 141/519 (27%), Positives = 242/519 (46%), Gaps = 20/519 (3%)

Query: 213  LGIFAGALVIGTVANFGRIVLLRVLGEKLVARLRSNVIRKIIHQDAEFFDR--NKVGDLI 270
            L + A AL  GT  NF +I +L    E  +  LR+ +++ +  +  E++ R  NK  ++ 
Sbjct: 726  LIVLAIALADGTF-NFIKIFILGYCSEYWIMDLRNELMQCVSQKRFEWYGRSSNKSSEIS 784

Query: 271  SRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTSALLMFAPPLLIGALIY 330
            +   +D   +   +T+ +S                      L+   +   P ++I ++IY
Sbjct: 785  ALALNDLRDLRTLVTEFLSTMSTFVTVSMMGLIWAIATGWKLSLVCISMFPLIIIFSMIY 844

Query: 331  GKRIRMISRDLQESTGNLTRVSEEQLSGVKTIQSFVAEGKELQRYNTAIRKVFLYGKKEA 390
            G  ++      + +  +L  +  E ++ +KTI+        L  Y+   +K+    KK  
Sbjct: 845  GTVLQNYETSYKSAVADLENLQYEMITSIKTIKCLRLNDHFLGLYSELEKKMKRIAKKRT 904

Query: 391  LTNATFFSSTNVLGDLSFLIVLAYGSHLVLQGGLTVGDLTAFMLYTEYTGSAVFGLSNFY 450
            +      S    +      I+  YG  LVL G  T   +        +T +    L +  
Sbjct: 905  IVTGLGLSMLTTITTCIQSILYYYGLKLVLTGEYTSKTMFQTFTLVLFTVTTCNSLVSQI 964

Query: 451  SELMKGAGAASRLFEMTDHAPSIKPTAGKPYVPGSGK--------ISFKDVSFSYPTRPG 502
             ++ +G  AAS +  + D     K   G+     + +        I  ++++F YP  PG
Sbjct: 965  PDVSRGQRAASWVLRIIDENEYTKEVNGEDCRVETIEHENDSDPLIEIENLNFHYPNTPG 1024

Query: 503  NQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSL 562
              ++  LN  I  G  + +VG SG GKST+  LL + Y+    +I I+  DI+  S   L
Sbjct: 1025 VNVYQDLNLKINSGETIGLVGQSGSGKSTLMYLLTKLYDVQDNRILINGTDINDWSYDIL 1084

Query: 563  RRHLGVVQQEPMLMSGSIKYNLTYGL--QSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTI 620
            R  + VV+Q+P L  G+I+ N+TYG+  ++ VS  E++ + +    H FV   P   DT+
Sbjct: 1085 RAEICVVEQKPNLFHGTIRENITYGVSEKNPVSETEVQELLQLVDMHEFVEALPKALDTV 1144

Query: 621  IGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSK--- 677
            +      LSGGQ QR+ I R L++KPK+LILDE TS+LD ++   I   L K + +K   
Sbjct: 1145 VDI--GLLSGGQAQRLCIVRTLLRKPKVLILDECTSSLDAQTT-QIVIALIKDLNTKLGW 1201

Query: 678  ELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLY 716
            ++  I I H    ++    ++VL + G VVE G+F DL+
Sbjct: 1202 DILTIVITHNRQMMQCCSRLVVL-DVGRVVEDGQFDDLH 1239

 Score =  165 bits (417), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 135/539 (25%), Positives = 252/539 (46%), Gaps = 36/539 (6%)

Query: 237 LGEKLVARLRSNVIRKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXX 296
           LGE+   R+RS ++ + + +  E++D      L   L+ D   ++R M +  S   +A  
Sbjct: 93  LGERQGFRVRSKLLEEYLEKPMEWYD------LKENLAGDFTQLNRCMEELRSGSAEASA 146

Query: 297 XXXXXXXXXXXX-------SISLTSALLMFAPPLLIGALIYGKRIRMISRDLQESTGNLT 349
                              S  LT  +L  +P +++ A  + + I+  +    + T    
Sbjct: 147 VTYQNCVAIIALICVSFYYSWQLTLIILCTSPFIIVCAACFSRFIQKYASFENKETAAAA 206

Query: 350 RVSEEQLSGVKTIQSFVAEGKELQRYNTAIRKVFLYGKKEALTNATFFSSTNVLGDLSFL 409
            +    +   +T++    + KE++++ T + K   Y  + +L     F++ N+ G L FL
Sbjct: 207 DLLMWTMDSSQTVKLSCTQSKEIKKFETLVSKCNDYFIRTSL-----FTAANI-GILRFL 260

Query: 410 IV------LAYGSHLVLQGGLTVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRL 463
            +        +GS ++ +G L + D+          GS +    +    + KG  A +++
Sbjct: 261 TLSMFVQGFWFGSTMIRKGKLNISDVITCFYSCLMLGSILNTTLHHVIFIQKGQVALAKI 320

Query: 464 FEMTDHAPSI--KPTAGKPYVPGSGKISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCI 521
            +  + +P +  K       V     IS  +++F+YP+RP   +   ++  I+      I
Sbjct: 321 QKFINESPELPSKTLTSSGLVYSHVDISIDNLTFAYPSRPTENVLKNVSLKIKSARTTFI 380

Query: 522 VGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIK 581
           VG SG GKSTIT+L++++Y    G I + D+DI  +    L +++ +V+Q   L + ++K
Sbjct: 381 VGKSGSGKSTITNLIMKFYEDYKGNIIVGDKDIRSVPIDELLQNITLVEQRCTLFNDTLK 440

Query: 582 YNLTYG--LQSEVSMDEIRSVAKKCFC-HGFVTKFPNGYDTIIGPRGASLSGGQKQRIAI 638
            N+  G    S+   D + S      C    ++  P+G +T +G  G +LSGGQ+QR+A+
Sbjct: 441 NNILLGSKYTSQTINDGLLSSICSLACLDSVISSLPDGIETRLGTDGITLSGGQQQRVAL 500

Query: 639 ARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSENVI 698
           ARA ++   ILILDEA SALD+     +   + K+ ++K  T I + H L+ I  ++ + 
Sbjct: 501 ARAFLRDTDILILDEAVSALDIMQREILMRNISKVRQNK--TTIILTHDLNQINDNDYIY 558

Query: 699 VLGNDGSVVEVGKFKDLYADQQSELYKLLNDKKRDKPTPRVQSDP---EKDREQEHQID 754
           +  N+  + E G  K L  D+ +  Y + N ++    T    S P   +KD   E + D
Sbjct: 559 LFENN-EIKENGFKKTLMNDENTLFYNMYNLQRNAAITDSRASSPTIYDKDEVYEKKDD 616

>ZYRO0D07106g Chr4 (616125..618254) [2130 bp, 709 aa] {ON} similar
           to uniprot|P40416 Saccharomyces cerevisiae YMR301C ATM1
           Mitochondrial inner membrane transporter exports
           mitochondrially synthesized precursors of iron- sulfur
           (Fe/S) clusters to the cytosol member of the ATP-
           binding cassette (ABC) transporter family
          Length = 709

 Score =  172 bits (436), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 123/393 (31%), Positives = 193/393 (49%), Gaps = 7/393 (1%)

Query: 339 RDLQESTGNLTRVSEEQLSGVKTIQSFVAEGKELQRYNTAIRKVFLYGKKEALTNATFFS 398
           R+  ++      V+ + L   + +++F  E    ++Y T++ K      + A + A   S
Sbjct: 280 REANKADNKAASVALDSLINFEAVKNFNNEKYLAEKYETSLLKYRDSQVRVAQSLAFLNS 339

Query: 399 STNVLGDLSFLIVLAYGSHLVLQGGLTVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAG 458
             N++   +   ++  G   ++ G LTVGDL             +  L + Y EL +   
Sbjct: 340 GQNLIFTTALTAMMYMGCTGIIGGSLTVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLI 399

Query: 459 AASRLFEMTDHAPSI-KPTAGK--PYVPGSGKISFKDVSFSYPTRPGNQIFNKLNFTIEP 515
               LF + ++   I  P+  K  P   G   I F++V+F Y   P  +I    +F I  
Sbjct: 400 DMESLFNLRNNPILIDNPSKPKMLPANAGPFDIVFENVTFGYD--PRRKILQNASFVIPA 457

Query: 516 GSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRHLGVVQQEPML 575
           G    +VGPSG GKST+  L+ R+Y+P  G+I ++  DI      SLRR +GVV Q+  L
Sbjct: 458 GWKTAVVGPSGSGKSTLLKLVFRFYDPQEGRILVNGIDIREYDLDSLRRAIGVVPQDTPL 517

Query: 576 MSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQR 635
            + +I  N+ +G       +  RS+ +K      V + P G +TI+G RG  +SGG+KQR
Sbjct: 518 FNDTIWENVKFGRIDADDQEVTRSI-EKAHLAPLVYRLPGGLNTIVGERGLMISGGEKQR 576

Query: 636 IAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSE 695
           +AIAR L+K   I+  DEATSALD  +E A+  T+         T + IAHRL TI  ++
Sbjct: 577 LAIARVLLKNSSIMFFDEATSALDTHTEQALLRTIRANFDRGSKTSVYIAHRLRTIADAD 636

Query: 696 NVIVLGNDGSVVEVGKFKDLYADQQSELYKLLN 728
            +IVL  +G   E G   +L   + S   +L N
Sbjct: 637 KIIVL-EEGRPREEGTHHELLQKEDSLYRELWN 668

>Kwal_33.15561 s33 (1157299..1161192) [3894 bp, 1297 aa] {ON} YKL209C
            (STE6) - ABC transporter, glycoprotein, component of
            a-factor secretory pathway [contig 290] FULL
          Length = 1297

 Score =  174 bits (441), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 144/526 (27%), Positives = 240/526 (45%), Gaps = 39/526 (7%)

Query: 228  FGRIVLLRVLGEKLVARLRSNVIRKIIHQDAEFFD--RNKVGDLISRLSSDAYVVSRSMT 285
            F +  +L   GE  +  LR N  R ++ +D  +F    N   ++ S + +D     R + 
Sbjct: 790  FLKCYILSRCGENWIKELRINAFRSVMEKDFTWFQDSNNSTSNITSLILNDL----RDLR 845

Query: 286  QNVSDGFKAXXXXXXXXXXXXXXSI----SLTSALLMFAPPLLIGALIYGKRIRMISRDL 341
               S+   A              ++     L+   +   P  ++ + IYG  ++      
Sbjct: 846  ALASEFLAALSTLAVVSLCGLLWALVAGWKLSLVCISLIPMFVLFSGIYGGLLQNYEARY 905

Query: 342  QESTGNLTRVSEEQLSGVKTIQSFVAEGKELQRYNTAIRKVFLYGKKEALTNATFFSSTN 401
            +     L     + +  +KTI+    E K  + Y           +K A+      +S+N
Sbjct: 906  KTCIAELENELYKAIRCMKTIKCLQMENKVARSYEMLEVTSKGAARKRAMGTGFGVASSN 965

Query: 402  VLGDLSFLIVLAYGSHLVLQGGLTVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAAS 461
             L  ++  I+L +G  LV+ G  T G +   +    +T      L +   E+ +G  AA+
Sbjct: 966  ALTFITQSILLYFGMKLVITGEYTPGKMLETLTLLLFTIMTCMTLMSQVPEISRGQRAAT 1025

Query: 462  RLFEM-------------TDHAPSIKPTAGKPYVPGSGKISFKDVSFSYPTRPGNQIFNK 508
             LF++               HAP IK  + +        IS K + FSY       ++  
Sbjct: 1026 YLFKLFGNEHEEGASVLKERHAPIIKTCSKQTL------ISIKHLKFSYSNINNPMVYKN 1079

Query: 509  LNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRHLGV 568
            L+  ++ G  V ++G SG GKST+ SLL R Y   +G I+ID  DI++   K+LR  + V
Sbjct: 1080 LSLKVDRGEIVGLIGTSGSGKSTLWSLLTRLYPVENGSISIDGTDINQWDRKALRSCIAV 1139

Query: 569  VQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGASL 628
            V+Q+P+  SGSI  NLTYGL  +VS +E+  +        FV   P    ++I  +   L
Sbjct: 1140 VEQKPLFFSGSIIENLTYGLMRKVSDEEVNELLLTLGMLEFVNSTPKRLHSVIDTQ--LL 1197

Query: 629  SGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSK--ELTIISIAH 686
            SGGQ QR+AI RAL++KP++L+LDE TSALD       ++ + + +K      T + + H
Sbjct: 1198 SGGQVQRLAIVRALLRKPQLLVLDECTSALDARH----SFIMSEFVKHHLYHTTTLVVTH 1253

Query: 687  RLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQSELYKLLNDKKR 732
                +R    ++   N G +VE G   +L+ +Q+ ELY++L    R
Sbjct: 1254 SEQMMRSCHRILTF-NKGEIVEEGSIDNLF-NQKGELYRILTCNSR 1297

 Score =  170 bits (431), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 163/612 (26%), Positives = 277/612 (45%), Gaps = 38/612 (6%)

Query: 150 THDWKLLTFAIGLLAISSVIGMSIPKVIGMVLDAIKNTYSSATGPV--GLDDLPPIVNDL 207
           + DW LL     +++I SV    +P V  +++ A+ N       PV    D +  ++ DL
Sbjct: 23  SRDWWLLM----IISICSVAYGIVPAVTSILMGAVFNLLQK---PVIQQFDSVNTLMRDL 75

Query: 208 SMYEFLGIFAGALVIGTVAN----FGRIVLLRVLGEKLVARLRSNVIRKIIHQDAEFFDR 263
           +      I   A++I  +A+    +  I     LGE+   RLR  ++R    +   ++D 
Sbjct: 76  T------IRTMAILITGIASIPFCWLSIYAWMSLGERQGFRLRRKLLRSYFEKSMAWYDI 129

Query: 264 N-KVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTSALLMFAPP 322
           N ++    ++L+     +  S  +  +  F+               S SLT  ++M   P
Sbjct: 130 NEQISGEYTQLNRCVEELRSSSAEASAIIFQNLVTVIALLGTALYYSWSLT-LVIMANSP 188

Query: 323 LLIGALIYGKR-IRMISRDLQESTGNLTRVSEEQLSGVKTIQSFVAEGKELQRYNTAIRK 381
           L+IG  IY  R +    +     T     +    L+  K ++    +  E+ ++  ++ K
Sbjct: 189 LVIGFAIYCSRNVEKYGKIENSETSVAADIMAWSLNAAKMVRLLGTQDYEIAKFRASVLK 248

Query: 382 VFLYGKKEALTNATFFSSTNVLGDLSFLIVLAYGSHLVLQGGLTVGDLTAFMLYTEYTGS 441
             +   K +L ++  +S    L    F+    YG+  +  G L  GD+           S
Sbjct: 249 CRMNFNKMSLFSSLNYSILRFLTLCMFVQGFWYGNVRIKSGNLKPGDVMTCFSSCILLAS 308

Query: 442 AVFGLSNFYSELMKGAGAASRLFE-----MTDHAPSIKPTAGKPYVPGSGKISFKDVSFS 496
            +    +    L KGA    ++ E     +      +  +   P +    +ISF++VSF+
Sbjct: 309 TLNSTLHQVVTLQKGAVGLKKIQEFLTSDVVQGKECVVNSMHLPLLWEQAQISFENVSFA 368

Query: 497 YPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISR 556
           YP+R  + +   LN  +  G    IVG SG GKSTI++LLL+ Y P SG I ++D DI  
Sbjct: 369 YPSRSKHPVIKNLNLKVPGGRFTFIVGKSGSGKSTISNLLLKLYRPCSGLIKVNDVDIRE 428

Query: 557 LSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIR--SVAKKCFCHGFVTKFP 614
           ++ + L R + +V+Q   L   SIK N+   L S+   D+ R     +     G +    
Sbjct: 429 INQQDLFRSITLVEQNSPLFEDSIKNNIQ--LTSDEHRDDGRLSQACQAAMLEGVIRDLA 486

Query: 615 NGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLM 674
            G DTIIG  G  LSGG++QR+A+ARA ++   ILILDEA SA D   +  +   +    
Sbjct: 487 KGLDTIIGSSGVDLSGGEQQRVALARAFVRDSPILILDEALSAQDRMHKDLLMEAIRFWR 546

Query: 675 KSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQSELYKL----LNDK 730
           K +  T I + H L+ I   ++ ++L  DG+V+E G+  DL +D  S+   L    L D+
Sbjct: 547 KGR--TTIILTHELNDILE-DDFVLLMEDGNVIERGQKSDLLSDSTSKFSLLHAFQLCDE 603

Query: 731 KRDKPTPRVQSD 742
             D+ +    S+
Sbjct: 604 IEDEASTITDSN 615

>KLTH0B01100g Chr2 complement(94260..98156) [3897 bp, 1298 aa] {ON}
            similar to uniprot|P12866 Saccharomyces cerevisiae
            YKL209C STE6 ATP-binding cassette (ABC) transporter
            required for the export of a-factor catalyzes ATP
            hydrolysis coupled to a-factor transport contains 12
            transmembrane domains and two ATP binding domains
            expressed only in MATa cells
          Length = 1298

 Score =  173 bits (439), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 145/519 (27%), Positives = 238/519 (45%), Gaps = 33/519 (6%)

Query: 228  FGRIVLLRVLGEKLVARLRSNVIRKIIHQDAEFF--DRNKVGDLISRLSSD-------AY 278
            F +   L   GE  +  LR    + I +++  +F  ++N   ++ S + +D       A 
Sbjct: 791  FLKCFTLSKCGENWIRALRLRAFKNISNRELAWFNSEQNSTSNVSSLVINDLRDLRALAS 850

Query: 279  VVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTSALLMFAPPLLIGALIYGKRIRMIS 338
                ++T  V   F                 ISL  A ++F      GA  YG  ++   
Sbjct: 851  EFLAAVTTLVVVSFCGLIWALASGWKLSLVCISLIPAFILFT-----GA--YGGLLQKCE 903

Query: 339  RDLQESTGNLTRVSEEQLSGVKTIQSFVAEGKELQRYNTAIRKVFLYGKKEALTNATFFS 398
             + + +  ++       +  +KTI+    E + ++ Y     K  L G+K AL      +
Sbjct: 904  ANYKSAVASMEDQLYSAVRRIKTIRCLQVEERVIKEYEVLEGKAKLAGRKRALGTGFGVA 963

Query: 399  STNVLGDLSFLIVLAYGSHLVLQGGLTVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAG 458
             +N L  ++  I+L YG  LV+ G  +   +   +    +T      L     E+ +G  
Sbjct: 964  LSNALTLITQSILLYYGMKLVITGEYSSERMFQTLTLLLFTIMTCMSLIAQIPEISRGQR 1023

Query: 459  AASRLFEMTDHAPSIKPT--AGKPYVPGSGK-----ISFKDVSFSYPTRPGNQIFNKLNF 511
            AA+ LF + D           G+  +   G      I  KD+ FSY       ++  LN 
Sbjct: 1024 AATYLFRILDSETQFADANLEGESALTSRGCSNEALIFIKDLRFSYSFLNNPMVYRGLNL 1083

Query: 512  TIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRHLGVVQQ 571
            +++ G  V +VG SG GKST+  L+ R Y   SG I  D  D++     +LR+ + VV+Q
Sbjct: 1084 SVKAGETVALVGLSGSGKSTLWHLITRLYRVPSGSIWFDGLDVNEWEEWALRKRIAVVEQ 1143

Query: 572  EPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGG 631
             P L  GSI  NLTYGL + V   EIR + +      FV   P G  + I      LSGG
Sbjct: 1144 RPSLFRGSIFDNLTYGLSTSVDEREIRELLELVGMMDFVNSNPLGLQSFIDTD--VLSGG 1201

Query: 632  QKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMK--SKELTIISIAHRLS 689
            Q QR+AI RAL++KP++L+LDE TSALD +      + + + ++  S+  T + + H   
Sbjct: 1202 QLQRLAIVRALLRKPQLLVLDECTSALDAQH----GFIMSEFVRQGSQSTTTLVLTHSEQ 1257

Query: 690  TIRRSENVIVLGNDGSVVEVGKFKDLYADQQSELYKLLN 728
             +R    ++   N G+++E G F+ LY+ Q+ EL+K+L+
Sbjct: 1258 MMRACNRILTFAN-GNIIEDGSFERLYS-QKGELFKILS 1294

 Score =  155 bits (391), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 131/503 (26%), Positives = 229/503 (45%), Gaps = 19/503 (3%)

Query: 237 LGEKLVARLRSNVIRKIIHQDAEFFDRNK--VGDLISRLSSDAYVVSRSMTQNVSDGFKA 294
           LGE+   RLR  +++  + +   ++D N+   GD  ++L+     +  S  ++ +  F+ 
Sbjct: 99  LGERQAFRLRRKMLQSYLDKSMAWYDANEQISGDF-TQLNRCVEELRSSSAESSAIVFQN 157

Query: 295 XXXXXXXXXXXXXXSISLTSALLMFAPPLLIG-ALIYGKRIRMISRDLQESTGNLTRVSE 353
                         S SLT  ++M   PL+IG A+ + +++   ++     T +      
Sbjct: 158 VVTVAALLGSALYYSWSLT-LIIMANSPLVIGFAVFFSRKVEKYAKRENSETSSAADAMA 216

Query: 354 EQLSGVKTIQSFVAEGKELQRYNTAIRKVFLYGKKEALTNATFFSSTNVLGDLSFLIVLA 413
             L   K ++    + +EL R+   ++K   +  K +L ++  +S    L    F+    
Sbjct: 217 WSLDAAKMVRLLGTQDRELARFEACVQKCRQHFNKMSLFSSLNYSVLRFLTLCMFVQGFW 276

Query: 414 YGSHLVLQGGLTVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHAPSI 473
           YG+  +  G L  GD+           S +    +    L KGA    ++    +   + 
Sbjct: 277 YGNSRINIGKLKPGDVVTCFSSCVLLASTLNSTLHQIIILQKGAVGLQKIMAFVNSRDAS 336

Query: 474 KPTAGK--------PYVPGSGKISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPS 525
           +    K        P       I+F++V F+YPTRP + +   ++     G    ++G S
Sbjct: 337 ESQKNKVEISFRRLPLCWERASITFQNVHFAYPTRPDDFVLKGVSLDFPSGETTFVIGKS 396

Query: 526 GRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLT 585
           G GKSTI +LLL +Y   SG I ++ QD+  ++   L R++ +V+Q   L + ++  N+T
Sbjct: 397 GSGKSTIGNLLLGFYGIGSGTINVNGQDVKEINQSELARNIMLVEQTTSLFTETLANNVT 456

Query: 586 YGLQSEVSMDEIR--SVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALM 643
            G ++ V  DEIR     +       +     G +T IG  G  LSGG++QR+A+ARA  
Sbjct: 457 IG-EAGVDDDEIRLKQACQMAMLGNIIRDLAKGLETTIGCSGLDLSGGEQQRVALARAYF 515

Query: 644 KKPKILILDEATSALDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGND 703
           +   ILILDEA SA D   +  +   + K    K  T I + H LS I  ++ V V+ +D
Sbjct: 516 RNAPILILDEALSAQDRIHKSLLMEAIRKWRADK--TTIILTHELSDILDTDYVYVM-SD 572

Query: 704 GSVVEVGKFKDLYADQQSELYKL 726
           G + E G    L ++ +SE   L
Sbjct: 573 GQIREHGYKSGLLSNPKSEFSNL 595

>Ecym_3612 Chr3 (1167419..1171366) [3948 bp, 1315 aa] {ON} similar to
            Ashbya gossypii AFR432W
          Length = 1315

 Score =  173 bits (439), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 153/531 (28%), Positives = 254/531 (47%), Gaps = 59/531 (11%)

Query: 228  FGRIVLLRVLGEKLVARLRSNVIRKIIHQDAEFF--DRNKVGDLISRLSSDA----YVVS 281
            F +  +L V  E  +  LR   + +I +QD  +F  D NK  ++ + + +D     Y+VS
Sbjct: 808  FLKKFILSVCSELWIMSLRIKAMDRISNQDVHWFSLDINKPSEISALILNDLRDLRYLVS 867

Query: 282  RSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTSALLMFAPPLLIGAL-IYGKRIRMISRD 340
              ++   +  F +              S+   S +     PL IG   IYG  ++    D
Sbjct: 868  GFLSAVTTLIFVSAIGLAWAFVSGWKLSLVCISTI-----PLFIGVTGIYGGVLQKYETD 922

Query: 341  LQESTGNLTRVSEEQLSGVKTIQSFVAEGKELQRY--------NTAIRKVFLYGKKEALT 392
             + +   L     E + G+KT++    E     +Y        + + R+  + G   AL+
Sbjct: 923  YKTAVAELENNMFEFVKGIKTVRCLQLESHFSNKYTMLEEGMKHQSRRRAVVTGFGVALS 982

Query: 393  NATFFSSTNVLGDLSFLIVLAYGSHLVLQGGLTVGDLT---AFMLYTEYTGSAVFGLSNF 449
            NA       V+G  +  I+  YG  LV+ G  T  +L      +++T  T SA+      
Sbjct: 983  NAL------VIGVQA--ILYYYGIKLVVDGEYTPDNLLQTFTLLVFTIMTCSALMYEVPS 1034

Query: 450  YSELMKGAGAASRLFEMTDH-------------APSIKPTAGKPYVPGSGKISFKDVSFS 496
            +S   +G  AA+ +F + +               P  KP+   P       I  +D++F+
Sbjct: 1035 FS---RGRRAATYVFRILNTRSDFLSIDDDFRTEPIEKPSHMNPL------IRIQDLTFA 1085

Query: 497  YPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISR 556
            YP+    +++ KL+ TI  G N+ IVG SG GKST+  +L   Y  +   + IDD DI +
Sbjct: 1086 YPSALDVEVYKKLSLTINFGENLAIVGESGSGKSTMGLILCGLYPVNGNTVFIDDTDICK 1145

Query: 557  LSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNG 616
             +  SLR+H+ +V+Q+     GSI+ NL YGL   V+  +I  V        FV + P G
Sbjct: 1146 WNLSSLRKHISMVEQKAKFFDGSIRDNLIYGLDRIVTDSQIFEVLSLVGIADFVKELPQG 1205

Query: 617  YDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKS 676
             +T I      +SGGQ QRI+I RAL+++PK+LILDE TS+LD ++  AI   +G  +  
Sbjct: 1206 LNTRIDTN--LISGGQAQRISIGRALLRQPKLLILDECTSSLDAKNAQAIASLVGSSLYG 1263

Query: 677  KELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQSELYKLL 727
              +T I I H  + + +S N I+   +G + E G F++L +D + + Y+++
Sbjct: 1264 --ITTIVITHN-TQMMKSCNRILFFKNGRISEEGTFQEL-SDSRRDFYRMI 1310

 Score =  138 bits (348), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 134/535 (25%), Positives = 241/535 (45%), Gaps = 38/535 (7%)

Query: 236 VLGEKLVARLRSNVIRKIIHQDAEFFDRNK--VGDLISRLSSDAYVVSRSMTQNVSDGFK 293
           +LGE+   R+R  ++   + +   ++D N+   GD  +++      +  S  ++ +  F 
Sbjct: 101 LLGERQGFRVRRRLLGAYLSKTMAWYDTNENLEGDF-TQIHRGVEELRSSAAESSAVTFL 159

Query: 294 AXXXXXXXXXXXXXXSISLTSALLMFAPPLLIGALIYGKRIRMISRDLQESTGNLTRVSE 353
                          S SLT  +L   P ++  A+I+ K +   +      T +   +  
Sbjct: 160 NAVTVVTLLTTSLYFSWSLTLVILASTPLIIALAIIFSKLVEKYTELENTETSHAASILT 219

Query: 354 EQLSGVKTIQSFVAEGKELQRYNTAIRKV---FLYGKKEALTNATFFSSTNVLGDLSFLI 410
             +   + I+ F  E  ELQ+++ +++K    F+   K A  N    +S   L  + F+ 
Sbjct: 220 WSMEAPQLIRLFGTEQVELQKFSISVKKCSKFFINLSKYAAANQ---ASLRGLSLIMFVQ 276

Query: 411 VLAYGSHLVLQGGLTVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTD-H 469
              +G+ ++ +G L  G +          G+ +         + KG  A  ++  M +  
Sbjct: 277 GFWFGNTMIKRGKLNSGQVITCFSACILLGTTLNNTLQHIVIMQKGKVALQKILSMVESE 336

Query: 470 APSIKPTAGKPY----VPGSG---------KISFKDVSFSYPTRPGNQIFNKLNFTIEPG 516
           + +++   G+ +     P SG         +I+F++VSFSYP+RP     + ++ T  P 
Sbjct: 337 SDALRGRRGETFEIFPSPISGMFVSPVFPKQITFENVSFSYPSRPNEYALDNVSLTFYPE 396

Query: 517 SNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRHLGVVQQEPMLM 576
               IVG SG GKST+++LLL+ Y+   G I +   DI       L  ++ +V+Q   L 
Sbjct: 397 KITFIVGKSGSGKSTLSNLLLKLYSDYEGTIKVGTLDIRATKDSWLLENITLVEQSCTLF 456

Query: 577 SGSIKYNLTYGLQSEVSMD-EIRSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQR 635
           + S+  NL    + +   +  I+   +       +   P+G  T+IG  G SLSGGQ+QR
Sbjct: 457 NDSLLNNLLLTAKDDNKNEASIKRACQMALLEKLLFDLPDGLSTVIGSNGISLSGGQQQR 516

Query: 636 IAIARALMKKPKILILDEATSALDVESEGAI-----NYTLGKLMKSKELTIISIAHRLST 690
           +A+ARA+++   +LILDE+ SALD+     +     N+  GK       T I + H LS 
Sbjct: 517 VALARAILRDTPVLILDESISALDIIHRDLLMEVIRNWRAGK-------TTIILTHELSH 569

Query: 691 IRRSENVIVLGNDGSVVEVGKFKDLYADQQSELYKLLNDKKRDKPTPRVQSDPEK 745
           I   ++ + L  DG V E G  +DL +       +L N      P+  +++  EK
Sbjct: 570 I-LDDDYLYLMEDGKVGEHGYKRDLLSYTSGRFTELHNAVIPSDPSA-IEASHEK 622

>NCAS0G03510 Chr7 (652949..656815) [3867 bp, 1288 aa] {ON} Anc_1.527
          Length = 1288

 Score =  171 bits (433), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 147/532 (27%), Positives = 243/532 (45%), Gaps = 28/532 (5%)

Query: 215  IFAGALVIGTVANFGRIVLLRVLGEKLVARLRSNVIRKIIHQDAEFF--DRNKVGDLISR 272
            I  G  V   V+NF +  +L    E  +  LR+  +  I+++D  +F  D NK     S 
Sbjct: 763  IVLGVAVADGVSNFLKAYILGYCSENWIMDLRNEAMESILNKDLFWFSKDTNKS----SE 818

Query: 273  LSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSI----SLTSALLMFAPPLLIGAL 328
            LS+      R +   VS+   A              ++     L+   L   P ++  + 
Sbjct: 819  LSALLLNDLRDLRSLVSEFLSAMTTFMVVSLIGLIWALVSGWKLSLVCLSMFPLIIAFSA 878

Query: 329  IYGKRIRMISRDLQESTGNLTRVSEEQLSGVKTIQSFVAEGKELQRYNTAIRKVFLYGKK 388
            +YG  ++      + S   L     E ++G+KTI+S  AE   ++ Y+     +     K
Sbjct: 879  VYGTMLQKYETTYKTSVAALENQEYEIMTGIKTIRSLQAESHFIKNYSGLEHNMRAIAHK 938

Query: 389  EALTNATFFSSTNVLGDLSFLIVLAYGSHLVLQGGLTVGDLTAFMLYTEYTGSAVFGLSN 448
             ++      S TN++      I+  YG  LV +G  +   +        +T      L N
Sbjct: 939  RSIATGFGISVTNMITICIQSILYYYGIKLVFEGEYSSKKMFETFTLLLFTIMTCTSLVN 998

Query: 449  FYSELMKGAGAASRLFEMTDHAPS-----------IKPTAGKPYVPGSGKISFKDVSFSY 497
               ++ +G  +A+ L+ + D   +            +  A K     +  I  ++++F+Y
Sbjct: 999  QIPDISRGQRSATFLYRILDEGLASDESEFETHRKAEIVAPKQESKSNPLIKIQNLTFAY 1058

Query: 498  PTRPGNQIFNKLNFTIEPGS-NVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISR 556
            P+     ++  LN  +      + +VG SG GKST+  LL + Y  +   I +D  D++ 
Sbjct: 1059 PSETNVNVYEDLNLEMHASEKTIGLVGESGSGKSTLMYLLTKLYQVAPHSIYLDGTDVND 1118

Query: 557  LSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNG 616
                +LR  + VV+Q+P L  G+++ NL+YG+ +++   E+  + K    + FV   P G
Sbjct: 1119 WGLMNLRTQISVVEQKPTLFDGTVRENLSYGISTDILDMELFDMLKYVGIYEFVESLPFG 1178

Query: 617  YDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKS 676
             DT I  +   LSGGQ QRI IARAL++KPKILILDE TSALD  S   I   + K    
Sbjct: 1179 LDTRIDTK--LLSGGQAQRICIARALLRKPKILILDECTSALDALSANII-IDIVKNGPP 1235

Query: 677  KELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQSELYKLLN 728
              LTI+ I H    +R    + VL N G ++E G FK+L  +   EL K+++
Sbjct: 1236 ALLTIV-ITHSEKMMRACNTIAVLKN-GKIIEKGGFKEL-VNGNGELKKIID 1284

 Score =  134 bits (338), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 136/527 (25%), Positives = 243/527 (46%), Gaps = 51/527 (9%)

Query: 237 LGEKLVARLRSNVIRKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDG----- 291
           LGE+    +R  ++++ + +   ++D N        LS D   ++R + +  S       
Sbjct: 102 LGERQGFAVREKILQEYLTKPITWYDSN------DNLSGDFTQINRCVEELRSSSAEASA 155

Query: 292 --FKAXXXXXXXXXXXXXXSISLTSALLMFAPPLLIGALIYGKRIRMISRDLQESTGNLT 349
             F+               S SLT  +L  AP ++  A+ +   I   +      TG   
Sbjct: 156 IIFQNLVSILALIGTSFYYSWSLTLIILCTAPIIIAFAVFFSHMIHKYTELENTETGKAA 215

Query: 350 RVSEEQLSGVKTIQSFVAEGKELQRY-------NTAIRKVFLYGKKEALTNATFFSSTNV 402
           +++   +  ++ ++ +  + +E++ +       N    K  LY            ++T +
Sbjct: 216 QLANWAMDSIQLVKLYCTQFREVRNFRELTSNCNDLFIKCCLYVS----------ANTAL 265

Query: 403 LGDLS---FLIVLAYGSHLVLQGGLTVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGA 459
           L  LS   F+    +G+ +V +G L + ++          GS +         L KG  A
Sbjct: 266 LRFLSLSMFIQGFWFGATMVRKGKLQISNVVTCFQSCLMLGSTLSNTLQVIVILQKGDVA 325

Query: 460 ASRLFEMTDHAPSIKPTAGKP-YVPGS----GKISFKDVSFSYPTRPGNQIFNKLNFTIE 514
             ++      + S+   A +P Y P +      I+F +++FSYP+RP + +   ++   E
Sbjct: 326 LKKILGFL--STSVDHGADEPIYEPETPAELCTIAFNNITFSYPSRPSHPVLKNVSLCFE 383

Query: 515 PGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRHLGVVQQEPM 574
           P     I+G SG GKST+++LLL++Y+  +G IT+   D+  ++   L  ++ VV+Q   
Sbjct: 384 PTKFTFIIGKSGSGKSTLSNLLLKFYDDYNGTITVKGNDVKEINRNWLLNNVTVVEQRCT 443

Query: 575 LMSGSIKYNLTYGLQSEVSMDEIRSVAKK----C---FCHGFVTKFPNGYDTIIGPRGAS 627
           L + +++ N+  G+ S+  +++  S+ +K    C        V   P+G +TIIG  G S
Sbjct: 444 LFNDTLRNNILLGV-SKDQLEDHESIEQKLKDACSISMLDRLVCDLPHGLNTIIGSGGIS 502

Query: 628 LSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTIISIAHR 687
           LSGGQ+QR+AIARA M+   ILILDEA SALD+     +   + +    K  T I + H 
Sbjct: 503 LSGGQQQRVAIARAFMRNKPILILDEAVSALDIIHRELLMKNIRQWRSGK--TTILLTHE 560

Query: 688 LSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQSELYKLLNDKKRDK 734
           LS I   +   V+  +G V E G  KDL   + S    +LN +  ++
Sbjct: 561 LSQIEPDDYTYVI-QEGEVKENGYQKDLKQKKTSVFNHMLNLQTNNR 606

>CAGL0K00363g Chr11 complement(38281..41964) [3684 bp, 1227 aa] {ON}
            similar to uniprot|P12866 Saccharomyces cerevisiae
            YKL209c STE6
          Length = 1227

 Score =  169 bits (427), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 143/531 (26%), Positives = 238/531 (44%), Gaps = 51/531 (9%)

Query: 225  VANFGRIVLLRVLGEKLVARLRSNVIRKIIHQDAEFFD--------------------RN 264
            V+ F ++  L   GE  +  LR     KII     +F                     RN
Sbjct: 720  VSTFIKLFFLGYSGEFWIFELRQETFIKIIKNPISWFSKSNNKAPILSTLLINDLRDLRN 779

Query: 265  KVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTSALLMFAPPLL 324
             V + +S +++   V S  +   ++ G+K                  L+   +   P ++
Sbjct: 780  LVTEFLSVITTLILVTSIGLVWAIAIGWK------------------LSLVCIAIIPLVV 821

Query: 325  IGALIYGKRIRMISRDLQESTGNLTRVSEEQLSGVKTIQSFVAEGKELQRYNTAIRKVFL 384
            +   +YG  +       + S  NL  +  E + G+KTIQS   +    +++N  I+ +  
Sbjct: 822  VLTGLYGTILIKTENRYKTSVANLESIVYEAIIGMKTIQSLCLQQYITKKFNCKIKLLEK 881

Query: 385  YGKKEALTNATFFSSTNVLGDLSFLIVLAYGSHLVLQGGLTVGDLTAFMLYTEYTGSAVF 444
             G   A+      + TN+L  L   I+  YG  LVL G  T   L   +    +T   V 
Sbjct: 882  NGTYRAVATGLGIALTNMLVLLFQSILFYYGFKLVLTGEYTHSKLFETIALLLFTIVTVA 941

Query: 445  GLSNFYSELMKGAGAASRLFEMT--DHAPSIKP-----TAGKPYVPGSGKISFKDVSFSY 497
             L     ++ +G  + S + ++   D+  +I+P     T    + P    I   ++SF+Y
Sbjct: 942  SLVTQLPDITRGQRSISWIDQILKGDNQQTIEPPSNLSTTKGIWNPNQPVIEVSNLSFTY 1001

Query: 498  PTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRL 557
                  +    +N  +       IVG SG GKST+ +L+   Y+ S G I I   DI++ 
Sbjct: 1002 AQVHNKKTLTNINMQLYSNQIYGIVGKSGSGKSTLINLICGLYSLSEGSINICSCDINKW 1061

Query: 558  SCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGY 617
            S K L + + ++QQ P+L   +I+ NL YGL   V  + + +V +      F+    NG 
Sbjct: 1062 STKELHKTVALLQQNPVLQFDTIRNNLLYGLTETVGDEHLLNVLEYVGLKSFIISLNNGL 1121

Query: 618  DTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSK 677
            D+ +    + LSGGQ QR+ +AR +++ PK+LILDE TSALDV S   IN  +G   +S 
Sbjct: 1122 DSKLDD--SLLSGGQSQRLCMAREMLRNPKVLILDECTSALDVTSAKKINDIIGS--RSL 1177

Query: 678  ELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQSELYKLLN 728
                I ++H+  TI+  + +  L  DG+V  +G +++L  +   E  KLLN
Sbjct: 1178 APVTIIVSHQKETIKLCDKIFFLV-DGTVAMMGTYEEL-MENNWEFRKLLN 1226

 Score =  152 bits (385), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 115/398 (28%), Positives = 190/398 (47%), Gaps = 15/398 (3%)

Query: 309 SISLTSALLMFAPPLLIGALIYGKRI-RMISRDLQESTGNLTRVSEEQLSGVKTIQSFVA 367
           S SLT  +    P ++I A+I+ K I +   ++  ES     R++   L  ++ ++    
Sbjct: 172 SWSLTLIIFCSTPFIIICAVIFSKYIHKYTEKENTESECAAERLAW-MLKNIEFVRLHNG 230

Query: 368 EGKELQRYNTAIRKVFLYGKKEALTNATFFSSTNVLGDLSFLIVLAYGSHLVLQGGLTVG 427
           +  E+  Y   I +   Y  K +L  +   S   +L  L F+    +GS ++ QG L + 
Sbjct: 231 DDFEISMYTHYIAQANEYYIKASLFISANISILRLLSLLMFVQGFWFGSSMIKQGKLNID 290

Query: 428 DLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHAPS-----IKPTAGKPYV 482
            +          GS +         L KG  A  RL +M D  P      I   +G   +
Sbjct: 291 SVITSFHCCLMLGSIINSALGQAVVLQKGDVAMKRLLKMIDRTPRESLAFIDAISGIDLL 350

Query: 483 PGSGKISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNP 542
           P    I F +VSF YP R  +++F+K+NF I+P     ++GPSG GKST+  L+L +Y+ 
Sbjct: 351 P----IVFNNVSFCYPERKTDKVFDKMNFIIKPNKMTYVIGPSGSGKSTLFDLILLHYDN 406

Query: 543 SSGQITIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNL--TYGLQSEVSMDEIRSV 600
             G I + D DI  ++   +  ++ +V Q P L + +I+ N+       +  S  E+  +
Sbjct: 407 YHGSIMLGDLDIRSINRNIILENITLVSQTPTLFNDTIRNNILACSNWTNLPSKLEMECI 466

Query: 601 AKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDV 660
            K       + + P+G DT IG  G  LSGGQ Q++A+ARA  +   IL+LDE  SA+D+
Sbjct: 467 CKFALLENLIAELPDGLDTRIGSGGIKLSGGQAQKVALARAFARNTSILLLDEPLSAVDM 526

Query: 661 ESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSENVI 698
                +   + +    K  T + I H L  IR ++N++
Sbjct: 527 RQRIVLMENIKRWRNGK--TTVIITHDLEFIRNTDNIL 562

>TDEL0E05610 Chr5 (1038912..1043519) [4608 bp, 1535 aa] {ON} Anc_4.52
            YLL015W
          Length = 1535

 Score =  169 bits (427), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 156/561 (27%), Positives = 263/561 (46%), Gaps = 56/561 (9%)

Query: 209  MYEFLGIFAGALVIGTVANFGR-IVLLRVLGEKLVARLRSNVIRKIIHQDAEFFDRNKVG 267
            +++F+GI+A   V     N  R IVLL     +  A+L   + + ++     FF+   VG
Sbjct: 993  VWKFVGIYAAIGVFSAAFNNLRTIVLLLFCTIRGAAQLHDTMAKTVLRSPMSFFETTPVG 1052

Query: 268  DLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTSALLMFAPPLLIGA 327
             +I+R SSD   V  ++    +  F++               IS      +    +L+  
Sbjct: 1053 RIINRFSSDVQAVDSTLQWVFAFFFRSILNYAVTVIL-----ISYNMPWFLIVNAVLLII 1107

Query: 328  LIYGKRIRM-ISRDLQE----STGNLTRVSEEQLSGVKTIQSFVAEGKELQRYNTAIRKV 382
             IY +   + +SR+L+     ST  +  +  E L G   I +F    K   R++      
Sbjct: 1108 YIYYQAFYITLSRELKRLTSVSTSPIMSLFSETLGGHAVINAF----KHFDRFD------ 1157

Query: 383  FL-YGKKEALTNATF-FSSTNV-----LGDLSFLIVLAYG----SHLVLQGGLTVGDLTA 431
            F+ +   +   N +F F STN      L  +   IVLA      S +  +  L+ G +  
Sbjct: 1158 FINFNNVQFNINCSFNFRSTNRWLSVRLQTIGAFIVLATALLALSTINSERRLSPGMVGL 1217

Query: 432  FMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFE---MTDHAPS-IKPTAGKPYVPGSGK 487
             M Y     S++  +     ++     +  R++E   +T  AP  I+    K   P  G+
Sbjct: 1218 LMSYALQVTSSLMWIVRMSVQIETNIVSVERIYEYCNLTPEAPEVIESCRPKKTWPSEGE 1277

Query: 488  ISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQI 547
            I FK+ S  Y T+ G+     +N +I+P   + +VG +G GKST++  L R    + G I
Sbjct: 1278 IIFKNYSTKYKTK-GDLALKGINLSIKPQEKIGVVGRTGAGKSTLSLALFRLLEATEGTI 1336

Query: 548  TIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNL-------TYGLQSEVSMDEIRSV 600
             ID  DIS++  K LR HLG++ Q+     G+++ NL       T  L + + +  ++  
Sbjct: 1337 EIDGLDISKMGLKDLRSHLGIIPQDAQAFEGTVRSNLDPFEQYSTEELWASIELSHLKPH 1396

Query: 601  AKKCFCHGFVTKFPNG----YDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATS 656
              + F     ++ P       D  I   G +LS GQ+Q + ++RAL+   K+L+LDEAT+
Sbjct: 1397 IVEMFRKEDNSELPASKEKMLDVKISENGGNLSVGQRQLLCLSRALLNTSKVLVLDEATA 1456

Query: 657  ALDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLY 716
            A+D+E++  I  T+   +K K  TI++IAHR+ T+  S+ +IVL + G V E    ++L 
Sbjct: 1457 AVDMETDKIIQETIRSELKEK--TILTIAHRIDTVLDSDKIIVL-DAGQVKEFDTPENLL 1513

Query: 717  ADQQSELYKLLN-----DKKR 732
            +++QS  Y L       DKKR
Sbjct: 1514 SNKQSIFYALCEKGGYLDKKR 1534

 Score = 96.7 bits (239), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 103/410 (25%), Positives = 194/410 (47%), Gaps = 46/410 (11%)

Query: 350 RVSEEQLSGVKTIQSFVAEGKELQRYNTAIRKVFL--YGKKEALTNATFFSSTNV--LGD 405
           + + E L+ +K+I+ +  E   L+R +     + L  Y +   ++N  +F+   V  +  
Sbjct: 464 KTTTEILNSMKSIKLYAWEEAMLKRLDHVRNGLELENYKRIGVVSNLIYFAWNCVPLMVT 523

Query: 406 LSFLIVLAYGSHLVLQGGLTVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFE 465
            S   + ++ +   L   +    L+ F +  +    A++ L N  + +++   + +R+ E
Sbjct: 524 CSTFAIFSFFNKTPLSPEVVFPSLSLFNILND----AIYSLPNTINSIIETKVSINRIKE 579

Query: 466 M------------TDHAPS--IKPTA---GKPYVPGSGKISFKDVSFSYPTRPGNQI-FN 507
                         D  PS  + P        ++  S KI F + S        +Q+   
Sbjct: 580 FLLSEELDDSFIEIDKTPSDKVSPVVEIINATFLWKSPKILFSEGSDEESRIESSQVALE 639

Query: 508 KLN-FTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRH- 565
            +N F  + G   CIVG  G GKST+   +L       GQ+   +  +  L  K L R  
Sbjct: 640 NINGFQAKKGELTCIVGRVGSGKSTMLRAIL-------GQLPCVNASVGGLEPKVLIRAS 692

Query: 566 -LGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPR 624
            +    QEP +M+ SIK N+T+G + + +     +  K C     +   P   +T++G +
Sbjct: 693 TVAYCPQEPWIMNASIKDNITFGFRYDETY--YNATIKACQLLPDLDILPERDNTLVGEK 750

Query: 625 GASLSGGQKQRIAIARALMKKPKILILDEATSALDVE-SEGAINYTLGK---LMKSKELT 680
           G SLSGGQK RI++ARA+  +  + +LD+  SA+D E S+  +   L K   L+++K  T
Sbjct: 751 GISLSGGQKARISLARAVYSRADLFLLDDILSAVDAEVSKNIVEMVLDKKMGLLRNK--T 808

Query: 681 IISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYAD-QQSELYKLLND 729
           ++   + +S + RS+ + +L   GS+VE G F ++ +  + S+L K++++
Sbjct: 809 VVLTTNAISVLNRSQKIYML-EGGSIVEEGSFTEVTSSPEPSKLKKMIDE 857

>SAKL0H26026g Chr8 (2287664..2292625) [4962 bp, 1653 aa] {ON} similar
            to uniprot|P32386 Saccharomyces cerevisiae YLL048C
          Length = 1653

 Score =  168 bits (426), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 183/681 (26%), Positives = 310/681 (45%), Gaps = 84/681 (12%)

Query: 112  ESQAKTPADKESQKSG--TMEDEESPNMGYKEVIRLFKLATHDWKLLTFA--IGLLAISS 167
            +S+ K  +D+E  K+G   ME+ +S  +   EV + F      WK++ F   I ++A S 
Sbjct: 972  DSKKKLQSDEERAKAGKLIMEETKSDGVVSIEVYKWFARLFGGWKMILFLAFIFIVAQSV 1031

Query: 168  VIGMS--------------IPKVIGMVLDA-IKNTYSSATGPVG---------LDDLPPI 203
             IG S              I  VIG VL + + +T+    G +          ++++ P+
Sbjct: 1032 YIGQSWWVRTWASHNIPAAITAVIGKVLPSHMASTFLPLRGIITSYTFVPESPVENITPL 1091

Query: 204  -VNDLSMYEFLGIFAGALVIGTVANFGRIVLLRVLGEKLVARLRSNVIRKIIHQDAEFFD 262
              N  S   +L I+    V+  V    + ++  + G     ++ + V++K+++    FFD
Sbjct: 1092 KTNAHSTLYYLAIYFAIGVLHAVIASSKTIINFIAGLNASRKIFNLVLKKVLYAKLRFFD 1151

Query: 263  RNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTSALLMFAPP 322
               +G +++R S D   V + +T  V   F +                 +T   L+ A  
Sbjct: 1152 STPIGRIMNRFSKDIEAVDQELTPFVEGAFVSLVQCLSTVILIAY----ITPGFLVVA-- 1205

Query: 323  LLIGALIY--GKRIRMISRDLQE----STGNLTRVSEEQLSGVKTIQSFVAEGK----EL 372
            + IG L Y  G      SR+L+     S   + +   E L G+ TI++F  E +     L
Sbjct: 1206 IFIGFLYYLVGYFYMAGSRELKRFESVSRSPIHQHFSETLVGITTIRAFGDERRFMLENL 1265

Query: 373  QRYNTAIRKVFLYGKKEALTNATFFSSTNVLGDLSFLIVLAYGSHLVLQ-----GGLTVG 427
            Q+ +    K F Y     + N       +++G     +V A G  ++L       GL   
Sbjct: 1266 QKIDEN-NKPFFY---LWVANRWLAFRIDMIGAC---VVFAAGVFILLNIKKLDSGLAGI 1318

Query: 428  DLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFE--MTDHAPSIKPTAGKPY-VPG 484
             LT  + +TE        L   YS +     +  RL E  + +  PS       P   P 
Sbjct: 1319 SLTYAISFTE----GALWLVRLYSNVEMTMNSVERLKEYMVIEQEPSNDGAFNPPIEWPD 1374

Query: 485  SGKISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSS 544
             GKI   D+S  Y T     I N ++FT++P   V IVG +G GKSTI + L R+ +P +
Sbjct: 1375 QGKIEVNDLSLRYATNLPRVIKN-VSFTVDPKCKVGIVGRTGAGKSTIITALFRFLDPET 1433

Query: 545  GQITIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLT-YGLQSE------------ 591
            G I ID+ DI+ +  K LR+ + ++ Q+P L SG++K NL  Y   ++            
Sbjct: 1434 GHIKIDNVDITSIGLKRLRQSITIIPQDPTLFSGTVKSNLDPYDEYTDEQIFKALKRVNL 1493

Query: 592  VSMDEIRSVAKKCFCHGFVTKFPNGYDTI---IGPRGASLSGGQKQRIAIARALMKKPKI 648
            V+ DE+  V          ++  N +  +   I   GA+LS GQ+Q + +AR+L++ PKI
Sbjct: 1494 VTADELDHVPDSADNASVNSENVNKFLDLRNEITEGGANLSQGQRQLVCLARSLLRSPKI 1553

Query: 649  LILDEATSALDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVE 708
            ++LDEAT+++D  S+  I  T+ +  +  + TI++IAHRL +I   + ++V+ + G V E
Sbjct: 1554 ILLDEATASIDYSSDAKIQQTIRE--EFGDSTILTIAHRLRSIIDYDKILVM-DAGEVRE 1610

Query: 709  VGKFKDLYADQQSELYKLLND 729
                  L  ++ S  Y +  D
Sbjct: 1611 YDHPYSLLLNKSSIFYSMCED 1631

 Score = 80.5 bits (197), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 94/388 (24%), Positives = 179/388 (46%), Gaps = 40/388 (10%)

Query: 354 EQLSGVKTIQSFVAEGKELQRYNTAIR----KVFL-YGKKEALTNATFFSSTNVLGDLSF 408
           E    ++ I+ F  E +  +R   AIR    K+ L      AL +  +F + +++  +SF
Sbjct: 562 ETFQSIRIIKFFSWE-ENFERDIKAIRTEELKILLKRSIVWALMSLVWFITPSIVTSVSF 620

Query: 409 LIVLAYGSHLVLQGGL--TVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEM 466
                   ++ +QG +  T    TA  L+T    + +  LS+  S +++   +  R+ E 
Sbjct: 621 ------AFYIYVQGEVLTTPIAFTALSLFT-LLRNPLDQLSDMLSFVIQSKVSLDRVQEF 673

Query: 467 TDHAPSIKPTAGKPYVPGSGKISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSG 526
            D   + K            KI+F++ +F++  +  +     LN   + G    ++G +G
Sbjct: 674 LDEEETEKYNQ---LTISRNKIAFENATFAWDKKNPSFKLKNLNVEFKLGKLNVVIGSTG 730

Query: 527 RGKSTITSLLLRYYNPSSGQI---TIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYN 583
            GK+++   LL   +   G++   ++D ++   +    +   +    Q   L++ +++ N
Sbjct: 731 SGKTSLLMGLLGEMDLIEGKVYVPSLDPREELVIESDGMTNSIAYCSQAAWLLNDTVRNN 790

Query: 584 LTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALM 643
           + +   S  +    ++V + C           G  T IG +G +LSGGQKQR+++ARAL 
Sbjct: 791 ILFN--SPYNETRYKAVVEACGLKRDFEILSAGDQTEIGEKGITLSGGQKQRVSLARALY 848

Query: 644 KKPKILILDEATSALDVESEGAI--NYTLGKLMKSKELTIISIAHRLS-TIRRSENVIVL 700
              + ++LD+  SA+D  +   I  N   G LM+ +  T I ++H ++ T++ +E V+VL
Sbjct: 849 SSSRHVLLDDCLSAVDSHTALWIYENCITGPLMQGR--TCILVSHNVALTLKNAEWVVVL 906

Query: 701 GNDGSVVEVGKFKDLYADQQSELYKLLN 728
            N       G+ KD     Q E   LLN
Sbjct: 907 DN-------GRIKD-----QGEPLDLLN 922

>AFR432W Chr6 (1213211..1217065) [3855 bp, 1284 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YKL209C (STE6)
          Length = 1284

 Score =  167 bits (424), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 138/511 (27%), Positives = 238/511 (46%), Gaps = 15/511 (2%)

Query: 225  VANFGRIVLLRVLGEKLVARLRSNVIRKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSM 284
            V NF ++ LL  + E+ V +LR N+++ ++ +D  +  +NK  ++ +   +D   +    
Sbjct: 776  VFNFLQLFLLGFVSEQCVRQLRGNMMQLVLKRDLHWISQNKSSEITALTMNDLRDLRNVT 835

Query: 285  TQNVSDGFKAXXXXXXXXXXXXXXSISLTSALLMFAPPLLIGAL-IYGKRIRMISRDLQE 343
            +  +S                      LT   L   P L IG + +YG  ++      + 
Sbjct: 836  SILLSSLTSLCVLASVGLIWAIVIGWKLTLVCLSLLP-LFIGVITLYGMFVQKSEVQYKT 894

Query: 344  STGNLTRVSEEQLSGVKTIQSFVAEGKELQRYNTAIRKVFLYGKKEALTNATFFSSTNVL 403
            +   L  +  E + GVKTI+    E     RY T  + +    ++ ++   +  + T+ L
Sbjct: 895  AVSQLENLLSEIVKGVKTIKCLQLEPYFQGRYATMEKYLKKQMRRRSILYGSGLAITSCL 954

Query: 404  GDLSFLIVLAYGSHLVLQGGLTVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRL 463
              L   I+  YG  LV+ G      L        +T  +  GL +      +G  A + +
Sbjct: 955  VILLQTILYYYGIRLVVTGEYDSKQLFQTFTLILFTTMSSVGLLSALPSSSRGQRAGTFV 1014

Query: 464  FEMT-------DHAPSIKPTAGKPYVPGSGKISFKDVSFSYPTRPGNQIFNKLNFTIEPG 516
            F M        D+  ++   A   +      +  + ++F+YP     QI+   N  I  G
Sbjct: 1015 FGMLEEPLPEPDNYSAVLRKAPTNHFSREPLVVLRALNFAYPAAKDVQIYKNFNLRINQG 1074

Query: 517  SNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRHLGVVQQEPMLM 576
            + V IVG SG GKST+  L+   Y      + ID  DI      +LR+ + VV+Q+P   
Sbjct: 1075 TKVAIVGESGSGKSTLFYLICGLYPVKPASLFIDGTDICNWEMSALRKIIAVVEQKPRFF 1134

Query: 577  SGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRI 636
            +G+I+ NL YGL+  ++ +EI  V  +     FV   P G +T +      +SGGQ QR+
Sbjct: 1135 NGTIRENLVYGLEGTITDNEIYEVLAEVRIINFVRSLPEGLETRVDTN--LVSGGQLQRL 1192

Query: 637  AIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSEN 696
            +I RAL+++P +LILDE TSALD  +  AI   +   +   ++T+I I H    ++  + 
Sbjct: 1193 SIVRALLRRPTLLILDECTSALDAANANAIANVVRNSL--HDITVIVITHSKQMMKMCDR 1250

Query: 697  VIVLGNDGSVVEVGKFKDLYADQQSELYKLL 727
            ++VL N G+V E G F DL+   + EL++++
Sbjct: 1251 IVVLKN-GAVAEDGSFDDLF-RARGELHRMV 1279

 Score =  126 bits (317), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 133/556 (23%), Positives = 246/556 (44%), Gaps = 26/556 (4%)

Query: 236 VLGEKLVARLRSNVIRKIIHQDAEFFDR----NKVGDLISRLSSDAYVVSRSMTQNVSDG 291
           +LGE+   R+R  ++R  + +  +++D+    N +  + +R   +A     S  +     
Sbjct: 97  LLGERQSLRIRRELLRSYLAKPMQWYDKIDDINGMYTITNRCVEEA---RASCAEASGVL 153

Query: 292 FKAXXXXXXXXXXXXXXSISLTSALLMFAPPLLIGALIYGKRIRMISRDLQESTGNLTRV 351
           F++              S  LT   L  AP L +  +++ K ++  +    E T + +  
Sbjct: 154 FQSAVTALILAVTAFKFSAKLTVVTLAGAPLLALLTVVFSKFVQKYAALENEQTSSASST 213

Query: 352 SEEQLSGVKTIQSFVAEGKELQRYNTAIRKVFLYGKKEALTNATFFSSTNVLGDLSFLIV 411
               L+    ++ F  +  EL+++N A+     Y  +  + ++   ++   L  + F+  
Sbjct: 214 LSWALNSATMVKLFGTQDLELRKFNKAVNLSKKYFVRTLICSSINQAAMRFLSLMMFVQA 273

Query: 412 LAYGSHLVLQGGLTVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHAP 471
             YGS L+ +  +    +      +    S++  + +    L KG  A  ++ E  +  P
Sbjct: 274 FWYGSILIQRDEVETAAVITVFSASVLLSSSINAMLSKVVLLQKGKVACRQIAEAVNVEP 333

Query: 472 SIKPTA-GKPYVPGS--------GKISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIV 522
             +P     PY  G          +I F  VSF+YP RP  +  + ++ T  P     IV
Sbjct: 334 EGRPNQYAFPYEVGHIIALEDQPSEIVFDQVSFNYPARPDTKALDGVSLTFRPNQITFIV 393

Query: 523 GPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKY 582
           G SG GKST+ +LLL++Y+   G IT++  ++  +    L +++ +V+Q   L +G++  
Sbjct: 394 GKSGSGKSTLGNLLLKFYSDYEGIITVNSTNLRGIDRSWLLQNITLVEQSCTLFNGTLFE 453

Query: 583 NLTYGLQS-EVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARA 641
           N+T   +    +   ++   +       V   P G  T +G  G S+SGGQ+QR+A+ARA
Sbjct: 454 NITLSAKPVNKTAGAVKRACQMALLEKLVFDLPEGLHTKVGSGGISMSGGQQQRVALARA 513

Query: 642 LMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLG 701
           +++   +LILDEA SALD+     +   +      K  T I + H LS +   ++ + + 
Sbjct: 514 ILRDAPVLILDEAISALDIIHRDLLMEVIRSWRADK--TTIILTHELSHV-LDDDYLYMM 570

Query: 702 NDGSVVEVGKFKDLYADQQSE---LYKLLNDKKRDKPTPRVQSDPEKDREQEHQIDNQVR 758
             G V+E G   +L ++  S    L +L N K       R     E   EQE   D+ + 
Sbjct: 571 EHGQVIEQGYKSELLSNPNSRFRALNRLQNSKNERALEERRSFAIENKLEQE---DDAIS 627

Query: 759 EQVANDFNLDQKSSKL 774
              A D   D   S++
Sbjct: 628 STSAGDDKFDTIGSRI 643

>ZYRO0G07612g Chr7 complement(601181..606268) [5088 bp, 1695 aa] {ON}
            similar to uniprot|P32386 Saccharomyces cerevisiae
            YLL048C
          Length = 1695

 Score =  167 bits (422), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 175/687 (25%), Positives = 302/687 (43%), Gaps = 105/687 (15%)

Query: 112  ESQAKTPADKESQKSGTMEDEESPNMG------YKEVIRLFKLATHDWKLLTFAIGLLAI 165
            ES      D+E +K+G +  +E+   G      YK  +++F      WK L+F +     
Sbjct: 1017 ESTKPQQTDEERKKAGKLVKDETKAEGVVGLEVYKWYLKIFG----GWKTLSFLVSAFVF 1072

Query: 166  SSVIGMSIPKVIGM-----------VLDAIKNTYSSATGPVG-LDDLPPIVNDL------ 207
            +   GM I +   +           +    +N  S+     G +D     V +L      
Sbjct: 1073 AQ--GMYIGQSWWVRDWASHNMNSTIFAFRENLVSAGFHTFGRVDAFVHYVAELPNRVAV 1130

Query: 208  ----------SMYEFLGIFAGALVIGTVANFGRIVLLRVLGEKLVARLRSNVIRKIIHQD 257
                      SM+ +L I+       +V +  + +L  V G     ++ + +++K++H  
Sbjct: 1131 ATGAEPVGPHSMFYYLAIYFLIGFAQSVLSAFKTILSFVAGLNASKKIFNLLLQKVLHAK 1190

Query: 258  AEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTSALL 317
              FFD   +G +++R S D   V + +T      F +               +S    + 
Sbjct: 1191 LRFFDSTPIGRIMNRFSKDIEAVDQELTPFFEGAFYSLVT-----------CLSTVVLIT 1239

Query: 318  MFAPPLLIGALIYGKRIRMI-------SRDLQE----STGNLTRVSEEQLSGVKTIQSFV 366
               P  LI A+I       I       SR+L+     S   + +   E L GV TI++F 
Sbjct: 1240 FITPQFLIVAVIVAVLYYFIGYFYLAGSRELKRLDSISRSPIYQHFSETLVGVTTIRAFG 1299

Query: 367  AEGKELQRYNTAI---RKVFLYGKKEALTNATFFSSTNVLGDLSFLIVLAYGSHLVLQ-- 421
             E + +Q     I    + F Y     + N       +++G L   +V   G  ++L   
Sbjct: 1300 DESRFIQENLHKIDENNRPFFY---LWVANRWLAMRIDLIGSL---VVFGAGVFILLNID 1353

Query: 422  ---GGLTVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFE--MTDHAPSIKPT 476
                G+    LT  + +TE        L   YS +     +  RL E  + +  P  +P 
Sbjct: 1354 HIDAGMAGISLTYAITFTE----GALWLVRLYSNVEMNMNSVERLKEYMVVEQEPYNQPI 1409

Query: 477  AGKPY-VPGSGKISFKDVSFSY-PTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITS 534
               P   P  G++   DVS  Y P  P  ++   ++FT+EP S V +VG +G GKSTI +
Sbjct: 1410 MTPPSDWPQHGRVEMSDVSLRYAPGLP--RVIKNVSFTVEPKSKVGVVGRTGAGKSTIIT 1467

Query: 535  LLLRYYNPSSGQITIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLT-YGLQSE-- 591
             L R+ +P +G I ID+ DIS +  + LRR + ++ Q+P L +G+IK NL  Y   S+  
Sbjct: 1468 ALFRFLDPETGHIKIDNVDISLIDLQMLRRSITIIPQDPTLFTGTIKSNLDPYDEYSDED 1527

Query: 592  ----------VSMDEI--RSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIA 639
                      VS +E+   ++         V KF +  ++ I   G +LS GQ+Q + +A
Sbjct: 1528 IFAALKRVNLVSQEELDRSNIDAASVGSENVNKFLD-LNSEINEGGGNLSQGQRQLVCLA 1586

Query: 640  RALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSENVIV 699
            R+L++ PKI++LDEAT+++D +S+  I  T+ K  +    TI++IAHRL ++   + ++V
Sbjct: 1587 RSLLRSPKIILLDEATASIDYQSDAKIQETIRKEFQGN--TILTIAHRLRSVIDYDKILV 1644

Query: 700  LGNDGSVVEVGKFKDLYADQQSELYKL 726
            + + G V E      L  ++ S+ Y +
Sbjct: 1645 M-DQGEVKEYDHPYSLLLNKNSQFYSM 1670

 Score = 92.4 bits (228), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 66/233 (28%), Positives = 112/233 (48%), Gaps = 9/233 (3%)

Query: 483 PGSGKISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNP 542
           PG  K+ F++ + S+ +   +     LN   + G    ++GP+G GK++I   LL     
Sbjct: 741 PGGQKLGFENATISWDSEKQDFKLRNLNIDFKVGKLNVVIGPTGSGKTSILMALLGEMKL 800

Query: 543 SSGQITI---DDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRS 599
            +G I +   D + +  +    +   +    Q   L++ +++ N+ +   S  S      
Sbjct: 801 LNGNIVVPSLDPRALLPIDADGMTNSIAYCSQAAWLLNDTVRNNILFN--SPYSEARYND 858

Query: 600 VAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALD 659
           V + C           G  T IG RG +LSGGQKQRI++AR+L    + L+LD+  SA+D
Sbjct: 859 VIEACGLKRDFEILSAGDMTEIGERGITLSGGQKQRISLARSLYSNSRHLLLDDCLSAVD 918

Query: 660 VESEGAI--NYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVG 710
             +   I  N   G LM+ +  T I I+H ++   R+  ++VL  +G V E G
Sbjct: 919 SHTASWIYDNCITGPLMQGR--TCILISHNIALTLRNAELVVLLENGQVKEQG 969

>Ecym_4265 Chr4 (560254..564771) [4518 bp, 1505 aa] {ON} similar to
            Ashbya gossypii AGR047W
          Length = 1505

 Score =  166 bits (421), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 150/537 (27%), Positives = 248/537 (46%), Gaps = 32/537 (5%)

Query: 209  MYEFLGIFAGALVIGTVANFGR-IVLLRVLGEKLVARLRSNVIRKIIHQDAEFFDRNKVG 267
            ++++LGI+       +++   R I L      K  ARL   + + ++     FF+   VG
Sbjct: 980  IWKYLGIYFLLCFSASLSTLLRSITLCMFCTIKASARLHDAMAKAVLRAPMSFFETTPVG 1039

Query: 268  DLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTSALLMFAPPLLIGA 327
             +++R S+D Y V   + ++ S  F                  S+T   + F  PL +  
Sbjct: 1040 RILNRFSNDIYKVDELLGRSFSQFF----IHVTKVVFTMIVICSITWQFIFFILPLSVLY 1095

Query: 328  LIYGKRIRMISRDLQESTGNLTRVS-----EEQLSGVKTIQSFVAEGKELQ----RYNTA 378
            L Y +     SR+L+    ++T+       +E L+GV T++SF  + + +     R NT 
Sbjct: 1096 LFYQQYYLRTSRELRR-LASVTKSPVYAHFQETLTGVTTVRSFKKQDRFIHINQSRINTY 1154

Query: 379  IRKVFLYGKKEALTNATFFSSTNVLGDLSFLIVLAYGSHLVLQGGLTVGDLTAFMLYTEY 438
            +   +L        N         +G +  L         + QG LT G L   + Y   
Sbjct: 1155 MCAYYL----SINANRWLAFRLEFMGSIVILAAAVLSVFRLKQGKLTAGMLGLGLSYALQ 1210

Query: 439  TGSAVFGLSNFYSELMKGAGAASRLFEMTD---HAPSIKPTAGKPY-VPGSGKISFKDVS 494
               ++  +     E+     +  R+ E TD    AP I PT+  P   P +G I F+  S
Sbjct: 1211 ITQSLNWIVRMTVEVETNIVSVERIKEYTDLKPEAPMIIPTSRPPKNWPANGDIKFEHFS 1270

Query: 495  FSYPTRPG-NQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQD 553
              Y  RP  + I   +N  I P   V IVG +G GKS++T  L R    ++G+I IDD  
Sbjct: 1271 TRY--RPELDLILEDINLHIHPREKVGIVGRTGAGKSSLTVSLFRLIEAAAGRILIDDLP 1328

Query: 554  ISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKF 613
            I  +    LR  L ++ Q+  +  G+ + N+     ++ + DEI +  +       V   
Sbjct: 1329 IDSIGLNDLRSSLSIIPQDSEVFEGTFRENIDPC--NKFTDDEIWNALELAHLKQHVMTL 1386

Query: 614  -PNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGK 672
               G +T +   G++LS GQ+Q + +ARAL+   KIL+LDEAT+A+DVE++  I  T+  
Sbjct: 1387 GTEGLNTSLKEGGSNLSVGQRQLMCLARALLVPSKILVLDEATAAIDVETDKLIQRTIRT 1446

Query: 673  LMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQSELYKLLND 729
              K +  TI++IAHRL+TI  S+ ++VL + G + E     +L  D+ S  Y L N+
Sbjct: 1447 AFKDR--TILTIAHRLNTIMDSDKIVVL-DKGRIAEFDTPCNLLKDETSIFYSLCNE 1500

 Score = 95.9 bits (237), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 74/263 (28%), Positives = 129/263 (49%), Gaps = 27/263 (10%)

Query: 480 PYVPGSGKISFK---DVSFSYPTRPGNQI-FNKLNFTIEPGSNVCIVGPSGRGKSTITSL 535
           P V   G IS     D ++ +  +P  ++    +NF    G   CIVG  G GKS +   
Sbjct: 604 PKVEEIGDISVNISGDATYLWQRQPEYKVALKNINFQARKGELSCIVGKVGTGKSALIQA 663

Query: 536 LLRYYNPSSGQITIDDQDISRLS-CKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSM 594
           +L               D+ R+    +L   +  V Q   +M+G+IK N+ +G + +   
Sbjct: 664 ML--------------GDLFRVKGSATLHGSVAYVSQVSWIMNGTIKDNILFGYKYDAEF 709

Query: 595 DEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEA 654
            E     K C     +   P+G  T +G RG SLSGGQK R+A+ARA+  K  +  LD+ 
Sbjct: 710 YE--KTIKACALSLDLNTLPDGDQTFVGERGISLSGGQKARLALARAVYAKADVYFLDDP 767

Query: 655 TSALDVE-SEGAINYTLGK--LMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGK 711
            +A+D   S+  + Y +G   L+K+K  T I   +++  +  ++++ +L N G +V+ G 
Sbjct: 768 LAAVDEHVSKHLVKYVIGPTGLLKTK--TRILTTNKIHVLSVADSITLLDN-GVIVQQGS 824

Query: 712 FKDLYADQQSELYKLLNDKKRDK 734
           +  + +++ S L+KL+ +  + K
Sbjct: 825 YDQVNSNKDSPLFKLIANFGKQK 847

>NCAS0J00160 Chr10 complement(12361..17325) [4965 bp, 1654 aa] {ON} 
          Length = 1654

 Score =  165 bits (417), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 153/552 (27%), Positives = 257/552 (46%), Gaps = 55/552 (9%)

Query: 207  LSMYEFLGIFAGALVIGTVANFGRIVLLRVLGEKLVARLRSNVIRKIIHQDAEFFDRNKV 266
            LS+Y  +GI A AL +G++    ++++   LG K   ++  ++++K++H    FFD   +
Sbjct: 1109 LSIYFLIGI-AQAL-LGSL----KVLINFFLGVKASRKIFIDLLKKVMHSKLRFFDSTPI 1162

Query: 267  GDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSIS-LTSALLMFAPPLLI 325
            G +++R S D   + + +   V   F +              +   L+ A+L+     LI
Sbjct: 1163 GRIMNRFSKDIEAIDQELAPVVQGAFYSLVSCVTTILLITFITPQFLSVAILVTGLYYLI 1222

Query: 326  GALIYGKRIRMISRDLQESTGNLTRVSEEQLSGVKTIQSFVAEGKELQRYNTAIRKVFLY 385
            G   Y    R   R    +   + +   E L GV TI++F  EG+ +Q   + I +    
Sbjct: 1223 GYF-YLAASREFKRFDSITKSPIYQHFSETLVGVTTIRAFGDEGRFMQENLSKIDE---- 1277

Query: 386  GKKEALTNATFFSSTNVLGDLSF-------LIVLAYGSHLV-----LQGGLTVGDLTAFM 433
                   N  FF        LSF       L+V   GS ++     +  G+    LT  +
Sbjct: 1278 ------NNRPFFYLWVANRWLSFRIDMVGALVVFGSGSFIIWNIKNIDAGMAGISLTYAI 1331

Query: 434  LYTEYTGSAVFGLSNFYSELMKGAGAASRLFEM--TDHAPSIKPTAGKP-YVPGSGKISF 490
             +TE        L   YS +     +  RL E    +  P    T   P   P  GKI  
Sbjct: 1332 SFTE----GALWLVRLYSNVEMNMNSVERLKEYMKIEQEPYEDATCTPPPEWPQEGKIEV 1387

Query: 491  KDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITID 550
             D+S  Y      ++   + FT+ P + + IVG +G GKSTI + L R+ +P +G I ID
Sbjct: 1388 CDLSLRY-AEGLPRVIKNVTFTVAPKAKIGIVGRTGAGKSTIITALFRFLDPETGYIKID 1446

Query: 551  DQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLT-YGLQSEVSM------------DEI 597
            + DI+ ++   LRR + ++ Q+P L +G+IK NL  YG  S+  M            D  
Sbjct: 1447 NIDITSINLNKLRRSINIIPQDPTLFTGTIKSNLDPYGEYSDEDMFTALRRVNLVPEDVS 1506

Query: 598  RSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSA 657
             ++  +      V KF N  +  I   G++LS GQ+Q + +AR+L++ PKI++LDEAT++
Sbjct: 1507 SNIETESISSQNVNKFLN-LNNEISEGGSNLSQGQRQLVCLARSLLRSPKIMLLDEATAS 1565

Query: 658  LDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYA 717
            +D  S+  I  T+ K   S   TI++IAHRL ++   + ++V+ + G V E      L  
Sbjct: 1566 IDYNSDAKIQETIRKEFNSS--TILTIAHRLRSVIDYDKILVM-DAGEVKEYDHPYSLLL 1622

Query: 718  DQQSELYKLLND 729
            +++S  Y +  +
Sbjct: 1623 NKKSIFYNMCEN 1634

 Score = 78.6 bits (192), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 58/233 (24%), Positives = 112/233 (48%), Gaps = 9/233 (3%)

Query: 483 PGSGKISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNP 542
           P   ++ FK+ + S+ +   +     LN   + G    ++GP+G GK+++   LL     
Sbjct: 704 PQGDQLEFKNTTVSWDSSAQDFKLKDLNIDFKIGKLNVVIGPTGSGKTSLLMALLGEMKI 763

Query: 543 SSGQI---TIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRS 599
             G+I   ++D ++   +        +    Q   L++ +++ N+ +   S  +     S
Sbjct: 764 MEGEIIVPSLDPREDLVVDENGTTNSIAYCSQAAWLLNDTVRNNILFN--SPYNEARYTS 821

Query: 600 VAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALD 659
           V + C           G  T IG +G +LSGGQKQR+++ARA+    + ++LD+  SA+D
Sbjct: 822 VIEACGLKRDFEILKAGDMTEIGEKGITLSGGQKQRVSLARAMYSNSRHILLDDCLSAVD 881

Query: 660 VESEGAI--NYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVG 710
             +   I  N   G LM  +  T I ++H ++   ++ +++V+  DG V + G
Sbjct: 882 SHTALWIYDNCITGPLMDGR--TCILVSHNIALTLKNADLVVILEDGKVKDQG 932

>Smik_11.14 Chr11 complement(26603..30553) [3951 bp, 1316 aa] {ON}
            YKL209C (REAL)
          Length = 1316

 Score =  163 bits (413), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 153/536 (28%), Positives = 250/536 (46%), Gaps = 35/536 (6%)

Query: 219  ALVIGTVA-----NFGRIVLLRVLGEKLVARLRSNVIRKIIHQDAEFF--DRNKVGDLIS 271
             +V+G  A     NF +  LL    E  +  LR+ V+ K+  +   +F  + NK  ++ +
Sbjct: 790  CIVLGVAAADGIFNFAKGFLLGYCSEYWIMDLRNEVMEKLTKKSMNWFSGEDNKASEVSA 849

Query: 272  RLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSIS----LTSALLMFAPPLLIGA 327
             + +D     R +   VS+   A              +++    L+   +   P ++I +
Sbjct: 850  LVLNDL----RDLRSLVSEFLSAITSFITVSFIGLVWALASGWKLSLVCISMFPLIIIFS 905

Query: 328  LIYGKRIRMISRDLQESTGNLTRVSEEQLSGVKTIQSFVAEGKELQRYNTAIRKVFLYGK 387
             IYG  ++    D + S   L     + ++ +KTI+   AE      Y+    K+     
Sbjct: 906  AIYGSILQKHETDYKTSVVQLENCLYQIVTNIKTIKYLQAEFHFQLSYHKLKTKMEQIAS 965

Query: 388  KEALTNATFFSSTNVLGDLSFLIVLAYGSHLVLQGGLTVGDLTAFMLYTEYTGSAVFGLS 447
            K A+      S TN++      I+  YG  LV+    T   +        +T  +   L 
Sbjct: 966  KRAIATGFGISMTNMIAMCIQAILYYYGLKLVMVHEYTSKKMFTTFTLLLFTIMSCTSLV 1025

Query: 448  NFYSELMKGAGAASRLFEMTD-----------HAPSIKPTAGKPY--VPGSGKISFKDVS 494
            +   ++ +G  AAS ++ + D           +A SI    G+ Y     +  +S ++++
Sbjct: 1026 SQIPDISRGQRAASWIYRILDEKQVTLEIEDNNARSIG-IIGETYHEKQTTPMLSIQNLT 1084

Query: 495  FSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDI 554
            F+YP+ P   I+  +N  +  G  + IVG SG GKST+  LL R Y+   G I +D  D+
Sbjct: 1085 FAYPSAPSVLIYKNMNLNMFCGQTIGIVGGSGSGKSTLVLLLTRLYDCEVGSIKLDGTDV 1144

Query: 555  SRLSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFP 614
            +  +   LRR + VV+Q+P+L +G+I+ NLTYG   E+   EI    K    + FV   P
Sbjct: 1145 NDWNLTVLRREISVVEQKPLLFNGTIRDNLTYGCLGEILEIEIYDALKYVGIYDFVASLP 1204

Query: 615  NGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLM 674
             G  T I      LSGGQ QR+ IARAL++KPKILILDE TSALD  S   I   + K  
Sbjct: 1205 LGLGTRIDTN--LLSGGQAQRLCIARALVRKPKILILDECTSALDSMSSHVIKEIVKK-- 1260

Query: 675  KSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQSELYKLLNDK 730
                L  + I H    +R  +++ V   DG V+E G F  LY +   E+++++++K
Sbjct: 1261 GPPALLTLVITHDEQMMRCCDSIAVF-KDGKVIEEGSFDTLY-NNCGEMFRIVSEK 1314

 Score =  159 bits (402), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 147/598 (24%), Positives = 267/598 (44%), Gaps = 44/598 (7%)

Query: 152 DWKLLTFAIGLLAISSVIGMSIPKVIGMVLDAIKNTYSSATGPVGLDDLPPIVNDLSMYE 211
           D+KLL     L+ IS+V    +P +  ++   + +  S        +DL P +   +M  
Sbjct: 49  DYKLLI----LMIISTVATGLVPAITSILTGRVFDLLSVFVLSGSHNDLYPQLVQRAMA- 103

Query: 212 FLGIFAGALVIGTV-ANFGRIVLLRVLGEKLVARLRSNVIRKIIHQD-AEFFDRNK--VG 267
                  AL + +V A +  +     +GEK   R+RS ++   + +   +++D N   +G
Sbjct: 104 -----VMALGVASVPAMWLSLTSWMYIGEKQGLRIRSQLLEAYLEKKPMKWYDVNDTLLG 158

Query: 268 DLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTSALLMFAPPLLIGA 327
           D  ++++     +  S  +  +  F+               S SLT  +L  +P +   A
Sbjct: 159 DF-TQINRCVEELRSSSAEASAITFQNLVAICALLGTSFYYSWSLTLIILCSSPIITFFA 217

Query: 328 LIYGKRIRMISRDLQESTGNLTRVSEEQLSGVKTIQSFVAEGKELQRYNTAIRKVFLYGK 387
           + + + + M S+   E T    ++    ++  + ++ +  +  E +++   I     +  
Sbjct: 218 VAFSRMVHMYSQKENEETSKAAQLFAWSMNAAQLVRLYCTQPLERKKFQRIILSCNTFFI 277

Query: 388 KEALTNATFFSSTNVLGDLSFLIV------LAYGSHLVLQGGLTVGDLTAFMLYTEYTGS 441
           K  L     F + N  G L FL +        +GS ++ QG L + D+          GS
Sbjct: 278 KSCL-----FVAANA-GILRFLTLTMFVQGFWFGSTMIKQGKLNINDVITCFHSCILLGS 331

Query: 442 AVFGLSNFYSELMKGAGAASRLFEMTDHAPSIKP-----TAGKPYVPGSGKISFKDVSFS 496
            +    +    L KG  A  ++  + ++ P   P         P    +  + F +VSFS
Sbjct: 332 TLNNTLHQIVVLQKGEVALQKIMNLLENGPKCNPPNEIELHQYPLDYANSDLVFDNVSFS 391

Query: 497 YPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISR 556
           YP+RP   +    +     G    IVG SG GKST++SLLL++Y+   G I+I+ ++I  
Sbjct: 392 YPSRPSEIVLENASLKFPAGQFTFIVGKSGSGKSTLSSLLLKFYDGYDGSISINGRNIQA 451

Query: 557 LSCKSLRRHLGVVQQEPMLMSGSIKYNLTYG---------LQSEVSMDEIRSVAKKCFCH 607
           +  K L +++ VV+Q   L + +++ N+  G           +  + + I+   +     
Sbjct: 452 IPQKLLIKNITVVEQRCTLFNDTLRKNILLGSTELAKNADYSTNKNTNLIKDACRMALLD 511

Query: 608 GFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAIN 667
             +   P+G +T+IG  G +LSGGQ+QR+A+ARA ++   IL LDEA SALD+     + 
Sbjct: 512 RLILDLPDGLETLIGSGGVTLSGGQQQRVAMARAFIRDTPILFLDEAVSALDIIHRNLLM 571

Query: 668 YTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQSELYK 725
             +    K K  T I + H L  +  S++ + L  +G V+E G   +L AD  S   K
Sbjct: 572 KAIRHWRKGK--TTIILTHELGQV-ESDDHLYLMQEGKVIESGTQSELLADSTSTFSK 626

>KNAG0E01120 Chr5 (214592..219745) [5154 bp, 1717 aa] {ON} Anc_4.6
            YHL035C
          Length = 1717

 Score =  161 bits (408), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 157/566 (27%), Positives = 261/566 (46%), Gaps = 81/566 (14%)

Query: 207  LSMYEFLGIFAGALVIGTVANFGRIVLLRVLGEKLVARLRSNVIRKIIHQDAEFFDRNKV 266
            L MY  +G+  GA V G++  F    L  + G     ++ + ++ K+IH    FFD   +
Sbjct: 1162 LIMYFMIGL-TGATV-GSLKTF----LTYIFGINASRKIFAMLLNKVIHSKLRFFDTTPI 1215

Query: 267  GDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTSALL--MFAPPLL 324
            G +++R S D   V + +T  ++  F +              +I L S +    F   +L
Sbjct: 1216 GRIMNRFSKDIESVDQELTPYLTGAFYSFVECFS--------TIILISWITPQFFVVAIL 1267

Query: 325  IGALIY--GKRIRMISRDLQE----STGNLTRVSEEQLSGVKTIQSFVAEGKELQRYNTA 378
            I  + Y  G      SR+L+     +   + +   E L GV TI++F   G E++     
Sbjct: 1268 ISIMYYLVGYFYMAGSRELKRLDSITKSPIYQHFSETLVGVTTIRAF---GDEMRFLKEN 1324

Query: 379  IRKVFLYGKKEALTNATFFSSTNVLGDLSFLIVLAYGSHLVLQGGLTV-GDL-------- 429
            + K+          N  FF        LSF I +  GS +V   G+ +  D+        
Sbjct: 1325 LFKI-------DENNKPFFYLWVANRWLSFRIDMI-GSFVVFGAGVFILADIKNIDSGMA 1376

Query: 430  -TAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRL----------FEMTDHAPSIKPTAG 478
              +      +T  A++ L  FYSE+     +  R+          +++ D      PT  
Sbjct: 1377 GISLTYAISFTEGALW-LVRFYSEVEMNMNSVERIKEYMSVEQEPYDIKDEIVRTPPTVW 1435

Query: 479  KPYVPGSGKISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLR 538
                P  GKI   D+S  Y       I N ++FT+EP S V +VG +G GKSTI + L R
Sbjct: 1436 ----PDEGKIEVNDLSLRYAANLPRVIKN-VSFTVEPNSKVGVVGRTGAGKSTIITALFR 1490

Query: 539  YYNPSSGQITIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNL----------TYGL 588
            + +P SG I ID+ DI+ +    LRR + ++ Q+P L +G++K+NL           +  
Sbjct: 1491 FLDPESGYIKIDNMDITTIPLTRLRRAITIIPQDPTLFAGTLKFNLDPYDEYNDKDIFAA 1550

Query: 589  QSEVSM-------DEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARA 641
             + V++        E  +V+ +   H             I   G +LS GQ+Q I +AR+
Sbjct: 1551 LTRVNLVSGEELNGETTAVSDQGSMHSNNENRFLDLSNEITEGGGNLSQGQRQLICLARS 1610

Query: 642  LMKKPKILILDEATSALDVESEGAINYTL-GKLMKSKELTIISIAHRLSTIRRSENVIVL 700
            L++ PKIL+LDEAT+++D ES+  +  T+ G+   S   TI++IAHRL ++   + ++V+
Sbjct: 1611 LLRNPKILLLDEATASIDYESDARLQATIRGEFGNS---TILTIAHRLRSVIDYDKILVM 1667

Query: 701  GNDGSVVEVGKFKDLYADQQSELYKL 726
             + G V+E      L  ++ SE YK+
Sbjct: 1668 -DAGEVIEYDHPYSLLLNRNSEFYKM 1692

 Score = 79.7 bits (195), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 67/237 (28%), Positives = 113/237 (47%), Gaps = 13/237 (5%)

Query: 487 KISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQ 546
           K++F + + S+ T         LN   + G    ++G +G GK+++   LL   +   G+
Sbjct: 758 KLAFDNSTTSWDTNGSGFKLRNLNIDFKVGKLNVVIGATGSGKTSLLMALLGEMHICQGR 817

Query: 547 ITIDD-QDISRLSCKS--LRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIR--SVA 601
           I +   +  S L+  S      +    Q   L++ +++ N+ +      S DE R   V 
Sbjct: 818 IIVPSLEPRSSLTANSDGFTNSIAYCSQAAWLLNDTVRNNILFN----SSFDENRYHKVV 873

Query: 602 KKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVE 661
           + C           G  T IG +G +LSGGQKQRI++ARAL    K L+LD+  SA+D  
Sbjct: 874 EACGLKRDFDILKAGDLTEIGEKGITLSGGQKQRISLARALYSDSKHLLLDDCLSAVDSH 933

Query: 662 SEGAI--NYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLY 716
           +   I  N   G LM  +  T I ++H ++   R+  ++V+  DG V + G   +L+
Sbjct: 934 TASWIYDNCITGPLMVGR--TCILVSHNIALTLRNAELVVILEDGRVKDQGDPLNLF 988

>NCAS0C05930 Chr3 (1220180..1225153) [4974 bp, 1657 aa] {ON} Anc_4.6
          Length = 1657

 Score =  160 bits (406), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 153/563 (27%), Positives = 257/563 (45%), Gaps = 82/563 (14%)

Query: 207  LSMYEFLGIFAGALVIG-TVANFGRIVLLRVLGEKLVARLRSNVIRKIIHQDAEFFDRNK 265
            LS+Y  +G+    L    +V NF       VLG +   ++  +++ + +H    FFD   
Sbjct: 1109 LSIYFLIGLTQSLLAASKSVLNF-------VLGIRASRKIFESLLYRTLHAKLGFFDATP 1161

Query: 266  VGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTSALLMFAPP--- 322
            +G +++R S D   V + +T  +   F                    T AL+ F  P   
Sbjct: 1162 IGRIMNRFSKDIESVDQELTPYLEAAFFCLVQCIA------------TMALITFITPQFL 1209

Query: 323  ---LLIGALIY--GKRIRMISRDLQE----STGNLTRVSEEQLSGVKTIQSFVAEGKELQ 373
               +L+G L Y  G      SR+L+     S   + +   E L GV TI+++  E + + 
Sbjct: 1210 SVAILVGCLYYLVGYFYMAASRELKRFESISKSPIYQHFSETLVGVATIRAYGDESRFML 1269

Query: 374  RYNTAIRKVFLYGKKEALTNATFFSSTNVLGDLSF-------LIVLAYGSHLV-----LQ 421
                 I +           N  FF        LSF        ++   G  ++     + 
Sbjct: 1270 ENLHKIDE----------NNKPFFYLWVFNRWLSFRIDMIGAFVIFGAGVFILTNIKNID 1319

Query: 422  GGLTVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEM--TDHAP--SIKPTA 477
             G+    LT  + +TE        L  FY+++     +  RL E    +  P    K T 
Sbjct: 1320 SGMAGISLTYAISFTE----GALWLVRFYADVEMNMNSVERLKEYMEIEQEPYDEYKDTL 1375

Query: 478  GKPYVPGSGKISFKDVSFSY-PTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLL 536
                 P +GKI  KD+S  Y P  P  ++   ++F +EP + + IVG +G GKSTI + +
Sbjct: 1376 LHDEWPSNGKIEVKDLSLRYAPNLP--KVIKNVSFVVEPKTKIGIVGRTGAGKSTIITAM 1433

Query: 537  LRYYNPSSGQITIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLT-YGLQSE---- 591
             R+ NP SG I IDD +I+ ++   LRR + ++ Q+P L +G+IK NL  Y   ++    
Sbjct: 1434 FRFLNPESGYIKIDDVNIASINLTKLRRSITIIPQDPTLFTGTIKLNLDPYNEFTDDAIF 1493

Query: 592  --------VSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALM 643
                    V+ +E+++   +        KF N  +  I   G++LS GQ+Q + +AR+L+
Sbjct: 1494 EALKRVNLVTEEELQNNGTQTGTSENANKFLN-LENEITEGGSNLSHGQRQLVCLARSLL 1552

Query: 644  KKPKILILDEATSALDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGND 703
            + PKI++LDEAT+++D  S+  I  T+ K  +  + TI++IAHRL ++   + +IV+ + 
Sbjct: 1553 RNPKIILLDEATASIDYASDAKIQETIRK--EFSQSTILTIAHRLRSVIDYDKIIVM-DA 1609

Query: 704  GSVVEVGKFKDLYADQQSELYKL 726
            G V E      L  D+ S  Y +
Sbjct: 1610 GEVKEYDHPYSLLLDKNSNFYSM 1632

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 64/238 (26%), Positives = 115/238 (48%), Gaps = 23/238 (9%)

Query: 486 GKISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSG 545
            +I+FK+V+ ++     +     LN   +PG+   ++GP+G GK+++   LL       G
Sbjct: 709 NRIAFKNVTVTWDNGEEDFKLRDLNIEFKPGALNVVIGPTGSGKTSLLLALLGEMCLEKG 768

Query: 546 QITI------DDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRS 599
           +I +       D  I +     L   +    Q   L++ +++ N+ +   S  + +   +
Sbjct: 769 EIIVPALNPRQDLVIDKFG---LTNSIAYCSQAAWLLNETVRNNILFN--SPYNEERYNA 823

Query: 600 VAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALD 659
           V   C     +        T IG +G +LSGGQKQR+++ARAL    K ++LD+  SA+D
Sbjct: 824 VIDACGLRRDLKILKASDMTEIGEKGITLSGGQKQRVSLARALYSNSKHVLLDDCLSAVD 883

Query: 660 VESEGAI--NYTLGKLMKSKELTIISIAHRLS-TIRRSENVIVLGNDGSVVEVGKFKD 714
             +   I  N   G LM  +  T I ++H ++ T++ +E V++L N       G+ KD
Sbjct: 884 SHTALWIYDNCITGPLMSGR--TCILVSHNIALTLKNAELVVILEN-------GRVKD 932

>Suva_10.23 Chr10 complement(44719..49704) [4986 bp, 1661 aa] {ON}
            YLL048C (REAL)
          Length = 1661

 Score =  160 bits (404), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 172/670 (25%), Positives = 291/670 (43%), Gaps = 86/670 (12%)

Query: 120  DKESQKSGTMEDEESPNMG------YKEVIRLFKLATHDWKLLTFAIGLLAISSV--IGM 171
            + E  + G + +EE+   G      YK  +++F      WK++ F   L   S +  IG 
Sbjct: 988  EAERAEDGKLIEEETKEEGVVSMDVYKWYLKIFG----GWKIVAFLASLFLFSQLLYIGQ 1043

Query: 172  S-----------IPKVIGMVLDAIKNTYSSAT------GPVGLDDLP----PIVNDLSMY 210
            S           I K++ M   AI      A+      G   +  +     P     +MY
Sbjct: 1044 SWWVRAWASHNVIAKIVPMAQRAIAFISKDASHLLDWRGSFQVSAMSNGSQPTGKHSTMY 1103

Query: 211  EFLGIFAGALVIGTVANF---GRIVLLRVLGEKLVARLRSNVIRKIIHQDAEFFDRNKVG 267
             +L ++   L+IG   +    G+ +L  V G     ++ + ++ K++H    FFD    G
Sbjct: 1104 -YLVLY---LIIGLAQSLLGAGKTILNFVAGINASRKIFNMILNKVLHSKLRFFDATPTG 1159

Query: 268  DLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTSALLMFAPPLLIGA 327
             +++R S D   + + +T  +   F +              +    S  ++ +       
Sbjct: 1160 RIMNRFSKDIEAIDQELTPYIQGAFYSLIECLSTVILITFITPQFLSVAIVVSIMYYFIG 1219

Query: 328  LIYGKRIRMISRDLQESTGNLTRVSEEQLSGVKTIQSFVAEGKELQRYNTAI---RKVFL 384
              Y    R + R    S   + +   E L GV TI++F  EG+ +Q     I    K F 
Sbjct: 1220 YFYMAGSRELKRYESISRSPIYQHFSETLVGVTTIRAFGDEGRFMQENLQKIDENNKPFF 1279

Query: 385  YGKKEALTNATFFSSTNVLGDLSF----LIVLAYGSHLVLQGGLTVGDLTAFMLYTEYTG 440
            Y     + N       +++G L      L +L+   HL    G+    LT  + +TE   
Sbjct: 1280 Y---LWVANRWLAFRIDMIGSLVIFGAGLFILSNIDHL--DSGMAGISLTYAISFTE--- 1331

Query: 441  SAVFGLSNFYSELMKGAGAASRL---FEMTDHAPSIKPTAGKPYVPGSGKISFKDVSFSY 497
                 L   YSE+     +  R+    E+     +       P  P  GKI   D+S  Y
Sbjct: 1332 -GALWLVRLYSEVEMNMNSVERVKEYMEIEQEPYNQHKEVPPPQWPQDGKIEVNDLSLRY 1390

Query: 498  -PTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISR 556
             P  P  ++   ++F+++  S V IVG +G GKSTI + L R+  P +G I ID+ DIS 
Sbjct: 1391 APNLP--RVIKNVSFSVDAQSKVGIVGRTGAGKSTIITALFRFLEPDTGHIKIDNIDISN 1448

Query: 557  LSCKSLRRHLGVVQQEPMLMSGSIKYNLT----------------YGLQSEVSMDE--IR 598
            +  + LRR + ++ Q+P L SG+IK NL                   L SE  + +  +R
Sbjct: 1449 VDLQRLRRSITIIPQDPTLFSGTIKTNLDPYNEFSNQKIFEALKRVNLVSEEQLQQGTVR 1508

Query: 599  SVAKKCFCHGF--VTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATS 656
             VA          V KF +  ++ +   G++LS GQ+Q + +AR+L++ PKI++LDEAT+
Sbjct: 1509 EVATDTSSADSENVNKFLD-LESEVSEGGSNLSQGQRQLMCLARSLLRSPKIILLDEATA 1567

Query: 657  ALDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLY 716
            ++D  S+  I  T+ K  +    TI++IAHRL ++   + ++V+ + G V E      L 
Sbjct: 1568 SIDYSSDAKIQETIRKEFQGS--TILTIAHRLRSVIDYDKILVM-DAGEVKEYDHPYSLL 1624

Query: 717  ADQQSELYKL 726
             ++QS  Y +
Sbjct: 1625 LNKQSIFYSM 1634

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 60/238 (25%), Positives = 114/238 (47%), Gaps = 9/238 (3%)

Query: 483 PGSGKISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNP 542
           P   + +F++ + S+     +     LN   + G    ++GP+G GK+++   LL     
Sbjct: 689 PNGKRFAFENSTISWDKDNQDFKLKDLNIEFKTGKLNVVIGPTGSGKTSLLMALLGEMYL 748

Query: 543 SSGQITIDDQDISR---LSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRS 599
            +G++ +   D  +   +        +    Q   L++ ++K N+ +   S+ +    ++
Sbjct: 749 LNGKVVVPALDPRQELVVEANGTTNSIAYCSQAAWLLNDTVKNNILFN--SQFNETRYKA 806

Query: 600 VAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALD 659
           V + C           G  T IG +G +LSGGQKQR+++ARAL    + ++LD+  SA+D
Sbjct: 807 VVEACGLKRDFEILKAGDLTEIGEKGITLSGGQKQRVSLARALYSNARHVLLDDCLSAVD 866

Query: 660 VESEGAI--NYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDL 715
             +   I  N   G LM+ +  T I ++H ++   R+  ++VL  DG V + G   D+
Sbjct: 867 SHTASWIYDNCITGPLMEDR--TCILVSHNIALTLRNAELVVLLEDGRVKDQGDPIDM 922

>CAGL0C03289g Chr3 (328799..333745) [4947 bp, 1648 aa] {ON} similar to
            uniprot|P32386 Saccharomyces cerevisiae YLL048c YBT1
            yeast bile transporter
          Length = 1648

 Score =  158 bits (400), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 151/569 (26%), Positives = 258/569 (45%), Gaps = 84/569 (14%)

Query: 207  LSMYEFLGIFAGALVIGTVANFGRIVLLRVLGEKLVARLRSNVIRKIIHQDAEFFDRNKV 266
            L +Y  +G+ +   +IG++  F    L  +   KL+     +++ +++H    FFD   +
Sbjct: 1093 LVVYCLIGVMSS--IIGSIKTFVN-SLFGIRASKLIF---DSLLDRVLHARVRFFDSTPI 1146

Query: 267  GDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTSALLMFAPPLLIG 326
            G +++R S D   + + +  N+   F +                 +T A    A  +++G
Sbjct: 1147 GRIMNRFSKDIESIDQEIPPNIQSVFYSAIEVFATLLLISY----ITPAFFPVAIIIVLG 1202

Query: 327  ALIYGKRIRMISRDLQE----STGNLTRVSEEQLSGVKTIQSFVAEGKELQRYNTAIRKV 382
              I G      SR+L+     S   + +   E L GV TI++F  E + ++   + I + 
Sbjct: 1203 YSIVGFFYLTTSRELKRLDSISKSPIFQHFSETLVGVTTIRAFGDEQRFIKENLSMIDQ- 1261

Query: 383  FLYGKKEALTNATFFSSTNVLGDLSF-------LIVLAYGSHLVLQ-----GGLTVGDLT 430
                      +  FF    V   LSF       L++ + G  ++L       GL    LT
Sbjct: 1262 ---------NSMPFFYLWVVNRWLSFRIDLIGALVIFSSGVFILLNINNIDAGLAGISLT 1312

Query: 431  AFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFE---------MTDHAPSIKPTAGKPY 481
              + +TE    A   L   YSEL     +  R+ E         + D A ++ P    P 
Sbjct: 1313 YAISFTE----AALWLVRQYSELEMNMNSVERVLEYMNIEQEPLIADPANAVTP---PPQ 1365

Query: 482  VPGSGKISFKDVSFSY-PTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYY 540
             P SGK+   ++S  Y P  P   +   + FTIEP   V IVG +G GKSTI + L R+ 
Sbjct: 1366 WPDSGKVEVNNLSLKYAPHLP--YVIKDVTFTIEPLEKVGIVGRTGAGKSTIITALFRFL 1423

Query: 541  NPSSGQITIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSI-------------------- 580
               +G I +D  +I+ +  K LRR + ++ Q+P L +GSI                    
Sbjct: 1424 EADTGSIKLDGVNIANIDLKRLRRSITIIPQDPTLFAGSIRSNLDPYDEYSDEEIFTALK 1483

Query: 581  KYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIAR 640
            + NL    + E S  EI+S + K      V KF N  ++ I   G++ S GQ+Q + +AR
Sbjct: 1484 RVNLVSTEEMEASTSEIQSNSSKN-----VNKFLN-LESEIAEGGSNFSQGQRQLMCLAR 1537

Query: 641  ALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSENVIVL 700
            +L++ PK+++LDEAT+++D  S+  I  T+ +   +   T+++IAHRL +I   + ++V+
Sbjct: 1538 SLLRMPKVILLDEATASIDYNSDAKIQETIRQEFNNS--TVLTIAHRLRSIVDYDKILVM 1595

Query: 701  GNDGSVVEVGKFKDLYADQQSELYKLLND 729
             + G V E      L  +++S  Y +  D
Sbjct: 1596 -DAGEVKEFDHPYSLLLEKKSIFYNMCED 1623

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 63/239 (26%), Positives = 112/239 (46%), Gaps = 15/239 (6%)

Query: 487 KISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQ 546
           +++F++V+  + +   + +   L+     G    IVG +G GK++I   LL     S G+
Sbjct: 705 RLAFENVTLRWDSDKDSFVLRNLDIEFMTGKLNVIVGATGSGKTSILMGLLGEMQLSEGK 764

Query: 547 ITIDDQDISRLSCKS----LRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIR--SV 600
           I +      R   +S    +   +    Q   L++ +++ N+ +        D+ R  +V
Sbjct: 765 IIVPSLS-PRHEYQSQAGVINDSIAYCSQAAWLLNDTVRNNILFN----APFDQARYDAV 819

Query: 601 AKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDV 660
            + C           G  T IG +G +LSGGQKQR+++ARAL      L+LD+  SA+D 
Sbjct: 820 VEACSLKRDFQILKAGDSTEIGEKGITLSGGQKQRVSLARALYSSAGHLLLDDCLSAVDS 879

Query: 661 ESEGAI--NYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYA 717
            +   I      G LM+ +  T I + H ++   ++ + +V+  DG V E G   +L A
Sbjct: 880 HTALWIYDKCISGPLMEGR--TCILVTHNIALTMKNADFVVMIEDGKVKEKGTPIELLA 936

>NDAI0B00640 Chr2 (141258..145733) [4476 bp, 1491 aa] {ON} Anc_5.10
          Length = 1491

 Score =  156 bits (394), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 152/552 (27%), Positives = 248/552 (44%), Gaps = 59/552 (10%)

Query: 207  LSMYEFLGIFAGALVIGTVANFGRIVLLRVLGEKLVARLRSNVIRKIIHQDAEFFDRNKV 266
            + +Y F  +FAG L   +     +  LL  +G +    L    + +I+H    + D   +
Sbjct: 952  MGLYSFF-VFAGYLFTSS-----QFTLLCAIGIRASKWLNLKAVHRILHTPMSYLDTTPL 1005

Query: 267  GDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTSALLMFAPPLLIG 326
            G +++R + D    + S+   +++  +                I       +  P L IG
Sbjct: 1006 GRILNRFTKD----TDSLDNELTESIRLMLFQTANIVGVCVMCIIYLPWFAIAIPFLFIG 1061

Query: 327  ALIYG----------KRIRMISRDLQESTGNLTRVSEEQLSGVKTIQSFVAEGKELQRYN 376
              +            KR+  I R    +  N      E L G+ TI+S+ +E + L + +
Sbjct: 1062 FTLITDHYQSTGREVKRLEAIQRSFVYNNFN------EILGGMDTIKSYGSEERFLAKSD 1115

Query: 377  TAIRKVFLYGKKEALTN---ATFFSSTNVLGDLSFLIVLAYGSHLVLQGGLTVGDLTAFM 433
              I K+   G          A F     V    + +I L   +       ++VG L  ++
Sbjct: 1116 YLINKMNEAGYLSVALQRWVAIFLDLVAVC--FALIITLLCVTRAFHISAVSVGVLLTYV 1173

Query: 434  LYTEYTGSAVF-GLSNFYSELMKGAGAASRLFEMTDHAPSIKPTAGKPY-VPGSGKISFK 491
            L      + V   L+   +++       S   E+   A   +P    P   P  GKI FK
Sbjct: 1174 LQLPGLLNGVLRALTQTENDMNSAERLVSYATELPLEAAYRRPEVSPPENWPSEGKIEFK 1233

Query: 492  DVSFSYPTRPGNQIFNK-LNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITID 550
             V FSY  RPG  I  K L+  I+ G  + I G +G GKSTI S L R    S G+I ID
Sbjct: 1234 HVDFSY--RPGLPIVLKDLDLDIKSGEKIGICGRTGAGKSTIMSALYRLNEISQGEILID 1291

Query: 551  DQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLTY----------------GLQSEVSM 594
            + DIS+L    LRR L ++ Q+P+L  G+I+ NL                  G     ++
Sbjct: 1292 NVDISKLGLYDLRRKLAIIPQDPVLFRGTIRKNLDPFNEHDDDLLWDSLVRGGAIERAAL 1351

Query: 595  DEIRSV-AKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDE 653
            ++I++    K   H  + KF    D ++   GA+ S G++Q +A+ RAL+++ K+LILDE
Sbjct: 1352 NKIKNQKVDKDGTHADMFKF--HLDQLVEEEGANFSLGERQLLALTRALVRQAKVLILDE 1409

Query: 654  ATSALDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFK 713
            ATS++D E++G I   + K  +  + TI+ IAHRL+TI   + ++VL   G V E  K K
Sbjct: 1410 ATSSVDYETDGKIQARIVK--EFGDCTILCIAHRLNTILNYDRILVL-EKGEVAEFEKPK 1466

Query: 714  DLYADQQSELYK 725
             L+ DQ+  +++
Sbjct: 1467 VLF-DQEDSIFR 1477

 Score = 89.0 bits (219), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 69/237 (29%), Positives = 115/237 (48%), Gaps = 22/237 (9%)

Query: 506 FNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRH 565
           F+ +   I+ G  + +VGP G GK++  + L  + N + G+I ++      L C      
Sbjct: 627 FHDITLDIKKGEFIIMVGPIGTGKTSFLNALAGFMNKTEGRIQVNGD---LLLCGY---- 679

Query: 566 LGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRG 625
                  P + + +++ N+ +G  S     +   V + C     +   P G  T IG RG
Sbjct: 680 -------PWIQNATVRDNILFG--SPYDKKKYEEVLRCCSLEADLDILPAGDSTEIGERG 730

Query: 626 ASLSGGQKQRIAIARALMKKPKILILDEATSALDVE-SEGAINYTLGKLMKSKELTIISI 684
            +LSGGQK RI +AR + KK  I + D+  SA+D    +  ++     L+K++  T I  
Sbjct: 731 ITLSGGQKARINLARCVYKKKDIYLFDDVLSAVDSRVGKHIMDECFLGLLKNE--TRILA 788

Query: 685 AHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQSELYKLL--NDKKRDKPTPRV 739
            H+LS + R+  VIVLG DGS  E+G    L    Q+ +  LL  N + +++ T  +
Sbjct: 789 THQLSLLERASRVIVLGTDGS-FEIGPVDVLKRTNQTLINLLLFSNQESKEEDTENI 844

>Ecym_8418 Chr8 (874901..879937) [5037 bp, 1678 aa] {ON} similar to
            Ashbya gossypii ACL072C
          Length = 1678

 Score =  155 bits (393), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 148/553 (26%), Positives = 247/553 (44%), Gaps = 54/553 (9%)

Query: 207  LSMYEFLGIFAGALVIGTVANFGRIVLLRVLGEKLVARLRSNVIRKIIHQDAEFFDRNKV 266
            LS+Y  LG      +I TV    +++L  + G K   ++ + +++K+++    FFD    
Sbjct: 1127 LSIYILLGTLRA--LISTV----KVILSYISGLKASRKIFTLLLKKVLYAKLRFFDSTPT 1180

Query: 267  GDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTSALLMFAPPLLIG 326
            G +++R S D   +   +       F +                 +T   L FA  + + 
Sbjct: 1181 GRIMNRFSRDVEAIDEELIPFFEGAFASLVQCITTILLIGY----ITPVFLFFAIVICVS 1236

Query: 327  ALIYGKRIRMISRDLQE----STGNLTRVSEEQLSGVKTIQSFVAE----GKELQRYNTA 378
              I G    + SR+LQ     +   + +   E L GV TI++F  E       L + +T 
Sbjct: 1237 YYIVGYFYLVGSRELQRFESITKSPIHQHFSETLVGVTTIRAFGDERRFLADNLSKVDTH 1296

Query: 379  IRKVFLYGKKEALTNATFFSSTNVLGDLSFLIVLAYGSHLVLQ-GGLTVGDLTAFMLYTE 437
             R  F       +TN       + +G     ++LA G  ++L    L  G     ++Y  
Sbjct: 1297 NRPFFYLW----VTNRWLAFRIDFIGAF---VILASGIFILLNVNSLDAGLAGISLIYAI 1349

Query: 438  YTGSAVFGLSNFYSELMKGAGAASRLFEM--TDHAPSIKPTAGKPYVPGSGKISFKDVSF 495
                    L   YS +     +  RL E    +  PS       P  P  GKI   ++S 
Sbjct: 1350 SFTEGALWLVRLYSNVEMTMNSVERLKEYMKIEQEPSTGLYEPPPEWPDRGKIEVNNLSL 1409

Query: 496  SYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDIS 555
             Y +     I N + FT+EP S V IVG +G GKSTI + L R+ +P +G I +D+ DI+
Sbjct: 1410 RYASNLPKVIKN-VTFTVEPQSKVGIVGRTGAGKSTIITALFRFLDPDTGTIKLDNVDIT 1468

Query: 556  RLSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKC----------- 604
             +  K LR+ + ++ Q+P+L +G+IK NL     SE + D I    K+            
Sbjct: 1469 SIRLKRLRQSITIIPQDPVLFAGTIKSNL--DPYSEYADDRIFEALKRVNLIVQEELTPT 1526

Query: 605  --------FCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATS 656
                         V KF +   + I   G++LS GQ+Q + +AR+L++ PK ++LDEAT+
Sbjct: 1527 DIPSSSSSLSFENVNKFLD-LTSEITEGGSNLSQGQRQLVCLARSLLRNPKAILLDEATA 1585

Query: 657  ALDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLY 716
            ++D  S+  I  T+ +       TI++IAHRL +I   + V+V+ + G + E      L 
Sbjct: 1586 SIDYASDAKIQQTIREEFSGS--TILTIAHRLRSIIDYDKVLVI-DSGELAEYDHPYTLL 1642

Query: 717  ADQQSELYKLLND 729
             ++ S  Y++  D
Sbjct: 1643 LNKGSLFYRMCED 1655

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 79/366 (21%), Positives = 167/366 (45%), Gaps = 35/366 (9%)

Query: 354 EQLSGVKTIQSFVAEGK---ELQR-----YNTAIRKVFLYGKKEALTNATFFSSTNVLGD 405
           E L  ++ I+ F  E K   ++Q+      +  +R+V ++    +L++  ++ +  ++  
Sbjct: 581 ETLQAIRIIKFFAWEDKFESDVQKIREMELSVMLRRVVVW----SLSSFVWYITPTLVAS 636

Query: 406 LSFLIVLAYGSHLVLQGGLTVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRL-- 463
            SF + + Y    VL   +    L+ F+L      + +  L +    L++ + +  R+  
Sbjct: 637 ASFCVYI-YVQGEVLTTPVAFTALSLFVLLR----NPLDQLCDIVFSLVQCSVSLRRIQN 691

Query: 464 FEMTDHAPSIKPTAGKPYVPGSGKISFKDVSFSYPTRPGNQI-FNKLNFTIEPGSNVCIV 522
           F   D  P  +    K       ++ F + +  +            LN   + G    IV
Sbjct: 692 FLDQDETPKYRQLTVK-----KDRLGFSNATIGWDHDSATDFKLKNLNIDFKIGKLNVIV 746

Query: 523 GPSGRGKSTITSLLLRYYNPSSGQI---TIDDQDISRLSCKSLRRHLGVVQQEPMLMSGS 579
           GP+G GK+++   LL   N S G+I    ++ ++   +    +   +G   Q   L++ +
Sbjct: 747 GPTGSGKTSLLMGLLGEINLSEGKIYVPALNPREDLVVDADGMTDSIGYCSQSAWLLNDT 806

Query: 580 IKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIA 639
           ++ N+ +    E   +   +V   C     +     G  T +G +G +LSGGQKQR+++A
Sbjct: 807 LRNNILFSAPYEA--NRYNAVIHACGLTRDLEILNAGDQTEVGEKGITLSGGQKQRVSLA 864

Query: 640 RALMKKPKILILDEATSALDVESEGAI--NYTLGKLMKSKELTIISIAHRLS-TIRRSEN 696
           RA+  + + ++LD+  SA+D  +   I  +   G LM+ +  T + ++H  + T++ ++ 
Sbjct: 865 RAMYSRARHILLDDCLSAVDSHTAQWIYKHCITGPLMEGR--TCVLVSHNTALTLKNADW 922

Query: 697 VIVLGN 702
           V++L N
Sbjct: 923 VVILEN 928

>Kwal_34.15770 s34 complement(51755..56065) [4311 bp, 1436 aa] {ON}
            YLL048C (YBT1) - bile acid transporter of ABC family
            [contig 274] PARTIAL
          Length = 1436

 Score =  155 bits (393), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 182/707 (25%), Positives = 304/707 (42%), Gaps = 107/707 (15%)

Query: 100  LQLTRLYSQKTVESQAKTPADKESQ------KSGTMEDEESPNMGYK--EVIRLFKLATH 151
            + L++L ++   ES   TP  K +Q      K G + +EE+ + G    EV + F     
Sbjct: 738  IDLSKLNAKIQEES---TPPKKTTQTEEDKIKLGKLVEEETKSEGVVSIEVYKWFAKLFG 794

Query: 152  DWKLLTFAIGLLAISSVIGMSIPKVIGMVLDAIKNTY------SSATGP----------V 195
             WK++ F   +  ++ V+  +I +   +   A  NTY      +S   P           
Sbjct: 795  GWKMVIFLASIFIVAQVV--NIFQTWWVRAWASHNTYGAVRYLASKIAPESTLNMFLPLS 852

Query: 196  GLDD---------LPPIVN-----------DLSMYEFLGIFAGALVIG--TVANFGRIVL 233
            GL++         +P  V             L +Y F+G F  ALV    T+ NF     
Sbjct: 853  GLENQFRSTVHINIPESVTVTKASKHSTMYYLLIYFFIG-FTQALVASSKTIINF----- 906

Query: 234  LRVLGEKLVARLRSNVIRKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFK 293
              + G     ++ + +++K+++    FFD   +G +++R S D   V + +T  V   F 
Sbjct: 907  --MAGLNASRKIFNLILKKVLYAKLRFFDSTPIGRIMNRFSKDIEAVDQELTPFVEGAFV 964

Query: 294  AXXXXXXXXXXXXXXSISLTSALLMFAPPLLIGALIYGKRIRMISRDLQESTGNLTRVSE 353
            +              +       +  A    +    Y    R + R    S   + +   
Sbjct: 965  SLVQCLSTVILIAYITPGFFVVAIFIAILYYLVGYFYMAGSRELKRFESISRSPIHQHFS 1024

Query: 354  EQLSGVKTIQSFVAEGKELQRYNTAI---RKVFLYGKKEALTNATFFSSTNVLGDLSFLI 410
            E L G+ TI++F  E + +Q     I    K F Y     + N       +++G     +
Sbjct: 1025 ETLVGITTIRAFGDERRFMQENLEKIDENNKPFFY---LWVANRWLAFRIDMIGAC---V 1078

Query: 411  VLAYGSHLVLQ-----GGLTVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFE 465
            + A G  ++L       GL    LT  + +TE        L   YS +     +  RL E
Sbjct: 1079 IFAAGIFVLLNIKSLDSGLAGISLTYAISFTE----GALWLVRLYSNVEMTMNSVERLKE 1134

Query: 466  M--TDHAPSIKPT-AGKPYVPGSGKISFKDVSFSY-PTRPGNQIFNKLNFTIEPGSNVCI 521
                +  P  + T    P  P  GKI   D+S  Y P+ P  ++   ++FT++P   V I
Sbjct: 1135 YMEVEQEPHYQSTHTPPPEWPSQGKIEVNDLSLRYAPSLP--KVIKNVSFTVDPNCKVGI 1192

Query: 522  VGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIK 581
            VG +G GKSTI + L R+ +P SG I ID+ DI+ +  K LR+ + ++ Q+P L +G++K
Sbjct: 1193 VGRTGAGKSTIITALFRFLDPESGYIKIDNVDITSVELKRLRQSITIIPQDPTLFTGTVK 1252

Query: 582  YNLT----------------YGLQSEVSMDEIRSVA--KKCFCHGFVTKFPNGYDTIIGP 623
             NL                   L +E  ++   S A          V KF    D  I  
Sbjct: 1253 SNLDPYDEYSDGQIFEALKRVNLLTEEELNSAGSPAPGNSSIHSENVNKFLR-LDNEITE 1311

Query: 624  RGASLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTL-GKLMKSKELTII 682
             GA+LS GQ+Q + +AR+L++ PK+++LDEAT+++D  S+  I  T+ G+   S   TI+
Sbjct: 1312 GGANLSQGQRQLVCLARSLLRSPKVMLLDEATASIDYTSDARIQQTIRGEFSNS---TIL 1368

Query: 683  SIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQSELYKLLND 729
            +IAHRL +I   + ++V+ + G V E      L  ++ S  Y +  D
Sbjct: 1369 TIAHRLRSIIDYDKILVM-DAGEVKEYDHPYSLLLNKNSIFYSMCED 1414

 Score = 76.6 bits (187), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 62/237 (26%), Positives = 118/237 (49%), Gaps = 13/237 (5%)

Query: 487 KISFKDVSFSYPTRPGNQIFNKLNFTIE--PGSNVCIVGPSGRGKSTITSLLLRYYNPSS 544
           +I F++ +FS+  +  N  F   N +IE   G    ++GP+G GK+++   LL   +   
Sbjct: 474 RIGFENATFSWDRK--NPDFKLKNMSIEFRLGKLNVVIGPTGSGKTSLLMGLLGEMDLLE 531

Query: 545 GQI---TIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVA 601
           G++    +D ++   +    +   +    Q   L++ ++K N+ +   S  +     +V 
Sbjct: 532 GKVYAPCLDPREDLIVENDGMTNSIAYCSQGAWLLNDTVKNNILFS--SPFNEARYDAVV 589

Query: 602 KKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVE 661
           + C           G  T IG +G +LSGGQKQR+++ARAL    + L+LD+  SA+D  
Sbjct: 590 EACGLKRDFEILSAGDQTEIGEKGITLSGGQKQRVSLARALYSSSRHLLLDDCLSAVDSH 649

Query: 662 SEGAI--NYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLY 716
           +   I  N   G LM+ +  T I ++H ++   ++ + +V   +G V + G+  +L+
Sbjct: 650 TALWIYENCITGPLMEGR--TCILVSHNVALTLKNADWVVFMENGKVKDQGEPLELF 704

>KLTH0H16038g Chr8 (1376941..1381890) [4950 bp, 1649 aa] {ON} similar
            to uniprot|P32386 Saccharomyces cerevisiae YLL048C
          Length = 1649

 Score =  155 bits (392), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 174/704 (24%), Positives = 311/704 (44%), Gaps = 120/704 (17%)

Query: 108  QKTVESQAKTPADKESQKSGTMEDEESPNMGYK--EVIRLFKLATHDWKLLTFAIGLLAI 165
            +K+     K   ++E  K G + +EE+ + G    EV + F      WK++ F   +  +
Sbjct: 962  EKSSVPSKKPLTEEERVKMGKLIEEETKSEGVVSIEVYKWFAKLFGGWKMVIFLASIFIV 1021

Query: 166  SSVIGM----------------SIPKVIGMVLDAIKNTYSSATGPVGLDD---LPPIVND 206
            +  + +                +  K I  +L   + T +     VGL++   + P++ +
Sbjct: 1022 AQCVYIFQSWWVRAWASHNTYDATRKFIARILP--EGTVNGLLPLVGLENQLSVSPVIEE 1079

Query: 207  -----------------LSMYEFLGIFAGALVIG--TVANFGRIVLLRVLGEKLVARLRS 247
                             L  Y F+G+ A A++    T+ NF       + G     ++ +
Sbjct: 1080 TVKPAVKKSKTHSTIYYLLFYFFIGV-AQAVIASSKTIINF-------MAGLNASRKIFN 1131

Query: 248  NVIRKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXX 307
             +++K+++    FFD   +G +++R S D   V + +T  V   F +             
Sbjct: 1132 LILKKVLYAKLRFFDSTPIGRIMNRFSRDIEAVDQELTPFVEGAFVSLVQ---------- 1181

Query: 308  XSISLTSALLM-------FAPPLLIGALIY--GKRIRMISRDLQE----STGNLTRVSEE 354
                L++ +L+       F   + IG   Y  G      SR+L+     S   + +   E
Sbjct: 1182 ---CLSTVILIAYITPDFFFVAIFIGIFYYLVGYFYMAGSRELKRYESISRSPIHQHFSE 1238

Query: 355  QLSGVKTIQSFVAEGKELQRYNTAI---RKVFLYGKKEALTNATFFSSTNVLGDLSFLIV 411
             L G+ TI++F  E + +Q   T I    K F Y     + N       +++G     ++
Sbjct: 1239 TLVGITTIRAFGDERRFMQENLTKIDENNKPFFY---LWVANRWLAFRIDMIGAC---VI 1292

Query: 412  LAYGSHLVLQ-----GGLTVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEM 466
             A G  ++L       GL    LT  + +TE        L   YS +     +  RL E 
Sbjct: 1293 FAAGIFVLLNIKSLDSGLAGISLTYAISFTE----GALWLVRLYSNVEMTMNSVERLKEY 1348

Query: 467  --TDHAPSIKPTAGKP-YVPGSGKISFKDVSFSY-PTRPGNQIFNKLNFTIEPGSNVCIV 522
               +  P  + T   P   P  GKI   D+S  Y P+ P  ++   + FT++P   V IV
Sbjct: 1349 MEVEQEPHYQSTHNPPPEWPSQGKIEVNDLSLRYAPSLP--KVIKNVTFTVDPNCKVGIV 1406

Query: 523  GPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKY 582
            G +G GKSTI + L R+ +P SG I ID+ DI+ +  K LR+ + ++ Q+P L +G++K 
Sbjct: 1407 GRTGAGKSTIITALFRFLDPESGYIKIDNVDITSVELKRLRQSITIIPQDPTLFTGTVKS 1466

Query: 583  NLT-YGLQSEVSMDE----IRSVAKKCFCHG---------FVTKFPNGY---DTIIGPRG 625
            NL  Y   S+  + E    +  V ++   H           V++  N +   +  I   G
Sbjct: 1467 NLDPYDEYSDKQIFEALKRVNLVTQEELDHAANPSPDNASAVSENVNKFLFLENEISEGG 1526

Query: 626  ASLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTIISIA 685
            ++LS GQ+Q + +AR+L++ PK+++LDEAT+++D +S+  I  T+    +  + TI++IA
Sbjct: 1527 SNLSQGQRQLVCLARSLLRSPKVMLLDEATASIDYQSDARIQQTIRS--EFSDSTILTIA 1584

Query: 686  HRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQSELYKLLND 729
            HRL +I   + ++V+ + G V E      L  ++ S  Y +  D
Sbjct: 1585 HRLRSIIDYDKILVM-DAGEVKEYDHPYSLLLNKNSIFYSMCED 1627

 Score = 81.3 bits (199), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 60/236 (25%), Positives = 115/236 (48%), Gaps = 9/236 (3%)

Query: 486 GKISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSG 545
            KI F++ +FS+  +  +     +N   + G    ++GP+G GK+++   LL   +   G
Sbjct: 687 NKIGFENATFSWDRKNPDFKLKNMNIDFKLGKLNVVIGPTGSGKTSLLMGLLGEMDLLEG 746

Query: 546 QI---TIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAK 602
           ++    +D ++   +    +   +    Q   L++ ++K N+ +   S  +     +V +
Sbjct: 747 KVYAPCLDPREDMVIENDGMTNSIAYCSQAAWLLNDTVKNNILFS--SPFNEGRYNAVIE 804

Query: 603 KCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVES 662
            C           G  T IG +G +LSGGQKQR+++ARAL    + L+LD+  SA+D  +
Sbjct: 805 ACGLKRDFEILSAGDQTEIGEKGITLSGGQKQRVSLARALYSSSRHLLLDDCLSAVDSHT 864

Query: 663 EGAI--NYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLY 716
              I  N   G LM+ +  T I ++H ++   ++   +V   +G V + G+  +LY
Sbjct: 865 ALWIYENCISGPLMEGR--TCILVSHNVALTLKNAEWVVFMENGRVKDQGEPLELY 918

>Skud_12.22 Chr12 complement(31933..36918) [4986 bp, 1661 aa] {ON}
            YLL048C (REAL)
          Length = 1661

 Score =  154 bits (388), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 172/682 (25%), Positives = 295/682 (43%), Gaps = 98/682 (14%)

Query: 114  QAKTPADKESQKSGTMEDEESPNMG------YKEVIRLFKLATHDWKLLTFAIGLLAISS 167
            Q     + E  + G + +EE+   G      YK  +++F      WK++TF + LL ++S
Sbjct: 982  QKPMRTEAERAEDGRLIEEETKEEGVVGMDVYKWYLKIFG----GWKIVTF-LALLFLTS 1036

Query: 168  ---VIGMS-----------IPKVIGMVLDAIK------------------NTYSSATGPV 195
                IG S           I K++ +   AI                   +T S+A+ P 
Sbjct: 1037 QLLYIGQSWWVRAWASHNVIAKIVPLAQSAIAFVSKKASDLIDWKGSFQVSTMSNASQPT 1096

Query: 196  GLDDLPPIVNDLSMYEFLGIFAGALVIG-TVANFGRIVLLRVLGEKLVARLRSNVIRKII 254
            G       +  L +Y  +G+    L  G T+ NF         G     ++ + ++ K++
Sbjct: 1097 GKHS---TMYYLILYLIIGLAQSLLGAGKTILNFAA-------GINASRKIFNMILNKVL 1146

Query: 255  HQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTS 314
            H    FFD    G +++R S D   + + +T  +   F +              +    S
Sbjct: 1147 HSKIRFFDATPTGRIMNRFSKDIEAIDQELTPYIQGAFYSLIECLSTVILITFITPQFLS 1206

Query: 315  ALLMFAPPLLIGALIYGKRIRMISRDLQESTGNLTRVSEEQLSGVKTIQSFVAEGKELQR 374
              ++ +         Y    R + R    S   + +   E L GV TI++F  EG+ +Q 
Sbjct: 1207 IAIVVSILYYFVGYFYMAGSRELKRFESISRSPIYQHFSETLVGVTTIRAFGDEGRFMQE 1266

Query: 375  YNTAI---RKVFLYGKKEALTNATFFSSTNVLGDLSF----LIVLAYGSHLVLQGGLTVG 427
                I    K F Y     + N       +++G L      L +L    H+    G+   
Sbjct: 1267 NLQKIDENNKPFFY---LWVANRWLAFRIDMIGSLVIFGAGLFILFNIDHI--DSGMAGI 1321

Query: 428  DLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEM--TDHAPSIKPTAGKP-YVPG 484
             LT  + +TE        L   YSE+     +  R+ E    +  P  +     P   P 
Sbjct: 1322 SLTYAISFTE----GALWLVRLYSEVEMNMNSVERVKEYMKIEQEPYNQHKEVPPSQWPQ 1377

Query: 485  SGKISFKDVSFSY-PTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPS 543
             GKI   D+S  Y P  P  ++ N ++F+++  S + IVG +G GKSTI + L R+  P 
Sbjct: 1378 DGKIEVNDLSLRYAPNLP--RVINNVSFSVDAQSKIGIVGRTGAGKSTIITALFRFLEPE 1435

Query: 544  SGQITIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLT-YGLQSEVSMDE----IR 598
            +G I ID+ DIS +  + LRR + ++ Q+P L SG+IK NL  Y   S+  + E    + 
Sbjct: 1436 TGHIKIDNIDISGVDLQRLRRSITIIPQDPTLFSGTIKTNLDPYDEFSDKKIFEALKRVN 1495

Query: 599  SVAKKCFCHGFVTKFPN--------------GYDTIIGPRGASLSGGQKQRIAIARALMK 644
             ++++    G V +  N                 + +   G++LS GQ+Q + +AR+L++
Sbjct: 1496 LISEEQSHQGAVREADNDTSSNSSENINKFLDLSSEVSEGGSNLSQGQRQLMCLARSLLR 1555

Query: 645  KPKILILDEATSALDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDG 704
             PKI++LDEAT+++D  S+  I  T+ K  +    TI++IAHRL ++   + ++V+ + G
Sbjct: 1556 SPKIILLDEATASIDYSSDAKIQETIRKEFQGS--TILTIAHRLRSVIDYDKILVM-DAG 1612

Query: 705  SVVEVGKFKDLYADQQSELYKL 726
             V E      L  ++QS  Y +
Sbjct: 1613 EVKEYDHPYSLLLNKQSIFYSM 1634

 Score = 79.0 bits (193), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 59/238 (24%), Positives = 113/238 (47%), Gaps = 9/238 (3%)

Query: 483 PGSGKISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNP 542
           P   + + ++ + S+     +     LN   + G    ++GP+G GK+++   LL     
Sbjct: 689 PNGKRFALENSTISWDKDNQDFKLKDLNIEFKTGKLNVVIGPTGSGKTSLLMALLGEMYL 748

Query: 543 SSGQITIDDQDISR---LSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRS 599
            +G+I +   +  +   +        +    Q   L++ +IK+N+ +   S  +    ++
Sbjct: 749 LNGKIVVPALEPRQELVVDANGTTNSIAYCSQGAWLLNDTIKHNILFN--SPFNEARYKA 806

Query: 600 VAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALD 659
           V + C           G  T IG +G +LSGGQKQR+++ARAL    + ++LD+  SA+D
Sbjct: 807 VVEACGLKRDFEILKAGDLTEIGEKGIALSGGQKQRVSLARALYSNARHVLLDDCLSAVD 866

Query: 660 VESEGAI--NYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDL 715
             +   I  N   G LM+ +  T I ++H ++   R+  ++VL  DG + + G   D+
Sbjct: 867 SHTASWIYDNCITGPLMEDR--TCILVSHNIALTLRNAELVVLLEDGRIKDQGDPIDM 922

>KNAG0J02730 Chr10 complement(512373..516986) [4614 bp, 1537 aa] {ON} 
          Length = 1537

 Score =  154 bits (388), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 151/548 (27%), Positives = 253/548 (46%), Gaps = 44/548 (8%)

Query: 206  DLSMYEFLGIFAGALVIGTVA----NFGRIVLLRVLGEKLVARLRSNVIRKIIHQDAEFF 261
            ++ +++F+GI+A   +IG  +    N   I+LL     +   +L  N+   I++   +FF
Sbjct: 1000 NIDVWKFVGIYA---LIGIASAAFNNLRTIILLVYCTIRGAKKLHDNMAHAIVYSSMQFF 1056

Query: 262  DRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTSALLMFAP 321
            +   +G +++R S+D   V  ++       FK+              +IS+    L+F  
Sbjct: 1057 ETTPIGRILNRFSADIDTVDSTLQMVFMVFFKSIFSYLITVILI---TISM-PLFLVFCL 1112

Query: 322  PLLIGALIYGKRIRMISRDLQESTG----NLTRVSEEQLSGVKTIQSF--VAEGKEL--Q 373
             L++  + Y K   + SR+L+  T      +  +  E L G+  I+++   +  K L  +
Sbjct: 1113 FLMVIYIYYQKLFIVQSRELKRMTSISYSPIMSLVGESLGGLAVIRAYKHFSMFKYLNNE 1172

Query: 374  RYNTAIRKVFLYGKKEALTNATFFSSTNVLGDLSFLIV-LAYGSHLVLQGGLTVGDLTAF 432
            R    I  VF Y      TN         +G L  LI  +   S +     LT G +   
Sbjct: 1173 RVQFNINCVFDYRS----TNRWLSIRLQTIGALMVLITGMLSLSTISSSKPLTAGMVGLL 1228

Query: 433  MLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHAPSIKPTAGKPYVPGS-----GK 487
            M Y     +++  +      +  G  +  R+ E  +  PS        Y P S     G 
Sbjct: 1229 MSYVLQVTTSLMWIVRSSVMIETGIVSVERIMEYCE-LPSEAEQIVDDYRPASNWPSKGA 1287

Query: 488  ISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQI 547
            I FK+ S  Y     + +   ++  I PG  V IVG +G GKST+T  L R   P  G I
Sbjct: 1288 IQFKNYSTRYRANL-DPVLKNISININPGEKVGIVGRTGAGKSTLTLALFRLLEPIEGTI 1346

Query: 548  TIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNL-------TYGLQSEVSMDEIRSV 600
             ID  DIS++    LR HL ++ Q+     G+++ NL          L + +++  ++  
Sbjct: 1347 IIDGMDISKIGISDLRSHLAIIPQDAQAFEGTVRSNLDPFNMFSDKELDTAITLSHLKPH 1406

Query: 601  AKKCFCHGFVTKFP-NGYDTI-IGPRGASLSGGQKQRIAIARALMKKPKILILDEATSAL 658
             KK       ++ P N Y  + I   G+SLS GQ+Q + +ARAL+ + KIL+LDEAT+++
Sbjct: 1407 LKKLMEES-GSELPLNDYLELGIKESGSSLSVGQRQLLCLARALLNRSKILVLDEATASV 1465

Query: 659  DVESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYAD 718
            DVE++  I  T+ +    +  TII+IAHR+ T+  S+ ++VL   G V E      L AD
Sbjct: 1466 DVETDKIIQATIRESFSDR--TIITIAHRIDTVLDSDRILVL-EQGEVKEFNSPASLLAD 1522

Query: 719  QQSELYKL 726
            + +  Y+L
Sbjct: 1523 KSTLFYQL 1530

 Score = 79.7 bits (195), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 70/253 (27%), Positives = 119/253 (47%), Gaps = 33/253 (13%)

Query: 484 GSGKISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPS 543
           GS  ++ KD+ F               F  +     C+VG  G GK+T+   +L     +
Sbjct: 642 GSTVVALKDIDF---------------FRAKKNVLTCVVGRVGSGKTTLLKSILGQLPCT 686

Query: 544 SG-QITIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAK 602
           SG Q  I  + I R         +    QE  +M+ SIK N+ +G + + +   +    K
Sbjct: 687 SGSQKAIPPKLIIR------GESVAYCPQEAWIMNDSIKENILFGHRYDETFYNL--TVK 738

Query: 603 KCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVES 662
            C         P+G +T++G +G +LSGGQK R+++ARA+  +  I +LD+  SA+D   
Sbjct: 739 ACELRPDFKILPDGDNTLVGEKGITLSGGQKARLSLARAVYSRSDIYLLDDVLSAVDAGV 798

Query: 663 EGAINYTL----GKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYAD 718
             +I + +      L+K+K   II   + +S +  S+ + VL  DG ++E   + +   D
Sbjct: 799 RKSIIHRVLDSDTGLLKNK--AIILTTNDISVLEHSDRIYVL-QDGRIIEESTYAEAIED 855

Query: 719 QQSE--LYKLLND 729
              +  LYKLL +
Sbjct: 856 NDVKPFLYKLLKE 868

>YLL048C Chr12 complement(41280..46265) [4986 bp, 1661 aa] {ON}
            YBT1Transporter of the ATP-binding cassette (ABC) family
            involved in bile acid transport; similar to mammalian
            bile transporters
          Length = 1661

 Score =  154 bits (388), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 175/683 (25%), Positives = 300/683 (43%), Gaps = 94/683 (13%)

Query: 108  QKTVESQAKTPADKESQKSGTMEDEESPNMGYKEVIRLFKLATHDWKLLTFAIGLLAISS 167
            QK++ ++A+   D +  K  T E+       YK  +++F      WK+++F   L  I+ 
Sbjct: 982  QKSLRTEAERTEDGKLIKEETKEEGVVGLDVYKWYLKIFG----GWKIVSFLASLFLIAQ 1037

Query: 168  V--IGMS-----------IPKVIGMVLDAI-----KNTY------SSATGPVGLDDLPP- 202
            +  IG S           I K+I     AI     K ++      SS       ++ P  
Sbjct: 1038 LLYIGQSWWVRAWASHNVIAKIIPRAQRAIAFISKKASHLIDWRGSSQISMASAENQPSS 1097

Query: 203  ---IVNDLSMYEFLGIFAGALVIGTVANFGRIVLLRVLGEKLVARLRSNVIRKIIHQDAE 259
                +  L +Y  +G FA AL +G     G+ +L  V G     ++ + ++ K++H    
Sbjct: 1098 GHSTMYYLVLYLIIG-FAQAL-LGA----GKTILNFVAGINASRKIFNMILNKVLHSKIR 1151

Query: 260  FFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTSALLMF 319
            FFD    G +++R S D   + + +T  +   F +              +    S  ++ 
Sbjct: 1152 FFDATPTGRIMNRFSKDIEAIDQELTPYIQGAFYSLIECLSTVILITFITPQFLSVAIVV 1211

Query: 320  APPLLIGALIYGKRIRMISRDLQESTGNLTRVSEEQLSGVKTIQSFVAEGKELQRYNTAI 379
            +         Y    R + R    S   + +   E L GV TI++F  EG+ +Q     I
Sbjct: 1212 SILYYFVGYFYMAGSRELKRFESISRSPIYQHFSETLVGVTTIRAFGDEGRFMQENLHKI 1271

Query: 380  ---RKVFLYGKKEALTNATFFSSTNVLGDLSFLIVLAYGSHLV-----LQGGLTVGDLTA 431
                K F Y     + N       +++G L   ++   G  ++     L  G+    LT 
Sbjct: 1272 DENNKPFFY---LWVANRWLAFRIDMIGSL---VIFGAGLFILFNINNLDSGMAGISLTY 1325

Query: 432  FMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTD-------HAPSIKPTAGKPYVPG 484
             + +TE        L   YSE+     +  R+ E  +           I P    P  P 
Sbjct: 1326 AISFTE----GALWLVRLYSEVEMNMNSVERVKEYMEIEQEPYNEHKEIPP----PQWPQ 1377

Query: 485  SGKISFKDVSFSY-PTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPS 543
             GKI   D+S  Y P  P  ++   ++F+++  S + IVG +G GKSTI + L R+  P 
Sbjct: 1378 DGKIEVNDLSLRYAPNLP--RVIKNVSFSVDAQSKIGIVGRTGAGKSTIITALFRFLEPE 1435

Query: 544  SGQITIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLT-YGLQSEVSMDE----IR 598
            +G I ID+ DIS +  + LRR + ++ Q+P L SG+IK NL  Y   S+  + E    + 
Sbjct: 1436 TGHIKIDNIDISGVDLQRLRRSITIIPQDPTLFSGTIKTNLDPYDEFSDRQIFEALKRVN 1495

Query: 599  SVAKKCFCHGF---------------VTKFPNGYDTIIGPRGASLSGGQKQRIAIARALM 643
             ++++    G                V KF +   + I   G++LS GQ+Q + +AR+L+
Sbjct: 1496 LISEEQLQQGATRETSNEASSTNSENVNKFLD-LSSEISEGGSNLSQGQRQLMCLARSLL 1554

Query: 644  KKPKILILDEATSALDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGND 703
            + PKI++LDEAT+++D  S+  I  T+ K  +    TI++IAHRL ++   + ++V+ + 
Sbjct: 1555 RSPKIILLDEATASIDYSSDAKIQETIRKEFQGS--TILTIAHRLRSVIDYDKILVM-DA 1611

Query: 704  GSVVEVGKFKDLYADQQSELYKL 726
            G V E      L  ++QS  Y +
Sbjct: 1612 GEVKEYDHPYSLLLNKQSAFYSM 1634

 Score = 80.5 bits (197), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 59/238 (24%), Positives = 113/238 (47%), Gaps = 9/238 (3%)

Query: 483 PGSGKISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNP 542
           P   + +F++ + S+     +     LN   + G    ++GP+G GK+++   LL     
Sbjct: 689 PNGNRFAFENSTISWDKDNQDFKLKDLNIEFKTGKLNVVIGPTGSGKTSLLMALLGEMYL 748

Query: 543 SSGQITIDDQDISR---LSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRS 599
            +G++ +   +  +   +        +    Q   L++ ++K N+ +   S  +    ++
Sbjct: 749 LNGKVVVPALEPRQELIVDANGTTNSIAYCSQAAWLLNDTVKNNILFN--SPFNEARYKA 806

Query: 600 VAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALD 659
           V + C           G  T IG +G +LSGGQKQR+++ARAL    + ++LD+  SA+D
Sbjct: 807 VVEACGLKRDFEILKAGDLTEIGEKGITLSGGQKQRVSLARALYSNARHVLLDDCLSAVD 866

Query: 660 VESEGAI--NYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDL 715
             +   I  N   G LM+ +  T I ++H ++   R+  ++VL  DG V + G   D+
Sbjct: 867 SHTASWIYDNCITGPLMEDR--TCILVSHNIALTLRNAELVVLLEDGRVKDQGDPIDM 922

>Smik_12.11 Chr12 complement(26055..31040) [4986 bp, 1661 aa] {ON}
            YLL048C (REAL)
          Length = 1661

 Score =  154 bits (388), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 179/735 (24%), Positives = 320/735 (43%), Gaps = 88/735 (11%)

Query: 57   LKRGTFGISAFHCQASHTNRTLTPRIQETRFETHSLRLSVPRTLQLTRLYSQKTVESQA- 115
            L+RG FG      ++S  +R  +     T+  T    L+V +  Q++   +    E++  
Sbjct: 923  LQRGLFGEDEL-VKSSILSRANSSANLATKSSTSLSNLAVAKEQQVSMNNNSPQFEAKKL 981

Query: 116  KTPADKESQKS--GTMEDEESPNMG------YKEVIRLFKLATHDWKLLTFAIGLLAISS 167
            + P   E++++  G + +EE+   G      YK  +++F      WK+++F   L  IS 
Sbjct: 982  QKPLRTEAERTEDGKLIEEETKEEGVVGMAVYKWYLKIFG----GWKIVSFLASLFLISQ 1037

Query: 168  V--IGMS-----------IPKVIGMVLDAIKNTYSSATGPVGL----------DDLPPIV 204
            +  IG S           I K++ +   AI      A+  +                P  
Sbjct: 1038 LLYIGQSWWVRAWASHNVIAKIVPIAQRAIAFVSKEASHLIDWRGSFQVNMASSGNQPTS 1097

Query: 205  NDLSMYEFLGIFAGALVIGTVANF---GRIVLLRVLGEKLVARLRSNVIRKIIHQDAEFF 261
               +MY +L ++   L+IG   +    G+ +L  V G     ++ + ++ K++H    FF
Sbjct: 1098 KHSTMY-YLILY---LIIGLAQSLLGAGKTILNFVAGINASRKIFNMILNKVLHSKIRFF 1153

Query: 262  DRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTSALLMFAP 321
            D    G +++R S D   + + +T  +   F +              +    S  ++ + 
Sbjct: 1154 DATPTGRIMNRFSKDIEAIDQELTPYIQGAFYSLIECLSTVILITFITPQFLSVAIVVSI 1213

Query: 322  PLLIGALIYGKRIRMISRDLQESTGNLTRVSEEQLSGVKTIQSFVAEGKELQRYNTAI-- 379
                    Y    R + R    S   + +   E L GV TI++F  EG+ +Q     I  
Sbjct: 1214 LYYFVGYFYMAGSRELKRFESISRSPIYQHFSETLVGVTTIRAFGDEGRFMQENLQKIDE 1273

Query: 380  -RKVFLYGKKEALTNATFFSSTNVLGDLSF----LIVLAYGSHLVLQGGLTVGDLTAFML 434
              K F Y     + N       +++G L      L +L   +HL    G+    LT  + 
Sbjct: 1274 NNKPFFY---LWVANRWLAFRIDMIGSLVIFGAGLFILFNINHL--DSGMAGISLTYAIS 1328

Query: 435  YTEYTGSAVFGLSNFYSELMKGAGAASRL---FEMTDHAPSIKPTAGKPYVPGSGKISFK 491
            +TE        L   Y+E+     +  R+    E+     +       P  P  GKI   
Sbjct: 1329 FTE----GALWLVRLYAEVEMNMNSVERVKEYMEIEQEPYNQHKEVPPPQWPQDGKIEVN 1384

Query: 492  DVSFSY-PTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITID 550
            D+S  Y P  P  ++   ++F+++  S + IVG +G GKSTI + L R+  P +G I ID
Sbjct: 1385 DLSLRYAPNLP--RVIKNVSFSVDAQSKIGIVGRTGAGKSTIITALFRFLEPETGHIKID 1442

Query: 551  DQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLT-YGLQSEVSMDE----IRSVAKKCF 605
            + DIS +  + LRR + ++ Q+P L SG+IK NL  Y   S+  + E    +  ++++  
Sbjct: 1443 NIDISGVDLQRLRRSITIIPQDPTLFSGTIKTNLDPYDEFSDRKIFEALKRVNLISEEQS 1502

Query: 606  CHGFVTKFPNGYDTI--------------IGPRGASLSGGQKQRIAIARALMKKPKILIL 651
              G   +  N   +               +   G++LS GQ+Q + +AR+L++ PKI++L
Sbjct: 1503 QQGTTREADNDNSSTNSENVNKFLDLSSEVSEGGSNLSQGQRQLMCLARSLLRSPKIILL 1562

Query: 652  DEATSALDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGK 711
            DEAT+++D  S+  I  T+ K  +    TI++IAHRL ++   + ++V+ + G V E   
Sbjct: 1563 DEATASIDYGSDAKIQETIRKEFQGS--TILTIAHRLRSVIDYDKILVM-DAGEVKEYDH 1619

Query: 712  FKDLYADQQSELYKL 726
               L  ++QS  Y +
Sbjct: 1620 PYSLLLNKQSIFYSM 1634

 Score = 80.5 bits (197), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 60/238 (25%), Positives = 113/238 (47%), Gaps = 9/238 (3%)

Query: 483 PGSGKISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNP 542
           P   + +F++ + S+     +     LN   + G    ++GP+G GK+++   LL     
Sbjct: 689 PNGKRFAFENSTISWDKDNQDFKLKDLNIEFKTGKLNVVIGPTGSGKTSLLMALLGEMYL 748

Query: 543 SSGQITIDDQDISR---LSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRS 599
            SG++ +   +  +   +        +    Q   L++ ++K N+ +   S  +    ++
Sbjct: 749 LSGKVVVPALEPRQELVVDANGTTNAIAYCSQGAWLLNDTVKNNILFN--SPFNEARYKA 806

Query: 600 VAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALD 659
           V + C           G  T IG +G +LSGGQKQR+++ARAL    + ++LD+  SA+D
Sbjct: 807 VVEACGLKRDFEILKAGDLTEIGEKGITLSGGQKQRVSLARALYSNARHVLLDDCLSAVD 866

Query: 660 VESEGAI--NYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDL 715
             +   I  N   G LM+ +  T I ++H ++   R+  ++VL  DG V + G   D+
Sbjct: 867 SHTASWIYDNCITGPLMEDR--TCILVSHNIALTLRNAELVVLLEDGRVKDQGDPIDM 922

>Suva_8.16 Chr8 complement(29573..34372) [4800 bp, 1599 aa] {ON}
            YHL035C (REAL)
          Length = 1599

 Score =  153 bits (387), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 186/698 (26%), Positives = 313/698 (44%), Gaps = 101/698 (14%)

Query: 95   SVPRTLQLTRLYSQKTV-ESQAKTPADKESQKSGTMEDEESPNMG-----YKEVIRLFKL 148
            SV  T  L    SQKT   ++ K   +   QK   ++DE+  N       YK  ++ F  
Sbjct: 920  SVNETSDLQESDSQKTKGVTENKESGEDLVQKGQLVKDEQKSNGAISLDVYKWYLKYFG- 978

Query: 149  ATHDWKLLTFAIGLLAISSVIGMSIPKVIGMVLDAIK----NTYSSATG-PVG---LDDL 200
                WK L+    L  I+ V+ +S    I   ++ IK    N+  S  G P+    L+ L
Sbjct: 979  ---GWKALSALFTLYIITQVLFISQSWWIRYWVNDIKPHIENSGVSINGLPLKGSVLERL 1035

Query: 201  PPIVNDLSMYEFLGI-----FAGALV--IGTVANFGRIVLLRVLGEKLVARLRSNVIRKI 253
             P+ N  +M  +LG+     F  AL+  I  +A F         G +   ++  N++  +
Sbjct: 1036 GPLKNKHTMLYYLGMYFAIGFIQALLGGIKNIATFFS-------GIQASRKIFDNMLDLV 1088

Query: 254  IHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSISLT 313
            +H    FFD   +G +++R + D   V + +T  +    +                  +T
Sbjct: 1089 LHAKIRFFDVTPIGRIMNRFAKDIEGVDQELTPYL----EVTMFCLIQCTSIIFLITIIT 1144

Query: 314  SALLMFAPPLLIGALIYGKRIRMISRDLQE----STGNLTRVSEEQLSGVKTIQSFVAEG 369
               L+ A  + I     G      SR+L+     +   + +   E L GV TI++F  E 
Sbjct: 1145 PHFLIVAVVVFILYYFVGMWYLTASRELKRIDSITKSPIFQHFSETLVGVCTIRAFGDEK 1204

Query: 370  K----ELQRYNTAIRKVFLYGKKEALTNATFFSSTNVLGDLSFLIVLAYGSHLVLQ---- 421
            +     L + +   R  F      ++    F    +++G     IVLA GS +++     
Sbjct: 1205 RFILENLDKIDQNNRAFFYL----SVAVKWFAFRVDIIGAF---IVLASGSFILINIGNI 1257

Query: 422  -GGLTVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMT------------D 468
              GL    LT  +L+T+        L   YS       +  RL E +            D
Sbjct: 1258 DSGLAGISLTYAILFTD----GALWLVRLYSTFEMSMNSVERLKEYSSIEQENYFDYNKD 1313

Query: 469  HAPSIKPTAGKPYVPGSGKISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRG 528
            H   ++ ++     P  G+I   ++S  Y +     I N ++FTIEP S V IVG +G G
Sbjct: 1314 HIQELQQSSW----PEHGQIEVDNLSLRYASNLPPVIKN-VSFTIEPQSKVGIVGRTGAG 1368

Query: 529  KSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNL---- 584
            KSTI + L R   P +G I ID  DIS++   +LRR + ++ Q+P+L +G+IK N+    
Sbjct: 1369 KSTIITALFRLLEPETGHIKIDGYDISQIDLVTLRRAITIIPQDPILFTGTIKSNVDPCD 1428

Query: 585  ------TYGLQSEVS------MDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQ 632
                   + + S+V+      M+  +++      +    KF N   T I   G ++S G+
Sbjct: 1429 EYDNKKIFKVLSQVNLISTGEMEAAQNMGDD--SNTARNKFVN-LQTEITEGGQNISQGE 1485

Query: 633  KQRIAIARALMKKPKILILDEATSALDVESEGAINYTL-GKLMKSKELTIISIAHRLSTI 691
            +Q + IAR+L+++PKI++LDEATS++D ES+  I   +  +  KS   TI++IAHRL ++
Sbjct: 1486 RQLLFIARSLLREPKIILLDEATSSIDYESDHLIQGIIRNEFNKS---TILTIAHRLRSV 1542

Query: 692  RRSENVIVLGNDGSVVEVGKFKDLYADQQSELYKLLND 729
               + V+V+ + G + E     +L  ++QS  Y +  D
Sbjct: 1543 IDYDRVLVM-DAGEIKEYDHPYNLLKNEQSIFYSMCRD 1579

 Score = 85.1 bits (209), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 101/378 (26%), Positives = 169/378 (44%), Gaps = 30/378 (7%)

Query: 354 EQLSGVKTIQSFVAEG---KELQ--RYNTAIRKVFLYGKKEALTNATFFSSTNVLGDLSF 408
           E L  ++ ++ F  E    K+++  R N  +R +F      AL++  +F +  ++  ++F
Sbjct: 534 ECLQNIRIVKYFAWENNISKDIKSIRQN-ELRFLFQKALVWALSSFLWFVTPTLVTGVTF 592

Query: 409 LIVLAYGSHLVLQGGLTVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTD 468
            I + +  H  L   L    L+ F L      + +  LSN  S + +   +  R+ +  +
Sbjct: 593 AIYI-FVQHQELNAPLAFTTLSLFTLLK----TPLDQLSNMLSFMNQSIVSLDRIVKFIN 647

Query: 469 HAPSIKPTAGKPYVPGSGKISFKDVSFSYPTRPGNQIFNKL---NFTIEPGSNVCIVGPS 525
              + K        P   KI FK+ + ++     +    KL   N T + G    I+G +
Sbjct: 648 EDDTEKYNQ-LTVSPDENKIEFKNATLTWNENDKDSTIFKLCGLNITFQIGKLNLILGST 706

Query: 526 GRGKSTITSLLLRYYNPSSGQITIDD----QDISRLSCKSLRRHLGVVQQEPMLMSGSIK 581
           G GKS +   LL   +  SG IT+       D+       L        Q   L++ ++K
Sbjct: 707 GSGKSALLMGLLGELHLISGSITVPGLEPRHDLIP-DHNGLTNSFAYCSQSAWLLNDTVK 765

Query: 582 YNLTY-GLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIAR 640
            N+ + G   +V   E   V   C     +   P G  T IG +G +LSGGQKQRI++AR
Sbjct: 766 NNIIFNGAYDDVRYKE---VIDACGLKRDLEILPAGDSTEIGEKGITLSGGQKQRISLAR 822

Query: 641 ALMKKPKILILDEATSALDVESEGAI--NYTLGKLMKSKELTIISIAHRLS-TIRRSENV 697
           A+    K ++LD+  SA+D  +   I  N   G +M+++  T I + H +S TIR +   
Sbjct: 823 AVYSNAKHVLLDDCLSAVDSHTAVWIYENCITGPIMENR--TCILVTHNVSLTIREAYFA 880

Query: 698 IVLGNDGSVVEVGKFKDL 715
           ++L N G V   G  K L
Sbjct: 881 VILEN-GKVKNQGTIKQL 897

>CAGL0E03982g Chr5 (378442..383421) [4980 bp, 1659 aa] {ON} similar to
            uniprot|P32386 Saccharomyces cerevisiae YLL048c YBT1
            yeast bile transporter
          Length = 1659

 Score =  153 bits (387), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 152/564 (26%), Positives = 251/564 (44%), Gaps = 83/564 (14%)

Query: 207  LSMYEFLGI----FAGALVIGTVANFGRIVLLRVLGEKLVARLRSNVIRKIIHQDAEFFD 262
            LS+Y  +GI    FAG     TV NF       V G     R+   ++ K++H    F D
Sbjct: 1110 LSIYFAIGITQALFAGT---KTVINF-------VAGINASRRIFKKLLSKVLHSRLRFID 1159

Query: 263  RNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTSALLMFAPP 322
               +G +++R S D   V + +T  +   F                 IS    +    P 
Sbjct: 1160 STPIGRIMNRFSKDIEAVDQELTPFLEAAFFCLVQ-----------CISTIILITFITPQ 1208

Query: 323  LLIGALIYGKRIRMISRDLQESTGNLTRVSE-----------EQLSGVKTIQSFVAEGKE 371
             L  A++      ++      ++  L R+             E L+GV TI++F   G E
Sbjct: 1209 FLFVAVLVCVLYYLVGYFYINTSRELKRIESITKSPIYQHFSETLTGVATIRAF---GDE 1265

Query: 372  LQRYNTAIRKV------FLYGKKEALTNATFFSSTNVLGDLSFLIVLAYGSHLVLQ---- 421
            ++     + K+      F Y     + N       +++G L   I+   G  ++L     
Sbjct: 1266 IRFIMHNLEKIDENNKPFFY---LWVANRWLAFRIDMIGAL---IIFGSGVFILLNLNRI 1319

Query: 422  -GGLTVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTD--HAPSIKPT-A 477
              G+    LT  + +TE        L  FYS +     +  RL E  D    P  + T  
Sbjct: 1320 DSGMAGISLTYAISFTE----GALWLVRFYSTVEMNMNSVERLKEYMDVPQEPYNEGTIT 1375

Query: 478  GKPYVPGSGKISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLL 537
                 P  GKI  KD+S  Y      ++  +++F IEP + V IVG +G GKSTI + L 
Sbjct: 1376 TSTNWPTEGKIEVKDLSLRYAENLP-RVIKEVSFDIEPHNMVGIVGRTGAGKSTIITALF 1434

Query: 538  RYYNPSSGQITIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNL----------TYG 587
            R+  P +G I ID  DI+ +  ++LRR + ++ Q+P L +G+I+ NL           + 
Sbjct: 1435 RFLEPETGSIKIDGIDITSIDLQTLRRSITIIPQDPTLFTGTIRSNLDPFGKYPDEEIFR 1494

Query: 588  LQSEVSM---DEI--RSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARAL 642
            +   V++   DE+  +S          V KF N  +  I   G +LS GQKQ + +ARAL
Sbjct: 1495 VLHRVNLIDDDEMTAQSSDNNSLSSDNVNKFLN-LENEITEGGNNLSQGQKQLMCLARAL 1553

Query: 643  MKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGN 702
            ++ PK+++LDEAT+++D  S+  I  T+  +      T+++IAHRL ++   + ++V+ +
Sbjct: 1554 LRNPKVILLDEATASIDYASDAKIQQTIRNVFDKS--TVLTIAHRLRSVIDYDKILVM-D 1610

Query: 703  DGSVVEVGKFKDLYADQQSELYKL 726
             G V+E  +   L  D+ S  Y +
Sbjct: 1611 AGEVIEYDQPYTLLLDKNSHFYSM 1634

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 123/556 (22%), Positives = 230/556 (41%), Gaps = 68/556 (12%)

Query: 197 LDDLPPIVNDLSMYEFLGIFAGALVIGTVAN----FGRIVLLRVLGEKLVARLRSNVIRK 252
           +DD      +L+ +   G+ A  + +         FGR V +R L   +++ + S  +R+
Sbjct: 392 VDDPTTASANLAWFYVFGMLACRIFVAITQAQALFFGRRVCIR-LKSIIISEVYSKALRR 450

Query: 253 IIHQDAEF-------FDRNKVGDLISRLSS-DAYVVSRSMTQNVS--------DGFK--- 293
            +  + +F        D N+  D ++ L+  D     +  T N+         D FK   
Sbjct: 451 SVAANNKFGDEEPNKADANQDNDTLANLNDGDKESSEKDQTSNIGAIINLMAVDAFKVSE 510

Query: 294 --AXXXXXXXXXXXXXXSISLTSALLMFAPP----LLIGALIYGKRIRMISRDLQESTGN 347
             A              + SL   LL +A      ++IG +    ++  +    Q+    
Sbjct: 511 ICAYLHTFIEAMVMSVVAFSLLYKLLGYAAIVGILIVIGMIPVNFKLVSLMGKYQKKALG 570

Query: 348 LT--RVSE--EQLSGVKTIQSFVAEGK-----------ELQRYNTAIRKVFLYGKKEALT 392
           +T  R+ +  E L  ++ I+ F  E             E+Q Y   I K + +    A +
Sbjct: 571 ITDKRIQKLNEALQAIRIIKFFSWEDNFFSEIDEIREAEIQMY---INKAYAW----AFS 623

Query: 393 NATFFSSTNVLGDLSFLIVLAYGSHLVLQGGLTVGDLTAFMLYTEYTGSAVFGLSNFYSE 452
              +F +  ++   SF + + Y    VL   +    L  F L  +        LSN  S 
Sbjct: 624 AFIWFLTPTIVTGASFTVYI-YVQKQVLTAPVAFTALALFQLLKQPLDQ----LSNMLSY 678

Query: 453 LMKGAGAASRLFEMTDHAPSIKPTAGKPYVPGSGKISFKDVSFSYPTRPGNQIFNKLNFT 512
           +++   +  R+    D   + K    K   P   K++F++ + ++     +     L+  
Sbjct: 679 VIQSKVSLDRVQNFLDEEDTQKYNQLK-VAPDGNKLAFENATIAWSNNNQDFKLKDLDIN 737

Query: 513 IEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISR---LSCKSLRRHLGVV 569
            + G    ++GP+G GK+++   LL      SG+I +   D      +    +   +   
Sbjct: 738 FKIGKLNVVIGPTGSGKTSLLLALLGEMQLLSGRIVVPSLDARHEMLIDSDGMTNSIAYC 797

Query: 570 QQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGASLS 629
            Q   L++ +++ N+ +   S  + D  + V   C        F  G  T IG +G +LS
Sbjct: 798 SQSAWLLNDTVRNNILF--YSPYNEDRYKEVIIACGLKRDFELFDAGDQTEIGEKGITLS 855

Query: 630 GGQKQRIAIARALMKKPKILILDEATSALDVESEGAI--NYTLGKLMKSKELTIISIAHR 687
           GGQKQRI++ARAL    + L+LD+  SA+D  +   I  N   G LM+ +  T + ++H 
Sbjct: 856 GGQKQRISLARALYSNCRHLLLDDCLSAVDSHTAAWIYDNCITGPLMEGR--TCVLVSHN 913

Query: 688 LS-TIRRSENVIVLGN 702
           ++ T++ +E V++L N
Sbjct: 914 IALTLKNAELVVMLEN 929

>CAGL0E03355g Chr5 complement(307479..312086) [4608 bp, 1535 aa] {ON}
            similar to uniprot|P14772 Saccharomyces cerevisiae
            YLL015w BPT1 or uniprot|P39109 Saccharomyces cerevisiae
            YDR135c YCF1
          Length = 1535

 Score =  152 bits (384), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 150/558 (26%), Positives = 262/558 (46%), Gaps = 52/558 (9%)

Query: 206  DLSMYEFLGIFAGALVIGTVANFGRIVLLRVLGEKLVAR-LRSNVIRKIIHQDAEFFDRN 264
            + ++  FLG++A   + G   N  R + + + G    +R L + + + I+     FF+  
Sbjct: 988  NYNLLWFLGVYAAIGLGGAFCNNMRSLTMLLYGSLRGSRKLHNKMAKTIMRSPMSFFETT 1047

Query: 265  KVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTSALLMFAPPLL 324
              G +I+R SSD   V  ++ QNV   F                ++ L     +    LL
Sbjct: 1048 PTGRIINRFSSDMDSVDTTL-QNVFSLFFRSILDYIITVILVTFNMPL---FFLLNAGLL 1103

Query: 325  IGALIYGKRIRMISRDLQE----STGNLTRVSEEQLSGVKTIQSFVAEGKELQRYNTAIR 380
            +  L Y     ++SR+L+     S   +  +  E LSG  TI ++    ++++R++    
Sbjct: 1104 VIYLYYQSFYIVLSRELKRLTSISYSPIMSLMGESLSGHFTISAY----EQIRRFSH--- 1156

Query: 381  KVFLYGKKEALTNATF-FSSTNV-----LGDLSFLIVLAYG----SHLVLQGGLTVGDLT 430
                Y + +   N  F + S+N      L  +  LIVL+ G    S L     L+ G + 
Sbjct: 1157 --LNYERIQFSINCFFNYRSSNRWLSVRLQSIGALIVLSTGLLALSSLGTDHQLSSGLVG 1214

Query: 431  AFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHAPSIKPTAGKPY-----VPGS 485
              M Y     S++  +      +     +  R+ E  D +P   P   + +      P  
Sbjct: 1215 LLMSYALQVTSSLIWIIRSSVLIETNIVSVERIVEYCDISPE-APEVKEEHRLDDNWPNQ 1273

Query: 486  GKISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSG 545
            G+I FK+ S SY     + +   +N  I PG  + +VG +G GKST++  L R   P++G
Sbjct: 1274 GQIEFKNYSTSYRENL-DPVLKHINLVISPGEKIGVVGRTGAGKSTLSMALFRLLEPTAG 1332

Query: 546  QITIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNL-------TYGLQSEVSMDEIR 598
             I+ID+ DI+ +  + LR H+ ++ Q+     G+I+ NL          L   + +  ++
Sbjct: 1333 TISIDNIDITSIGLRDLRSHIAIIPQDAQAFEGTIRSNLDPFEKFSDDDLWHAIELSHLK 1392

Query: 599  ----SVAKKCFC---HGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILIL 651
                ++AK+      +   ++  +  D  +   G++LS GQKQ + +ARAL+ K KIL+L
Sbjct: 1393 FHLETIAKEINDDSEYSDRSRLESPLDIPVREAGSNLSVGQKQLLCLARALLNKSKILVL 1452

Query: 652  DEATSALDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGK 711
            DEAT+++DVE++  I  T+ K    +  TI++IAHRL T+  S+ +IVL + G V E  K
Sbjct: 1453 DEATASVDVETDKIIQETIRKEFADR--TILTIAHRLDTVFDSDRIIVL-DGGEVKEFDK 1509

Query: 712  FKDLYADQQSELYKLLND 729
             + L   + S  YKL ++
Sbjct: 1510 PETLLEQKDSIFYKLCDN 1527

 Score = 93.2 bits (230), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 72/242 (29%), Positives = 127/242 (52%), Gaps = 18/242 (7%)

Query: 510 NFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRHLGVV 569
           NF +   S +C+VG  G GKSTI   +L      SG    +D    +    +    +   
Sbjct: 639 NFEVPKSSLICVVGRVGAGKSTILKCILGQLPCISGN---NDHLSPQFQINA--TTVAYC 693

Query: 570 QQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGASLS 629
            QE  +M+ S+K N+ +G + + +    ++  K C     +   P+G +T++G +G  LS
Sbjct: 694 PQEAWIMNASVKDNILFGHKYDEAF--YKATIKACQLLPDIKVLPDGDETMVGEKGIVLS 751

Query: 630 GGQKQRIAIARALMKKPKILILDEATSALDVE-SEGAINYTLGK---LMKSKELTIISIA 685
           GGQK R+++ARA+  +  + +LD+  SA+D E  +  I   L +   L+K K  +I+   
Sbjct: 752 GGQKTRLSLARAVYSRADLYLLDDILSAVDTEVCKTIIKEVLDEKTGLLKDK--SIVLAT 809

Query: 686 HRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQ-SELYKLLNDKKRDKP-TPRVQ--S 741
           + +S ++ S  + +L N  S+ + G + D+  +QQ S+L  +L++   +KP TP VQ  +
Sbjct: 810 NTISVLKHSTKIYLLENK-SIAQEGNYDDIMNNQQDSKLKNILHEFDLEKPDTPAVQEGT 868

Query: 742 DP 743
           DP
Sbjct: 869 DP 870

>TDEL0G01850 Chr7 (369839..374767) [4929 bp, 1642 aa] {ON} Anc_4.6
            YHL035C
          Length = 1642

 Score =  152 bits (383), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 172/691 (24%), Positives = 293/691 (42%), Gaps = 111/691 (16%)

Query: 91   SLRLSVPRTLQLTRLYSQKTVESQAKTPADKESQKSGTMEDEESPNMG------YKEVIR 144
            S+ L    T  +  L   K +    KT  D+E  K G +  +E+   G      YK  +R
Sbjct: 947  SVNLKSKSTTSIRNLSKGKELAKSKKT--DEERAKDGKLIKDETKAEGVVSADVYKWYLR 1004

Query: 145  LFKLATHDWKLLTFAIGLLAISSVIGMSIPKVIGMVLDAIKNTYSSATGPVG-------- 196
            +F      WK+L+  I    I+   G+SI +    V   + N +S+    +G        
Sbjct: 1005 IFG----GWKMLSILIAAFVIAQ--GISIGQT-WWVRSWVSNNFSTKIIALGQNIAVSTS 1057

Query: 197  --LDDLPPIVNDLSM----------------YEFLGIFAGALVIGTVANFGRIVLLRVLG 238
              +  +   V   S                 + +L ++    VI +V +  + VL  V G
Sbjct: 1058 RAISHVGNFVTSFSFMQHNFDEESRAKIHSTFYYLSLYFLIGVIQSVLSALKTVLSFVAG 1117

Query: 239  EKLVARLRSNVIRKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXX 298
                 ++ + ++ K++H    FFD   +G +++R S D     + +T  +   F +    
Sbjct: 1118 INASRKIFNLLLSKVMHAKLRFFDSTPIGRIMNRFSKDMEAADQELTPFIEGAFYSLVQC 1177

Query: 299  XXXXXXXXXXSISLTSALLMFAPP------LLIGALIY--GKRIRMISRDLQE----STG 346
                          T  L+ F  P      +L+  L Y  G      SR+L+     S  
Sbjct: 1178 VS------------TVVLITFITPQFLFVAILVAVLYYFVGYFYLTGSRELKRLESISRS 1225

Query: 347  NLTRVSEEQLSGVKTIQSFVAEGK----ELQRYNTAIRKVFLYGKKEALTNATFFSSTNV 402
             + +   E L GV TI++F  E +     LQ+ +   R  F       + N       ++
Sbjct: 1226 PIYQHFSETLVGVTTIRAFGDESRFMRENLQKIDENNRPFFYLW----VANRWLSFRIDM 1281

Query: 403  LGDLSFLIVLAYGSHLVLQ-----GGLTVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGA 457
            +G L   ++   G  ++L       G     LT  + +TE        L   YS +    
Sbjct: 1282 IGAL---VIFGAGIFVLLNIDHIDSGKAGISLTYAITFTE----GALWLVRLYSNVEMNM 1334

Query: 458  GAASRLFEMTD--HAPSIKPTAGKPY-VPGSGKISFKDVSFSY-PTRPGNQIFNKLNFTI 513
             +  RL E  D    P  +     P   P  G+I   D+S  Y P  P  ++   ++FT+
Sbjct: 1335 NSVERLKEYMDVEQEPYDQSILTPPVEWPQQGRIEVNDLSLRYAPNLP--KVIKNVSFTV 1392

Query: 514  EPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRHLGVVQQEP 573
            +P S V IVG +G GKSTI + L R+ +P +G I ID+ DI+ +  + LRR + ++ Q+P
Sbjct: 1393 DPRSKVGIVGRTGAGKSTIITALFRFLDPETGNIKIDNVDITSIDLQRLRRSITIIPQDP 1452

Query: 574  MLMSGSIKYNLT----------------YGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGY 617
             L +G+IK NL                   L ++  +D   +          + KF +  
Sbjct: 1453 TLFTGTIKSNLDPYDEYTDQQIFEALKRVNLVTQEELDRRPTSESSSVSSENINKFLD-L 1511

Query: 618  DTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSK 677
             + I   G ++S GQ+Q + +AR+L++ PKI++LDEAT+++D  S+  I  T+ K     
Sbjct: 1512 SSEISEGGGNISQGQRQLVCLARSLLRSPKIILLDEATASIDYASDAKIQETIRKEFGGN 1571

Query: 678  ELTIISIAHRLSTIRRSENVIVLGNDGSVVE 708
              TI++IAHRL ++   + ++V+ + G V E
Sbjct: 1572 --TILTIAHRLRSVIDYDKILVM-DAGEVKE 1599

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 64/231 (27%), Positives = 114/231 (49%), Gaps = 11/231 (4%)

Query: 487 KISFKDVSFSYPT-RPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSG 545
           KI F++ + ++   RP  ++ N LN   + G    I+GP+G GK+++   LL   +  SG
Sbjct: 695 KIGFENATITWDAERPDFKLKN-LNIDFKVGKLNVIIGPTGSGKTSLLMALLGEMHLVSG 753

Query: 546 QITIDDQDISR---LSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAK 602
           +I +   D  +   +    +   +    Q   L++ ++K N+ +   S  +     +V +
Sbjct: 754 KIIVPSLDPRQELPIEADGMTNSMAYCSQAAWLLNDTVKNNILFN--SPYNEGRYEAVVE 811

Query: 603 KCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVES 662
            C      +    G  T IG RG +LSGGQKQRI++AR+L    + ++LD+  SA+D  +
Sbjct: 812 ACGLKRDFSILSAGDLTEIGERGITLSGGQKQRISLARSLYSNARHVLLDDCLSAVDSHT 871

Query: 663 EGAI--NYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGK 711
              I  N   G LM+ +  T I ++H  +   R+  ++V   +G V   G+
Sbjct: 872 ASWIYDNCITGPLMEGR--TCILVSHNTALTLRNAELVVTMENGQVKNQGE 920

>Kpol_311.3 s311 (5480..10453) [4974 bp, 1657 aa] {ON} (5480..10453)
            [4974 nt, 1658 aa]
          Length = 1657

 Score =  150 bits (378), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 146/520 (28%), Positives = 241/520 (46%), Gaps = 67/520 (12%)

Query: 244  RLRSNVIRKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXX 303
            ++ S ++ K +H +  FFD   +G +++R S D   V + +   +               
Sbjct: 1139 KIFSLLLNKALHANLRFFDSTPIGRIMNRFSKDMEAVDQELVPYLEAALYCII------- 1191

Query: 304  XXXXXSISLTSALLMFAPP------LLIGALIYGKRIRMI--SRDLQE----STGNLTRV 351
                  IS T  L+ +  P      +L+  L Y   +  +  SR+L+     +   + + 
Sbjct: 1192 -----DISSTILLITYITPEFLIIAILVAGLYYAIGVLYLAGSRELKRFDSITKSPIYQH 1246

Query: 352  SEEQLSGVKTIQSFVAEGKELQRYNTAI---RKVFLYGKKEALTNATFFSSTNVLGDLSF 408
              E L GV T++++  E + ++     I    K F Y     ++N       +V+G L  
Sbjct: 1247 FSETLVGVTTVRAYGDEARFMRENLKMIDENNKPFFY---LWVSNRWLAFRIDVVGAL-- 1301

Query: 409  LIVLAYGSHLVLQ-----GGLTVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRL 463
             ++   G  ++L       GL    L+  + +TE   SA++ L   YS L     +  RL
Sbjct: 1302 -VIFGSGVFVLLNIDKIDSGLAGISLSFAISFTE---SALW-LVRHYSNLEMNMNSVERL 1356

Query: 464  FEM--TDHAPSIKPTAGKPY-VPGSGKISFKDVSFSY-PTRPGNQIFNKLNFTIEPGSNV 519
             E    +  P    +   P   P  GKI   DVS  Y P  P  ++     FT++P   V
Sbjct: 1357 MEYMEVEQEPYKSSSLDVPSSWPEEGKIEVNDVSLRYAPNLP--RVIKNATFTVDPKMKV 1414

Query: 520  CIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRHLGVVQQEPMLMSGS 579
             IVG +G GKSTI + L R+ +P +G I ID+ DIS +  K LRR + ++ Q+P L SG+
Sbjct: 1415 GIVGRTGAGKSTIITALFRFLDPETGSIKIDNVDISTIELKKLRRSITIIPQDPTLFSGT 1474

Query: 580  IKYNLT-YGLQSEVSMDE----IRSVAKK----------CFCHGFVTKFPNGYDTIIGPR 624
            IK NL  Y   SE  + E    +  V +K              G   KF N  +  I   
Sbjct: 1475 IKSNLDPYDEYSEKQIFEALKRVNLVTEKELASGNSDQQSIASGNANKFLN-VNNEISEG 1533

Query: 625  GASLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTIISI 684
            G++LS GQ+Q + +AR+L++ PK+++LDEAT+++D  S+  I  T+    +  + TI++I
Sbjct: 1534 GSNLSQGQRQLVCLARSLLRCPKVILLDEATASIDYASDAKIQETIRN--EFDDSTILTI 1591

Query: 685  AHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQSELY 724
            AHRL T+   + ++V+ + G V E      L  ++ S  Y
Sbjct: 1592 AHRLRTVIDYDKILVM-DAGEVKEFDHPYSLLLNKNSIFY 1630

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 62/231 (26%), Positives = 114/231 (49%), Gaps = 9/231 (3%)

Query: 486 GKISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSG 545
            KI+FK+ + ++     +     ++   + G    I+GP+G GK+++   LL   +   G
Sbjct: 701 NKIAFKNATTTWNKEKQDFKLRNIDIDFKIGKLNVIIGPTGSGKTSLLMALLGEMDLIDG 760

Query: 546 QITI---DDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAK 602
           +I +   D ++  +L    L   +    Q   L++ +++ N+ +   S    +   +V +
Sbjct: 761 EIIVPCLDPREDLKLDANGLTNSIAYCSQAAWLLNDTVRNNILFN--SPYCEERYNAVVE 818

Query: 603 KCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVES 662
                        G  T IG RG +LSGGQKQR+++ARAL    K L+LD+  SA+D  +
Sbjct: 819 ASGLKRDFEILNAGDMTEIGERGITLSGGQKQRVSLARALYSNSKHLLLDDCLSAVDSHT 878

Query: 663 EGAI--NYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGK 711
              I  N   G LM+++  T I ++H ++   R+ + +V   +G +VE G+
Sbjct: 879 ATWIYDNCISGPLMENR--TCILVSHNIALTLRNADYVVKLENGKIVEHGE 927

>Smik_8.6 Chr8 complement(11717..16474) [4758 bp, 1585 aa] {ON}
            YHL035C (REAL)
          Length = 1585

 Score =  149 bits (375), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 152/571 (26%), Positives = 259/571 (45%), Gaps = 88/571 (15%)

Query: 207  LSMYEFLGIFAGALV-IGTVANFGRIVLLRVLGEKLVARLRSNVIRKIIHQDAEFFDRNK 265
            LS+Y  +GI    L  + T+  F       + G +   ++ ++++  ++H    FFD   
Sbjct: 1042 LSLYFVIGIIQALLGGLKTMVTF-------LSGMQASKKIFNSMLDLVLHAKIRFFDVTP 1094

Query: 266  VGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTSALLMFAPPLLI 325
            VG +++R S D       + Q +    +                + +T      A  + I
Sbjct: 1095 VGRIMNRFSKDI----EGIDQELIPYLEVTVFCLIQCSSILLLIVVITPRFFSVAVIVFI 1150

Query: 326  GALIYGKRIRMISRDLQE----STGNLTRVSEEQLSGVKTIQSFVAEGKELQRYNTAIRK 381
                 GK     SRDL+     +   + +   E L GV TI++F   G E         K
Sbjct: 1151 LYYFVGKWYLKASRDLKRIDSITKSPIFQHFSETLVGVCTIRAF---GDE---------K 1198

Query: 382  VFLYGKKEAL--TNATFFSSTNVLGDLSF-------LIVLAYGSHLV-----LQGGLTVG 427
             F+    E +   N  FF  +  +   +F        IVL  GS ++     +  GL   
Sbjct: 1199 RFILENMEKIDQNNKAFFYLSVAVKWFAFRVDMIGAFIVLGSGSFILFNIDNIDSGLAGI 1258

Query: 428  DLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMT------------DHAPSIKP 475
             LT  +L+T+   SA++ L   YS       +  RL E +            DH  ++  
Sbjct: 1259 SLTYAILFTD---SALW-LVQLYSRFEMNMNSVERLKEYSSIVQEKYLGYDEDHIQALND 1314

Query: 476  TAGKPYVPGSGKISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSL 535
            ++     P  GKI  +++S  Y +     +   + F ++P S V IVG +G GKSTI + 
Sbjct: 1315 SSW----PKHGKIEVENLSLRYASNLP-LVLKNVCFKVDPQSKVGIVGRTGAGKSTIIAA 1369

Query: 536  LLRYYNPSSGQITIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYN------------ 583
            L R   P +G I IDDQDIS++   +LRR + ++ Q+P+L +G+IK N            
Sbjct: 1370 LFRLLEPVTGCIKIDDQDISKIDLITLRRSITIIPQDPVLFAGTIKSNIDPHDEYDERRI 1429

Query: 584  ----LTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIA 639
                L   L S +   ++ ++ +    H    KF N    I+   G +LS G++Q + IA
Sbjct: 1430 FKVLLQVNLISSLEFKQVFNLKENFNIHN---KFLNLQSEIV-EGGLNLSQGERQLLFIA 1485

Query: 640  RALMKKPKILILDEATSALDVESEGAINYTL-GKLMKSKELTIISIAHRLSTIRRSENVI 698
            R+L+++ KI++LDEATS++D +S+  I   +  K  KS   TI++IAHRL ++   + ++
Sbjct: 1486 RSLLRESKIILLDEATSSIDYDSDHLIQSIIRSKFNKS---TILTIAHRLRSVIYYDKIL 1542

Query: 699  VLGNDGSVVEVGKFKDLYADQQSELYKLLND 729
            V+ + G + E G   +L  +++S  Y++  D
Sbjct: 1543 VM-DAGEIKEYGHPYELLKNERSTFYRMCRD 1572

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 73/250 (29%), Positives = 109/250 (43%), Gaps = 30/250 (12%)

Query: 483 PGSGKISFKDVSFSYPTRPGNQIFNK-----LNFTIEPGSNVCIVGPSGRGKSTITSLLL 537
           P   KI FK  +  +     +   NK     LN     G    ++G +G GKS +   LL
Sbjct: 659 PDRNKIEFKKANLVWNENDND--INKFKLCDLNIIFSIGKLNLVLGSTGSGKSALLMSLL 716

Query: 538 RYYNPSSGQITID----------DQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLTYG 587
              +  SG I I           D D        L        Q   L+S +IK N+ + 
Sbjct: 717 GELDLVSGFIIIPGLEPRHDLIPDHD-------GLTNSFAYCSQSAWLVSDTIKNNIVFN 769

Query: 588 LQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPK 647
              + S    + V   C  +  +   P G  T IG +G +LSGGQKQRI++ARA+    K
Sbjct: 770 GSYDKS--RYKKVIDACGLNRDLNILPAGDLTEIGEKGITLSGGQKQRISLARAVYSHAK 827

Query: 648 ILILDEATSALDVESEGAI--NYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGS 705
            ++LD+  SA+D  +   I  N   G+LMK++  T I + H +    R+ +  ++  DG 
Sbjct: 828 HVLLDDCLSAVDSHTAVWIYENCITGQLMKNR--TCILVTHNVPLAIRNAHFAIILEDGK 885

Query: 706 VVEVGKFKDL 715
           V   G  K+L
Sbjct: 886 VKNQGTIKEL 895

>YHL035C Chr8 complement(27978..32756) [4779 bp, 1592 aa] {ON}
            VMR1Vacuolar membrane protein involved in multiple drug
            resistance and metal sensitivity; ATP-binding cassette
            (ABC) family member involved in drug transport; potential
            Cdc28p substrate; induced under respiratory conditions
          Length = 1592

 Score =  149 bits (375), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 144/528 (27%), Positives = 240/528 (45%), Gaps = 57/528 (10%)

Query: 238  GEKLVARLRSNVIRKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXX 297
            G +   ++ +N++  ++H    FFD   VG +++R S D       + Q +    +    
Sbjct: 1067 GMRASRKIFNNLLDLVLHAQIRFFDVTPVGRIMNRFSKDI----EGVDQELIPYLEVTIF 1122

Query: 298  XXXXXXXXXXXSISLTSALLMFAPPLLIGALIYGKRIRMISRDLQE----STGNLTRVSE 353
                          +T   L  A  + +     GK     SR+L+     +   + +   
Sbjct: 1123 CLIQCASIIFLITVITPRFLTVAVIVFVLYFFVGKWYLTASRELKRLDSITKSPIFQHFS 1182

Query: 354  EQLSGVKTIQSFVAEGKELQRYNTAI---RKVFLYGKKEALTNATFFSSTNVLGDLSFLI 410
            E L GV TI++F  E + +      I    + F Y    ++T   F    +++G     I
Sbjct: 1183 ETLVGVCTIRAFGDERRFILENMNKIDQNNRAFFY---LSVTVKWFSFRVDMIGAF---I 1236

Query: 411  VLAYGSHLVLQ-----GGLTVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFE 465
            VLA GS ++L       GL    LT  +L+T+        L   YS       +  RL E
Sbjct: 1237 VLASGSFILLNIANIDSGLAGISLTYAILFTD----GALWLVRLYSTFEMNMNSVERLKE 1292

Query: 466  MTD--------HAPSIKPTAGKPYVPGSGKISFKDVSFSY-PTRPGNQIFNKLNFTIEPG 516
             +         H         +P  P  G+I  +++S  Y P  P   +   ++F ++P 
Sbjct: 1293 YSSIEQENYLGHDEGRILLLNEPSWPKDGEIEIENLSLRYAPNLP--PVIRNVSFKVDPQ 1350

Query: 517  SNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRHLGVVQQEPMLM 576
            S + IVG +G GKSTI + L R   P +G I ID QDIS++   +LRR + ++ Q+P+L 
Sbjct: 1351 SKIGIVGRTGAGKSTIITALFRLLEPITGCIKIDGQDISKIDLVTLRRSITIIPQDPILF 1410

Query: 577  SGSIKYNLT-YGLQSEVSMDEIRSVAKKCFCHGFV-------------TKFPNGYDTIIG 622
            +G+IK N+  Y    E  + +  S       H F               KF N + T I 
Sbjct: 1411 AGTIKSNVDPYDEYDEKKIFKALSQVNLISSHEFEEVLNSEERFNSTHNKFLNLH-TEIA 1469

Query: 623  PRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTL-GKLMKSKELTI 681
              G +LS G++Q + IAR+L+++PKI++LDEATS++D +S+  I   +  +  KS   TI
Sbjct: 1470 EGGLNLSQGERQLLFIARSLLREPKIILLDEATSSIDYDSDHLIQGIIRSEFNKS---TI 1526

Query: 682  ISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQSELYKLLND 729
            ++IAHRL ++   + +IV+ + G V E  +  +L  D++   Y +  D
Sbjct: 1527 LTIAHRLRSVIDYDRIIVM-DAGEVKEYDRPSELLKDERGIFYSMCRD 1573

 Score = 86.3 bits (212), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 88/303 (29%), Positives = 136/303 (44%), Gaps = 35/303 (11%)

Query: 483 PGSGKISFKDVSFSYPTRPGNQIFNKL---NFTIEPGSNVCIVGPSGRGKSTITSLLLRY 539
           P   KI FK+ + ++     +    KL   N   + G    I+G +G GKS +   LL  
Sbjct: 659 PDKNKIEFKNATLTWNENDSDMNAFKLCGLNIKFQIGKLNLILGSTGSGKSALLLGLLGE 718

Query: 540 YNPSSGQITIDDQDISR---LSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDE 596
            N  SG I +   +        C+ L        Q   L++ ++K N+ +   +  + D 
Sbjct: 719 LNLISGSIIVPSLEPKHDLIPDCEGLTNSFAYCSQSAWLLNDTVKNNIIF--DNFYNEDR 776

Query: 597 IRSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATS 656
              V   C     +   P G  T IG +G +LSGGQKQRI++ARA+    K ++LD+  S
Sbjct: 777 YNKVIDACGLKRDLEILPAGDLTEIGEKGITLSGGQKQRISLARAVYSSAKHVLLDDCLS 836

Query: 657 ALDVESEGAI--NYTLGKLMKSKELTIISIAHRLS-TIRRSENVIVL-----GNDGSVVE 708
           A+D  +   I  N   G LMK++  T I + H +S T+R +   IVL      N G++ E
Sbjct: 837 AVDSHTAVWIYENCITGPLMKNR--TCILVTHNVSLTLRNAHFAIVLENGKVKNQGTITE 894

Query: 709 V---GKFKDLYADQQSELYKLLNDKKRDKPTPRVQSDPEKDREQEHQIDNQVREQVANDF 765
           +   G FK+ Y    S       D   +K   R+++ P K+       D+Q  E V  + 
Sbjct: 895 LQSKGLFKEKYVQLSSR------DSINEKNANRLKA-PRKN-------DSQKIEPVTENI 940

Query: 766 NLD 768
           N D
Sbjct: 941 NFD 943

>KLLA0E00529g Chr5 complement(39173..44125) [4953 bp, 1650 aa] {ON}
            similar to uniprot|P32386 Saccharomyces cerevisiae
            YLL048C
          Length = 1650

 Score =  148 bits (374), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 169/692 (24%), Positives = 303/692 (43%), Gaps = 112/692 (16%)

Query: 113  SQAKTPADKESQKSGTMEDEESPNMGYK--EVIRLFKLATHDWKLLTFAIGLLAISSVIG 170
            ++  T     S+ SG +  EE+ + G    +V + + +    WK+++F   +   + +I 
Sbjct: 974  NEESTTCGDRSKSSGKLIAEETKSNGVVSLDVYKWYAVFFGGWKMISFLCFIFLFAQMI- 1032

Query: 171  MSIPKVIGMVLDAIKNTYSSATGPVGLDDLPPIVNDLSMYE------------------- 211
             SI +   +   A  NT    +  +GL  + P    L   E                   
Sbjct: 1033 -SISQAWWLRAWASNNTLKVFSN-LGLQTMRPFALSLQGKEASPVTLSAVFPNGSLTTAT 1090

Query: 212  --------FLGIFAGALVIGTVANFGRIVLLRVLGEKLVARLRSNVIRKIIHQDAEFFDR 263
                    +L I+ G  V   + +  + ++  V G +   ++ + +++ +++    FFD 
Sbjct: 1091 EPNHSNAYYLSIYLGIGVFQALCSSSKAIINFVAGIRASRKIFNLLLKNVLYAKLRFFDS 1150

Query: 264  NKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTSALLMFA--- 320
              +G +++R S D   + + +T  +   F +               I   S +++ A   
Sbjct: 1151 TPIGRIMNRFSKDIESIDQELTPYMEGAFGSL--------------IQCVSTIIVIAYIT 1196

Query: 321  PPLLIGALI-----------YGKRIRMISRDLQESTGNLTRVSEEQLSGVKTIQSFVAEG 369
            P  LI A I           Y    R + R    S   + +   E L G+ TI++F  E 
Sbjct: 1197 PQFLIVAAIVMLLFYFVAYFYMSGARELKRLESMSRSPIHQHFSETLVGITTIRAFSDER 1256

Query: 370  K----ELQRYNTAIRKVFLYGKKEALTNATFFSSTNVLGDLSFLIVLAYGSHLVLQ---- 421
            +     +++ +   R  F       + N        ++G L   IVLA GS ++L     
Sbjct: 1257 RFLVDNMKKIDDNNRPFFYLW----VCNRWLSYRIELIGAL---IVLAAGSFILLNIKSI 1309

Query: 422  ----GGLTVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMT--DHAPSIKP 475
                 G+++G         ++T  A++ +   YS +     +  RL E T  +  PS   
Sbjct: 1310 DSGLAGISLG------FAIQFTDGALW-VVRLYSNVEMNMNSVERLKEYTTIEQEPSNVG 1362

Query: 476  TAGKPY-VPGSGKISFKDVSFSYPT-RPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTIT 533
                P   P +GKI  KD+S  Y    P  ++   + FT++    V IVG +G GKSTI 
Sbjct: 1363 ALVPPCEWPQNGKIEVKDLSLRYAAGLP--KVIKNVTFTVDSKCKVGIVGRTGAGKSTII 1420

Query: 534  SLLLRYYNPSSGQITIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLT-YGLQSE- 591
            + L R+ +P +G I IDD DI+ +  K LR+ + ++ Q+P L +G++K NL  Y   SE 
Sbjct: 1421 TALFRFLDPETGYIKIDDVDITTIGLKRLRQSITIIPQDPTLFTGTLKTNLDPYNEYSEA 1480

Query: 592  -----------VSMDEI--RSVAKKCFCH-GFVTKFPNGYDTIIGPRGASLSGGQKQRIA 637
                       VS +E+   S +     H   + KF +  +  +   G++LS GQ+Q I 
Sbjct: 1481 EIFEALKRVNLVSSEELGNPSTSDSTSVHSANMNKFLD-LENEVSEGGSNLSQGQRQLIC 1539

Query: 638  IARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSENV 697
            +AR+L++ PK+++LDEAT+++D  S+  I  T+ +   +   TI++IAHRL +I   + +
Sbjct: 1540 LARSLLRCPKVILLDEATASIDYNSDSKIQATIREEFSNS--TILTIAHRLRSIIDYDKI 1597

Query: 698  IVLGNDGSVVEVGKFKDLYADQQSELYKLLND 729
            +V+ + G V E      L  ++ S  Y +  D
Sbjct: 1598 LVM-DAGEVKEYDHPYSLLLNRDSIFYHMCED 1628

 Score = 73.6 bits (179), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 57/233 (24%), Positives = 116/233 (49%), Gaps = 13/233 (5%)

Query: 486 GKISFKDVSFSYPTRPGNQIFNKLNFTIE--PGSNVCIVGPSGRGKSTITSLLLRYYNPS 543
            K+  ++ +F++     NQ F   N TI+   G    IVGP+G GK+++   LL      
Sbjct: 697 NKLGLQNATFTWD--KNNQDFKLKNLTIDFKIGKLNVIVGPTGSGKTSLLMGLLGEMELL 754

Query: 544 SGQI---TIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSV 600
           +G++   +++ ++   +    +   +    Q   L++ +++ N+ +   +  + +   +V
Sbjct: 755 NGKVFVPSLNPREELVVEADGMTNSIAYCSQAAWLLNDTVRNNILFN--APYNENRYNAV 812

Query: 601 AKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDV 660
              C           G  T IG +G +LSGGQKQR+++AR+L    + L+LD+  SA+D 
Sbjct: 813 ISACGLKRDFEILSAGDQTEIGEKGITLSGGQKQRVSLARSLYSSSRHLLLDDCLSAVDS 872

Query: 661 ESEGAI--NYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGK 711
            +   I  N   G LM+ +  T + ++H ++   ++ + +++  +G V E G+
Sbjct: 873 HTALWIYENCITGPLMEGR--TCVLVSHNVALTLKNADWVIIMENGRVKEQGE 923

>NCAS0E04160 Chr5 (818254..822774) [4521 bp, 1506 aa] {ON} Anc_5.10
          Length = 1506

 Score =  147 bits (371), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 146/548 (26%), Positives = 245/548 (44%), Gaps = 58/548 (10%)

Query: 207  LSMYEFLGIFAGALVIGTVANFGRIVLLRVLGEKLVARLRSNVIRKIIHQDAEFFDRNKV 266
            + +Y F   F+  L   T + F  +  + VL  K +  LR+  +++I+H    + D   +
Sbjct: 967  MGLYSFFVFFSYIL---TTSQFTLLCCIGVLSSKWL-NLRA--VKRILHTPMSYLDTTPL 1020

Query: 267  GDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTSALLMFAPPLLIG 326
            G +++R + D   +   +T++V    +                I       +  P L +G
Sbjct: 1021 GRILNRFTKDTDSLDNELTESV----RMLLYQFANIVGVCIMCIIYLPWFAIAIPFLFVG 1076

Query: 327  ALIYG----------KRIRMISRDLQESTGNLTRVSEEQLSGVKTIQSFVAEGKELQRYN 376
             ++            KR+  I R    +  N      E L G+ TI+S+ +E + + + +
Sbjct: 1077 FVLIADHYQSSGREIKRLEAIQRSFVYNNFN------EVLGGMDTIKSYRSENRFIAKSD 1130

Query: 377  TAIRKVFLYGKKEALTN---ATFFSSTNVLGDLSFLIVLAYGSHLVLQGGLTVGDLTAFM 433
              I K+   G          A F     V    + +I L   +        +VG L  ++
Sbjct: 1131 FLIDKMNEAGYLVVAVQRWVAIFLDVIAVC--FALIITLLCVTRAFPISAASVGVLLTYV 1188

Query: 434  LYTEYTGSAVF-GLSNFYSELMKGAGAASRLFEMTDHAPSIKPTAGKPY-VPGSGKISFK 491
            L      + V   L+   +++       +   E+   A   KP    P   P  G+I F+
Sbjct: 1189 LQLPGLLNGVLRSLTQTENDMNSAERLVTYATELPLEADYRKPEVSPPEEWPTKGEIHFE 1248

Query: 492  DVSFSYPTRPG-NQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITID 550
            +V FSY  RPG   +   L+  I+ G  + I G +G GKSTI S L R    SSG++ ID
Sbjct: 1249 NVDFSY--RPGLPTVLKNLSLDIKSGEKIGICGRTGAGKSTIMSALYRLNEISSGKMIID 1306

Query: 551  DQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLTY----------------GLQSEVSM 594
            D DIS +    LRR L ++ Q+P+L  G+I+ NL                  G   +  +
Sbjct: 1307 DVDISTIGLYDLRRKLAIIPQDPVLFRGTIRKNLDPFNEHQDEHLWNALVRGGAIEQKEL 1366

Query: 595  DEIRSVA-KKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDE 653
            +EI++    +   H  + KF    D ++   GA+ S G++Q +A+ RAL+++ +ILILDE
Sbjct: 1367 NEIKAQKPDEKGNHSEMYKF--HLDQLVEEEGANFSLGERQLLALTRALVRQARILILDE 1424

Query: 654  ATSALDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFK 713
            ATS++D E++G I   +  + +    TI+ IAHRL TI   + ++VL   G V E    K
Sbjct: 1425 ATSSVDYETDGKIQARI--VEEFGHCTILCIAHRLKTILTYDRILVL-EKGEVAEFDTPK 1481

Query: 714  DLYADQQS 721
             L+A + S
Sbjct: 1482 TLFAQEDS 1489

 Score = 96.3 bits (238), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 70/211 (33%), Positives = 109/211 (51%), Gaps = 20/211 (9%)

Query: 506 FNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRH 565
           F+ LNF I+ G  + +VGP G GK+++ +    + N  SG+I I+      L C      
Sbjct: 649 FHDLNFEIKKGEFIIMVGPIGTGKTSLLNAFAGFMNKVSGRIQING---DLLLCGY---- 701

Query: 566 LGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRG 625
                  P + + S+K N+ +G  S  +  +   V + C     +   P G  T IG RG
Sbjct: 702 -------PWIQNASVKDNIIFG--SPYNKAKYDEVIRVCSLKSDLDILPAGDLTEIGERG 752

Query: 626 ASLSGGQKQRIAIARALMKKPKILILDEATSALDVE-SEGAINYTLGKLMKSKELTIISI 684
            +LSGGQK RI +AR++ K+  I + D+  SA+D    +  ++     L+K K  T I  
Sbjct: 753 ITLSGGQKARINLARSVYKQKDIYLFDDVLSAVDSRVGKHIMDECFLGLLKDK--TRILA 810

Query: 685 AHRLSTIRRSENVIVLGNDGSVVEVGKFKDL 715
            H+LS + R+  VIVLGNDGS  ++G  ++L
Sbjct: 811 THQLSLLERASRVIVLGNDGS-FDIGTVEEL 840

>TPHA0C00960 Chr3 (204061..208632) [4572 bp, 1523 aa] {ON} Anc_8.303
            YDR135C
          Length = 1523

 Score =  147 bits (370), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 154/558 (27%), Positives = 242/558 (43%), Gaps = 50/558 (8%)

Query: 207  LSMYEFLGIFAGALVIGTVANFGRIVLLRVL----GEKLVARLRSNVIRKIIHQDAEFFD 262
            L +Y  LG FA +L     AN  + ++L +     G K   +L S++   I      FF+
Sbjct: 986  LFIYFTLG-FASSL-----ANLIQTIILWIFCTIQGSK---QLHSSMTSSIFRAPMSFFE 1036

Query: 263  RNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTSALLMFAPP 322
               +G +++R S+D Y +   + ++ S  F+                 S T   +    P
Sbjct: 1037 TTPIGRILNRFSNDVYKIDEILGRSFSQFFQNTIRVSFTIVVI----CSTTWQFIFLIIP 1092

Query: 323  LLIGALIYGKRIRMISRDLQ--ESTGN--LTRVSEEQLSGVKTIQSFVAEGKELQRYNTA 378
            +    + Y +     SR+L+  +ST    L    +E L GV TI+ F  + + +    + 
Sbjct: 1093 MAFLYIYYQQYFLRTSRELRRLDSTTRSPLYAHFQETLCGVSTIRGFAQQDRFIHINQSR 1152

Query: 379  IRKVFLYGKKEALTNATFFSSTNVLGDLSFLIVLAYGSHLVLQGGLTVGDLTAFMLYTEY 438
            +    +       +N         LG L  L         +  G LT G +   M Y   
Sbjct: 1153 VDSNMMAYYPSINSNRWLAFRLEFLGSLIILGAATLSIFRLKNGSLTAGMIGLSMSYALQ 1212

Query: 439  TGSAVFGLSNFYSELMKGAGAASRLFEMTDHAPSIKPTA---GKPY--VPGSGKISFKDV 493
               ++  +     ++     +  R+ E + H PS  P      +P    P  G I FK+ 
Sbjct: 1213 VTQSLNWIVRMTVDVESNIVSVERIEEYS-HLPSEAPLIIENNRPSEEWPSKGAIEFKNY 1271

Query: 494  SFSYPTRPG-NQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQ 552
            S  Y  RP  + +   +N  I P   V IVG +G GKS++T  L R    SSG I ID  
Sbjct: 1272 STRY--RPELDLVLKNINLKILPKEKVGIVGRTGAGKSSLTLALFRIIEASSGSIEIDGV 1329

Query: 553  DISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTK 612
            +I+ L    LR  L ++ Q+  +  GSI+ N+    Q   S  EI +  +       + K
Sbjct: 1330 NINELGLYDLRHKLSIIPQDSQVFEGSIRENIDPTQQ--FSEQEIWNALEMAHLKPHILK 1387

Query: 613  F---------------PNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSA 657
                             N  D  I   G++LS GQ+Q I +ARAL+    +LILDEAT+A
Sbjct: 1388 MNEISPESENSDTNQSSNPLDAKITEGGSNLSVGQRQLICLARALLVPSNVLILDEATAA 1447

Query: 658  LDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYA 717
            +DVE++  I +T+    K +  TI++IAHR++TI  S+ +IVL N G V E  K + L  
Sbjct: 1448 VDVETDELIQHTIRTAFKDR--TILTIAHRINTIMDSDKIIVLDN-GEVAEFDKPEILLT 1504

Query: 718  DQQSELYKLLNDKKRDKP 735
            ++ S  Y L  +    KP
Sbjct: 1505 NKNSLFYSLCYESGVLKP 1522

 Score = 97.8 bits (242), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 93/344 (27%), Positives = 163/344 (47%), Gaps = 46/344 (13%)

Query: 443 VFGLSNF--------YSELMKGAGAASRLFE-MTDHAPSIKPTAGKPYVPGSGKISFK-- 491
           +F L NF         S  ++ + + SRL+  +T+           P+V  +G+ + K  
Sbjct: 558 LFNLLNFPLVAVPITISAFIEASVSISRLYSYLTNEELQKDAIQRLPFVKQNGETTVKIG 617

Query: 492 -DVSFSYPTRPGNQI-FNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITI 549
            + +F +  +P  ++    +NF    G   CIVG  G GKS     +L            
Sbjct: 618 DNATFLWKRKPEYKVALKNINFEARKGELACIVGKVGSGKSAFIQSIL------------ 665

Query: 550 DDQDISRLS-CKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHG 608
              D+ R+    S+  ++  V Q   +M+G++K N+ +G + +    E     K C    
Sbjct: 666 --GDLFRVKGFASIHGNVAYVSQLAWIMNGTVKDNIIFGHRYDPEFYE--KTIKACALTI 721

Query: 609 FVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVE-SEGAIN 667
            ++  P+G  T++G +G SLSGGQK R+++ARA+  +  I +LD+  +A+D   S+  I 
Sbjct: 722 DLSILPDGDQTLVGEKGISLSGGQKARLSLARAVYARADIYLLDDPLAAVDEHVSKHLIQ 781

Query: 668 YTLGK--LMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQSELYK 725
             LG   L+KSK  T I   +++  +  ++++ +L N G + E G + D+ A + S L K
Sbjct: 782 NVLGAKGLLKSK--TRILTTNKIPVLSIADSITLLEN-GEITEQGTYFDVMATEGSSLSK 838

Query: 726 LLND--KKRDKPTPRVQSD---PEKD-----REQEHQIDNQVRE 759
           L+ +  KK+D        D    E D     RE    I++++RE
Sbjct: 839 LITEYGKKKDSSESEAAKDNVNSESDESSVNRELTVPIEDELRE 882

>Suva_10.60 Chr10 (123173..126145) [2973 bp, 990 aa] {ON} YLL015W
           (REAL)
          Length = 990

 Score =  144 bits (363), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 150/559 (26%), Positives = 257/559 (45%), Gaps = 64/559 (11%)

Query: 209 MYEFLGIFAGALVIGTVA--NFGRIVLLRVLGEKLVARLRSNVIRKIIHQDAEFFDRNKV 266
           ++ F+G+++  L +G+ A  N   I++L     +   +L  N+ + +I     FF+   V
Sbjct: 446 VWMFVGVYS-LLGVGSAAFNNLRSIIMLLYCSIRGSKKLHENMAKSVIRSPMVFFETTPV 504

Query: 267 GDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTSALLMFAPPLLIG 326
           G +I+R SSD   V  S+    S  FK+                      L+F   LL+ 
Sbjct: 505 GRIINRFSSDMDAVDSSLQYVFSFFFKSILTYLVTIVLVGYN----MPWFLVFNMFLLVI 560

Query: 327 ALIYGKRIRMISRDLQE----STGNLTRVSEEQLSGVKTIQSFVAEGKELQRYNTAIRKV 382
            + Y     ++SR+L+     S   +  +  E L+G   I +          YN   R +
Sbjct: 561 YIYYQTFYIVLSRELKRLISISYSPIMSLMSESLNGYSIIDA----------YNHYERFI 610

Query: 383 FL-YGKKEALTNATF-FSSTNVLGDLSFLIVLAYGSHLVL------------QGGLTVGD 428
           +L Y K ++  +  F F S N    +    +   G+ +VL            +  L+ G 
Sbjct: 611 YLNYDKIQSNIDLVFNFRSINRWLSVRLQTI---GATIVLATALLALATINTKNQLSSGM 667

Query: 429 LTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHAP---SIKPTAGKP--YVP 483
           +   M Y+    S++  +      +     +  R+ E  +  P   SI P   +P    P
Sbjct: 668 VGLLMAYSFEVTSSLTWIVRTTVMIETNIVSVERIVEYCELPPEAQSINPEK-RPDENWP 726

Query: 484 GSGKISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPS 543
             G+I FK+ S  Y     + +   +N +I+P   + IVG +G GKST++  L R   PS
Sbjct: 727 SEGRIEFKNYSTKYRENL-DPVLKDINVSIQPCEKIGIVGRTGAGKSTLSLALFRILEPS 785

Query: 544 SGQITIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLT----YG---LQSEVSMDE 596
            G+I IDD +IS L    LR +L ++ Q+     G+++ NL     Y    L+  + +  
Sbjct: 786 EGEIIIDDVNISELGLFDLRSNLAIIPQDAQAFEGTVRTNLDPFNRYSEDELKRAIELAH 845

Query: 597 IRSVAKKCFCHGF------VTKFPNGYDTI---IGPRGASLSGGQKQRIAIARALMKKPK 647
           ++S  +K   +        V +  N  D +   I   G++LS GQ+Q + +ARAL+   K
Sbjct: 846 LKSHLEKMLGNEAENNDINVEERGNAKDILDVKINENGSNLSVGQRQLLCLARALLSHSK 905

Query: 648 ILILDEATSALDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVV 707
           IL+LDEAT+++D+E++  I  T+ +  K +  TI++IAHR+ T+  S+ +IVL + G+V 
Sbjct: 906 ILVLDEATASVDMETDKIIQDTIRREFKDR--TILTIAHRIDTVLDSDKIIVL-DKGNVK 962

Query: 708 EVGKFKDLYADQQSELYKL 726
           E      L +D+ S  Y L
Sbjct: 963 EFDSPSKLLSDKGSIFYSL 981

 Score = 99.0 bits (245), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 83/301 (27%), Positives = 148/301 (49%), Gaps = 39/301 (12%)

Query: 482 VPGSGKISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYN 541
           + GS +I+ K++                +F  + G  +C+VG  G GKST    +L    
Sbjct: 75  IMGSSQIALKNIE---------------HFEAKRGDLICVVGRVGAGKSTFLKAIL---- 115

Query: 542 PSSGQITIDDQDISRLSCKSLRR--HLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRS 599
              GQ+         L+ K + R   L    QE  +M+ S++ N+ +G + + +  ++  
Sbjct: 116 ---GQLPCMSGSKESLAPKLIIRASSLAYCSQESWIMNASVRENILFGHKFDKAYYDL-- 170

Query: 600 VAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALD 659
             K C     +   P+G +T++G +G SLSGGQK R+++ARA+  +  I +LD+  SA+D
Sbjct: 171 TIKACQLLPDLKILPDGDETLVGEKGISLSGGQKARLSLARAVYSRADIYLLDDILSAVD 230

Query: 660 VE-SEGAINYTL-GKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLY- 716
            E S+  I + L GK    K  TII   + +S ++ S+ +  L N G +VE G ++ +  
Sbjct: 231 AEVSKNIIEHVLIGKTALLKNKTIILTTNTVSILKHSQMIYALEN-GEIVEQGNYESVMK 289

Query: 717 -ADQQSELYKLLND-----KKRDKPTPRVQSDPEKDREQEHQ---IDNQVREQVANDFNL 767
             +  S+L KLL +        ++   R    PE+D E+  Q   ++++  ++VA +  L
Sbjct: 290 RENDSSKLKKLLEEFDTPIDNMNESDRRTDQSPERDEEETLQLKVVESEAEDEVATNGEL 349

Query: 768 D 768
           +
Sbjct: 350 E 350

>Smik_12.48 Chr12 (103624..108297) [4674 bp, 1557 aa] {ON} YLL015W
            (REAL)
          Length = 1557

 Score =  144 bits (364), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 151/553 (27%), Positives = 249/553 (45%), Gaps = 56/553 (10%)

Query: 209  MYEFLGIFAGALVIGTVA--NFGRIVLLRVLGEKLVARLRSNVIRKIIHQDAEFFDRNKV 266
            ++ F+G+++  + +G+ A  N   I++L     +   +L  ++ + +I     FF+   V
Sbjct: 1017 VWMFVGVYS-LIGVGSAAFNNLRSIMMLLYCSIRGSKKLHESMAKSVIKSPMIFFETTPV 1075

Query: 267  GDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTSALLMFAPPLLIG 326
            G +I+R SSD   V  S+    S  FK+               +       +     L+G
Sbjct: 1076 GRIINRFSSDMDAVDSSLQYIFSFFFKSILTYLVTVIL-----VGYNMPWFLVFNMFLLG 1130

Query: 327  ALIYGKRIRMI-SRDLQE----STGNLTRVSEEQLSGVKTIQS------FVAEGKELQRY 375
              IY +   ++ SR+L+     S   +  +  E L+G   I +      F+    E  +Y
Sbjct: 1131 IYIYYQTFYIVLSRELKRLISISYSPIMSLMSESLNGYSIIDAYDHFERFIYLNYEKIQY 1190

Query: 376  NTAIRKVFLYGKKEALTNATFFSSTNVLGDLSFLIVLAYGSHLVLQGGLTVGDLTAFMLY 435
            N      F    +          +T VL   + L +    +   L  G+ VG L ++ L 
Sbjct: 1191 NIDFVFNFRSTNRWLSVRLQTIGATIVLAT-AMLTLATMNTKKQLSSGM-VGLLMSYSL- 1247

Query: 436  TEYTGSAVFGLSNFYSELMKGAGAAS-----RLFEMTDHAPSIKPTA--GKPYVPGSGKI 488
             E TGS  + +    + +M      S        E+   A SI P     K + P  G I
Sbjct: 1248 -EVTGSLTWIVR---TTVMIETNIVSVERIVEYCELPSEAQSINPEKRPDKNW-PSRGSI 1302

Query: 489  SFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQIT 548
             FKD S  Y     + +   +N  IEP   V IVG +G GKST++  L R   P+ G+I 
Sbjct: 1303 EFKDYSTKYRENL-DPVLKDINVKIEPCEKVGIVGRTGAGKSTLSLALFRILEPTEGKII 1361

Query: 549  IDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLT-YGLQSEVSMDEIRSVAKKCFCH 607
            ID  +IS L    LR HL ++ Q+     G++K NL  +   SE   DE++   +     
Sbjct: 1362 IDGINISDLGLFDLRSHLAIIPQDAQAFEGTVKTNLDPFNRYSE---DELKKAVELAHLK 1418

Query: 608  GFVTKF--------------PNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDE 653
              + K                +  D  I   G++LS GQ+Q + +ARAL+ + KIL+LDE
Sbjct: 1419 PHLEKMLENEPSDSEESCDIKDILDVKINENGSNLSVGQRQLLCLARALLNRSKILVLDE 1478

Query: 654  ATSALDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFK 713
            AT+++D+E++  I  T+ +  K +  TI++IAHR+ T+  S+ +IVL ++GSV E     
Sbjct: 1479 ATASIDMETDKIIQDTIRREFKDR--TILTIAHRIDTVLDSDKIIVL-DEGSVKEFDSPS 1535

Query: 714  DLYADQQSELYKL 726
             L +++ S  Y L
Sbjct: 1536 KLLSNKASIFYSL 1548

 Score = 94.7 bits (234), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 82/259 (31%), Positives = 133/259 (51%), Gaps = 17/259 (6%)

Query: 510 NFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSG-QITIDDQDISRLSCKSLRRHLGV 568
           +F  + G+ VCIVG  G GKST    +L      SG + +I  + I R S       L  
Sbjct: 659 HFEAKRGNLVCIVGRVGAGKSTFLKAILGQLPCMSGSKESIPPKLIIRSS------SLAY 712

Query: 569 VQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGASL 628
             QE  +M+ S+K N+ +G + + +  ++    K C     +   P+G +T++G +G SL
Sbjct: 713 CSQESWIMNASVKENILFGHKFDKAYYDL--TIKACQLLPDLRILPDGDETLVGEKGISL 770

Query: 629 SGGQKQRIAIARALMKKPKILILDEATSALDVE-SEGAINYTL-GKLMKSKELTIISIAH 686
           SGGQK R+++ARA+  +  I +LD+  SA+D E S+  I Y L GK    K  TII   +
Sbjct: 771 SGGQKARLSLARAVYSRADIYLLDDILSAVDAEVSKNIIEYVLIGKKALLKNKTIILTTN 830

Query: 687 RLSTIRRSENVIVLGNDGSVVEVGKFKDLY--ADQQSELYKLLNDKKRDKPTPR-VQSDP 743
            +S ++ S+ +  L N G +VE G +  +    +  S+L KLL  ++ D P  +  ++D 
Sbjct: 831 TVSILKHSQMIYALEN-GEIVEQGNYDSVMNRENSTSKLKKLL--EEFDSPIDKGNENDT 887

Query: 744 EKDREQEHQIDNQVREQVA 762
                 E  ID  ++ +V 
Sbjct: 888 HTGHRSESDIDEPLQLKVV 906

>Suva_10.59 Chr10 (121460..126142) [4683 bp, 1561 aa] {ON} YLL015W
            (REAL)
          Length = 1561

 Score =  144 bits (364), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 150/559 (26%), Positives = 257/559 (45%), Gaps = 64/559 (11%)

Query: 209  MYEFLGIFAGALVIGTVA--NFGRIVLLRVLGEKLVARLRSNVIRKIIHQDAEFFDRNKV 266
            ++ F+G+++  L +G+ A  N   I++L     +   +L  N+ + +I     FF+   V
Sbjct: 1017 VWMFVGVYS-LLGVGSAAFNNLRSIIMLLYCSIRGSKKLHENMAKSVIRSPMVFFETTPV 1075

Query: 267  GDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTSALLMFAPPLLIG 326
            G +I+R SSD   V  S+    S  FK+                      L+F   LL+ 
Sbjct: 1076 GRIINRFSSDMDAVDSSLQYVFSFFFKSILTYLVTIVLVGYN----MPWFLVFNMFLLVI 1131

Query: 327  ALIYGKRIRMISRDLQE----STGNLTRVSEEQLSGVKTIQSFVAEGKELQRYNTAIRKV 382
             + Y     ++SR+L+     S   +  +  E L+G   I +          YN   R +
Sbjct: 1132 YIYYQTFYIVLSRELKRLISISYSPIMSLMSESLNGYSIIDA----------YNHYERFI 1181

Query: 383  FL-YGKKEALTNATF-FSSTNVLGDLSFLIVLAYGSHLVL------------QGGLTVGD 428
            +L Y K ++  +  F F S N    +    +   G+ +VL            +  L+ G 
Sbjct: 1182 YLNYDKIQSNIDLVFNFRSINRWLSVRLQTI---GATIVLATALLALATINTKNQLSSGM 1238

Query: 429  LTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHAP---SIKPTAGKP--YVP 483
            +   M Y+    S++  +      +     +  R+ E  +  P   SI P   +P    P
Sbjct: 1239 VGLLMAYSFEVTSSLTWIVRTTVMIETNIVSVERIVEYCELPPEAQSINPEK-RPDENWP 1297

Query: 484  GSGKISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPS 543
              G+I FK+ S  Y     + +   +N +I+P   + IVG +G GKST++  L R   PS
Sbjct: 1298 SEGRIEFKNYSTKYRENL-DPVLKDINVSIQPCEKIGIVGRTGAGKSTLSLALFRILEPS 1356

Query: 544  SGQITIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLT----YG---LQSEVSMDE 596
             G+I IDD +IS L    LR +L ++ Q+     G+++ NL     Y    L+  + +  
Sbjct: 1357 EGEIIIDDVNISELGLFDLRSNLAIIPQDAQAFEGTVRTNLDPFNRYSEDELKRAIELAH 1416

Query: 597  IRSVAKKCFCHGF------VTKFPNGYDTI---IGPRGASLSGGQKQRIAIARALMKKPK 647
            ++S  +K   +        V +  N  D +   I   G++LS GQ+Q + +ARAL+   K
Sbjct: 1417 LKSHLEKMLGNEAENNDINVEERGNAKDILDVKINENGSNLSVGQRQLLCLARALLSHSK 1476

Query: 648  ILILDEATSALDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVV 707
            IL+LDEAT+++D+E++  I  T+ +  K +  TI++IAHR+ T+  S+ +IVL + G+V 
Sbjct: 1477 ILVLDEATASVDMETDKIIQDTIRREFKDR--TILTIAHRIDTVLDSDKIIVL-DKGNVK 1533

Query: 708  EVGKFKDLYADQQSELYKL 726
            E      L +D+ S  Y L
Sbjct: 1534 EFDSPSKLLSDKGSIFYSL 1552

 Score = 99.4 bits (246), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 83/301 (27%), Positives = 148/301 (49%), Gaps = 39/301 (12%)

Query: 482 VPGSGKISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYN 541
           + GS +I+ K++                +F  + G  +C+VG  G GKST    +L    
Sbjct: 646 IMGSSQIALKNIE---------------HFEAKRGDLICVVGRVGAGKSTFLKAIL---- 686

Query: 542 PSSGQITIDDQDISRLSCKSLRR--HLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRS 599
              GQ+         L+ K + R   L    QE  +M+ S++ N+ +G + + +  ++  
Sbjct: 687 ---GQLPCMSGSKESLAPKLIIRASSLAYCSQESWIMNASVRENILFGHKFDKAYYDL-- 741

Query: 600 VAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALD 659
             K C     +   P+G +T++G +G SLSGGQK R+++ARA+  +  I +LD+  SA+D
Sbjct: 742 TIKACQLLPDLKILPDGDETLVGEKGISLSGGQKARLSLARAVYSRADIYLLDDILSAVD 801

Query: 660 VE-SEGAINYTL-GKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLY- 716
            E S+  I + L GK    K  TII   + +S ++ S+ +  L N G +VE G ++ +  
Sbjct: 802 AEVSKNIIEHVLIGKTALLKNKTIILTTNTVSILKHSQMIYALEN-GEIVEQGNYESVMK 860

Query: 717 -ADQQSELYKLLND-----KKRDKPTPRVQSDPEKDREQEHQ---IDNQVREQVANDFNL 767
             +  S+L KLL +        ++   R    PE+D E+  Q   ++++  ++VA +  L
Sbjct: 861 RENDSSKLKKLLEEFDTPIDNMNESDRRTDQSPERDEEETLQLKVVESEAEDEVATNGEL 920

Query: 768 D 768
           +
Sbjct: 921 E 921

>NDAI0H00190 Chr8 complement(20586..25634) [5049 bp, 1682 aa] {ON}
            Anc_4.6
          Length = 1682

 Score =  144 bits (364), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 140/536 (26%), Positives = 234/536 (43%), Gaps = 90/536 (16%)

Query: 244  RLRSNVIRKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXX 303
            ++  +++  ++H    FFD   +G +++R S D   V + +T  +   F           
Sbjct: 1159 KIFKSLLHTVLHSKLRFFDATPIGRIMNRFSKDIEAVDQELTPYLEAAFYCL-------- 1210

Query: 304  XXXXXSISLTSALLMFA---PPLLIGALIYGKRIRMISRDLQESTGNLTRVSE------- 353
                  +   S +L+ A   P  LI A+  G    ++      ++  L R          
Sbjct: 1211 ------VECVSTMLLIAFITPQFLILAIFIGFLYYLVGYFYMAASRELKRFESVTKSPIY 1264

Query: 354  ----EQLSGVKTIQSFVAEGKELQRYNTAIRKVFLYGKKEALTNATFFSSTNVLGDLSF- 408
                E L G+ TI+++  E + +      I +           N  FF        LSF 
Sbjct: 1265 QHFSETLVGIVTIRAYGDEKRFMLENLHKIDE----------NNKPFFYLWAFNRWLSFR 1314

Query: 409  ------LIVLAYGSHLVLQ-----GGLTVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGA 457
                  L+V   G  ++L       GL    LT  + +TE    A   L  FY+++    
Sbjct: 1315 IDMIGSLVVFGAGVFIILNIDNLDSGLAGISLTYAISFTE----AALWLVRFYADVEMNM 1370

Query: 458  GAASRLFEMTD--------HAPSIKPTAGKPYVPGSGKISFKDVSFSY-PTRPGNQIFNK 508
             +  RL E  +        H    +  A   + P +GKI   ++S  Y P  P  ++   
Sbjct: 1371 NSVERLKEYMEIDQEPYEEHLERSEVLAVDNW-PRNGKIEVNNLSLRYAPNLP--KVIKN 1427

Query: 509  LNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRHLGV 568
            + F +EP   V +VG +G GKSTI + L R+ +  +G I IDD DI+ ++   LRR + +
Sbjct: 1428 VTFVVEPNCKVGVVGRTGAGKSTIITALFRFLDAETGYIKIDDIDITTVNLTKLRRSITI 1487

Query: 569  VQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKC------------------FCHGFV 610
            + Q+P L SG+I+ NL     +E S D I    ++                        V
Sbjct: 1488 IPQDPTLFSGTIRSNL--DPYNEFSDDAIFKALRRVNLINENESTGPASSETSPSSTENV 1545

Query: 611  TKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTL 670
             KF N  +  I   G +LS GQ+Q + +AR+L++ PKI++LDEAT+++D  S+  I  T+
Sbjct: 1546 NKFLNLKNE-ITEGGNNLSHGQRQLVCLARSLLRCPKIILLDEATASIDNASDAKIQETI 1604

Query: 671  GKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQSELYKL 726
             K  + KE TI++IAHRL ++   + ++V+ + G V E      L  ++ S  Y +
Sbjct: 1605 RK--EFKESTILTIAHRLRSVCDYDKILVM-DAGEVKEYDHPYSLLLNKNSIFYSM 1657

 Score = 87.0 bits (214), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 60/230 (26%), Positives = 115/230 (50%), Gaps = 9/230 (3%)

Query: 486 GKISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSG 545
            +I+F++ + ++  +        LN   +PG    ++GP+G GKS++   LL   +  +G
Sbjct: 729 NRIAFQNATVAWDKKNSEFKLRDLNIDFKPGKLNVVIGPTGSGKSSLLLALLGEMHLENG 788

Query: 546 QI---TIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAK 602
            I   ++D +D   +    +   +    Q   L++ +++ N+ +   S  +     +V +
Sbjct: 789 NIIVPSLDPRDELVIDHDGMTNSIAYCSQGAWLLNDTVRNNILFN--SPYNEARYNAVVE 846

Query: 603 KCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVES 662
            C           G  T IG +G +LSGGQKQR+++ARAL    + ++LD+  SA+D  +
Sbjct: 847 ACCLKRDFEILKAGDMTEIGEKGITLSGGQKQRVSLARALYSNSRHVLLDDCLSAVDSHT 906

Query: 663 EGAI--NYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVG 710
              I  N   G LM+++  T I ++H ++   R+  ++V+  DG V + G
Sbjct: 907 ALWIYDNCITGPLMENR--TCILVSHNIALTLRNAELVVILEDGRVKDQG 954

>Skud_7.614 Chr7 (1027230..1031663) [4434 bp, 1477 aa] {ON} YGR281W
            (REAL)
          Length = 1477

 Score =  144 bits (363), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 165/660 (25%), Positives = 284/660 (43%), Gaps = 80/660 (12%)

Query: 101  QLTRLYSQKTVESQAKTPADKESQKSGTMEDEESPN-MG---YKEVIRLFKLATHDWKLL 156
            +LT L  + T  SQ    A        + ++E + N +G   YKE I   K+A   W  +
Sbjct: 839  ELTELKKKTTQMSQTTDTAQPVVNGHTSTKEERAVNSIGVNVYKEYI---KVAVGRWGFV 895

Query: 157  TFAIGLLAISSVIGMSIPKVIGMVLDAIKNTYSSATGPVGLDDLPPIVNDLSMYEFLGIF 216
            T  +  +    V+G +   +   V       + S        + PP    + +Y F  +F
Sbjct: 896  TLPLYFVL---VVGTTFCSLFSSV-------WLSYWTENKFKNRPPSFY-MGLYSFF-VF 943

Query: 217  AGALVIGTVANFGRIVLLRVLGEKLVARLRSNVIRKIIHQDAEFFDRNKVGDLISRLSSD 276
            A  + +      G+  +L V+G      L    +++I+H    + D   +G +++R + D
Sbjct: 944  AAFIFMN-----GQYTILCVMGIMASKWLNLKAVKRILHTPMSYIDTTPLGRILNRFTKD 998

Query: 277  AYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTSALLMFAPPLLIGALIYG----- 331
                + S+   +++  +                I       +  P LL+  ++       
Sbjct: 999  ----TDSLDNELTESLRLLTSQFANIVGVCVMCIVYLPWFAIAIPFLLVIFVLIADHYQS 1054

Query: 332  -----KRIRMISRDLQESTGNLTRVSEEQLSGVKTIQSFVAEGKELQRYNTAIRKVFLYG 386
                 KR+  + R    +  N      E L G+ TI+++ ++ + L + +  I K+   G
Sbjct: 1055 SGREIKRLEAVQRSFVYNNLN------EVLGGMDTIKAYRSQERFLAKSDFLINKMNEAG 1108

Query: 387  KKEALTN---ATFFSSTNVLGDLSFLIVLAYGSHLVLQGGLTVGDLTAFMLYTEYTGSAV 443
                +       F     ++   + ++ L   +        +VG L  ++L      + +
Sbjct: 1109 YLVVVLQRWVGVFLDMVAIV--FALIVTLLCVTRAFPISAASVGVLLTYVLQLPGLLNTI 1166

Query: 444  F-GLSNFYSELMKGAGAASRLFEMTDHAPSIKPTAGKPY-VPGSGKISFKDVSFSYPTRP 501
               ++   +++       S   E+   A   KP    P   P  G+I  ++V FSY  RP
Sbjct: 1167 LRAMTQTENDMNSAERLVSYATELPLEADYRKPEMTPPESWPSKGEIVLENVCFSY--RP 1224

Query: 502  G-NQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCK 560
            G   +   LN  IE G  + I G +G GKSTI S L R    S+G+I IDD DIS+L   
Sbjct: 1225 GLPVVLKNLNLNIESGEKIGICGRTGAGKSTIMSALYRLNELSAGKILIDDVDISKLGLF 1284

Query: 561  SLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIR-------SVAK----------- 602
             LRR L ++ Q+P+L  G+I+ NL      E + DE+        ++AK           
Sbjct: 1285 DLRRKLAIIPQDPVLFRGTIRKNLDPF--DERTDDELWDALVRGGAIAKNDLSEAKLQKP 1342

Query: 603  -KCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVE 661
             K   HG + KF    D  +   G++ S G++Q +A+ RAL+++ KILILDEATS++D E
Sbjct: 1343 DKNGTHGRMHKF--HLDQAVEEEGSNFSLGERQLLALTRALVRQSKILILDEATSSVDYE 1400

Query: 662  SEGAINYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQS 721
            ++G I   +  + +  + TI+ IAHRL TI   + ++VL   G V E      L+  + S
Sbjct: 1401 TDGKIQARI--VEEFGDCTILCIAHRLQTIVNYDRILVL-EKGEVAEFDTPWTLFTQENS 1457

 Score = 92.4 bits (228), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 71/223 (31%), Positives = 112/223 (50%), Gaps = 21/223 (9%)

Query: 506 FNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRH 565
           F  LNF I+ G  + I GP G GKS++ + +      + G+I ++      L C      
Sbjct: 604 FKDLNFEIKKGEFIMITGPIGTGKSSLLNAMAGSMRKTDGKIEVNG---DLLMCGY---- 656

Query: 566 LGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRG 625
                  P + +  ++ N+ +G  S    ++   V + C     +   P G  T IG RG
Sbjct: 657 -------PWIQNAPVRDNIIFG--SPFIKEKYNEVIRVCSLKADLDILPAGDMTEIGERG 707

Query: 626 ASLSGGQKQRIAIARALMKKPKILILDEATSALDVE-SEGAINYTLGKLMKSKELTIISI 684
            +LSGGQK RI +AR++ K+ +I + D+  SA+D    +  ++  L  ++ +K  T I  
Sbjct: 708 ITLSGGQKARINLARSVYKRKEIYLFDDVLSAVDSRVGKHIMDECLTGMLANK--TRILA 765

Query: 685 AHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQSELYKLL 727
            H+LS I R+  VIVLG DG  V++G   +L A  Q+ L KLL
Sbjct: 766 THQLSLIERASRVIVLGTDGQ-VDIGTVDELKARNQT-LIKLL 806

>KLTH0C09240g Chr3 complement(766620..771260) [4641 bp, 1546 aa] {ON}
            similar to uniprot|P14772 Saccharomyces cerevisiae
            YLL015W BPT1 ABC type transmembrane transporter of
            MRP/CFTR family found in vacuolar membrane involved in
            the transport of unconjugated bilirubin and in heavy
            metal detoxification via glutathione conjugates along
            with Ycf1p
          Length = 1546

 Score =  144 bits (362), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 150/547 (27%), Positives = 235/547 (42%), Gaps = 55/547 (10%)

Query: 212  FLGIFAGALVIGTVANFGR-IVLLRVLGEKLVARLRSNVIRKIIHQDAEFFDRNKVGDLI 270
            F+GI+    +     N  R IVLL V   +   +L  ++   ++     FF+   VG +I
Sbjct: 1016 FVGIYVLISLGAAFFNSARSIVLLLVCSIRASRKLHDSMAVAVLRSPMSFFETTPVGRII 1075

Query: 271  SRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTSALLMFAPPLLIGALIY 330
            +R SSD   V  ++ Q V   F                 +     L +     L+G  +Y
Sbjct: 1076 NRFSSDMNSVDDNV-QYVISFFLISILDYVVVVVIIGYQV----PLFLLVNAALLGIYLY 1130

Query: 331  GKRI-----RMISRDLQESTGNLTRVSEEQLSGVKTIQSFVAEGKELQRYNTAIRKVFLY 385
             +       R + R +  S   +  +  E L+G   I +F        R++        Y
Sbjct: 1131 YQVFYVTLSRELKRLMSTSFSPIMSMLSETLAGHMVINAF----NHFSRFD--------Y 1178

Query: 386  GKKEAL---TNATF-FSSTNV-----LGDLSFLIVL--AYGSHLVLQG--GLTVGDLTAF 432
               EA+    N  F F STN      L  +  L++L  A  S     G   L+ G +   
Sbjct: 1179 LNIEAVQFNINCVFNFRSTNRWLSIRLESIGALMILTTALLSLATTTGDKALSTGMVGLL 1238

Query: 433  MLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHAPSIKPTA--GKPY--VPGSGKI 488
            M Y     + +  +     +L     +  R+ E  D  P   P     +P    P  G +
Sbjct: 1239 MSYALQVTNKLMWIVRMSVQLETNVVSVERIVEYCDLPPEAPPVIEDCRPEKNWPAQGHV 1298

Query: 489  SFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQIT 548
             FKD S  Y     + +  KLN  I P   + IVG +G GKST++  L R   P  G I 
Sbjct: 1299 VFKDYSARYRENL-DPVLKKLNVEINPQEKIGIVGRTGAGKSTLSLALFRILEPCGGTIV 1357

Query: 549  IDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHG 608
            ID  DI+++    LR HL ++ Q+     GS++ NL    Q   S DEI    +      
Sbjct: 1358 IDGVDITKIGLADLRSHLSIIPQDAQAFEGSVRSNLDPFEQ--YSDDEIWRALELSHLKP 1415

Query: 609  FVTKFPNG---------YDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALD 659
             + K  N           +T I   G++LS GQ+Q + ++RAL+ + +IL+LDEAT+A+D
Sbjct: 1416 HILKMANEEGPEKTKNLLETKISENGSNLSVGQRQLLCLSRALLNRSRILVLDEATAAVD 1475

Query: 660  VESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQ 719
             E++  I  T+    K +  TI++IAHR+ T+  S+ ++VL + G V E     +L AD+
Sbjct: 1476 SETDRLIQETIRAEFKDR--TILTIAHRIDTVMDSDKIMVL-DQGEVKEFDSPSNLLADK 1532

Query: 720  QSELYKL 726
             +  Y L
Sbjct: 1533 NTIFYNL 1539

 Score = 98.6 bits (244), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 81/280 (28%), Positives = 145/280 (51%), Gaps = 38/280 (13%)

Query: 516 GSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITI----DDQDISRLS--CKSLRRHLGVV 569
           G  VC+VG  G GKST    LL       GQ+       DQ   ++   C S+     + 
Sbjct: 663 GQLVCVVGRVGAGKSTFLHALL-------GQLPCISSSHDQATPKMHFRCDSV----ALC 711

Query: 570 QQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGASLS 629
            Q+  +++ S+KYN+ +G + + +    ++  + C     +    +G +T++G +G SLS
Sbjct: 712 SQQAWILNASVKYNVLFGHKYDEA--SYKATIEACQLLPDLGILADGDETLVGEKGISLS 769

Query: 630 GGQKQRIAIARALMKKPKILILDEATSALDVE-SEGAINYTLGK---LMKSKELTIISIA 685
           GGQK RI++ARA+  +  + +LD+  SA+D E  +  I++ L +   L+K+K  T+I   
Sbjct: 770 GGQKARISLARAVYSRSDVYLLDDILSAVDAEVCKRIIDHVLSRKTGLLKNK--TVILTT 827

Query: 686 HRLSTIRRSENVIVLGNDGSVVEVGKFKDLYA-DQQSELYKLLND-------KKRDKPTP 737
           + +S ++ S+++  L N G +VE G F ++ + D +S+L  L+ +        K D+P P
Sbjct: 828 NSISVLKHSQSIYALEN-GEIVERGSFDEIMSKDAESKLKTLIAEFGSDSSAVKDDEPIP 886

Query: 738 R----VQSDPEKDREQEHQIDNQVREQVANDFNLDQKSSK 773
                V     +D   E +I+ +V  ++ N F+ D +S K
Sbjct: 887 EQKPPVDLQEVEDDALEEEINPEVPFELDNAFSSDFRSRK 926

>Skud_12.52 Chr12 (107860..112545) [4686 bp, 1561 aa] {ON} YLL015W
            (REAL)
          Length = 1561

 Score =  143 bits (361), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 153/556 (27%), Positives = 247/556 (44%), Gaps = 58/556 (10%)

Query: 209  MYEFLGIFAGALVIGTVA--NFGRIVLLRVLGEKLVARLRSNVIRKIIHQDAEFFDRNKV 266
            ++ F+G+++  + +G+ A  N   IV+L     +   +L  N+ + +I     FF+   V
Sbjct: 1017 VWMFVGVYS-LIGVGSAAFNNLRSIVMLLYCSIRGSKKLHENMAKSVIRSPMVFFETTPV 1075

Query: 267  GDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTSALLMFAPPLLIG 326
            G +I+R SSD   V  S+    S  FK+                       +F   LL+ 
Sbjct: 1076 GRIINRFSSDMDAVDSSLQYIFSFFFKSILTYLVTVILVGYN----MPWFFVFNMFLLVI 1131

Query: 327  ALIYGKRIRMISRDLQE----STGNLTRVSEEQLSGVKTIQS------FVAEGKELQRYN 376
             + Y     ++SR+L+     S   +  +  E L+G   I +      F+    E  +YN
Sbjct: 1132 YIYYQTFYIVLSRELKRLISISYSPIMSLMSESLNGYSIIDAYDHFERFIYLNYEKIQYN 1191

Query: 377  TAIRKVFLYGKKEALTNATFFSSTNVLGDLSFLIVLAYGSHLVLQGGLTVGDLTAFMLYT 436
                  F    +          +T VL   + L +    +   L  G+ VG L ++ L  
Sbjct: 1192 IDFVFNFRSTNRWLSVRLQTIGATIVLAT-AMLALTTMNTKKQLSSGM-VGLLMSYSL-- 1247

Query: 437  EYTGSAVFGLSNFYSELMKGAGAAS-----RLFEMTDHAPSIKPTAGKP--YVPGSGKIS 489
            E TGS  + +    + +M      S        E+   A SI P   +P    P  G I 
Sbjct: 1248 EVTGSLTWIVR---TTVMIETNIVSVERIVEYCELPSEARSINP-ENRPDESWPSKGSIE 1303

Query: 490  FKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITI 549
            FK+ S  Y     + +   +N  I+P   + IVG +G GKST++  L R   P+ G I I
Sbjct: 1304 FKNYSTKYRENL-DPVLKDINVRIKPCEKIGIVGRTGAGKSTLSLALFRILEPTEGSIVI 1362

Query: 550  DDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLT------------------YGLQSE 591
            DD +IS L    LR HL ++ Q+     G+++ NL                    G   E
Sbjct: 1363 DDINISDLGLFDLRSHLAIIPQDAQAFEGTVRTNLDPFNRYSEGELKKAVDLAHLGPHLE 1422

Query: 592  VSMD-EIRSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILI 650
              +D EIR        +G V+   N     I   G +LS GQ+Q + +ARAL+ + KIL+
Sbjct: 1423 KMLDNEIRGADGAAEENGNVSDVLN---VKINENGTNLSVGQRQLLCLARALLNRSKILV 1479

Query: 651  LDEATSALDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVG 710
            LDEAT+++D+E++  I  T+ +  K +  TI++IAHR+ T+  S+ +IVL ++G+V E  
Sbjct: 1480 LDEATASVDMETDKIIQDTIRREFKDR--TILTIAHRIDTVLDSDKIIVL-DEGTVKEFD 1536

Query: 711  KFKDLYADQQSELYKL 726
                L +D+ S  Y L
Sbjct: 1537 SPSKLLSDKASIFYSL 1552

 Score = 90.5 bits (223), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 81/288 (28%), Positives = 144/288 (50%), Gaps = 34/288 (11%)

Query: 477 AGKPYVPGSGKISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLL 536
           A +  + GS +I+ K++                +F  + G  VC+VG  G GKST    +
Sbjct: 641 ADEESIIGSSQIALKNID---------------HFEAKRGDLVCVVGRVGAGKSTFLKGI 685

Query: 537 LRYYNPSSG-QITIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMD 595
           L      SG + +I  + I R S       L    QE  +M+ S++ N+ +G + + +  
Sbjct: 686 LGQLPCMSGSKGSIPPKLIIRAS------SLAYCSQESWIMNSSVRENILFGHKFDKAYY 739

Query: 596 EIRSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEAT 655
           ++    K C     +   P+G +T++G +G SLSGGQK R+++ARA+  +  I +LD+  
Sbjct: 740 DL--TIKACQLLPDLKILPDGDETLVGEKGISLSGGQKARLSLARAVYSRADIYLLDDVL 797

Query: 656 SALDVE-SEGAINYTL-GKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFK 713
           SA+D E S+  + Y L GK    K  TII   + +  ++ S+ +  L N G ++E G ++
Sbjct: 798 SAVDAEVSKNIVEYVLIGKAALLKNKTIILATNTVPILKHSQMIYALEN-GEIIEQGNYE 856

Query: 714 DLY--ADQQSELYKLLNDKKRDKPTPRVQSDPEKDREQEHQIDNQVRE 759
            +    +  S+L KLL  ++ D P   + +  + D + EH+ ++ + E
Sbjct: 857 GVMNRENTNSKLKKLL--EEFDSP---IDNGSKSDIQTEHRSESDMDE 899

>Suva_7.577 Chr7 (1007741..1012177) [4437 bp, 1478 aa] {ON} YGR281W
            (REAL)
          Length = 1478

 Score =  142 bits (357), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 137/545 (25%), Positives = 244/545 (44%), Gaps = 56/545 (10%)

Query: 212  FLGIFAGALVIGTVANFGRIVLLRVLGEKLVARLRSNVIRKIIHQDAEFFDRNKVGDLIS 271
            ++G+++  +    +   G+  +L  +G      L    +++I+H    + D   +G +++
Sbjct: 935  YMGLYSFFVFAAFIFMNGQYTILCAMGIMASKWLNLKAVKRILHTPMSYIDTTPLGRILN 994

Query: 272  RLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTSALLMFAPPLLIGALIYG 331
            R + D    + S+   +++  +                I       +  P LLI  ++  
Sbjct: 995  RFTKD----TDSLDNELTESLRLMTSQFANIVGVCVMCIVYLPWFAIAIPFLLIIFVLIA 1050

Query: 332  ----------KRIRMISRDLQESTGNLTRVSEEQLSGVKTIQSFVAEGKELQRYNTAIRK 381
                      KR+  + R    +  N      E L G+ TI+++ ++ + L + +  I K
Sbjct: 1051 DHYQSSGREIKRLEAVQRSFVYNNLN------EVLGGMDTIKAYRSQERFLAKSDFLINK 1104

Query: 382  VFLYGKKEALTN---ATFFSSTNVLGDLSFLIVLAYGSHLVLQGGLTVGDLTAFMLYTE- 437
            +   G    +       F     ++   + +I L   +        +VG +  ++L    
Sbjct: 1105 MNEAGYLVVVLQRWVGIFLDMVAIV--FALIITLLCVTRAFPISAASVGVMLTYVLQLPG 1162

Query: 438  YTGSAVFGLSNFYSELMKGAGAASRLFEMTDHAPSIKPTAGKPY-VPGSGKISFKDVSFS 496
               + +  L+   +++       S   E+   A   KP    P   P  G+I+FK+V FS
Sbjct: 1163 LLNTLLRALTQTENDMNSAERLVSYATELPLEADYRKPEMAPPESWPSKGEIAFKNVDFS 1222

Query: 497  YPTRPG-NQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDIS 555
            Y  RPG   +   LN  I+ G  + I G +G GKSTI S L R    S G+I IDD +IS
Sbjct: 1223 Y--RPGLPVVLKNLNLNIKSGEKIGICGRTGAGKSTIMSALYRLNELSGGEILIDDVNIS 1280

Query: 556  RLSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIR-------SVAKKCF--- 605
            ++    LRR L ++ Q+P+L  G+I+ NL     +E + DE+        ++AK      
Sbjct: 1281 QIGLFDLRRKLAIIPQDPVLFRGTIRKNLDPF--NERTEDELWDALVRGGAIAKNDLPEV 1338

Query: 606  ---------CHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATS 656
                      HG + KF    D  +   G++ S G++Q +A+ RAL+++ KILILDEATS
Sbjct: 1339 KLQKPEENGTHGKMHKF--HLDQAVEEEGSNFSLGERQLLALTRALVRQSKILILDEATS 1396

Query: 657  ALDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLY 716
            ++D E++G I   +  + +  + TI+ IAHRL TI   + ++VL   G V E      L+
Sbjct: 1397 SVDYETDGKIQVRI--VEEFGDCTILCIAHRLKTIVNYDRILVL-EKGEVAEFDTPWALF 1453

Query: 717  ADQQS 721
            + + S
Sbjct: 1454 SQEDS 1458

 Score = 90.1 bits (222), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 66/217 (30%), Positives = 109/217 (50%), Gaps = 20/217 (9%)

Query: 506 FNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRH 565
           F  L+F I+ G  + I GP G GKS++ + +      + G+I ++      L C      
Sbjct: 604 FKDLDFEIKKGEFIMITGPIGTGKSSLLNAMAGSMRKTDGKIEVNGD---LLMCGY---- 656

Query: 566 LGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRG 625
                  P + + ++K N+ +G  S  + ++   V   C     +   P G  T IG RG
Sbjct: 657 -------PWIQNATVKDNIIFG--SPFNKEKYDEVIHVCSLKADLDILPAGDMTEIGERG 707

Query: 626 ASLSGGQKQRIAIARALMKKPKILILDEATSALDVE-SEGAINYTLGKLMKSKELTIISI 684
            +LSGGQK RI +AR++ K+  I + D+  SA+D    +  ++  L  L+++K  T +  
Sbjct: 708 ITLSGGQKARINLARSVYKRKDIYLFDDVLSAVDSRVGKHIMDECLTGLLENK--TRVLA 765

Query: 685 AHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQS 721
            H+LS I ++  VIVLG DG  V++G   +L A  Q+
Sbjct: 766 THQLSLIEKASRVIVLGTDGD-VDIGTVDELKARNQT 801

>TPHA0F00180 Chr6 complement(23050..27990) [4941 bp, 1646 aa] {ON}
            Anc_4.6 YHL035C
          Length = 1646

 Score =  142 bits (357), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 136/507 (26%), Positives = 239/507 (47%), Gaps = 50/507 (9%)

Query: 249  VIRKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNV-SDGFKAXXXXXXXXXXXXX 307
            ++ K++H    FFD   +G +++R S D   + + +T  V S  + +             
Sbjct: 1136 LLSKVLHSKLRFFDSTPIGRIMNRFSKDIEAIDQELTPYVESVVYNSVQLIATVLLITYI 1195

Query: 308  XSISLTSALLMFAPPLLIGALIYGKRIRMISRDLQESTGNLTRVSEEQLSGVKTIQSFVA 367
             +  +  ALL+      +G + Y    R + R    +   + +   E L GV TI+++  
Sbjct: 1196 TNGFIVVALLVILLYYFVG-VYYLSGSRELKRFESTTKSPIYQHFSETLVGVTTIRAYGD 1254

Query: 368  EGKELQRYNTAI---RKVFLYGKKEALTNATFFSSTNVLGDLSFLIVLAYGSHLVLQ--- 421
            E + ++   T I    K F Y     + N       +++G L   ++   G  +++    
Sbjct: 1255 EIRFMKENLTKIDENNKPFFY---LWVANRWLCFRIDIIGSL---VIFGAGVLVLMNINK 1308

Query: 422  --GGLTVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHAPSIKP-TAG 478
               GL    LT  + +TE    +   L   YS +     +  R+ E  D     +P +AG
Sbjct: 1309 IDSGLAGISLTYAITFTE----SALWLVRSYSNVEINMNSVERVKEYMDIEQ--EPYSAG 1362

Query: 479  KPYV----PGSGKISFKDVSFSY-PTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTIT 533
               V    P  GKI   D+S  Y P+ P  ++   ++FT+EP   V +VG +G GKSTI 
Sbjct: 1363 IVNVDKSWPSEGKIEVNDLSLRYAPSLP--KVIKNVSFTVEPKMKVGVVGRTGAGKSTII 1420

Query: 534  SLLLRYYNPSSGQITIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVS 593
            + L R+ +P +G I ID+ DI+ +  K LR+ + ++ Q+P L +G+IK NL     +E +
Sbjct: 1421 TALFRFLDPETGYIKIDNIDITTIDLKKLRKSITIIPQDPTLFTGTIKSNL--DPYNEYN 1478

Query: 594  MDEIRSVAKKC--------------FCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIA 639
             D+I    ++                    V KF N   + I   G++LS GQ+Q + +A
Sbjct: 1479 DDQIFKALRRVNLIVDGNLNSDVTSVSSENVNKFLN-LQSEISEGGSNLSQGQRQLMCLA 1537

Query: 640  RALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSENVIV 699
            R+L++ P I++LDEAT+++D  S+  I  T+    + K+ TI++IAHRL ++   + ++V
Sbjct: 1538 RSLLRAPNIMLLDEATASIDYASDAKIQGTIRN--EFKDSTILTIAHRLRSVIDYDKILV 1595

Query: 700  LGNDGSVVEVGKFKDLYADQQSELYKL 726
            + + G V E      L  ++ S  Y +
Sbjct: 1596 M-DAGEVKEYDHPYSLLLNKNSIFYSM 1621

 Score = 92.0 bits (227), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 67/231 (29%), Positives = 118/231 (51%), Gaps = 11/231 (4%)

Query: 486 GKISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSG 545
            KIS ++V+ S+  +  +     LN   + G    ++GP+G GK+++   LL   +   G
Sbjct: 696 NKISLENVTVSWNKQKQDFKLRNLNIDFKVGKLNVVIGPTGSGKTSLLMALLGEMHLLEG 755

Query: 546 QITI---DDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAK 602
           +IT+   D +         L   +    Q   L++ ++K N+ +   +E + +   +V  
Sbjct: 756 KITVPSLDPRCEMTFDSDGLSNSMAYCSQAAWLLNDTVKNNILFN--AEYNEERYLAVIS 813

Query: 603 KCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVES 662
            C           G  T IG RG +LSGGQKQRI++ARAL    K ++LD+  SA+D  +
Sbjct: 814 ACALKRDFEILAAGDLTEIGERGITLSGGQKQRISLARALYSSSKHILLDDCLSAVDSHT 873

Query: 663 EGAI--NYTLGKLMKSKELTIISIAHRLS-TIRRSENVIVLGNDGSVVEVG 710
              I  N  +G LM+++  T I ++H ++ T++ +E VI++ N G +  +G
Sbjct: 874 AAWIYDNCIIGPLMENR--TCILVSHNVALTLKNAEQVIMIDN-GKISHIG 921

>NDAI0J01150 Chr10 complement(262920..267473) [4554 bp, 1517 aa] {ON}
            Anc_8.303
          Length = 1517

 Score =  141 bits (355), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 139/524 (26%), Positives = 244/524 (46%), Gaps = 56/524 (10%)

Query: 232  VLLRVLGEKLVARLRSNVIRKIIHQDAEFFDRNKVGDLISRLSSDAY----VVSRSMTQN 287
            V   + G + +  L +N +   +     FF+   +G +++R S+D Y    V+ R+ +Q 
Sbjct: 1018 VFCTIQGSRYLHTLMTNAV---LRAPMSFFETTPIGRILNRFSNDIYKVDSVLGRTFSQF 1074

Query: 288  VSDGFKAXXXXXXXXXXXXXXSISLTSALLMFA-PPLLIGALIYGKRIRMISRDLQESTG 346
              +  K                I +T+   +F   PL +  + Y +     SR+L+    
Sbjct: 1075 FVNAVKVSFTIGV---------ICVTTWQFIFVIVPLGVFYIYYQQYYLRTSRELRR-LD 1124

Query: 347  NLTRVS-----EEQLSGVKTIQSFVAEGKELQRYNTAIRKVFLYGKKEALTNATFFSSTN 401
            ++TR       +E L G+ TI+ +  + K   + N           +     + F+ S N
Sbjct: 1125 SITRSPVYSHFQETLGGIVTIRGY-GQQKRFSQINQC---------RVDNNMSAFYPSVN 1174

Query: 402  VLGDLSF-------LIVLAYGSHLVL---QGGLTVGDLTAFMLYTEYTGSAVFGLSNFYS 451
                L++       +I+L   +  V+   QG LT G +   + Y      ++  +     
Sbjct: 1175 ANRWLAYRLELIGSIIILGAATLSVMRLKQGTLTAGMVGLSLSYALQITQSLNWIVRMTV 1234

Query: 452  ELMKGAGAASRLFEMTD---HAPSI-KPTAGKPYVPGSGKISFKDVSFSYPTRPG-NQIF 506
            E+     +  R+ E  D    AP I +    +   P  G I F+  S  Y  RP  + + 
Sbjct: 1235 EVETNIVSVERIKEYADLKSEAPEIIEDHRPQETWPEEGDIKFEHYSTRY--RPELDLVL 1292

Query: 507  NKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRHL 566
              +NF I+P   + IVG +G GKS++T  L R    S G I ID+ DIS +    LR  L
Sbjct: 1293 KDINFHIKPKEKIGIVGRTGAGKSSLTLALFRIIEASEGNIIIDNVDISDIGLYDLRHKL 1352

Query: 567  GVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFV-TKFPNGYDTIIGPRG 625
             ++ Q+  +  G+I+ N+     ++ + ++I  V +       + T   +G DT +   G
Sbjct: 1353 SIIPQDSQVFEGTIRENI--DPTNQYTDEQIWRVLELSHLRDHIATMGGDGLDTKLNEGG 1410

Query: 626  ASLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTIISIA 685
            ++LS GQ+Q + +ARAL+   KIL+LDEAT+A+DVE++  +  T+    K +  TI++IA
Sbjct: 1411 SNLSVGQRQLMCLARALLVPSKILVLDEATAAVDVETDKVLQETIRTSFKDR--TILTIA 1468

Query: 686  HRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQSELYKLLND 729
            HR++TI  ++ ++VL N GS+ E  + K L  ++ S  Y L  +
Sbjct: 1469 HRINTIMDNDRIMVLDN-GSIKEFDEPKKLLENKSSLFYSLCEE 1511

 Score = 91.3 bits (225), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 108/443 (24%), Positives = 197/443 (44%), Gaps = 50/443 (11%)

Query: 349 TRVSEEQLSGVKTIQSFVAEGK-----ELQRYNTAIRKVFLYGKKEALTNATFFSSTNVL 403
           TRV  E L+ +K+++ +  E       E  R N  ++ +   G   AL +  F +    L
Sbjct: 483 TRVISEILNNIKSLKLYAWETPYKAKLENVRNNKELKNLTKLGCYMALMSFQF-NVVPFL 541

Query: 404 GDLSFLIVLAYGSHLVLQGGLTVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRL 463
              S   V  Y     L   L    LT F L        +  + N  + L++ + +  RL
Sbjct: 542 VSCSTFAVFVYTEDRPLTTDLVFPALTLFNLL----HFPLMVIPNVLTALIECSVSVGRL 597

Query: 464 FEMTDHAPSIKPTAGK-PYVPGSGKISFK---DVSFSYPTRPGNQI-FNKLNFTIEPGSN 518
           F    +    K +  + P V   G ++     D +F +  +P  ++    +NF  + G  
Sbjct: 598 FSFLTNEELQKDSVQRLPKVTEIGDVAINVGDDATFLWQRKPEYKVALKNVNFQAKKGEL 657

Query: 519 VCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLS-CKSLRRHLGVVQQEPMLMS 577
            CIVG  G GKS +   +L               D+ R+    ++  ++  V Q   +M+
Sbjct: 658 TCIVGRVGSGKSALIQSIL--------------GDLFRVKGFATIHGNVAYVSQVAWIMN 703

Query: 578 GSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIA 637
           G++K N+ +G + +    E     K C     ++   +G  T++G +G SLSGGQK R++
Sbjct: 704 GTVKDNILFGHKYDAEFYE--KTIKACALTIDLSVLVDGDQTLVGEKGISLSGGQKARLS 761

Query: 638 IARALMKKPKILILDEATSALDVE-SEGAINYTLGK--LMKSKELTIISIAHRLSTIRRS 694
           +ARA+  +    +LD+  +A+D   +   I + LG   L+ +K  T +   +++S +  +
Sbjct: 762 LARAVYSRADTYLLDDPLAAVDEHVARHLIEHVLGPNGLLHTK--TKVLATNKVSVLSVA 819

Query: 695 ENVIVLGNDGSVVEVGKFKDLYADQQSELYKLL---------NDKKRDKPTPRVQSDPEK 745
           ++V +L N G +V+ G + ++  D  S+L KL+         N    +  TP   S    
Sbjct: 820 DSVSLLEN-GEIVQQGSYDEIMKDGASQLNKLIMEYGKKSNGNPASSNAITP--ASSSTN 876

Query: 746 DREQEHQIDNQVRE-QVANDFNL 767
            REQ   ++++++E +   D NL
Sbjct: 877 IREQTIPLEDELKELKKLEDINL 899

>TPHA0K02310 Chr11 (497267..502216) [4950 bp, 1649 aa] {ON} Anc_4.6
            YHL035C
          Length = 1649

 Score =  141 bits (355), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 158/624 (25%), Positives = 270/624 (43%), Gaps = 101/624 (16%)

Query: 154  KLLTFAIGLLAISSVIGMSIPKVIGMVLDAIKNTYSSATGPVGLDDLPPIVNDLSMYEFL 213
            K++ F  GLL ++  I +S  +   +   +  N+     G +G        N+ S+Y +L
Sbjct: 1055 KMIIFICGLLLLAHAIYVS--QSWWLRYWSNDNSLDVNGGTIG--------NESSLY-YL 1103

Query: 214  GIFAGALVIGTVANFGRIVLLRVLGEKLVARLRSNVIRKIIHQDAEFFDRNKVGDLISRL 273
             I+    V  ++ +  R +     G      +   ++ ++++    FFD   +G +++R 
Sbjct: 1104 RIYFLIGVTHSIISSTRGIFSFFAGVNTANLIFKKLLYRVVNSKLTFFDNTPIGRIMNRF 1163

Query: 274  SSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTSALLMFAPPLLIGALIYGKR 333
            S D  V+   +   +   F                 + +T   L+ A  ++  ++  G  
Sbjct: 1164 SKDIQVLDSELAPFLDGVFSCFIQAVTALMLI----VFITPKFLIIAIFIICSSITIGYL 1219

Query: 334  IRMISRDLQE----STGNLTRVSEEQLSGVKTIQSFVAEGKELQRYNTAIRKVFLYGKKE 389
                SR+L+     S   + +   E LSG+ TI++F  E K L+     I +        
Sbjct: 1220 YLCCSRELKRFESSSKSPVYQHFTETLSGLVTIRAFGNEIKFLKENLDFIDE-------- 1271

Query: 390  ALTNATFFSSTNVLGDLSFLI-------VLAYGSHLVLQG-----GLTVGDLTAFMLYTE 437
               N  FF   +V   LSF I       V   G+ ++L       GL    LT  + +TE
Sbjct: 1272 --NNKFFFYMWSVNSWLSFRIDLLGAITVFGSGAFILLNADKIDAGLAGISLTYAVTFTE 1329

Query: 438  YTGSAVFGLSNFYSELMKGAGAASRL---FEMTDHAPSIKPTAGKP--YVPGSGKISFKD 492
            +       +  FYS +     +  RL    E+ + A +  P A  P    P  G I+F +
Sbjct: 1330 FC----LWMVKFYSTVEMSMNSVERLKEYMEIEEEALA-DPGAITPSENWPVQGAITFAN 1384

Query: 493  VSFSY-PTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDD 551
             S  Y P  P   +  +LN  I+ GS + +VG +G GKSTI S L R+ + SSG+I IDD
Sbjct: 1385 YSLRYAPKLP--DVLKQLNLKIDGGSKIGVVGRTGAGKSTIISALFRFLDCSSGKILIDD 1442

Query: 552  QDISRLSCKSLRRHLGVVQQEPMLMSGSIK-----------------------------Y 582
             DIS ++ + LR  L ++ Q+P L  G+I+                              
Sbjct: 1443 LDISEINLRRLRSCLTIIPQDPSLFVGTIRSNLDPNEEYENKDIYDALVKVHLLTEDYLA 1502

Query: 583  NLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARAL 642
            NL Y   ++V+ DE                F N  D+ I   G +LS GQ+Q I +AR++
Sbjct: 1503 NLNYDANADVAYDE--------------NIFLN-LDSPISEGGINLSQGQRQLICLARSI 1547

Query: 643  MKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGN 702
            +   KI++LDEAT+++D +S+  +  T+      K  TI++IAHR+ ++   + ++VL +
Sbjct: 1548 LHCSKIVLLDEATASIDYKSDFKVQETIRNEFSQK--TILTIAHRIKSVIDYDKILVL-D 1604

Query: 703  DGSVVEVGKFKDLYADQQSELYKL 726
             G  +E      L  ++ S  Y +
Sbjct: 1605 AGQALEFDHPYVLLQNKSSIFYSM 1628

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 66/215 (30%), Positives = 113/215 (52%), Gaps = 13/215 (6%)

Query: 508 KLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSC----KSLR 563
            +N   E G    ++GP+G GK+++   LL   +  SG++ + + + S+ +      +L 
Sbjct: 734 NINAEFEMGKLNLVIGPTGSGKTSLLMALLGELHLFSGKVFVPNLE-SKFNLIPESDNLL 792

Query: 564 RHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGP 623
             +    Q P + + +I+ N+ + +  +   D   +V   C           G  TI+G 
Sbjct: 793 NSIAYCSQLPWIFNDTIRNNIIFDMGYD--KDRYENVVIACGLERDFQILNLGDKTIVGD 850

Query: 624 RGASLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAI-NYTL-GKLMKSKELTI 681
           +G+ LSGGQKQRI++ARAL  K + LILD+  SA+D  S   I N  + G LM+ +  T 
Sbjct: 851 KGSCLSGGQKQRISLARALYSKSRHLILDDCLSAVDSHSAKWIYNVCITGPLMQGR--TC 908

Query: 682 ISIAHRLS-TIRRSENVIVLGNDGSVVEVGKFKDL 715
           I ++H +S TI+++  V ++ N G +V  G+  DL
Sbjct: 909 ILVSHNVSLTIKKASKVFMIEN-GYIVASGRPIDL 942

>TBLA0G00710 Chr7 (157927..163002) [5076 bp, 1691 aa] {ON} Anc_4.6
            YHL035C
          Length = 1691

 Score =  140 bits (353), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 136/550 (24%), Positives = 247/550 (44%), Gaps = 55/550 (10%)

Query: 212  FLGIFAGALVIGTVANFGRIVLLRVLGEKLVARLRSNVIRKIIHQDAEFFDRNKVGDLIS 271
            +L I+ G  V+ +     + +L    G     ++ +++++  +H    FFD   +G +++
Sbjct: 1137 YLSIYFGIGVLHSSIFAIKDILCTYAGLAASRKMFNSLLKNSLHAKLRFFDSTPLGRIMN 1196

Query: 272  RLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTSALLMFAPPLLIGALIYG 331
            R S D   V + +   +   F                +       +  A        +Y 
Sbjct: 1197 RFSKDIEAVDQEVPMYLGGTFACLVECFSIIVLITLITPQFLGVAIFIAVFYWFVGAVYI 1256

Query: 332  KRIRMISRDLQESTGNLTRVSEEQLSGVKTIQSFVAEGKELQRYNTAI---RKVFLYGKK 388
               R + R    +   + +   E L+G+ T++++  E + ++     I    K F Y   
Sbjct: 1257 SGSRELKRFDSITKSPIYQHFSETLAGITTVRAYGDESRFMRENLEKIDENNKPFFY--- 1313

Query: 389  EALTNATFFSSTNVLGDLSFLIVLAYGSHLV----LQGGLTVGDLTAFMLYTEYTGSAVF 444
              ++N      T ++G  +F+I+ A G  +     +  GL    LT  + +++    A  
Sbjct: 1314 MWVSNRWLSFRTQIIG--AFVILGAGGFSIWNINKIDSGLAGISLTYALTFSD----AAL 1367

Query: 445  GLSNFYSELMKGAGAASRLFEM--TDHAPSIKPTAGKPY-VPGSGKISFKDVSFSY-PTR 500
             L  FY +      +  R+ E    D  P  + T   P   P +GKI   DVS  Y P  
Sbjct: 1368 WLVRFYGDTEMNMNSTERIQEYMNIDQEPYNEGTVEPPADWPENGKIEINDVSLRYAPNL 1427

Query: 501  PGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCK 560
            P  ++   ++FT++  S V IVG +G GKSTI + L R+  P +G I ID+ DI  +  +
Sbjct: 1428 P--RVIKNVSFTVDSKSKVGIVGRTGAGKSTIITALFRFLEPETGNIKIDNIDIVSIDLQ 1485

Query: 561  SLRRHLGVVQQEPMLMSGSIKYNLT-YGLQSE------------VSMDEI---------- 597
             LRR + ++ Q+P L +G+I+ NL  Y   S+            VS +E+          
Sbjct: 1486 KLRRSISIIPQDPTLFTGTIRSNLDPYTQYSDKEIFDSLICVNLVSREELAQVQSPSSND 1545

Query: 598  -RSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATS 656
              S+  + F H    ++       +   G+++S GQ+Q + +AR+L+ KPKI++LDEAT+
Sbjct: 1546 TSSIVSENFNHFLDLEYN------VSEGGSNISQGQRQLLCLARSLLGKPKIILLDEATA 1599

Query: 657  ALDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLY 716
            ++D ES+  I  T+     +   TI++IAHRL ++   + ++V+ + G V E      L 
Sbjct: 1600 SIDYESDKKIQETIRNEFGNS--TILTIAHRLRSVIDYDKILVM-DAGEVEEYDHPYSLL 1656

Query: 717  ADQQSELYKL 726
             ++ S  Y +
Sbjct: 1657 LNKNSIFYSM 1666

 Score = 77.0 bits (188), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 59/230 (25%), Positives = 108/230 (46%), Gaps = 9/230 (3%)

Query: 486 GKISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSG 545
            K+SFK+ + S+     +     L+   + G    ++GP+G GK+++   LL     + G
Sbjct: 756 NKLSFKNATMSWGNDNDSFKLRNLDIDFKIGQLNVVIGPTGSGKTSLLMALLGEMTLTEG 815

Query: 546 QITIDDQDISR---LSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAK 602
           QI I   D      +        +    Q   L++ +++ N+ +   S  + D   +   
Sbjct: 816 QINIPSLDPRHDLIIESDGHTNSIAYCSQAAWLLNDTVRNNILFN--SPYNKDRYDAAIV 873

Query: 603 KCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVES 662
                        G  T IG RG +LSGGQKQRI++ARAL    + ++LD+  SA+D  +
Sbjct: 874 AAGLKRDFEILAAGDLTEIGERGITLSGGQKQRISLARALYSNARHVLLDDCLSAVDAHT 933

Query: 663 EGAI--NYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVG 710
              I  N   G LM+ +  T + ++H ++   ++ +++V+  +G V + G
Sbjct: 934 AAWIYDNCISGPLMEGR--TCVLVSHNIALTLKNASLVVMLKNGRVADQG 981

>ZYRO0G22176g Chr7 (1822665..1827377) [4713 bp, 1570 aa] {ON} similar
            to uniprot|P14772 Saccharomyces cerevisiae YLL015W BPT1
            ABC type transmembrane transporter of MRP/CFTR family
            found in vacuolar membrane involved in the transport of
            unconjugated bilirubin and in heavy metal detoxification
            via glutathione conjugates along with Ycf1p
          Length = 1570

 Score =  138 bits (348), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 148/572 (25%), Positives = 259/572 (45%), Gaps = 75/572 (13%)

Query: 209  MYEFLGIFAGALVIGTVA--NFGRIVLL---RVLGEKLVARLRSNVIRKIIHQDAEFFDR 263
            +++F+GI+A  L I + A  N   +++L    + G K+   L + +   ++     FF+ 
Sbjct: 1025 LWKFVGIYA-LLGISSAAFDNIRAVIILLYSSIRGSKV---LHNKMAVSVLKSPMGFFES 1080

Query: 264  NKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTSALLMFAPPL 323
              +G +I+R SSD   V R++  N +  FK                       L+F   L
Sbjct: 1081 TPIGRIINRFSSDMSTVDRNLKYNFAFFFKCVLDYFVTILLIGYN----MPWFLVFNAGL 1136

Query: 324  LIGALIYGKRIRMISRDLQESTGN----LTRVSEEQLSGVKTIQSFVAEGKELQRYNTAI 379
            L+  + Y      +SR+L+  +      +  +  E L G   I +F    +  +R++   
Sbjct: 1137 LVVYVYYQVFYVTLSRELKRLSSTAFSPIMSLFSETLGGHMVITAF----RHSERFH--- 1189

Query: 380  RKVFL-YGKKEALTNATF-FSSTNVLGDLSFLIVLAYGSHLVLQGGL------------T 425
               FL + K +   +A F   STN    +   I+   G  +VL   L            T
Sbjct: 1190 ---FLNFNKTQFQIDAQFNLRSTNRWLSIRLQII---GGAMVLITALLTLATIGTKKQMT 1243

Query: 426  VGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFE---MTDHAPSI-KPTAGKPY 481
             G +   M Y     +++  +    + +     +  R++E   +   AP+I + +  +  
Sbjct: 1244 AGLVGLLMSYVLQVTNSLMWIVRMTTMIETNIISVERIYEYCQLPSEAPAIIESSRPEKS 1303

Query: 482  VPGSGKISFKDVSFSYPTRPG-NQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYY 540
             P  G+I FKD S  Y  RP  + +  K+N +I+P   + +VG +G GKS+++  L R  
Sbjct: 1304 WPSMGEIIFKDYSTKY--RPELDPVLKKINLSIKPREKIGVVGRTGAGKSSLSLALFRLL 1361

Query: 541  NPSSGQITIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSV 600
              + G I ID  DIS++    LR HL ++ Q+     G+++ NL     ++ S+ EI   
Sbjct: 1362 ESTGGSIEIDGVDISKIGLYDLRSHLSIIPQDAQAFEGTVRSNLDPF--NQYSVQEIWKA 1419

Query: 601  AKKCFCHGFVTKF-----PN---------GYDTIIGPRGASLSGGQKQRIAIARALMKKP 646
             +       + K      P+           D  I   G ++S GQ+Q + ++RAL+ K 
Sbjct: 1420 VELAHLKPHIIKMMTDEDPDKSSPEDEISALDVKISENGNNMSMGQRQLLCLSRALLSKS 1479

Query: 647  KILILDEATSALDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSV 706
            K+L+LDEAT+A+D+E++  I  T+    + K  TI++IAHR+ T+  S+ ++VL + G V
Sbjct: 1480 KVLVLDEATAAVDMETDQIIQETIRNEFQDK--TILTIAHRIDTVLDSDKILVL-DKGEV 1536

Query: 707  VEVGKFKDLYADQQSELYKLLN-----DKKRD 733
             E      L  D++S  Y L       DKK +
Sbjct: 1537 KEFESPDTLLKDEKSLFYGLCQKGGYLDKKNN 1568

 Score = 85.1 bits (209), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 77/258 (29%), Positives = 127/258 (49%), Gaps = 23/258 (8%)

Query: 510 NFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSL--RRHLG 567
           +F  + G+  C+VG  G GKST+   +L       GQ+         +S + L   R + 
Sbjct: 661 HFEAKKGALTCVVGRVGSGKSTLLRAIL-------GQLPCRSGPKEFISPEILVRARSVA 713

Query: 568 VVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGAS 627
              Q P +M+ SIK N+ +G + + +   +    K C     +     G +T++G +G S
Sbjct: 714 YCPQAPWVMNASIKDNILFGHRYDETYYNL--TIKACQLIPDLKILSEGDETLVGEKGIS 771

Query: 628 LSGGQKQRIAIARALMKKPKILILDEATSALDVE-SEGAINYTLGK---LMKSKELTIIS 683
           LSGGQK R+++ARA+  +  + ++D+  SA+D E S+  I+  LG+   L+K K  TII 
Sbjct: 772 LSGGQKARLSLARAVYSRADLYLMDDILSAVDAEVSKNIIDKVLGEENGLLKHK--TIIL 829

Query: 684 IAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYA-DQQSELYKLLNDKKRDKPTPRVQSD 742
             + +S ++ S N+I     G +VE G ++   +    S L KL+ +       P   SD
Sbjct: 830 TTNAVSVLKHS-NMIYALQGGRIVEEGTYEQAVSRGDDSVLQKLIKEFDTFAENP---SD 885

Query: 743 PEKDREQE-HQIDNQVRE 759
            +KD E + H I     E
Sbjct: 886 KKKDEENDSHSISEDFEE 903

>Smik_16.27 Chr16 complement(40287..44720) [4434 bp, 1477 aa] {ON}
            YGR281W (REAL)
          Length = 1477

 Score =  138 bits (347), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 169/658 (25%), Positives = 275/658 (41%), Gaps = 89/658 (13%)

Query: 108  QKTVESQAKTPADKESQKSGTMEDEESP--NMGYKEVIRLFKLATHDWKLLTFAIGLLAI 165
            +KT +    T  DK      T   EE    ++G K      K A   W  +  A+ L AI
Sbjct: 845  KKTTQMSQTTNRDKAIVDGHTSSKEERAVNSIGLKIYQEYIKAAVGKWGFI--ALPLYAI 902

Query: 166  SSVIGMSIPKVIGMVLDAIKNTYSSATGPVGLDDLPPIVNDLSMYEFLGIFAGALVIGTV 225
              V+G +   +   V       + S        + PP    + +Y F  +FA  + +   
Sbjct: 903  L-VVGTTFCSLFSSV-------WLSYWTENKFKNRPPSFY-MGLYSFF-VFAAFIFMN-- 950

Query: 226  ANFGRIVLLRVLGEKLVARLRSNVIRKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMT 285
               G+  +L  +G      L    +R+I+H    + D   +G +++R + D    + S+ 
Sbjct: 951  ---GQFTILCAMGIMASKCLNLRAVRRILHTPMSYIDTTPLGRILNRFTKD----TDSLD 1003

Query: 286  QNVSDGFKAXXXXXXXXXXXXXXSISLTSALLMFAPPLLIGALIYG----------KRIR 335
              +++  +                I       +  P LL+  ++            KR+ 
Sbjct: 1004 NELTESLRLMTSQFANIVGVCVMCIVYLPWFAIAIPFLLVVFVLIADHYQSSGREIKRLE 1063

Query: 336  MISRDLQESTGNLTRVSEEQLSGVKTIQSFVAEGKELQRYNTAIRKVFLYGKKEALTN-- 393
             + R    +  N      E L G+ TI+++ ++ + L + +  I K+   G    +    
Sbjct: 1064 AVQRSFVYNNLN------EVLGGMDTIKAYRSQERFLAKSDFLINKMNEAGYLVVVLQRW 1117

Query: 394  -ATFFSSTNVLGDLSFLIVLAYGSHLVLQGGLTVGDLTAFMLYTEYTGSAVFGLSNFYSE 452
               F     +    + +I L   +        +VG L  ++L          GL N    
Sbjct: 1118 VGIFLDMVAIA--FALIITLLCVTRAFPISAASVGVLLTYVLQLP-------GLLNTILR 1168

Query: 453  LM----KGAGAASRLFEMTDHAP----SIKPTAGKPY-VPGSGKISFKDVSFSYPTRPGN 503
             M        +A RL       P      KP    P   P  GKI F++V F+Y  RPG 
Sbjct: 1169 AMTQTENDMNSAERLVSYATKLPLEADYRKPEMTPPESWPSKGKIVFENVDFAY--RPGL 1226

Query: 504  QIFNK-LNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSL 562
             I  K  N  I+ G  + I G +G GKSTI S L R    ++GQI IDD DIS+L    L
Sbjct: 1227 PIVLKNFNLDIKSGEKIGICGRTGAGKSTIMSALYRLNELTAGQIFIDDVDISQLGLFDL 1286

Query: 563  RRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIR-------SVAKKCF---------- 605
            R+ L ++ Q+P+L  G+I+ NL      E + DE+        ++AK             
Sbjct: 1287 RKKLAIIPQDPVLFRGTIRKNLDPF--DERTDDELWDALVRGGAIAKNDLPEVRLQKPDE 1344

Query: 606  --CHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVESE 663
               HG + KF    D  +   G++ S G++Q +A+ RAL+++ KILILDEATS++D E++
Sbjct: 1345 NGTHGRMHKF--HLDQAVEEEGSNFSLGERQLLALTRALVRQSKILILDEATSSVDYETD 1402

Query: 664  GAINYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQS 721
            G I   +  + +  + TI+ IAHRL TI   + ++VL   G V E      L++ + S
Sbjct: 1403 GKIQTRI--VEEFGDCTILCIAHRLKTIVNYDRILVL-EKGEVAEYDTPWALFSQEDS 1457

 Score = 90.9 bits (224), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 67/217 (30%), Positives = 108/217 (49%), Gaps = 20/217 (9%)

Query: 506 FNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRH 565
           F  LNF I+ G  + I GP G GKS++ + +        G+I ++      L C      
Sbjct: 604 FKDLNFDIQKGEFIMITGPIGTGKSSLLNAMAGSMRKVDGKIEVNG---DLLMCGY---- 656

Query: 566 LGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRG 625
                  P + + +++ N+ +G  S  + ++   V   C     +   P G  T IG RG
Sbjct: 657 -------PWIQNATVRDNIIFG--SPFNKEKYDEVIHVCSLKADLDILPAGDMTEIGERG 707

Query: 626 ASLSGGQKQRIAIARALMKKPKILILDEATSALDVE-SEGAINYTLGKLMKSKELTIISI 684
            +LSGGQK RI +AR++ KK  I + D+  SA+D    +  ++  L  ++ +K  T I  
Sbjct: 708 ITLSGGQKARINLARSVYKKKDIYLFDDVLSAVDSRVGKHIMDECLTGMLSNK--TRILA 765

Query: 685 AHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQS 721
            H+LS I R+  VIVLG DG  V++G  ++L A  ++
Sbjct: 766 THQLSLIERASRVIVLGTDGK-VDIGTVEELKARNKT 801

>Skud_8.9 Chr8 complement(16026..20789) [4764 bp, 1587 aa] {ON}
            YHL035C (REAL)
          Length = 1587

 Score =  136 bits (342), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 144/556 (25%), Positives = 256/556 (46%), Gaps = 60/556 (10%)

Query: 207  LSMYEFLGIFAGALV-IGTVANFGRIVLLRVLGEKLVARLRSNVIRKIIHQDAEFFDRNK 265
            LSMY  +GI    L  I T+A F       + G +   ++ +N++  ++H +  FFD   
Sbjct: 1043 LSMYFLIGIIQALLGGIKTMATF-------LSGLQASKKIFNNMLDLVLHANIRFFDVTP 1095

Query: 266  VGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTSALLMFAPPLLI 325
            VG +++R + D   V + +   +                    +       ++       
Sbjct: 1096 VGRIMNRFAKDIEGVDQELIPYLEVTIFCLIQCLSIIFLITIITPRFLVVAVVVLVLYYF 1155

Query: 326  GALIYGKRIRMISRDLQESTGNLTRVSEEQLSGVKTIQSFVAEGKELQRYNTAI---RKV 382
                Y    R + R    +   + +   E L+GV TI++F  E + +      I    + 
Sbjct: 1156 VGKCYLSAGRELKRIDSITKSPIFQYFSETLAGVCTIRAFGDEKRFILENMDKIDQNNRA 1215

Query: 383  FLYGKKEALTNATFFSSTNVLGDLSFLIVLAYGSHLVLQGGLTVGDLTAFMLYTEYTGSA 442
            F Y    ++    F    +++G     IVL  GS ++L     +GD+ + +     T S 
Sbjct: 1216 FFY---LSVAVKWFAFRVDIIGAF---IVLGSGSFILLN----IGDIDSSLAGISLTYSI 1265

Query: 443  VF-----GLSNFYSELMKGAGAASRLFEMT---------DHAPSIKPTAGKPYVPGSGKI 488
            +F      L   YS       +  RL E +         +H  +++ +      P  GKI
Sbjct: 1266 LFTDGALWLVRLYSTFEMNMNSVERLKEYSGIEQENYNENHIQALQNSLW----PEHGKI 1321

Query: 489  SFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQIT 548
               ++S  Y +     I N ++FT++P + + IVG +G GKSTI + L R   P +G I 
Sbjct: 1322 EVDNLSLRYASNLPPVIKN-VSFTVDPQTKIGIVGRTGAGKSTIITALFRLLKPVTGCIK 1380

Query: 549  IDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNL----------TYGLQSEVSMDEIR 598
            ID  DIS++   +LRR + ++ Q+P+L +G+IK NL           + + S+V++   R
Sbjct: 1381 IDGYDISKIDLVTLRRAITIIPQDPILFTGTIKSNLDPYDEYDERRIFKVLSQVNLISSR 1440

Query: 599  ----SVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEA 654
                ++ ++    G   +F N   T I   G +LS G+KQ + IAR+L+++PKI++LDEA
Sbjct: 1441 ELEETLNREENFSGVHNRFLN-LRTEIVEGGLNLSQGEKQLLFIARSLLREPKIILLDEA 1499

Query: 655  TSALDVESEGAINYTL-GKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFK 713
            TS++D +S+  I   +  +  +S   TI++IAHRL ++   + V+V+ + G V E     
Sbjct: 1500 TSSIDYDSDHLIQGIIRNEFSRS---TILTIAHRLRSVIDYDKVLVM-DAGEVKEYDHPY 1555

Query: 714  DLYADQQSELYKLLND 729
            +L  +++S  Y +  D
Sbjct: 1556 ELLKNERSIFYSMCRD 1571

 Score = 78.2 bits (191), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 93/344 (27%), Positives = 152/344 (44%), Gaps = 42/344 (12%)

Query: 446 LSNFYSELMKGAGAASRLFEMTDHAPSIKPTAGKPYVPGSGKISFKDVSFSYPTRPGNQI 505
           LSN  S + +   +  R+ E  +   + K        P   KI FK  +  +     +  
Sbjct: 621 LSNMLSFMNQSKVSLERIVEFLNEEDTAKYNQ-LTVSPDKNKIKFKKATLVWNENDND-- 677

Query: 506 FNK-----LNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQD-----IS 555
            NK     LN     G    I+G +G GKS +   LL      SG I +   +     I 
Sbjct: 678 INKFRLCDLNINFRIGKLNLILGSTGSGKSALLMGLLGELYLLSGSIIVPGLEPRHDMIP 737

Query: 556 RLSCKSLRRHLGVVQQEPMLMSGSIKYNLTY-GLQSEVSMDEIRSVAKKCFCHGFVTKFP 614
            L+   L        Q   L++G+++ N+ + G+  E   +  ++V   C     +   P
Sbjct: 738 DLN--GLTNSFAYCSQSAWLLNGTVRNNIIFNGVYDE---NRYKNVIDACGLKRDLEILP 792

Query: 615 NGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTL---G 671
            G  T IG +G +LSGGQKQRI++ARA+    K ++LD+  SA+D  +   I Y +   G
Sbjct: 793 AGDSTEIGEKGITLSGGQKQRISLARAIYSNAKHVLLDDCLSAVDSHTAIWI-YEICITG 851

Query: 672 KLMKSKELTIISIAHRLS-TIRRSENVIVLGN-----DGSVVEV---GKFKD-----LYA 717
            LMK++  T I + H +S  IR++   ++L N      G++ E+   G FK+      Y 
Sbjct: 852 LLMKNR--TCILVTHNISLAIRKAYFAVILENGKVKSQGTITELKNKGVFKEDFGQLSYD 909

Query: 718 DQQSELYKLLNDKKR-DKPTPRVQSDPEKDREQEHQIDNQVREQ 760
           D  +E  K +N  +   +  PR+     +D E     + Q+ E+
Sbjct: 910 DNNTE--KNINRSEYFQEIAPRITGSTTEDTEVNIATNGQLIEE 951

>KAFR0I01300 Chr9 complement(262852..267462) [4611 bp, 1536 aa] {ON}
            Anc_4.52 YLL015W
          Length = 1536

 Score =  136 bits (342), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 142/553 (25%), Positives = 253/553 (45%), Gaps = 59/553 (10%)

Query: 207  LSMYEFLGIFAGALVIGTVANFGRIVLLRVLGEKLVARLRSNVIRKIIHQDAEFFDRNKV 266
            +++Y  +G+ + A  I     F  I++L     +    L  ++ + II    +FF+   +
Sbjct: 1005 VAVYALIGLGSAAFNI-----FRTIIMLLYCSIRGSKTLHDSMAKAIIRSPVQFFETTPI 1059

Query: 267  GDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTSALLMFAPPLLIG 326
            G +I+R SSD   V  ++    S  F++              S+++    L+F   ++I 
Sbjct: 1060 GRVINRFSSDIDSVDVNLQNVFSIFFRSILDYILTVILV---SVAM-PWFLLFNALIMII 1115

Query: 327  ALIYGKRIRMISRDLQESTGNLTRVSEEQLSGVKTIQSFVAEGKE-LQRYNTAIRKVFLY 385
               Y K   + SR+L+       R++    S + ++ S    G+  +  YN +  K+F +
Sbjct: 1116 YFYYEKLYIVQSRELK-------RLTSIAYSPIISLMSETLGGQMVISAYNHS--KMFKF 1166

Query: 386  GKKEALT---NATF-FSSTNVLGDLSFLIVLAYGSHLVLQGGLTV------------GDL 429
               E +    N  F F STN    +    + + G+ ++L  GL              G +
Sbjct: 1167 MNIERVQYNLNVLFTFRSTNRWLSIR---LQSIGAFIILCTGLLALTTLRTSSPIGSGLI 1223

Query: 430  TAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHAPSIKPTAGKPYV----PGS 485
               M Y     SA+  +     ++     +  R+ E     P  +       V    P  
Sbjct: 1224 GLLMSYVLQVTSALTWIVRSTVQIETNIVSVERILEYCHLPPEAEDIIDSNRVERDWPQR 1283

Query: 486  GKISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSG 545
            G I FK+ + +Y     + +   ++ TI P   V IVG +G GKST++  L R    + G
Sbjct: 1284 GSIEFKNYTTTYRANL-SPVLKNISVTINPSEKVGIVGRTGAGKSTLSLALFRILEAAEG 1342

Query: 546  QITIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLT-YGLQSEVSMDEIRSVAKKC 604
             I ID  DISR+    LR ++ ++ Q+     G+++ NL  +   ++V   E+ +V +  
Sbjct: 1343 TIFIDGVDISRIGLTDLRGNMAIIPQDAQAFEGTVRSNLDPFQKHTDV---ELWNVIELS 1399

Query: 605  FCHGFVTKFP---------NGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEAT 655
                 V +           +G D  I   G++LS GQ+Q + +ARAL+ + K+L+LDEAT
Sbjct: 1400 HLKPHVLRMAEDDNLSGNLSGLDAKINENGSNLSVGQRQLLCLARALLNQSKVLVLDEAT 1459

Query: 656  SALDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDL 715
            +A+DVE++  I  T+    K +  TI++IAHRL TI  ++ ++VL + G V E    K+L
Sbjct: 1460 AAVDVETDKIIQETIRTQFKDR--TILTIAHRLDTIMDNDKILVL-DAGGVKEFDSPKNL 1516

Query: 716  YADQQSELYKLLN 728
             +D+ +  Y+L +
Sbjct: 1517 LSDESTLFYQLCD 1529

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 77/279 (27%), Positives = 137/279 (49%), Gaps = 26/279 (9%)

Query: 510 NFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDIS-RLSCKSLRRHLGV 568
           +FT  P S  C++G  G GK+T+   +L      SG      + IS +LS +     +  
Sbjct: 646 HFTASPKSLTCVIGKVGSGKTTLLKAILGQLPCISGS----KESISPKLSIRG--ESIAY 699

Query: 569 VQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGASL 628
             QE  +M+ +IK N+ +G + + +   +   A  C         P+G  T++G +G SL
Sbjct: 700 CPQEAWIMNDTIKENILFGHKFDETYYTLTVAA--CELLADFDILPDGDQTLVGEKGISL 757

Query: 629 SGGQKQRIAIARALMKKPKILILDEATSALDV-ESEGAINYTLGK---LMKSKELTIISI 684
           SGGQK R+++ARA+  +  I +LD+  SA+D   S+  +   L     L+++K  T+I  
Sbjct: 758 SGGQKARVSLARAVYSRADIYLLDDILSAVDAGVSKKIVENVLDSNSGLLRNK--TVILS 815

Query: 685 AHRLSTIRRSENVIVLGNDGSVVEVGKFKDLY----ADQQSELYKLLND-----KKRDKP 735
            + +S ++ S+ +  L N G +VE G + D+     +D +S++  LL        KR+  
Sbjct: 816 TNTVSVLKHSQLIYALEN-GIIVERGNYNDIIESANSDDESKISALLKQFDVSLAKRESS 874

Query: 736 TPRVQSDPEKDREQEHQIDNQVREQVANDF-NLDQKSSK 773
              + S  +    Q+    + + E V N+  +L+  SS+
Sbjct: 875 NLSLTSKSQTAIPQDSTTKSDLIEDVDNEMSSLEDVSSR 913

>YGR281W Chr7 (1052824..1057257) [4434 bp, 1477 aa] {ON}  YOR1Plasma
            membrane ATP-binding cassette (ABC) transporter,
            multidrug transporter mediates export of many different
            organic anions including oligomycin; similar to human
            cystic fibrosis transmembrane receptor (CFTR)
          Length = 1477

 Score =  135 bits (341), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 142/552 (25%), Positives = 245/552 (44%), Gaps = 70/552 (12%)

Query: 212  FLGIFAGALVIGTVANFGRIVLLRVLGEKLVARLRSNVIRKIIHQDAEFFDRNKVGDLIS 271
            ++G+++  +    +   G+  +L  +G      L    +++I+H    + D   +G +++
Sbjct: 934  YMGLYSFFVFAAFIFMNGQFTILCAMGIMASKWLNLRAVKRILHTPMSYIDTTPLGRILN 993

Query: 272  RLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTSALLMFAPPLLIGALIYG 331
            R + D    + S+   +++  +                I       +  P LL+  ++  
Sbjct: 994  RFTKD----TDSLDNELTESLRLMTSQFANIVGVCVMCIVYLPWFAIAIPFLLVIFVLIA 1049

Query: 332  ----------KRIRMISRDLQESTGNLTRVSEEQLSGVKTIQSFVAEGKELQRYNTAIRK 381
                      KR+  + R    +  N      E L G+ TI+++ ++ + L + +  I K
Sbjct: 1050 DHYQSSGREIKRLEAVQRSFVYNNLN------EVLGGMDTIKAYRSQERFLAKSDFLINK 1103

Query: 382  VFLYGKKEALTN---ATFFSSTNVLGDLSFLIVLAYGSHLVLQGGLTVGDLTAFMLYTEY 438
            +   G    +       F     +    + +I L   +        +VG L  ++L    
Sbjct: 1104 MNEAGYLVVVLQRWVGIFLDMVAIA--FALIITLLCVTRAFPISAASVGVLLTYVL---- 1157

Query: 439  TGSAVFGLSNFYSELM----KGAGAASRLF----EMTDHAPSIKPTAGKPY-VPGSGKIS 489
                + GL N     M        +A RL     E+   A   KP    P   P  G+I 
Sbjct: 1158 ---QLPGLLNTILRAMTQTENDMNSAERLVTYATELPLEASYRKPEMTPPESWPSMGEII 1214

Query: 490  FKDVSFSYPTRPGNQIFNK-LNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQIT 548
            F++V F+Y  RPG  I  K LN  I+ G  + I G +G GKSTI S L R    ++G+I 
Sbjct: 1215 FENVDFAY--RPGLPIVLKNLNLNIKSGEKIGICGRTGAGKSTIMSALYRLNELTAGKIL 1272

Query: 549  IDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIR-------SVA 601
            ID+ DIS+L    LRR L ++ Q+P+L  G+I+ NL     +E + DE+        ++A
Sbjct: 1273 IDNVDISQLGLFDLRRKLAIIPQDPVLFRGTIRKNLDPF--NERTDDELWDALVRGGAIA 1330

Query: 602  KKCF------------CHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKIL 649
            K                HG + KF    D  +   G++ S G++Q +A+ RAL+++ KIL
Sbjct: 1331 KDDLPEVKLQKPDENGTHGKMHKF--HLDQAVEEEGSNFSLGERQLLALTRALVRQSKIL 1388

Query: 650  ILDEATSALDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEV 709
            ILDEATS++D E++G I   +  + +  + TI+ IAHRL TI   + ++VL   G V E 
Sbjct: 1389 ILDEATSSVDYETDGKIQTRI--VEEFGDCTILCIAHRLKTIVNYDRILVL-EKGEVAEF 1445

Query: 710  GKFKDLYADQQS 721
                 L++ + S
Sbjct: 1446 DTPWTLFSQEDS 1457

 Score = 95.5 bits (236), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 76/246 (30%), Positives = 120/246 (48%), Gaps = 29/246 (11%)

Query: 506 FNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRH 565
           F  LNF I+ G  + I GP G GKS++ + +      + G++ ++      L C      
Sbjct: 604 FKDLNFDIKKGEFIMITGPIGTGKSSLLNAMAGSMRKTDGKVEVNGD---LLMCGY---- 656

Query: 566 LGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRG 625
                  P + + S++ N+ +G  S  + ++   V + C     +   P G  T IG RG
Sbjct: 657 -------PWIQNASVRDNIIFG--SPFNKEKYDEVVRVCSLKADLDILPAGDMTEIGERG 707

Query: 626 ASLSGGQKQRIAIARALMKKPKILILDEATSALDVE-SEGAINYTLGKLMKSKELTIISI 684
            +LSGGQK RI +AR++ KK  I + D+  SA+D    +  ++  L  ++ +K  T I  
Sbjct: 708 ITLSGGQKARINLARSVYKKKDIYLFDDVLSAVDSRVGKHIMDECLTGMLANK--TRILA 765

Query: 685 AHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQSELYKLLNDKKRDKPTPRVQSDPE 744
            H+LS I R+  VIVLG DG  V++G   +L A  Q+ L  LL            Q+  +
Sbjct: 766 THQLSLIERASRVIVLGTDGQ-VDIGTVDELKARNQT-LINLLQFSS--------QNSEK 815

Query: 745 KDREQE 750
           +D EQE
Sbjct: 816 EDEEQE 821

>Kwal_56.22747 s56 (262824..267440) [4617 bp, 1538 aa] {ON} YLL015W
            (BPT1) - ABC-type transmembrane transporter; highly
            homologous to human MRP1 and to C. elegans mrp-1 [contig
            184] FULL
          Length = 1538

 Score =  135 bits (340), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 150/549 (27%), Positives = 236/549 (42%), Gaps = 54/549 (9%)

Query: 212  FLGIFAG-ALVIGTVANFGRIVLLRVLGEKLVARLRSNVIRKIIHQDAEFFDRNKVGDLI 270
            ++GI+   +L    ++N   IVLL V   K   +L   +   +I     FF+   VG +I
Sbjct: 1007 YVGIYVFISLSAALLSNARTIVLLLVCSIKASRKLHDTMALAVIRSPMSFFETTPVGRII 1066

Query: 271  SRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTSALLMFAPPLLIGALIY 330
            +R SSD   +  S+ Q V   F                 + L    L+    LL+    Y
Sbjct: 1067 NRFSSDMNSLDDSV-QYVMSFFLVSILDYLVVVIIIGYQVPL---FLIVNAVLLVIYFYY 1122

Query: 331  GKRIRMISRDLQE----STGNLTRVSEEQLSGVKTIQSFVAEGKELQRYNTAIRKVFLYG 386
                  +SR+L+     S   +  +  E L+G   I +F    +            F Y 
Sbjct: 1123 QVYYVTLSRELKRLMSTSFSPIMSMLSETLAGHMIIDAFRHSDR------------FDYL 1170

Query: 387  KKEAL---TNATF-FSSTNV-----LGDLSFLIVL--AYGSHLVLQGG--LTVGDLTAFM 433
              E +    N  F F STN      L  +  L++L  A  S     GG  L+ G +   M
Sbjct: 1171 NVENVQFNINCLFNFRSTNRWLSIRLESIGALMILTTALLSLATKNGGHALSTGMVGLLM 1230

Query: 434  LYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHAPSIKPTA--GKP--YVPGSGKIS 489
             Y     + +  +     +L     +  R+ E  D  P   P     +P    P  G I 
Sbjct: 1231 SYALQVTNKLMWIVRMSVQLETNIVSVERIVEYCDLPPEAPPVIEDSRPPKNWPSQGLIR 1290

Query: 490  FKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITI 549
            FK+ S  Y     + +   L+  I+P   + IVG +G GKST++  L R   PS G I I
Sbjct: 1291 FKNYSTRYRANL-DPVLRHLDLEIKPQEKIGIVGRTGAGKSTLSLALFRILEPSEGTIDI 1349

Query: 550  DDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGF 609
            D  DIS++  K LR +L ++ Q+     G+++ NL    Q   S +EI    +       
Sbjct: 1350 DGVDISKIGLKDLRSNLSIIPQDAQAFEGTVRTNLDPFEQ--YSDEEIWKALELSHLKPH 1407

Query: 610  VTKFPNG----------YDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALD 659
            + K                T I   G++LS GQ+Q + ++RAL+ + +IL+LDEAT+A+D
Sbjct: 1408 ILKMAKDDADPEKKEDLLQTKISENGSNLSVGQRQLLCLSRALLNRSRILVLDEATAAVD 1467

Query: 660  VESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQ 719
             E++  I  T+    K +  TI++IAHR+ T+  S+ ++VL + G V E     +L A +
Sbjct: 1468 SETDRLIQETIRAEFKDR--TILTIAHRIDTVMDSDKIMVL-DKGEVKEFDSPSNLLAQK 1524

Query: 720  QSELYKLLN 728
             S  Y L +
Sbjct: 1525 DSIFYNLCD 1533

 Score = 88.6 bits (218), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 74/260 (28%), Positives = 129/260 (49%), Gaps = 34/260 (13%)

Query: 511 FTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRR--HLGV 568
           F +  G  VC+VG  G GKST    LL       GQ+       S  S     R   + +
Sbjct: 649 FQVFKGQLVCVVGRVGAGKSTFLQALL-------GQLPCISNSPSHASPTVHFRANSVAL 701

Query: 569 VQQEPMLMSGSIKYNLTYGLQSEVSMDE--IRSVAKKCFCHGFVTKFPNGYDTIIGPRGA 626
             Q+  +M+ S+K N+ +G +     DE   ++  + C     +    +G +T++G +G 
Sbjct: 702 CSQQSWIMNASVKDNVLFGHR----FDEATYKATLEACQLVPDLEILADGDETLVGEKGI 757

Query: 627 SLSGGQKQRIAIARALMKKPKILILDEATSALDVE-SEGAINYTLGK---LMKSKELTII 682
           SLSGGQK R+++ARA+  +  + +LD+  SA+D E  +  I   L K   L+K+K  T+I
Sbjct: 758 SLSGGQKARLSLARAVYSRSDVYLLDDILSAVDAEVCKRIIEQVLSKKTGLLKNK--TVI 815

Query: 683 SIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLY-ADQQSELYKLLNDKKRDKPTPRVQS 741
              + +S ++ S+++  L  DG +VE G F D+   D  S+L +L+           V+ 
Sbjct: 816 LTTNSISVLKHSQSIYAL-EDGEIVESGSFNDIMRRDDSSKLKRLI-----------VEC 863

Query: 742 DPEKDREQEHQIDNQVREQV 761
           + E  + +   +D++++  V
Sbjct: 864 ESENTKAKIEPVDSEIKAPV 883

>YDR135C Chr4 complement(723004..727551) [4548 bp, 1515 aa] {ON}
            YCF1Vacuolar glutathione S-conjugate transporter; member
            of the ATP-binding cassette family; has a role in
            detoxifying metals such as cadmium, mercury, and
            arsenite; also transports unconjugated bilirubin,
            selenodigluthatione, and oxidized glutathione; similar to
            human cystic fibrosis protein CFTR
          Length = 1515

 Score =  135 bits (340), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 151/575 (26%), Positives = 248/575 (43%), Gaps = 52/575 (9%)

Query: 176  VIGMVLDAIKNTYSSATGPVG--LDDLPPIVNDLSMYEFLGI-FAGALVIGTVANFGRIV 232
            VI M L  + N +      V       P     L++Y  LGI  A A +I T+  +   V
Sbjct: 959  VISMFLSVMGNVWLKHWSEVNSRYGSNPNAARYLAIYFALGIGSALATLIQTIVLW---V 1015

Query: 233  LLRVLGEKLVARLRSNVIRKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGF 292
               +   K +  L +N    ++     FF+   +G +++R S+D Y V   + +  S  F
Sbjct: 1016 FCTIHASKYLHNLMTN---SVLRAPMTFFETTPIGRILNRFSNDIYKVDALLGRTFSQFF 1072

Query: 293  KAXXXXXXXXXXXXXXSISLTSALLMFAPPLLIGALIYGKRIRMISRDLQESTGNLTRVS 352
                              + T   +    PL +  + Y +     SR+L+    ++TR  
Sbjct: 1073 ----VNAVKVTFTITVICATTWQFIFIIIPLSVFYIYYQQYYLRTSRELRR-LDSITRSP 1127

Query: 353  -----EEQLSGVKTIQSFVAEGKELQRYNTAIRKVFLYGKKEALTNATFFSSTNVLGDLS 407
                 +E L G+ T++     G   Q+  + I +  +     A     F+ S N    L+
Sbjct: 1128 IYSHFQETLGGLATVR-----GYSQQKRFSHINQCRIDNNMSA-----FYPSINANRWLA 1177

Query: 408  FLIVLAYGSHLVL-----------QGGLTVGDLTAFMLYTEYTGSAVFGLSNFYSELMKG 456
            + + L  GS ++L           QG LT G +   + Y       +  +     E+   
Sbjct: 1178 YRLELI-GSIIILGAATLSVFRLKQGTLTAGMVGLSLSYALQITQTLNWIVRMTVEVETN 1236

Query: 457  AGAASRLFEMTD---HAPSIKPTAGKPY-VPGSGKISFKDVSFSYPTRPG-NQIFNKLNF 511
              +  R+ E  D    AP I      P   P  G I F + S  Y  RP  + +   +N 
Sbjct: 1237 IVSVERIKEYADLKSEAPLIVEGHRPPKEWPSQGDIKFNNYSTRY--RPELDLVLKHINI 1294

Query: 512  TIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRHLGVVQQ 571
             I+P   V IVG +G GKS++T  L R    S G I ID+  I+ +    LR  L ++ Q
Sbjct: 1295 HIKPNEKVGIVGRTGAGKSSLTLALFRMIEASEGNIVIDNIAINEIGLYDLRHKLSIIPQ 1354

Query: 572  EPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGG 631
            +  +  G+++ N+   +         R++         ++   +G D  +   G +LS G
Sbjct: 1355 DSQVFEGTVRENID-PINQYTDEAIWRALELSHLKEHVLSMSNDGLDAQLTEGGGNLSVG 1413

Query: 632  QKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTIISIAHRLSTI 691
            Q+Q + +ARA++   KIL+LDEAT+A+DVE++  +  T+    K +  TI++IAHRL+TI
Sbjct: 1414 QRQLLCLARAMLVPSKILVLDEATAAVDVETDKVVQETIRTAFKDR--TILTIAHRLNTI 1471

Query: 692  RRSENVIVLGNDGSVVEVGKFKDLYADQQSELYKL 726
              S+ +IVL N G V E      L +D +S  Y L
Sbjct: 1472 MDSDRIIVLDN-GKVAEFDSPGQLLSDNKSLFYSL 1505

 Score = 94.0 bits (232), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 97/396 (24%), Positives = 184/396 (46%), Gaps = 40/396 (10%)

Query: 349 TRVSEEQLSGVKTIQSFVAEGK-----ELQRYNTAIRKVFLYGKKEALTNATFFSSTNVL 403
           TRV  E L+ +K+++ +  E       E  R N  ++ +   G   A+T+  F     ++
Sbjct: 484 TRVISEILNNIKSLKLYAWEKPYREKLEEVRNNKELKNLTKLGCYMAVTSFQFNIVPFLV 543

Query: 404 GDLSFLIVLAYGSHLVLQGGLTVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRL 463
              +F  V  Y     L   L    LT F L +         L++F    ++ + +  RL
Sbjct: 544 SCCTF-AVFVYTEDRALTTDLVFPALTLFNLLSFPLMIIPMVLNSF----IEASVSIGRL 598

Query: 464 FEMTDHAPSIKPTAGK--PYVPGSGKISFK---DVSFSYPTRPGNQI-FNKLNFTIEPGS 517
           F    +   ++P + +  P V   G ++     D +F +  +P  ++    +NF  + G+
Sbjct: 599 FTFFTN-EELQPDSVQRLPKVKNIGDVAINIGDDATFLWQRKPEYKVALKNINFQAKKGN 657

Query: 518 NVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLS-CKSLRRHLGVVQQEPMLM 576
             CIVG  G GK+ + S +L               D+ R+    ++   +  V Q P +M
Sbjct: 658 LTCIVGKVGSGKTALLSCML--------------GDLFRVKGFATVHGSVAYVSQVPWIM 703

Query: 577 SGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRI 636
           +G++K N+ +G + +    E     K C     +    +G  T++G +G SLSGGQK R+
Sbjct: 704 NGTVKENILFGHRYDAEFYE--KTIKACALTIDLAILMDGDKTLVGEKGISLSGGQKARL 761

Query: 637 AIARALMKKPKILILDEATSALDVE-SEGAINYTLGK--LMKSKELTIISIAHRLSTIRR 693
           ++ARA+  +    +LD+  +A+D   +   I + LG   L+ +K  T +   +++S +  
Sbjct: 762 SLARAVYARADTYLLDDPLAAVDEHVARHLIEHVLGPNGLLHTK--TKVLATNKVSALSI 819

Query: 694 SENVIVLGNDGSVVEVGKFKDLYADQQSELYKLLND 729
           ++++ +L N G + + G + ++  D  S L+KLLN+
Sbjct: 820 ADSIALLDN-GEITQQGTYDEITKDADSPLWKLLNN 854

>ZYRO0D06160g Chr4 (524435..529012) [4578 bp, 1525 aa] {ON} highly
            similar to uniprot|P39109 Saccharomyces cerevisiae
            YDR135C
          Length = 1525

 Score =  135 bits (339), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 163/646 (25%), Positives = 282/646 (43%), Gaps = 68/646 (10%)

Query: 113  SQAKTPADKESQKSGTMEDEESPNMGYKEVIRLFKLATHDWKLLTFAIGLLAISSVIGMS 172
            SQ+   A   + +S   +DEE+ N  ++EV ++       W +    +    I +V+   
Sbjct: 909  SQSLRRASDATLRSIDFDDEEAVNKEHREVGKV------KWGIYWEYVRSCGIRNVLIFM 962

Query: 173  IPKVIGMVLDAIKNTY----SSATGPVGLDDLPPIVNDLSMYEFLGIFAG-ALVIGTVAN 227
               ++ M L  + + +    S      G +  P     L++Y   GIF+  + +I TV  
Sbjct: 963  SFAILSMFLSVMGSVWLKHWSEVNTKYGAN--PHAGGYLAVYLAFGIFSALSTLIQTVVL 1020

Query: 228  FGRIVLLRVLGEKLVARLRSNVIRKIIHQDAEFFDRNKVGDLISRLSSDAYVVS----RS 283
            +   V   + G K    L + +   +      FF+   +G +++R S+D + V     R+
Sbjct: 1021 W---VYCTIHGSKY---LHAGMANSVFRAPMRFFETTPIGRILNRFSNDIFKVDELLGRT 1074

Query: 284  MTQNVSDGFKAXXXXXXXXXXXXXXSISLTSALLMFAPPLLIGALIYGKRIRMISRDLQ- 342
             +Q V++  K                   T    +F  PL I  + Y +     SR+L+ 
Sbjct: 1075 FSQFVNNVIKVSFTIIVICFT--------TWQFTLFVIPLGILYVYYQQYYLRTSRELRR 1126

Query: 343  -ESTGN--LTRVSEEQLSGVKTIQSFVAEGKELQRYNTAIRKVFLYGKKEALTNATFFSS 399
             +ST    +    +E L G+ TI+           YN   R + +   +     + ++ S
Sbjct: 1127 LDSTTRSPIYAHFQESLGGLSTIRG----------YNQQRRFIHINQSRMDNNMSAYYPS 1176

Query: 400  TNVLGDLSF-------LIVLAYGSHLVLQ---GGLTVGDLTAFMLYTEYTGSAVFGLSNF 449
             N    L++       +I+    S  +L+   G LT G +   + Y      ++  +   
Sbjct: 1177 VNANRWLAYRLEFIGTIIIFGASSLSILRLKSGSLTPGMIGLSLSYALQITQSLNWIVRM 1236

Query: 450  YSELMKGAGAASRLFEMTD---HAPS-IKPTAGKPYVPGSGKISFKDVSFSYPTRPG-NQ 504
              E+     +  R+ E ++    AP  I+     P  P  G I F+  S  Y  RPG + 
Sbjct: 1237 TVEVETNIVSVERIKEYSEIPSEAPYLIEDRRPSPNWPTDGAIQFQHYSTRY--RPGLDL 1294

Query: 505  IFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRR 564
            I   +N  I+P   + IVG +G GKS++T  L R    + G+I ID   I ++    LR 
Sbjct: 1295 ILKDINLDIKPKEKIGIVGRTGAGKSSLTLALFRLIEAAEGRIVIDGVPIDQMGLYDLRH 1354

Query: 565  HLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPN-GYDTIIGP 623
             L ++ Q+  +  GS++ N+      + S +EI  V         V    N G  T +  
Sbjct: 1355 KLSIIPQDSQVFEGSVRENI--DPTEQYSDEEIWRVLDLSHLKNHVLNMGNDGLLTQLSE 1412

Query: 624  RGASLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTIIS 683
             G +LS GQ+Q + +ARAL+   KIL+LDEAT+A+DVE++  +  T+      +  TI++
Sbjct: 1413 GGGNLSVGQRQLMCLARALLVPTKILVLDEATAAVDVETDKVLQETIRTAFADR--TILT 1470

Query: 684  IAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQSELYKLLND 729
            IAHRL+TI  S+ ++VL + G V E    ++L  +  +  Y L  D
Sbjct: 1471 IAHRLNTIMDSDRILVL-DAGRVAEFDTPENLLKNPGTMFYGLCQD 1515

 Score = 94.4 bits (233), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 94/369 (25%), Positives = 167/369 (45%), Gaps = 61/369 (16%)

Query: 382 VFLYGKKEALTNATFFSSTNVLGDLSF-LIVLAYGSHLVLQGGLTVGDLTAFMLYTEYTG 440
           VF+Y +   LT    F +  + G LSF L V+    +  ++  +++G L +F+   E   
Sbjct: 554 VFVYTEDRPLTTDLVFPALTLFGLLSFPLAVVPLVLNSYIEASVSIGRLYSFLTNEELQR 613

Query: 441 SAVFGLSNFYSELMKGAGAASRLFEMTDHAPSIKPTAGKPYVPGSGKISFK---DVSFSY 497
            +V                  RL                P V   G ++ K   + +F +
Sbjct: 614 DSV-----------------QRL----------------PRVKNIGDVAMKLGDNATFLW 640

Query: 498 PTRPGNQI-FNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISR 556
             +P  ++    +NF  + G   C+VG  G GKS +   LL               D+ R
Sbjct: 641 KRKPEYKVALKNVNFQAKKGELNCVVGRVGSGKSALIQSLL--------------GDLFR 686

Query: 557 LS-CKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPN 615
           +    ++  ++  V Q   +M+G++K N+ +G + +    E     K C     +   P+
Sbjct: 687 VKGFATVHGNIAYVSQVAWIMNGTVKDNILFGHKYDPEFYE--KTIKACALTIDLAILPD 744

Query: 616 GYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVE-SEGAINYTLGK-- 672
           G  TI+G +G SLSGGQK R+++ARA+  +  I +LD+  +A+D   S   I++ LG   
Sbjct: 745 GDKTIVGEKGISLSGGQKARLSLARAVYSRADIFLLDDPLAAVDEHVSTHLIDHVLGPNG 804

Query: 673 LMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQSELYKLLNDKKR 732
           L+K+K  T I   +++S +  +++V +L N G +++ G F ++     S L KL+ +  +
Sbjct: 805 LLKTK--TKILATNKISALSIADSVTLLEN-GEIIQQGTFCEITKAADSPLSKLIKEYGK 861

Query: 733 DKPTPRVQS 741
            K    V S
Sbjct: 862 KKHKSEVAS 870

>Suva_2.297 Chr2 complement(518369..522919) [4551 bp, 1516 aa] {ON}
            YDR135C (REAL)
          Length = 1516

 Score =  135 bits (339), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 152/578 (26%), Positives = 255/578 (44%), Gaps = 58/578 (10%)

Query: 176  VIGMVLDAIKNTY----SSATGPVGLDDLPPIVNDLSMYEFLGI-FAGALVIGTVANFGR 230
            VI M L  + N +    S      G +  P     L +Y  LGI  A A +I T+  +  
Sbjct: 960  VISMFLSVMGNVWLKHWSEVNSHYGAN--PHAARYLGIYFALGIGSALATLIQTIVLW-- 1015

Query: 231  IVLLRVLGEKLVARLRSNVIRKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSD 290
             V   +   K +  L +N    ++     FF+   +G +++R S+D Y V   + +  S 
Sbjct: 1016 -VFCTIHASKYLHNLMTN---SVLRAPMTFFETTPIGRILNRFSNDIYKVDALLGRTFSQ 1071

Query: 291  GFKAXXXXXXXXXXXXXXSISLTSALLMFA-PPLLIGALIYGKRIRMISRDLQESTGNLT 349
             F                 I +T+   +F   PL +  + Y +     SR+L+    ++T
Sbjct: 1072 FF-----VNAVKVTFTITVICVTTWQFIFIIVPLGVFYIYYQQYYLRTSRELRR-LDSIT 1125

Query: 350  RVS-----EEQLSGVKTIQSFVAEGKELQRYNTAIRKVFLYGKKEALTNATFFSSTNVLG 404
            R       +E L G+ T++     G   Q+  + I +  +     A     F+ S N   
Sbjct: 1126 RSPIYSHFQETLGGLATVR-----GYSQQKRFSHINQCRIDNNMSA-----FYPSVNANR 1175

Query: 405  DLSFLIVLAYGSHLVL-----------QGGLTVGDLTAFMLYTEYTGSAVFGLSNFYSEL 453
             L++ + L  GS ++L           QG LT G +   + Y       +  +     E+
Sbjct: 1176 WLAYRLELI-GSVIILGAATLSVFRLKQGTLTAGMVGLSLSYALQITQTLNWIVRMTVEV 1234

Query: 454  MKGAGAASRLFEMTD---HAPSIKPTAGKPY-VPGSGKISFKDVSFSYPTRPG-NQIFNK 508
                 +  R+ E  D    AP +      P   PG G I F   S  Y  RP  + +  +
Sbjct: 1235 ETNIVSVERIKEYADIKSEAPLVIEGHRPPKEWPGQGDIKFNQYSTRY--RPELDLVLKQ 1292

Query: 509  LNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRHLGV 568
            ++  I+P   + IVG +G GKS++T  L R    S+G I ID   I+ +    LR  L +
Sbjct: 1293 IDIHIKPKEKIGIVGRTGAGKSSLTLALFRIIEASAGNIVIDGIPINEIGLYDLRHKLSI 1352

Query: 569  VQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGASL 628
            + Q+  +  G+++ N+   +         R++         ++   +G D+ +   G++L
Sbjct: 1353 IPQDSQVFEGTVRENID-PINQYTDEAMWRALELSHLKEHILSMSNDGLDSQLTEGGSNL 1411

Query: 629  SGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTIISIAHRL 688
            S GQ+Q + +ARA++ + KIL+LDEAT+A+DVE++  I  T+    K +  TI++IAHRL
Sbjct: 1412 SVGQRQLLCLARAMLVQSKILVLDEATAAVDVETDKVIQETIRTAFKDR--TILTIAHRL 1469

Query: 689  STIRRSENVIVLGNDGSVVEVGKFKDLYADQQSELYKL 726
            +TI  S+ +IVL N G V E      L  + +S  Y L
Sbjct: 1470 NTIMDSDRIIVLDN-GKVAEFDSPAQLLTNTKSLFYSL 1506

 Score = 94.0 bits (232), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 89/364 (24%), Positives = 164/364 (45%), Gaps = 63/364 (17%)

Query: 382 VFLYGKKEALTNATFFSSTNVLGDLSF-LIVLAYGSHLVLQGGLTVGDLTAFMLYTEYTG 440
           VF+Y +  ALT    F +  +   LSF L+++    +  ++  +++G L +F    E   
Sbjct: 551 VFVYTEDRALTTDLVFPALTLFNLLSFPLMIIPMVLNSFIEASVSIGRLFSFFTNEELQP 610

Query: 441 SAVFGLSNFYSELMKGAGAASRLFEMTDHAPSIKPTAGKPYVPGSGKISFK---DVSFSY 497
            +V                  RL                P V   G I+     D +F +
Sbjct: 611 DSV-----------------QRL----------------PKVENVGDIAINIGDDATFLW 637

Query: 498 PTRPGNQI-FNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISR 556
             +P  ++    +NF  + G   C+VG  G GK+ + S  L               D+ R
Sbjct: 638 QRKPEYKVALKNINFQAKKGELTCVVGKVGSGKTALLSSTL--------------GDLFR 683

Query: 557 LS-CKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPN 615
           +    S+   +  V Q P +M+G++K N+ +G + +    E     K C     +    +
Sbjct: 684 VKGFASVHGSVAYVSQVPWIMNGTVKENILFGHKYDAEFYE--KTIKACALTIDLAILMD 741

Query: 616 GYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVE-SEGAINYTLGK-- 672
           G  T++G +G SLSGGQK R+++ARA+  +    +LD+  +A+D   +   + + LG   
Sbjct: 742 GDQTLVGEKGISLSGGQKARLSLARAVYSRADTYLLDDPLAAVDEHVARHLVEHVLGSNG 801

Query: 673 LMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQSELYKLLND--K 730
           L+ +K  T +   +++S +  ++++ +L N G +++ G + D+  D  S L+KL+ D  K
Sbjct: 802 LLHTK--TKLLATNKVSALSVADSIALLDN-GEIIQQGTYDDITKDADSPLWKLIKDYGK 858

Query: 731 KRDK 734
           K +K
Sbjct: 859 KNNK 862

>Kpol_1060.7 s1060 complement(13248..17630) [4383 bp, 1460 aa] {ON}
            complement(13248..17630) [4383 nt, 1461 aa]
          Length = 1460

 Score =  134 bits (337), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 135/542 (24%), Positives = 246/542 (45%), Gaps = 60/542 (11%)

Query: 212  FLGIFAGALVIGTVANFGRIVLLRVLGEKLVARLRSNVIRKIIHQDAEFFDRNKVGDLIS 271
            ++G+++  +  G +    +  ++  +G     +L  + +R+I+H    F D   +G +++
Sbjct: 919  YMGLYSFFVFGGYIFMTSQFTIVCFIGVNASKKLNLSAVRRILHTPMAFLDTTPLGRILN 978

Query: 272  RLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTSALLMFAPPLLIGALIYG 331
            R + D   +   +T+NV                     I +    +++ P   I      
Sbjct: 979  RFTKDTDSLDNELTENVR-----------LMLAQFANIIGVCVMCIIYLPWFAIAIPFIL 1027

Query: 332  KRIRMISRDLQESTGNLTRVS-----------EEQLSGVKTIQSFVAEGKELQRYNTAIR 380
                ++S   Q +   + R+             E L G+ TI+ + +E + + + +  I 
Sbjct: 1028 LIFVLVSNHYQSAGREIKRLEAIQRSFVYNNLNEVLGGMDTIRFYNSEERFMAKSDYLID 1087

Query: 381  KVFLYGKKEALTNATFFSSTNVLGDL-----SFLIVLAYGSHLVLQGGLTVGDLTAFMLY 435
            K+   G               VL D+     + +I L   +        +VG L  ++L 
Sbjct: 1088 KMNEAGYLVVCVQ----RWVAVLLDMIAVCFALIIALLCVTRQFHISASSVGVLLTYVLQ 1143

Query: 436  TEYTGSAVF-GLSNFYSELMKGAGAASRLFEMTDHAPSIKP-TAGKPYVPGSGKISFKDV 493
                 + V   L+   +++       S   E+   A   KP ++  P  P  GKI F++V
Sbjct: 1144 LPGLLNTVLRALTQTENDMNSVERLVSYATELPTEAAYRKPESSPDPSWPQEGKIDFEEV 1203

Query: 494  SFSYPTRPG-NQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQ 552
            SF+Y  RPG   +   L+ +I  G  + I G +G GKSTI S L R     SG+I ID  
Sbjct: 1204 SFAY--RPGLPAVLKNLSMSINGGEKIGICGRTGAGKSTIMSALYRLNELESGRIIIDGV 1261

Query: 553  DISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLT-YGLQSE---------------VSMDE 596
            +IS +    LRR L ++ Q+P+L  G+I+ NL  +G +S+                S++E
Sbjct: 1262 NISNIGLFDLRRSLSIIPQDPVLFRGTIRKNLDPFGERSDDELWDALSRGGSIDKESLEE 1321

Query: 597  IRSVAKKCFCHGFVTKFPNGY-DTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEAT 655
            +++  +K   +  V +    + D  +   G++ S G++Q +A+ARAL++  K+LILDEAT
Sbjct: 1322 VKT--QKSTGNSKVQELHKFHLDQEVEEEGSNFSLGERQLLALARALVRNSKVLILDEAT 1379

Query: 656  SALDVESEGAINYTLGKLMKS-KELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKD 714
            S++D E++  I     +++++  E TI+ IAHRL TI   + ++VL   G + E     +
Sbjct: 1380 SSVDYETDNKIQ---NRIIEAFSECTILCIAHRLKTILNYDRILVL-EKGEIAEFDSPYN 1435

Query: 715  LY 716
            LY
Sbjct: 1436 LY 1437

 Score = 84.7 bits (208), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 63/223 (28%), Positives = 103/223 (46%), Gaps = 32/223 (14%)

Query: 506 FNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRH 565
           F  +N  I  G  + I GP G GK+++ + +      + G + I+ + +           
Sbjct: 604 FKDINLEIHKGEFIMITGPIGTGKTSLLNAMSGLMEKTEGSVQINGELL----------- 652

Query: 566 LGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRG 625
              +   P + + +++ N+ +G  S     +   V K C     +   P G  T IG RG
Sbjct: 653 ---MGGYPWIQNATVRDNIIFG--SPFDKSKYNMVVKACCLDADLDILPAGDMTEIGERG 707

Query: 626 ASLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKEL------ 679
            +LSGGQK RI +AR + K   I + D+  SA+D          +GKL+  + L      
Sbjct: 708 INLSGGQKARINLARCVYKNKDIYLFDDVLSAVDSR--------VGKLIMDECLLGLLNG 759

Query: 680 -TIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQS 721
            T +   H+LS +  +  VIVLGNDGS V++G  ++L    Q+
Sbjct: 760 KTRVLATHQLSLVENASRVIVLGNDGS-VDIGTVEELKKRNQT 801

>KAFR0C06510 Chr3 (1306097..1310470) [4374 bp, 1457 aa] {ON} Anc_5.10
            YGR281W
          Length = 1457

 Score =  134 bits (336), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 95/267 (35%), Positives = 146/267 (54%), Gaps = 26/267 (9%)

Query: 474  KPTAGKPY-VPGSGKISFKDVSFSYPTRPGNQIFNK-LNFTIEPGSNVCIVGPSGRGKST 531
            KP    P   P  G+I F DV F+Y  R G  +  K LN  I+ G  + I G +G GKST
Sbjct: 1178 KPELSPPESWPSKGEIRFLDVDFAY--RSGLPVVLKGLNLDIKSGEKIGICGRTGAGKST 1235

Query: 532  ITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLT------ 585
            I S L R    +SG+I IDD DIS L    LRR L ++ Q+P+L  G+I+ NL       
Sbjct: 1236 IMSALYRLNELTSGKILIDDVDISTLGLYDLRRKLSIIPQDPVLFKGTIRKNLDPFSNYD 1295

Query: 586  ----------YGLQSEVSMDEIRS-VAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQ 634
                       G   + S+++++S +  +   H  + KF    D ++   G++ S G++Q
Sbjct: 1296 DSLLWDALIRSGAIEKESVEKVKSEMVNEEGTHTDMHKF--HLDQLVEEEGSNFSLGERQ 1353

Query: 635  RIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRRS 694
             +A+ RAL+++ KILILDEATS++D E++G I   +  + +    TI+ IAHRL TI + 
Sbjct: 1354 VLALTRALVRQSKILILDEATSSVDYETDGKIQKRI--VEEFDNCTILCIAHRLKTILQY 1411

Query: 695  ENVIVLGNDGSVVEVGKFKDLYADQQS 721
            + ++VL   G + E  +   L++D+ S
Sbjct: 1412 DRILVL-EKGVIAEFDQPFKLFSDKDS 1437

 Score = 97.4 bits (241), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 74/247 (29%), Positives = 119/247 (48%), Gaps = 21/247 (8%)

Query: 506 FNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRH 565
           F+ L+F I  G  + I GP G GKS++ +    + N + G+I ++      L C      
Sbjct: 588 FSNLDFEIRKGEFIMITGPIGTGKSSLLNAFAGFMNKTEGRIQVNG---DLLFCGY---- 640

Query: 566 LGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRG 625
                  P + + ++K N+ +G  S    ++  +V + C     +   P G  T IG RG
Sbjct: 641 -------PWIQNATVKDNILFG--SPFIKEKYENVLRVCSLDADLKVLPAGDKTEIGERG 691

Query: 626 ASLSGGQKQRIAIARALMKKPKILILDEATSALDVE-SEGAINYTLGKLMKSKELTIISI 684
            +LSGGQK RI +ARA+ K   I + D+  SA+D    +  ++  L  L++ K  T I  
Sbjct: 692 INLSGGQKARINLARAVYKTKDIFLFDDVLSAVDSRVGKHIMDECLLDLLEGK--TRILA 749

Query: 685 AHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQSELYKLLNDKKRDKPTPRVQSDPE 744
            H+LS I +++ VIVLG DGS  ++G   +L    Q+ L  LL+    ++        P 
Sbjct: 750 THQLSLIEKADRVIVLGTDGS-FDIGTVDELKQRNQT-LTNLLDYSTTERENENRDESPV 807

Query: 745 KDREQEH 751
            D E + 
Sbjct: 808 ADEENDE 814

>NCAS0B03470 Chr2 complement(606008..610546) [4539 bp, 1512 aa] {ON}
            Anc_8.303
          Length = 1512

 Score =  134 bits (336), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 136/495 (27%), Positives = 228/495 (46%), Gaps = 51/495 (10%)

Query: 260  FFDRNKVGDLISRLSSDAY----VVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTSA 315
            FF+   +G +++R S+D Y    V+ R+ +Q   +  K                I  T+ 
Sbjct: 1038 FFETTPIGRILNRFSNDVYKVDSVLGRTFSQFFVNAVKVSFTIIV---------ICFTTW 1088

Query: 316  LLMFAP-PLLIGALIYGKRIRMISRDLQE----STGNLTRVSEEQLSGVKTIQSFVAEGK 370
              +F   PL +  + Y +     SR+L+     +   +    +E L G+ TI+     G 
Sbjct: 1089 QFIFIIIPLGVFYIYYQQYFLRTSRELRRLDSITKSPIFSHFQETLGGITTIR-----GY 1143

Query: 371  ELQRYNTAIRKVFLYGKKEALTNATFFSSTNVLGDLSF-------LIVLAYGSHLVL--- 420
            + Q   T I +  +     A     F+ S N    L++       LI+L   +  V    
Sbjct: 1144 QQQHRFTHINQCRVDNNMSA-----FYPSVNANRWLAYRLETIGSLIILGAATLSVFRLR 1198

Query: 421  QGGLTVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTD---HAPS-IKPT 476
            QG LT G +   + Y      ++  +     E+     +  R+ E +D    AP+ I+  
Sbjct: 1199 QGTLTAGMVGLSLSYALQITQSLNWIVRMTVEVETNIVSVERIKEYSDLKSEAPAVIEDH 1258

Query: 477  AGKPYVPGSGKISFKDVSFSYPTRPG-NQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSL 535
                  P  G I F+  S  Y  RP  + I   +N  I+P   V IVG +G GKS++T  
Sbjct: 1259 RPAETWPDEGDIKFEHYSTRY--RPELDLILKDINVHIKPKEKVGIVGRTGAGKSSLTLA 1316

Query: 536  LLRYYNPSSGQITIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMD 595
            L R    SSG+I ID+  I+ +    LR  L ++ Q+  +  G+++ N+     +E + +
Sbjct: 1317 LFRIIEASSGRIVIDNVPINEIGLYDLRHKLSIIPQDSQVFEGTVRENI--DPTNEYTDE 1374

Query: 596  EIRSV-AKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEA 654
            +I +V A        ++    G +  +   G +LS GQ+Q + +ARAL+   KIL+LDEA
Sbjct: 1375 QIWNVLALSHLKDHIISMGDEGLNNQLTEGGNNLSVGQRQLLCLARALLVPSKILLLDEA 1434

Query: 655  TSALDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKD 714
            T+A+DVE++  I  T+    K +  TI++IAHR++TI  S+ +IVL N G++ E    + 
Sbjct: 1435 TAAVDVETDKVIQETIRTAFKDR--TILTIAHRINTIMDSDRIIVLDN-GTIKEFDSPEK 1491

Query: 715  LYADQQSELYKLLND 729
            L  +  S  Y L  +
Sbjct: 1492 LLENPSSLFYSLCQE 1506

 Score = 86.3 bits (212), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 99/436 (22%), Positives = 188/436 (43%), Gaps = 56/436 (12%)

Query: 349 TRVSEEQLSGVKTIQSFVAEGKELQ-----RYNTAIRKVFLYGKKEALTNATFFSSTNVL 403
           TRV  E L+ +K+++ +  E    Q     R N  ++ +   G   AL +  F     ++
Sbjct: 481 TRVISEMLNNIKSLKLYAWEVPYRQKLENVRNNKELKNLTKLGCYMALMSFQFNVVPFLV 540

Query: 404 GDLSFLIVLAYGSHLVLQGGLTVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRL 463
              +F     Y  +  L   L    LT F L        +  + N  + +++ + +  RL
Sbjct: 541 SCCTF-AAFIYTENRPLTTDLVFPALTLFNL----LHFPLMVIPNVLTMIIETSVSIGRL 595

Query: 464 FEMTDHAPSIKPTAGK-PYVPGSGKISFK---DVSFSYPTRPGNQI-FNKLNFTIEPGSN 518
           F    +    K    + P V   G ++     D +F +  +P  ++    +NF  + G  
Sbjct: 596 FSFLTNEELQKDAVQRLPKVTNIGDVAINVGDDATFLWQRKPEYKVALKNINFQAKKGEL 655

Query: 519 VCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLS-CKSLRRHLGVVQQEPMLMS 577
            CIVG  G GKS +   +L               D+ R+    ++  ++  V Q   +M+
Sbjct: 656 TCIVGKVGSGKSAMIQSIL--------------GDLFRVKGFATIHGNVAYVSQVAWIMN 701

Query: 578 GSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIA 637
           G++K N+ +G   +   D  +   K C     +    +G  T++G +G SLSGGQK R++
Sbjct: 702 GTVKENILFG--HKYDEDFYQKTIKACALTIDLAVLMDGDQTLVGEKGISLSGGQKARLS 759

Query: 638 IARALMKKPKILILDEATSALDVE-SEGAINYTLG---------KLMKSKELTIISIAHR 687
           +ARA+  +    +LD+  +A+D   +   + + LG         K++ + +++++SIA  
Sbjct: 760 LARAVYSRADTYLLDDPLAAVDEHVARHLVEHVLGPNGLLHTKTKVLATNKVSVLSIADS 819

Query: 688 LSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQSELYKLLND--KKRDKPTPRV--QSDP 743
           +S          L  +G +V+ G + ++  D  S L KL+ +  KK    T  V   +  
Sbjct: 820 VS----------LLENGEIVQQGTYDEIMKDDSSPLSKLITEYGKKSTDSTSNVTPSTSS 869

Query: 744 EKDREQEHQIDNQVRE 759
               EQ   ++ +++E
Sbjct: 870 SNIHEQSVPLEAELKE 885

>CAGL0G00242g Chr7 complement(20428..24861) [4434 bp, 1477 aa] {ON}
            highly similar to uniprot|P53049 Saccharomyces cerevisiae
            YGR281w YOR1 ATP-binding cassette transporter protein
          Length = 1477

 Score =  134 bits (336), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 139/556 (25%), Positives = 250/556 (44%), Gaps = 74/556 (13%)

Query: 207  LSMYEFLGIFAGALVIGTVANFGRIVLLRVLGEKLVARLRSNVIRKIIHQDAEFFDRNKV 266
            + +Y F  +F G L +     F  + ++ ++  K    L    +++I+H    + D   +
Sbjct: 936  MGLYSFF-VFGGYLFMNI--QFTMLCMMGIMASKW---LNLKAVKRILHAPMSYLDTTPL 989

Query: 267  GDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTSALLMFAPPLLIG 326
            G +++R + D   +   +T+N+    +                I       +  P LL+ 
Sbjct: 990  GRILNRFTKDTDSLDNELTENI----RLMMSQFANIIGVCVLCIVYLPWFAIAIPFLLLV 1045

Query: 327  ALIYG----------KRIRMISRDLQESTGNLTRVSEEQLSGVKTIQSFVAEGKELQRYN 376
             ++            KR+  I R       NL  V    L G+ TI+++ ++ + + + +
Sbjct: 1046 FVLIADHYQSAGREIKRLEAIQRSF--VYNNLIEV----LGGMDTIKAYKSQDRYMTKMD 1099

Query: 377  TAIRKVFLYGKKEALTNATFFSSTNVLGDLS-FLIVLAYGSHLVLQ----------GGLT 425
              I K+          N   +   +V   ++ FL ++A    L++               
Sbjct: 1100 FLINKM----------NEVSYMVVSVQRWVAIFLDMIAVAFALIISLLCVTRQFHISPSA 1149

Query: 426  VGDLTAFMLYTEYTGSAVF-GLSNFYSELMKGAGAASRLFEMTDHAPSIKPTAGKP-YVP 483
            VG L  ++L      + V   L+   +++       +   E+   A   K     P   P
Sbjct: 1150 VGVLLTYVLQLPGLLNTVLRALTQTENDMNSAERLVTYATELPQEAAYRKSDYSPPDNWP 1209

Query: 484  GSGKISFKDVSFSYPTRPG-NQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNP 542
             +G++ F+DVSF+Y  RPG   +   +N +I  G  + I G +G GKSTI + L R    
Sbjct: 1210 TNGEVIFEDVSFAY--RPGLPTVLKNVNLSIAGGEKIGICGRTGAGKSTIMTALYRLNEL 1267

Query: 543  SSGQITIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLT-YGLQSEVSM------- 594
            +SG+I ID  D  +L    LRR L ++ Q+P+L  G+I+ NL  +   S+ S+       
Sbjct: 1268 TSGRIFIDGIDTFKLGLYDLRRKLSIIPQDPVLFRGTIRKNLDPFNEFSDDSLWNSLIRG 1327

Query: 595  -----DEIRSVA----KKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKK 645
                 D++  +      K   +  + KF    D I+   GA+ S G++Q +A+ RAL+++
Sbjct: 1328 GAIEKDDLEDIKHQKPDKNGSYNNMHKF--HLDQIVEEDGANFSLGERQVLALTRALVRQ 1385

Query: 646  PKILILDEATSALDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGS 705
             KILILDEATS++D E++G I   +    + ++ TI+ IAHRL TI   + ++VL   G 
Sbjct: 1386 SKILILDEATSSVDYETDGKIQTRIAT--EFQDCTILCIAHRLKTILNYDRILVL-EKGE 1442

Query: 706  VVEVGKFKDLYADQQS 721
            V E  K + L+ +++S
Sbjct: 1443 VAEFDKPEILFNNEKS 1458

 Score = 91.3 bits (225), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 64/217 (29%), Positives = 112/217 (51%), Gaps = 20/217 (9%)

Query: 506 FNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRH 565
           F+ LNF I+ G  + I GP G GKS++ + +  +   ++G++ I+      L C      
Sbjct: 617 FSNLNFEIKKGEFIMITGPIGTGKSSLLNAMAGFMPQTTGELDINGH---MLLCGY---- 669

Query: 566 LGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRG 625
                  P + + +++ N+ +G  S    ++ + V + C     +   P G  T IG RG
Sbjct: 670 -------PWIQNATVRDNIIFG--SPYDREKYKEVIRVCSLQADIDILPAGDMTEIGERG 720

Query: 626 ASLSGGQKQRIAIARALMKKPKILILDEATSALDVE-SEGAINYTLGKLMKSKELTIISI 684
            +LSGGQK RI +AR++ K   I + D+  SA+D    +  ++    + ++SK  T I  
Sbjct: 721 ITLSGGQKARINLARSVYKNKDIYLFDDVLSAVDSRVGKHIMDECFLQTLQSK--TRILA 778

Query: 685 AHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQS 721
            H+LS I +++ VIVL  +GS V++G  ++L    Q+
Sbjct: 779 THQLSLIEKADRVIVLSTNGS-VDIGTVEELKTRNQT 814

>KNAG0K00170 Chr11 complement(15700..20028) [4329 bp, 1442 aa] {ON}
            Anc_5.10 YGR281W
          Length = 1442

 Score =  133 bits (334), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 136/547 (24%), Positives = 238/547 (43%), Gaps = 56/547 (10%)

Query: 207  LSMYEFLGIFAGALVIGTVANFGRIVLLRVLGEKLVARLRSNVIRKIIHQDAEFFDRNKV 266
            + MY F  +F   L +       +  LL  LG +    L    + +I+H    + D   +
Sbjct: 901  MGMYSFF-VFGAYLFMNL-----QFTLLCTLGLRASKWLNLKAVERILHTPMSYLDTTPL 954

Query: 267  GDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTSALLMFAPPLLIG 326
            G +++R + D    + S+   +++  +                I       +  P LLI 
Sbjct: 955  GRILNRFTKD----TDSLDNELTESIRLMLSQVGNLIGVIVMCIVYLPWFAIAVPFLLII 1010

Query: 327  ALIYG----------KRIRMISRDLQESTGNLTRVSEEQLSGVKTIQSFVAEGKELQRYN 376
             ++            KR+  + R    +  N      E L G+ TI+++ ++ + L + +
Sbjct: 1011 FVLICDHYQSTGREIKRLEAVQRSFVYNNFN------EVLGGMDTIKAYGSQERFLAKTD 1064

Query: 377  TAIRKVFLYGKKEALTN---ATFFSSTNVLGDLSFLIVLAYGSHLVLQGGLTVGDLTAFM 433
              I K+   G          A    S  V+  L  + +L       +  G +VG L  ++
Sbjct: 1065 YLINKMNEAGYLIVAVQRWVAILLDSVAVVFAL-IITLLCVTRAFPISAG-SVGVLLTYV 1122

Query: 434  LYTEYTGSAVF-GLSNFYSELMKGAGAASRLFEMTDHAPSIKPTAGKPY-VPGSGKISFK 491
            L      + +   L+   +++       +   E+   A   KP    P   P  G I F 
Sbjct: 1123 LQLPGLLNTILRALTQTENDMNSAERLVTYATELPLEAAYRKPEVSPPESWPEKGDIDFI 1182

Query: 492  DVSFSYPTRPG-NQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITID 550
            DV+F+Y  RPG   +   +N  I  G  + I G +G GKSTI S L R    S G+I ID
Sbjct: 1183 DVNFAY--RPGLPVVLKNMNLKINNGEKIGICGRTGAGKSTIMSALYRLNELSDGKIVID 1240

Query: 551  DQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLT----------------YGLQSEVSM 594
              DI ++    LR+ L ++ Q+P+L  G+I+ NL                  G+    ++
Sbjct: 1241 GVDIRKIGLYDLRKKLTIIPQDPVLFRGTIRKNLDPFKECSDDLLWDALIRTGVVERENL 1300

Query: 595  DEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEA 654
            ++I+ + K    + +        D ++   G++ S G++Q +A+ RAL++  KILILDEA
Sbjct: 1301 NDIK-LEKPDENNSYSNMHKFHLDELVEEEGSNFSLGERQMLALTRALVRNSKILILDEA 1359

Query: 655  TSALDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKD 714
            TS++D E++G I   +  + +  + TI+ IAHRL TI   + ++VL   G + E  K  +
Sbjct: 1360 TSSVDYETDGKIQSRI--VSEFGDCTILCIAHRLKTILSYDKILVL-EKGVIAEYEKPWE 1416

Query: 715  LYADQQS 721
            L+ D+ S
Sbjct: 1417 LFNDKNS 1423

 Score = 85.5 bits (210), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 64/218 (29%), Positives = 108/218 (49%), Gaps = 22/218 (10%)

Query: 506 FNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRH 565
           F  LN  I  G  + + GP G GK+++ + +  +   +SG++ ++ +    L C      
Sbjct: 581 FTDLNLEIFKGEFIIVTGPIGTGKTSLLNAMAGFMKQTSGRVEVNGE---LLLCGY---- 633

Query: 566 LGVVQQEPMLMSGSIKYNLTYGL-QSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPR 624
                  P +++ +++ N+ +G    E   +EI  V   C     +   P G  T IG R
Sbjct: 634 -------PWILNATVRDNILFGSPYEEARYNEIVEV---CSLDADLKILPAGDRTEIGER 683

Query: 625 GASLSGGQKQRIAIARALMKKPKILILDEATSALDVE-SEGAINYTLGKLMKSKELTIIS 683
           G +LSGGQK RI +ARA+ K   I + D+  SA+D    +  ++  L  ++K K  T I 
Sbjct: 684 GITLSGGQKARINLARAVYKNKDIFLFDDVLSAVDSRVGKHIMDDCLLGILKGK--TRIL 741

Query: 684 IAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQS 721
             H+LS I R++ +IV+G +GS  + G   +L    Q+
Sbjct: 742 ATHQLSVIERADRIIVVGPNGS-FDFGTLDELKGRNQT 778

>KAFR0L00190 Chr12 complement(21836..26797) [4962 bp, 1653 aa] {ON}
            Anc_4.6 YHL035C
          Length = 1653

 Score =  133 bits (334), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 137/519 (26%), Positives = 234/519 (45%), Gaps = 59/519 (11%)

Query: 249  VIRKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXX 308
            ++ K++H    FFD   +G +++R S D       + Q+++  F+               
Sbjct: 1134 LLDKVLHAKLRFFDSTPIGRIMNRFSKDM----EGIDQDLAPYFQGAFYSFIECITTIIL 1189

Query: 309  SISLTSALLMFAPPLLIGALIY--GKRIRMISRDLQE----STGNLTRVSEEQLSGVKTI 362
               +T   L  A  +++G L Y  G      SR+L+     +   + +   E L GV TI
Sbjct: 1190 ITFITPQFLSVA--IIVGMLYYMIGYFYLTGSRELKRLDSITKSPIYQHFSETLVGVTTI 1247

Query: 363  QSFVAEGKELQRYNTAI---RKVFLYGKKEALTNATFFSSTNVLGDLSFLIVLAYGSHLV 419
            ++F  E + L+     I    + F Y     + N       +V+G L   +V   G  ++
Sbjct: 1248 RAFGDESRFLRENLLKIDENNRPFFY---LWVANRWLSFRIDVIGAL---VVFGSGIFIL 1301

Query: 420  -----LQGGLTVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFE-MT-DHAPS 472
                 +  G+    LT  + +TE        L  FYSE+     +  R+ E MT +  P 
Sbjct: 1302 TNINTIDSGMAGISLTYAISFTE----GALWLVRFYSEVEMNMNSVERVHEYMTIEQEPY 1357

Query: 473  IKPTAGKPYVPGS----GKISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRG 528
             +       VP      G+I   D+S  Y       I N + F ++P + V +VG +G G
Sbjct: 1358 DEVQVSDSKVPADWPEEGRIEVSDLSLRYAAHLPKVIKN-VTFNVDPRAKVGVVGRTGAG 1416

Query: 529  KSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLT-YG 587
            KSTI + L R+    +G I ID  DI+ ++   LRR + ++ Q+P L SG+IK NL  Y 
Sbjct: 1417 KSTIITALFRFLEAETGYIKIDGLDITSVNLTRLRRSITIIPQDPTLFSGTIKSNLDPYD 1476

Query: 588  -LQSEVSMDEIRSVA----------------KKCFCHGFVTKFPNGYDTIIGPRGASLSG 630
              + E   + +R V                 +       + +F +  ++ I   G + S 
Sbjct: 1477 EYKDEEVFEALRRVNLVTEEELSSRTENNNDEASVSSKNINRFLD-LESEIAEGGTNFSQ 1535

Query: 631  GQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTIISIAHRLST 690
            GQ+Q I +AR+L++ PKIL+LDEAT+++D +S+  +  T+    +  E TI++IAHRL +
Sbjct: 1536 GQRQLICLARSLLRSPKILLLDEATASIDYDSDAKVQETIRT--EFSESTILTIAHRLRS 1593

Query: 691  IRRSENVIVLGNDGSVVEVGKFKDLYADQQSELYKLLND 729
            +   + ++V+G  G V E      L  ++ S  Y +  +
Sbjct: 1594 VIDYDKILVMGA-GEVKEYDHPYSLLLNKNSIFYSMCEN 1631

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 60/230 (26%), Positives = 110/230 (47%), Gaps = 9/230 (3%)

Query: 486 GKISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSG 545
            +I+FK+ + ++     +     LN   + G    I+GP+G GK+++   LL   N   G
Sbjct: 699 NQIAFKNTTVAWDNSRDSFKLRNLNIDFKVGKLNVIIGPTGSGKTSLLMALLGEMNLLEG 758

Query: 546 QITIDDQDISR---LSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAK 602
           QI +   +      +        +    Q   L++ +++ N+ +   S  +     +V +
Sbjct: 759 QIVVPALNARHDLIVESDGTTNSIAYCSQAAWLLNDTVRNNILFN--SPYNETRYHNVVE 816

Query: 603 KCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVES 662
            C           G  T IG +G +LSGGQKQRI++ARAL    + ++LD+  SA+D  +
Sbjct: 817 ACGLRRDFEILKAGDMTEIGEKGIALSGGQKQRISLARALYSNSRHVLLDDCLSAVDAHT 876

Query: 663 EGAI--NYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVG 710
              +  N   G LM+ +  T I ++H ++   R+ +++V+  DG V + G
Sbjct: 877 ALWVYDNCITGPLMEGR--TCILVSHNIALTLRNADLVVMLEDGQVKDQG 924

>ACL072C Chr3 complement(224562..229445) [4884 bp, 1627 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YLL048C
            (YBT1) and YHL035C
          Length = 1627

 Score =  132 bits (332), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 141/522 (27%), Positives = 236/522 (45%), Gaps = 77/522 (14%)

Query: 249  VIRKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXX 308
            V+ KI+H    FFD    G +++RLS D   V + +       F A              
Sbjct: 1114 VLWKILHAKMRFFDATPTGRIMNRLSKDLEAVDQELIPYFEGSFAAV------------- 1160

Query: 309  SISLTSALLMFA---PPLLIGALIYGKRIRMI-------SRDLQESTGNLTRVS-----E 353
             +   S L++ A   P  LI A+  G    +I       SR+L+    ++TR        
Sbjct: 1161 -VQCISTLVLIAYVTPQFLIMAIFIGFLYALIGYFYVTTSRELKRFE-SITRSPIYQHFS 1218

Query: 354  EQLSGVKTIQSFVAEGK----ELQRYNTAIRKVFLYGKKEALTNATFFSSTNVLGDL--- 406
            E L G+ +I+++  E +     L R +   R  F       + N       ++LG L   
Sbjct: 1219 ETLVGITSIRAYGDERRFMLENLSRIDDNNRPFFYLW----IANRWLAFRVDLLGALVTF 1274

Query: 407  --SFLIVLAYGSHLVLQGGLTVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLF 464
                 I L  G    L  GL    LT  + +TE  G+  F     YS +     +  RL 
Sbjct: 1275 FSGLFIYLNIGK---LDAGLAGISLTYAIFFTE--GALWF--VRHYSNVEMTMNSFERLK 1327

Query: 465  E-MTDHAPSIKPTAGKP--YVPGSGKISFKDVSFSY-PTRPGNQIFNKLNFTIEPGSNVC 520
            E M          A  P    P  G+I   D+S  Y P  P  ++   +NF++EP   V 
Sbjct: 1328 EYMEIEQEPYNENAQLPPDNWPQHGRIDVSDLSLRYAPNLP--KVIKNVNFSVEPKLKVG 1385

Query: 521  IVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSI 580
            IVG +G GKSTI + + R+ +P +G + ID+ DI+ +    LR+ + ++ Q+P L +G++
Sbjct: 1386 IVGRTGAGKSTIITAMFRFLDPETGFVKIDNIDITTIPLHRLRQSITIIPQDPTLFTGTL 1445

Query: 581  KYNLT----------------YGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPR 624
            K  L                   L S+  ++ + S + +      + KF +  +  +   
Sbjct: 1446 KSILDPYSQYSDKQIYEALQRVNLLSDTDINSLSSPSTQSSGEN-INKFLD-LNNEVTEG 1503

Query: 625  GASLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTIISI 684
            GA+LS GQ+Q + +AR+L++ PKI++LDEAT+++D  S+  I  T+ +  + ++ TI++I
Sbjct: 1504 GANLSQGQRQLVCLARSLLRSPKIIMLDEATASIDYTSDEKIQQTIRE--EFRDSTILTI 1561

Query: 685  AHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQSELYKL 726
            AHRL +I   + V+V+ + G V E      L  ++ +  Y +
Sbjct: 1562 AHRLKSIIDYDKVLVM-DAGEVKEYDHPYSLLLNKNTIFYNM 1602

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 57/222 (25%), Positives = 108/222 (48%), Gaps = 10/222 (4%)

Query: 487 KISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQ 546
           +++F++ + ++   P +     ++     G      GP+G GKS++   LL       G+
Sbjct: 671 RLAFENATIAWNDDPSSFRLRNIDIEFMIGKLNVAFGPTGTGKSSLLLGLLGEMTLQEGK 730

Query: 547 I---TIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKK 603
           I   ++D ++   +    L   +    Q   L++ + + N+ +   S  +      V + 
Sbjct: 731 IYVPSLDPREDLVIQADGLTNSIAYCSQSAWLLNDTARSNILF--NSPYNEQRYNDVLEA 788

Query: 604 CFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVESE 663
           C           G  T IG +G +LSGGQKQRI++ARAL    + L+LD+  SA+D  + 
Sbjct: 789 CGLKKDFEILSGGDLTQIGEKGMTLSGGQKQRISLARALYSSARHLLLDDCLSAVDSHTA 848

Query: 664 GAI--NYTLGKLMKSKELTIISIAHRLS-TIRRSENVIVLGN 702
             I  N  +G LM+ +  T + ++H ++ T+R ++ V++L N
Sbjct: 849 LLIYENCIIGPLMEGR--TCVLVSHNVALTMRNADWVVILEN 888

>KAFR0B05630 Chr2 complement(1156621..1161168) [4548 bp, 1515 aa] {ON}
            Anc_8.303 YDR135C
          Length = 1515

 Score =  132 bits (331), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 154/587 (26%), Positives = 263/587 (44%), Gaps = 70/587 (11%)

Query: 176  VIGMVLDAIKNTYSSATGPVGLD--DLPPIVNDLSMYEFLGIFAGAL--VIGTVANFGRI 231
            V+ M L  + N +      +  +    P  ++ L +Y  LG F  AL  +I TV  +   
Sbjct: 958  VVSMFLSVMGNVWLKHWSEINTERGSNPNAIHYLFIYFALG-FGSALSTLIQTVILW--- 1013

Query: 232  VLLRVLGEKLVARLRSNVIRKIIHQDAEFFDRNKVGDLISRLSSDAY----VVSRSMTQN 287
            V   + G + +  L ++ + K       FF+   +G +++R S+D Y    ++ R+ +Q 
Sbjct: 1014 VFCTIRGSRYLHDLMTDAVLK---APMSFFETTPIGRILNRFSNDIYKIDSILGRTFSQF 1070

Query: 288  VSDGFKAXXXXXXXXXXXXXXSISLTSALLMFAP-PLLIGALIYGKRIRMISRDLQESTG 346
              +  K                I  T+   +F   PL +  + Y +     SR+L+    
Sbjct: 1071 FVNAVKVVFVMAV---------ICATTWQFIFVIIPLGVFYIYYQQYYLRTSRELRR-LD 1120

Query: 347  NLTRVS-----EEQLSGVKTIQSFVAEGKELQRYNTAIRKVFLYGKKEALTN--ATFFSS 399
            ++TR       +E L G+ TI+ +  E            K F +  +  + N  + F+ S
Sbjct: 1121 SITRSPVYSHFQETLGGITTIRGYNQE------------KRFGHINQCRVDNNMSAFYPS 1168

Query: 400  TNVLGDLSFLIVLAYGSHLVL-----------QGGLTVGDLTAFMLYTEYTGSAVFGLSN 448
             N    L+F + L  GS ++L           +G LT G +   + Y       +  +  
Sbjct: 1169 INANRWLAFRLELI-GSIIILGAATLSIFRLKEGTLTPGMVGLSLSYALQITQTLNWIVR 1227

Query: 449  FYSELMKGAGAASRLFE---MTDHAPSI-KPTAGKPYVPGSGKISFKDVSFSYPTRPG-N 503
               E+     +  R+ E   +   AP I +        P  G I F++ S  Y  RP  +
Sbjct: 1228 MTVEVETNIVSVERVKEYAQLESEAPRIVEEKRPDEMWPTEGDIKFENYSTRY--RPELD 1285

Query: 504  QIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLR 563
             +   +N  I P   V IVG +G GKS++T  L R    ++G I ID   I+ +    LR
Sbjct: 1286 LVLKNINVHIRPTEKVGIVGRTGAGKSSLTLALFRIIEATAGNIIIDGIPINEIGLYDLR 1345

Query: 564  RHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKF-PNGYDTIIG 622
              L ++ Q+  +  G+++ N+     +  + +EI  V +       V     +G D  + 
Sbjct: 1346 HKLSIIPQDSQVFEGTLRENI--DPTNLFTDEEIWRVLELSHLKEHVLSMGADGLDVQLT 1403

Query: 623  PRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTII 682
              G++LS GQ+Q + +ARAL+   KIL+LDEAT+A+DVE++  +  T+    K +  TI+
Sbjct: 1404 EGGSNLSVGQRQLMCLARALLIPSKILVLDEATAAVDVETDKIVQETIRTAFKDR--TIL 1461

Query: 683  SIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQSELYKLLND 729
            +IAHRL+TI  S+ +IVL + G +VE     +L A  +S  Y L N+
Sbjct: 1462 TIAHRLNTIMDSDRIIVL-DKGEIVEFDTPDELLAKPESLFYSLCNE 1507

 Score = 95.1 bits (235), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 77/325 (23%), Positives = 160/325 (49%), Gaps = 33/325 (10%)

Query: 448 NFYSELMKGAGAASRLFEMTDHAPSIKPTAGK-PYVPGSGKISFK---DVSFSYPTRPGN 503
           N  +  ++ + + +RLF    +    K +  + P V   G ++     + +F +  +P  
Sbjct: 580 NVITSFVEASVSVNRLFSFLTNEELQKDSIQRLPKVENKGDVAINLGDNATFLWKRKPEY 639

Query: 504 QI-FNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLS-CKS 561
           ++    +NF  + G   CIVG  G GKS +   +L               D+ R+    +
Sbjct: 640 KVALKNINFQAKKGDLTCIVGKVGSGKSALIQSIL--------------GDLFRVKGFAT 685

Query: 562 LRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTII 621
           +  ++  V Q P +M+G++K N+ +G + +    E     K C     +    +G  T++
Sbjct: 686 VHGNVAYVSQVPWIMNGTVKENILFGHKYDQEFYE--KTIKACALTIDLGILVDGDQTLV 743

Query: 622 GPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVE-SEGAINYTLGK--LMKSKE 678
           G +G SLSGGQK R+++ARA+  +    +LD+  +A+D   S+  + + LG   L+ SK 
Sbjct: 744 GEKGISLSGGQKARLSLARAVYSRADTYLLDDPLAAVDEHVSKHLVEHVLGPTGLLHSK- 802

Query: 679 LTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQSELYKLLNDKKRDKPTPR 738
            T +   +++S +  ++++ +L N G +V+ G ++++ +D+ S L+KL+ +  R +   +
Sbjct: 803 -TKVLCTNKISVLSIADSITLLEN-GEIVQQGSYEEVNSDEDSPLFKLIKEYGRKENKSK 860

Query: 739 -----VQSDPEKDREQEHQIDNQVR 758
                + +  E  REQ   +++++ 
Sbjct: 861 GSSTSLSTVTESSREQTIPVEDELE 885

>Skud_4.395 Chr4 complement(694806..699356) [4551 bp, 1516 aa] {ON}
            YDR135C (REAL)
          Length = 1516

 Score =  131 bits (330), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 151/579 (26%), Positives = 253/579 (43%), Gaps = 60/579 (10%)

Query: 176  VIGMVLDAIKNTY----SSATGPVGLDDLPPIVNDLSMYEFLGI-FAGALVIGTVANFGR 230
            +I M L  + N +    S      G +  P     L++Y  LGI  A A +I T+  +  
Sbjct: 960  IISMFLSVMGNVWLKHWSEVNSRYGAN--PNAARYLAIYFALGIGSALATLIQTIVLW-- 1015

Query: 231  IVLLRVLGEKLVARLRSNVIRKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSD 290
             V   +   K +  L +N    ++     FF+   +G +++R S+D Y V   + +  S 
Sbjct: 1016 -VFCTIHASKYLHNLMAN---SVLRAPMAFFETTPIGRILNRFSNDIYKVDALLGRTFSQ 1071

Query: 291  GFKAXXXXXXXXXXXXXXSISLTSALLMFAPPLLIGALIYGKRIRMISRDLQESTGNLTR 350
             F                  + T   +    PL +  + Y +     SR+L+    ++TR
Sbjct: 1072 FF----VNAVKVIFTITVICATTWQFIFIIIPLGVCYIYYQQYYLRTSRELRR-LDSITR 1126

Query: 351  VS-----EEQLSGVKTIQSFVAEGKELQRYNTAIRKVFLYGKKEALTNATFFSSTNVLGD 405
                   +E L G+ T++     G   Q+  + I +  +     A     F+ S N    
Sbjct: 1127 SPIYSHFQETLGGLATVR-----GYSQQKRFSHINQCRIDNNMSA-----FYPSINANRW 1176

Query: 406  LSFLIVLAYGSHLVL-----------QGGLTVGDLTAFMLYTEYTGSAVFGLSNFYSELM 454
            L++ + L  GS ++L           QG LT G     + Y       +  +     E+ 
Sbjct: 1177 LAYRLELI-GSIIILGAATLSVFRLKQGTLTAGMAGISLSYALQITQTLNWIVRMTVEVE 1235

Query: 455  KGAGAASRLFEMTD---HAP-SIKPTAGKPYVPGSGKISFKDVSFSYPTRPG-NQIFNKL 509
                +  R+ E  D    AP +I+        P  G I F + S  Y  RP  + +   +
Sbjct: 1236 TNIVSVERIKEYADLKSEAPLTIEGHMPPKEWPSQGDIKFNNYSTRY--RPELDLVLKHI 1293

Query: 510  NFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRHLGVV 569
            N  I+P   + IVG +G GKS++T  L R    S+G I ID   I+ +    LR  L ++
Sbjct: 1294 NIHIKPNEKIGIVGRTGAGKSSLTLALFRMIEASAGNIVIDGIAINEIGLYDLRHRLSII 1353

Query: 570  QQEPMLMSGSIKYNLTYGLQSEVSMDE--IRSVAKKCFCHGFVTKFPNGYDTIIGPRGAS 627
             Q+  +  GS++ N+     +    DE   R++         ++   +G D  +   G +
Sbjct: 1354 PQDSQVFEGSLRENID---PTNQYTDEAIWRALELSHLKEHVLSMSNDGLDAQLTEGGGN 1410

Query: 628  LSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTIISIAHR 687
            LS GQ+Q + +ARA++   KILILDEAT+A+DVE++  +  T+    K +  TI++IAHR
Sbjct: 1411 LSVGQRQLLCLARAMLVPSKILILDEATAAVDVETDKVVQETIRTAFKDR--TILTIAHR 1468

Query: 688  LSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQSELYKL 726
            L+TI  S+ +IVL N G+V E      L ++ +S  + L
Sbjct: 1469 LNTIMDSDRIIVLDN-GTVAEFDSPSQLLSNSESLFHSL 1506

 Score = 98.2 bits (243), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 104/421 (24%), Positives = 193/421 (45%), Gaps = 41/421 (9%)

Query: 349 TRVSEEQLSGVKTIQSFVAEGK-----ELQRYNTAIRKVFLYGKKEALTNATFFSSTNVL 403
           TRV  E L+ +K+++ +  E       E  R N  ++ +   G   A+T+  F     ++
Sbjct: 485 TRVISEILNNIKSLKLYAWEKPYREKLEDIRNNKELKNLTRLGCYMAVTSFQFNIVPFLV 544

Query: 404 GDLSFLIVLAYGSHLVLQGGLTVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRL 463
              +F  V  Y     L   L    LT F L +         L++F    ++ + +  RL
Sbjct: 545 SCCTF-AVFVYTEDRALTTDLVFPALTLFNLLSFPLMIIPMVLNSF----IEASVSIGRL 599

Query: 464 FEMTDHAPSIKPTAGK--PYVPGSGKISFK---DVSFSYPTRPGNQI-FNKLNFTIEPGS 517
           F    +   ++P + +  P V   G ++     D +F +  +P  ++    +NF  + G 
Sbjct: 600 FTFFTN-EELQPDSVQRLPKVENFGDVAINVGDDATFLWQRKPEYKVALKNINFQAKKGE 658

Query: 518 NVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLS-CKSLRRHLGVVQQEPMLM 576
             C+VG  G GK+ + S +L               D+ R+    ++   +  V Q P +M
Sbjct: 659 LTCVVGKVGSGKTALLSCML--------------GDLFRVKGFATVHGSVAYVSQVPWIM 704

Query: 577 SGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRI 636
           +G++  N+ +G + +V   E     K C     +    +G  T++G +G SLSGGQK R+
Sbjct: 705 NGTVMENILFGHKYDVEFYE--KTIKACALTIDLAILMDGDKTLVGEKGISLSGGQKARL 762

Query: 637 AIARALMKKPKILILDEATSALDVE-SEGAINYTLGK--LMKSKELTIISIAHRLSTIRR 693
           ++ARA+  +    +LD+  +A+D   +   I + LG   L+ +K  T +   +++S +  
Sbjct: 763 SLARAVYSRADTYLLDDPLAAVDEHVARHLIEHVLGPNGLLHTK--TRLLATNKVSALSI 820

Query: 694 SENVIVLGNDGSVVEVGKFKDLYADQQSELYKLLNDKKRDKPTPRVQS-DPEKDREQEHQ 752
           +++V +L N G +++ G + ++  D  S L+KLLND  +     R  S D  K+  +E  
Sbjct: 821 ADSVALLDN-GEIIQKGTYDEITKDADSPLWKLLNDYGKKNNNKRNDSGDSSKNSVRESS 879

Query: 753 I 753
           I
Sbjct: 880 I 880

>Smik_4.380 Chr4 complement(684148..688698) [4551 bp, 1516 aa] {ON}
            YDR135C (REAL)
          Length = 1516

 Score =  131 bits (330), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 148/573 (25%), Positives = 247/573 (43%), Gaps = 52/573 (9%)

Query: 176  VIGMVLDAIKNTYSSATGPVG--LDDLPPIVNDLSMYEFLGIFAGALVIGTVANFGRIVL 233
            VI M+L  + N +      +       P     L++Y  LGI  G+ +   +      V 
Sbjct: 960  VISMLLSVMGNVWLKHWSEINSRYGGNPNAARYLAIYFALGI--GSALATLIQTIILWVF 1017

Query: 234  LRVLGEKLVARLRSNVIRKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFK 293
              +   K +  L +N    ++     FF+   +G +++R S+D Y V   + +  S  F 
Sbjct: 1018 CTIHASKYLHNLMTN---SVLRAPMTFFETTPIGRILNRFSNDIYKVDALLGRTFSQFF- 1073

Query: 294  AXXXXXXXXXXXXXXSISLTSALLMFAPPLLIGALIYGKRIRMISRDLQESTGNLTRVS- 352
                             + T   +    PL +  + Y +     SR+L+    ++TR   
Sbjct: 1074 ---VNAVKVTFTITVICATTWQFIFIIIPLGVFYIYYQQYYLRTSRELRR-LDSITRSPI 1129

Query: 353  ----EEQLSGVKTIQSFVAEGKELQRYNTAIRKVFLYGKKEALTNATFFSSTNVLGDLSF 408
                +E L G+ T++     G   Q+  + I +  +     A     F+ S N    L++
Sbjct: 1130 YSHFQETLGGLATVR-----GYSQQKRFSHINQCRIDNNMSA-----FYPSINANRWLAY 1179

Query: 409  LIVLAYGSHLVL-----------QGGLTVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGA 457
             + L  GS ++L           QG LT G +   + Y       +  +     E+    
Sbjct: 1180 RLELI-GSIIILGAATLSVFRLKQGTLTSGMVGLSLSYALQITQTLNWIVRMTVEVETNI 1238

Query: 458  GAASRLFEMTD---HAPSIKPTAGKP-YVPGSGKISFKDVSFSYPTRPG-NQIFNKLNFT 512
             +  R+ E  D    AP I      P   P  G I F + S  Y  RP  + +  ++N  
Sbjct: 1239 VSVERIKEYADLKSEAPLIIEGHRPPKQWPAQGDIRFNNYSTRY--RPELDLVLKQINIH 1296

Query: 513  IEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRHLGVVQQE 572
            I+P   V IVG +G GKS++T  L R    S G I ID   I+ +    LR  L ++ Q+
Sbjct: 1297 IKPNEKVGIVGRTGAGKSSLTLALFRMIEASEGNIVIDGVSINEIGLYDLRHKLSIIPQD 1356

Query: 573  PMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPN-GYDTIIGPRGASLSGG 631
              +  G+++ N+     ++ S + I    +       V    N G D  +   G++LS G
Sbjct: 1357 SQVFEGTVRENI--DPINQYSDEAIWRALELSHLKEHVLSMSNDGLDAQLSEGGSNLSVG 1414

Query: 632  QKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTIISIAHRLSTI 691
            Q+Q + +ARA++   KIL+LDEAT+A+DVE++  +  T+    K +  TI++IAHRL+TI
Sbjct: 1415 QRQLLCLARAMLVPSKILVLDEATAAVDVETDKVVQETIRTAFKDR--TILTIAHRLNTI 1472

Query: 692  RRSENVIVLGNDGSVVEVGKFKDLYADQQSELY 724
              S+ +IVL N G V E      L ++ +S  Y
Sbjct: 1473 MDSDRIIVLDN-GKVAEFDTPGQLLSNSKSLFY 1504

 Score =  103 bits (256), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 109/437 (24%), Positives = 198/437 (45%), Gaps = 42/437 (9%)

Query: 349 TRVSEEQLSGVKTIQSFVAEGK-----ELQRYNTAIRKVFLYGKKEALTNATFFSSTNVL 403
           TRV  E L+ +K+++ +  E       E  R N  ++ +   G   A+T+  F     ++
Sbjct: 485 TRVISEILNNIKSLKLYAWEKPYREKLEEVRNNKELKNLTKLGCYMAVTSFQFNIVPFLV 544

Query: 404 GDLSFLIVLAYGSHLVLQGGLTVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRL 463
              +F  V  Y     L   L    LT F L +         L++F    ++ + +  RL
Sbjct: 545 SCCTF-AVFVYTEDRALTTDLVFPALTLFNLLSFPLMIIPMVLNSF----IEASVSIGRL 599

Query: 464 FEMTDHAPSIKPTAGK--PYVPGSGKISFK---DVSFSYPTRPGNQI-FNKLNFTIEPGS 517
           F    +   ++P + +  P V   G I+     D +F +  +P  ++    ++F    G+
Sbjct: 600 FSFFTN-EELQPDSVQRLPNVENIGDIAINIGDDATFLWQRKPEYKVALKNIDFQATKGN 658

Query: 518 NVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRHLGVVQQEPMLMS 577
             CIVG  G GK+ + S +L       G  T+         C      +  V Q P +M+
Sbjct: 659 LTCIVGKVGSGKTALLSCMLGDLFRVKGFATVH-------GC------IAYVSQVPWIMN 705

Query: 578 GSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIA 637
           G++K N+ +G + +    E     K C     +    +G  T++G +G SLSGGQK R++
Sbjct: 706 GTVKENILFGHKYDAEFYE--KTIKACALTIDLAILMDGDKTLVGEKGISLSGGQKARLS 763

Query: 638 IARALMKKPKILILDEATSALDVE-SEGAINYTLGK--LMKSKELTIISIAHRLSTIRRS 694
           +ARA+  +    +LD+  +A+D   +   I + LG   L+ +K  T I   +++S +  +
Sbjct: 764 LARAVYSRADTYLLDDPLAAVDEHVARHLIEHVLGPNGLLHTK--TRILATNKVSALSIA 821

Query: 695 ENVIVLGNDGSVVEVGKFKDLYADQQSELYKLLND---KKRDKPTPRVQSDPEKDREQEH 751
           +++ +L N G +++ G + D+  D  S L+KLLND   K  +K +    S     RE   
Sbjct: 822 DSIALLDN-GEIIQQGAYSDITKDADSPLWKLLNDYGKKNNNKQSEECDSSKNSVRESSI 880

Query: 752 QIDNQVRE-QVANDFNL 767
            ++ ++ + Q  ND + 
Sbjct: 881 PVEGELEQLQKLNDLDF 897

>KLLA0D04059g Chr4 complement(338422..343128) [4707 bp, 1568 aa] {ON}
            similar to uniprot|P14772 Saccharomyces cerevisiae
            YLL015W BPT1 ABC type transmembrane transporter of
            MRP/CFTR family found in vacuolar membrane involved in
            the transport of unconjugated bilirubin and in heavy
            metal detoxification via glutathione conjugates along
            with Ycf1p
          Length = 1568

 Score =  131 bits (329), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 133/550 (24%), Positives = 245/550 (44%), Gaps = 53/550 (9%)

Query: 209  MYEFLGIFAGALVIGTVANFGRIVLLRVLGEKLVARLRSN-VIRKIIHQDAEFFDRNKVG 267
            +++++ ++A   V  +     R +++ +      ++L  N +   ++     FF+   VG
Sbjct: 1030 IWKYVAVYALIGVTSSAFELARTIIMMLFCSIRASKLFHNQMAHSVVMAPMSFFETTPVG 1089

Query: 268  DLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTSALLMFAPPLLIGA 327
             +++R SSD   +       +S  F++               I+++    +    +L+G 
Sbjct: 1090 RIVNRFSSDVNSIDEDFQHIISFFFRSMLDYLITIVI-----ITVSMPWFLLFNTILLGI 1144

Query: 328  LIYGKRIRMI-SRDLQE----STGNLTRVSEEQLSGVKTIQSFVAEGKELQRYNTAIRKV 382
              Y + + ++ SR+L+     S   +  +  E L G   I ++    K    +N      
Sbjct: 1145 YYYYQTLYVVLSRELKRLTSISYSPVMSLLSETLGGHVVINAY----KHANIFN------ 1194

Query: 383  FLYGKKEALTNATF---FSSTN--------VLGDLSFLI--VLAYGSHLVLQGGLTVGDL 429
              Y  +   TN  F   F STN         +G +  LI  ++A  S L     ++ G +
Sbjct: 1195 -YYNFENIQTNINFIFNFRSTNRWLSMRLQTIGAVIVLITSLMALAS-LGTSNPISAGLI 1252

Query: 430  TAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHAPS----IKPTAGKPYVPGS 485
               M Y     S++  +      +     +  R+ E  D  P     I+ +      P  
Sbjct: 1253 GLLMSYALQVSSSLMWIIRMAVNIETTIVSVERIIEYRDLKPEGIRVIEDSRPPKNWPKR 1312

Query: 486  GKISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSG 545
            G+I+F+  +  Y     + +   ++  I+    + +VG +G GKST+T  L R   P  G
Sbjct: 1313 GEITFEHYTTKYRENL-DPVLKDIDLRIKHQEKIGVVGRTGAGKSTLTLALFRILEPFEG 1371

Query: 546  QITIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLT-YGLQSEVSMDEIRSVAK-K 603
            +ITID  DIS L    LRR L ++ Q+     G+++ NL  +   ++  + +   ++  K
Sbjct: 1372 KITIDGIDISTLGLYDLRRSLSIIPQDAQAFEGTVRSNLDPFNRHTDAEIWKALELSHLK 1431

Query: 604  CFCHGFVTKFPNG-------YDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATS 656
                  V++ P+         DT I   G +LS GQ+Q + ++RAL+   KILILDEAT+
Sbjct: 1432 PHIERIVSELPDDENKPTDLLDTQISDNGNNLSMGQRQLLCLSRALLNPSKILILDEATA 1491

Query: 657  ALDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLY 716
            A+D E++  I  T+    K +  TI++IAHR+ T+  S+ ++VL + G V E     +L 
Sbjct: 1492 AVDRETDKIIQETIRTAFKDR--TILTIAHRIDTVLDSDKIMVL-DKGEVKEFDTPDNLL 1548

Query: 717  ADQQSELYKL 726
             +++S  Y L
Sbjct: 1549 KNKESLFYGL 1558

 Score = 91.7 bits (226), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 102/394 (25%), Positives = 181/394 (45%), Gaps = 51/394 (12%)

Query: 354 EQLSGVKTIQSFVAEGKELQRYNTAIRKVFLYG-KKEALTNATFFSSTNV---LGDLSFL 409
           E L+ +K+I+ +  E   L R N     + L+  KK A+ +   F   N+   L   S  
Sbjct: 473 EILNSMKSIKLYAWEKPMLDRLNHVRNDLELHNMKKIAIVSNFMFFCWNIVPLLVTCSTF 532

Query: 410 IVLAYGSHLVLQGGLTVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRL------ 463
           ++ +Y +  VL   +    LT F +  +    A+F +    S +++   +  RL      
Sbjct: 533 VLFSYLTDQVLSPQIIFPSLTLFSMLND----ALFTVPTMISNIIEIGVSLKRLKGYLLA 588

Query: 464 ----FEMTDHAPSIKPTAGKPYVPGSGKI----SFKDVSFSYPT-------RPGNQIFNK 508
                   +HA   + TA  P V  S  +    S K  + S  T        PG  + + 
Sbjct: 589 EELDTSFIEHA---RATASDPTVEISNAVFLWKSPKSAASSEDTDEEAEISSPGVALKSI 645

Query: 509 LNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQI-TIDDQDISRLSCKSLRR--H 565
            NF+ +     CIVG  G GKST    +L       GQ+  +     S +  K + R  +
Sbjct: 646 ENFSAKKAQLTCIVGRVGSGKSTFLQAIL-------GQLPCVSSDSASGVKPKVVIRADN 698

Query: 566 LGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRG 625
           L    Q+P +M+ S+K N+ +G + + +M   +   K C     +   P+G  T++G +G
Sbjct: 699 LAYCPQQPWIMNASLKDNILFGYKYDEAM--YKKTIKACQLLPDLEILPDGDQTLVGEKG 756

Query: 626 ASLSGGQKQRIAIARALMKKPKILILDEATSALDVE-SEGAINYTLGK---LMKSKELTI 681
            SLSGGQK R+++ARA+  +  + +LD+  SA+D    +  I+  L +   L+K+K  T+
Sbjct: 757 ISLSGGQKARLSLARAVYSRADLYLLDDVLSAVDSHVCKSIIDDVLDRQKGLLKNK--TV 814

Query: 682 ISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDL 715
           I   + ++ +  S+ + +L N G +VE   ++++
Sbjct: 815 ILTTNAVNVLVHSDMIYLLKN-GKIVESNSYEEV 847

>YLL015W Chr12 (116432..121111) [4680 bp, 1559 aa] {ON}  BPT1ABC type
            transmembrane transporter of MRP/CFTR family, found in
            vacuolar membrane, involved in the transport of
            unconjugated bilirubin and in heavy metal detoxification
            via glutathione conjugates, along with Ycf1p
          Length = 1559

 Score =  130 bits (328), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 152/555 (27%), Positives = 251/555 (45%), Gaps = 57/555 (10%)

Query: 209  MYEFLGIFAGALVIGTVA----NFGRIVLLRVLGEKLVARLRSNVIRKIIHQDAEFFDRN 264
            ++ F+G+++   +IG  +    N   I++L     +   +L  ++ + +I     FF+  
Sbjct: 1017 VWMFVGVYS---LIGVASAAFNNLRSIMMLLYCSIRGSKKLHESMAKSVIRSPMTFFETT 1073

Query: 265  KVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTSALLMFAPPLL 324
             VG +I+R SSD   V  ++    S  FK+                      L+F   L+
Sbjct: 1074 PVGRIINRFSSDMDAVDSNLQYIFSFFFKSILTYLVTVILVGYN----MPWFLVFNMFLV 1129

Query: 325  IGALIYGKRIRMISRDLQE----STGNLTRVSEEQLSGVKTIQS------FVAEGKELQR 374
            +  + Y     ++SR+L+     S   +  +  E L+G   I +      F+    E  +
Sbjct: 1130 VIYIYYQTFYIVLSRELKRLISISYSPIMSLMSESLNGYSIIDAYDHFERFIYLNYEKIQ 1189

Query: 375  YNTAIRKVFLYGKKEALTNATFFSSTNVLGDLSFLIVLAYGSHLVLQGGLTVGDLTAFML 434
            YN      F    +          +T VL   + L +    +   L  G+ VG L ++ L
Sbjct: 1190 YNVDFVFNFRSTNRWLSVRLQTIGATIVLAT-AILALATMNTKRQLSSGM-VGLLMSYSL 1247

Query: 435  YTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHAP---SIKPTAGKP--YVPGSGKIS 489
              E TGS  + +    + +     +  R+ E  +  P   SI P   +P    P  G I 
Sbjct: 1248 --EVTGSLTWIVRTTVT-IETNIVSVERIVEYCELPPEAQSINP-EKRPDENWPSKGGIE 1303

Query: 490  FKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITI 549
            FK+ S  Y     + + N +N  IEP   V IVG +G GKST++  L R   P+ G+I I
Sbjct: 1304 FKNYSTKY-RENLDPVLNNINVKIEPCEKVGIVGRTGAGKSTLSLALFRILEPTEGKIII 1362

Query: 550  DDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLT-YGLQSEVSMDEIRSVAKKCFCHG 608
            D  DIS +    LR HL ++ Q+     G++K NL  +   SE   DE++   ++     
Sbjct: 1363 DGIDISDIGLFDLRSHLAIIPQDAQAFEGTVKTNLDPFNRYSE---DELKRAVEQAHLKP 1419

Query: 609  FVTKF----PNG-------------YDTIIGPRGASLSGGQKQRIAIARALMKKPKILIL 651
             + K     P G              D  I   G++LS GQ+Q + +ARAL+ + KIL+L
Sbjct: 1420 HLEKMLHSKPRGDDSNEEDGNVNDILDVKINENGSNLSVGQRQLLCLARALLNRSKILVL 1479

Query: 652  DEATSALDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGK 711
            DEAT+++D+E++  I  T+ +  K +  TI++IAHR+ T+  S+ +IVL + GSV E   
Sbjct: 1480 DEATASVDMETDKIIQDTIRREFKDR--TILTIAHRIDTVLDSDKIIVL-DQGSVREFDS 1536

Query: 712  FKDLYADQQSELYKL 726
               L +D+ S  Y L
Sbjct: 1537 PSKLLSDKTSIFYSL 1551

 Score =  101 bits (251), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 81/254 (31%), Positives = 131/254 (51%), Gaps = 17/254 (6%)

Query: 510 NFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRHLGVV 569
           +F  + G  VC+VG  G GKST    +L      SG     D    +L  +S    +   
Sbjct: 659 HFEAKRGDLVCVVGRVGAGKSTFLKAILGQLPCMSGS---RDSIPPKLIIRS--SSVAYC 713

Query: 570 QQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGASLS 629
            QE  +M+ S++ N+ +G   +   D      K C     +   P+G +T++G +G SLS
Sbjct: 714 SQESWIMNASVRENILFG--HKFDQDYYDLTIKACQLLPDLKILPDGDETLVGEKGISLS 771

Query: 630 GGQKQRIAIARALMKKPKILILDEATSALDVE-SEGAINYTL-GKLMKSKELTIISIAHR 687
           GGQK R+++ARA+  +  I +LD+  SA+D E S+  I Y L GK    K  TII   + 
Sbjct: 772 GGQKARLSLARAVYSRADIYLLDDILSAVDAEVSKNIIEYVLIGKTALLKNKTIILTTNT 831

Query: 688 LSTIRRSENVIVLGNDGSVVEVGKFKDLY--ADQQSELYKLLNDKKRDKPTPRVQSDPEK 745
           +S ++ S+ +  L N G +VE G ++D+    +  S+L KLL  ++ D P   + +  E 
Sbjct: 832 VSILKHSQMIYALEN-GEIVEQGNYEDVMNRKNNTSKLKKLL--EEFDSP---IDNGNES 885

Query: 746 DREQEHQIDNQVRE 759
           D + EH+ +++V E
Sbjct: 886 DVQTEHRSESEVDE 899

>KLLA0C14234g Chr3 (1234598..1238962) [4365 bp, 1454 aa] {ON} similar
            to uniprot|P53049 Saccharomyces cerevisiae YGR281W YOR1
            Plasma membrane transporter of the ATP- binding cassette
            (ABC) family mediates export of many different organic
            anions including oligomycin
          Length = 1454

 Score =  130 bits (327), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 142/546 (26%), Positives = 237/546 (43%), Gaps = 58/546 (10%)

Query: 212  FLGIFAGALVIGTVA-NFGRIVLLRVLGEKLVARLRSNVIRKIIHQDAEFFDRNKVGDLI 270
            ++G++    V+G++A  F + + + +LG      L    +++++H    F D   +G ++
Sbjct: 911  YMGLYI-LFVLGSLAFMFTQFISIGLLGTYASKHLNIKALQRLLHAPMSFMDVTPIGRVM 969

Query: 271  SRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTSALLMFAPPLLIGALIY 330
            +R + D   +   +T++V                       +       A P L+   ++
Sbjct: 970  NRFTKDTDTLDNEITESVR-----LLIFQIANLTGIIILCIIYIPWFAIAMPFLVFLYVF 1024

Query: 331  G-----------KRIRMISRDLQESTGNLTRVSEEQLSGVKTIQSFVAEGKELQRYNTAI 379
                        KR+  + R    +  N      E L G+ TI+++ +E + L + +  I
Sbjct: 1025 VADHYQASGREIKRMDAVQRSFVYNNFN------EVLGGMDTIKAYRSEQRFLMKSDFLI 1078

Query: 380  RKVFLYGKKEALTNATFFSSTNVLGDLSFLIVLAYGSHLVLQGGLTVGDLTAFMLYTEYT 439
             K+   G            S ++L  +  LI+      +  Q  ++ G +   + Y    
Sbjct: 1079 NKMNEAGYLVTSIQRWVAISLDMLAVIFALIIALLC--VTRQFHVSAGSVGVMVTYVLQL 1136

Query: 440  GSAVFGLSNFYSELMKGAGAASRLFEMTDHAP-----SIKPTAGKPYVPGSGKISFKDVS 494
               +  L    ++      +A RL       P      I  T      P  G+I F++VS
Sbjct: 1137 PGLLNALLRSQTQTENDLNSAERLVNYAYDLPIEAKYRILETQPPEQWPSEGRIKFENVS 1196

Query: 495  FSYPTRPGNQIFNKLNFTIEPGSN--VCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQ 552
             +Y  RP   +  K N +I+ GSN  + I G +G GKSTI S L R     +G+ITIDD 
Sbjct: 1197 LAY--RPELPVALK-NVSIDIGSNEKIGICGRTGAGKSTIMSALYRLVELKTGKITIDDI 1253

Query: 553  DISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLTY----------------GLQSEVSMDE 596
            DIS L    LR  L ++ Q+P+L  G I+ NL                  G      +D 
Sbjct: 1254 DISTLGLYELRSKLAIIPQDPVLFKGDIRRNLDPFQECTDEQLWDALVRGGAIDRKDVDS 1313

Query: 597  IRSVAKKCF-CHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEAT 655
            IR+  K      G + KF    D ++   G++ S G++Q +A+ RAL++  KILILDEAT
Sbjct: 1314 IRAQHKDANGLSGDMFKF--HLDQMVEDDGSNFSLGERQLLALTRALVRGSKILILDEAT 1371

Query: 656  SALDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDL 715
            S++D  ++  I   +  + +    TI+ IAHRL TI     ++VL + G VVE    K L
Sbjct: 1372 SSVDYATDAKIQSRI--VEEFSNCTILCIAHRLKTILAYNRILVL-DQGQVVEFDTPKKL 1428

Query: 716  YADQQS 721
            Y D+ S
Sbjct: 1429 YNDRDS 1434

 Score = 87.0 bits (214), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 72/246 (29%), Positives = 117/246 (47%), Gaps = 22/246 (8%)

Query: 506 FNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRH 565
           F+ LNF ++    + I GP G GKS++ + L  +   SSG +TI       L C      
Sbjct: 592 FHGLNFDVKENEFIIITGPIGTGKSSLLNALAGFMRRSSGSMTIKGD---LLLCGY---- 644

Query: 566 LGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRG 625
                  P + + ++K N+ +G  S     + + V + C     +   P G  T IG RG
Sbjct: 645 -------PWVQNATVKDNILFG--SPFDKPKYQKVIEICSLQADLDILPAGDRTEIGERG 695

Query: 626 ASLSGGQKQRIAIARALMKKPKILILDEATSALDVE-SEGAINYTLGKLMKSKELTIISI 684
            +LSGGQK RIA+AR++ K   I + D+  SA+D    +  ++  +   +K K  T I  
Sbjct: 696 ITLSGGQKARIALARSVYKDMDIYLFDDVLSAVDSRVCKHIVDECMMGYLKQK--TRILA 753

Query: 685 AHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQSELYKLLNDKKRDKPTPRVQSDPE 744
            H+LS I ++  VI LG DGS  ++G   +L   +++  +  L   +   P   ++ D  
Sbjct: 754 THQLSLIDKASRVIFLGLDGS-FDIGTVPELL--KRNTGFSDLMQFQNSAPAEELEDDDT 810

Query: 745 KDREQE 750
           K +  E
Sbjct: 811 KAQNME 816

>SAKL0H16016g Chr8 (1396707..1401206) [4500 bp, 1499 aa] {ON} similar
            to uniprot|P39109 Saccharomyces cerevisiae YDR135C
          Length = 1499

 Score =  130 bits (327), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 142/543 (26%), Positives = 244/543 (44%), Gaps = 48/543 (8%)

Query: 211  EFLGIFAGALVIGTVANFGRIVLLRVLGEKLVAR-LRSNVIRKIIHQDAEFFDRNKVGDL 269
            ++LGI+    +   ++   + V+L V      +R L   +   ++     FF+   +G +
Sbjct: 975  KYLGIYFALGIGSALSTLVQTVVLWVFCTIHGSRYLHDAMASSVLRAPMSFFETTPIGRI 1034

Query: 270  ISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTSALLMFAPPLLIGALI 329
            ++R S+D Y V   + +  S  F                    T   ++   PL +  + 
Sbjct: 1035 LNRFSNDIYKVDELLGRTFSQFFVNVVKVTFTIVVICTS----TWQFILVVLPLSVLYIY 1090

Query: 330  YGKRIRMISRDLQESTGNLTRVS-----EEQLSGVKTIQSFVAEGKELQRYNTAIRKVFL 384
            Y +     SR+L+    ++TR       +E L GV TI+ +   G++         K F 
Sbjct: 1091 YQQYYLRTSRELRR-LDSVTRSPIYAHFQETLGGVSTIRGY---GQQ---------KRFA 1137

Query: 385  YGKKEALTN--ATFFSSTNVLGDLSF-------LIVLAYGSHLVL---QGGLTVGDLTAF 432
            +  +  + N  + F+ + N    L+F       +I+L   +  V    QG LT G +   
Sbjct: 1138 HINQARIDNNMSAFYPAVNANRWLAFRLEFLGSIIILGAATLSVFRLKQGTLTAGMIGLS 1197

Query: 433  MLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTD---HAPSIKPTAGKPY-VPGSGKI 488
            + Y      ++  +     E+     +  R+ E  +    AP+I  ++  P   P  G I
Sbjct: 1198 LSYALQITQSLNWIVRMTVEVETNIVSVERIKEYAELKPEAPAIIESSRPPKGWPSQGDI 1257

Query: 489  SFKDVSFSYPTRPGNQ-IFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQI 547
             F+  S  Y  RP  Q I   +N  I+    V IVG +G GKS++T  L R    + G I
Sbjct: 1258 RFEHYSTRY--RPELQLILRDVNLHIKAREKVGIVGRTGAGKSSLTLALFRIIEAAEGHI 1315

Query: 548  TIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCH 607
             ID      +    LR  L ++ Q+  + +G+++ N+      E + +EI    +     
Sbjct: 1316 FIDGLSTDTIGLADLRHKLSIIPQDSQVFAGTLRENV--DPTEEFTDEEIWHALELSHLK 1373

Query: 608  GFVTKFPN-GYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAI 666
              V    N G  T++   G++LS GQ+Q + +ARAL+   KIL+LDEAT+A+DVE++  I
Sbjct: 1374 EHVMSMGNDGLQTMLTECGSNLSVGQRQLLCLARALLIPSKILVLDEATAAVDVETDRVI 1433

Query: 667  NYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQSELYKL 726
              T+    K++  TI++IAHR++TI  S+ +IVL N+G V E    ++L     S  Y L
Sbjct: 1434 QETIRTAFKNR--TILTIAHRINTIMDSDKIIVL-NEGQVAEFDTPENLLQRPDSLFYSL 1490

Query: 727  LND 729
              +
Sbjct: 1491 CKE 1493

 Score = 95.5 bits (236), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 110/461 (23%), Positives = 206/461 (44%), Gaps = 81/461 (17%)

Query: 310 ISLTSALLMFAPPLLIGALIYGKRIRMIS------RDLQE----STGNLTRVSEEQLSGV 359
           + L S   +  P + +G +I    I + S      ++LQ+    +    TRV  E L+ +
Sbjct: 426 LCLISLYSLLGPCMWVGVIIMVVMIPINSIIMKYQKNLQKIQMKNKDERTRVISEILNNI 485

Query: 360 KTIQSFVAEGKELQRYNTAIRKVFLYGKKEALTNATFFSSTNVLGDLSFLIV------LA 413
           K+++ +  E    ++ +      ++  +KE L N T    T  L    F IV        
Sbjct: 486 KSLKLYAWEVPYKKKLD------YVRNEKE-LKNLTKMGCTLALASFQFNIVPFLVSCST 538

Query: 414 YGSHLVLQGG------LTVGDLTAFMLYTEYTGSAVFGLS---NFYSELMKGAGAASRLF 464
           +   ++ Q G      L    LT F L +       F L+   N  +  ++ + + +RL 
Sbjct: 539 FAVFVMTQKGRALTTDLVFPALTLFNLLS-------FPLAVVPNAITSFIEASVSVNRLH 591

Query: 465 E-MTDHAPSIKPTAGKPYVPGSGKISFK---DVSFSYPTRPGNQI-FNKLNFTIEPGSNV 519
             +T+        + +P V   G I+ K   D +F +  +P  ++    +NF  + G   
Sbjct: 592 SFLTNEELQKDSVSREPSVTSKGDIAVKVGGDATFLWQRKPEYKVALKNINFQAKKGELT 651

Query: 520 CIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLS-CKSLRRHLGVVQQEPMLMSG 578
           CIVG  G GKS +   +L               D+ R+    ++   +  V Q P +M+G
Sbjct: 652 CIVGRVGSGKSALIQSIL--------------GDLFRVKGFATIHGSVAYVSQIPWIMNG 697

Query: 579 SIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAI 638
           ++K N+ +G + + S  E     K C  +  ++  P G  T++G +G SLSGGQK R+++
Sbjct: 698 TVKENILFGHKYDPSFYE--KTVKACALNVDLSILPQGDQTLVGEKGISLSGGQKARLSL 755

Query: 639 ARALMKKPKILILDEATSALDVE-SEGAINYTLG---------KLMKSKELTIISIAHRL 688
           ARA+  +    +LD+  +A+D   ++  ++  LG         K++ + ++T++SIA   
Sbjct: 756 ARAVYSRADTYLLDDPLAAVDEHVAKHLVDNVLGVTGLLHSKTKVLATNKITVLSIA--- 812

Query: 689 STIRRSENVIVLGNDGSVVEVGKFKDLYADQQSELYKLLND 729
                  + I L  +G +V+ G + ++  D  S L KL+++
Sbjct: 813 -------DSIALLENGEIVQQGSYDEVVRDDGSALSKLIHE 846

>SAKL0H00704g Chr8 (85322..89641) [4320 bp, 1439 aa] {ON} similar to
            uniprot|P53049 Saccharomyces cerevisiae YGR281W YOR1
            Plasma membrane transporter of the ATP- binding cassette
            (ABC) family mediates export of many different organic
            anions including oligomycin
          Length = 1439

 Score =  129 bits (323), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 142/571 (24%), Positives = 251/571 (43%), Gaps = 91/571 (15%)

Query: 214  GIFAGALVIGTVANFG----RIVLLRVLGEKLVARLRSNVIRKIIHQDAEFFDRNKVGDL 269
            G + G  +     N+     +  +L  +G      L    +++++H    F D   +G +
Sbjct: 893  GFYIGLYIFFVFVNYFFMSLQFTILCYIGLAASKWLNLKAVKRLLHTPMSFMDTTPLGRV 952

Query: 270  ISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTSALLMFAPPLLIGALI 329
            ++R + D   +   +T++V                    +I+    + +   P    A+ 
Sbjct: 953  LNRFTKDTDTLDNELTESVR------------LFVYQTANIAGVIIMCIIYLPWFAIAVP 1000

Query: 330  YGKRIRMISRDLQESTGNLTRVSE------------EQLSGVKTIQSFVAEGKELQRYNT 377
            +   I +I  D  +S+G   +  E            E LSG+ TI+++ +E + L + + 
Sbjct: 1001 FLGLIFIIVADHYQSSGREIKRLEAVQRSFVYNNFNEVLSGMDTIKAYKSENRFLMKSDF 1060

Query: 378  AIRKVFLYGKKEALTNATFFSSTNVLG----------------DLSFLIVLAYGSHLVLQ 421
             I ++   G            S +++                 D+S   V    ++++  
Sbjct: 1061 LINRMSEAGYLVVAVQRWVSISLDMIAVAFALIITLLCVTRQFDISAASVGVLLTYVLQL 1120

Query: 422  GGLTVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHAPSIKPTAGKPY 481
             GL  G L A M   E   ++V  + N+ +EL +   AA R  EMT   P          
Sbjct: 1121 PGLLNGLLRA-MTQAENDMNSVERIVNYATELPQ--EAAYRKPEMTPQEPW--------- 1168

Query: 482  VPGSGKISFKDVSFSYPTRPGNQIFNK-LNFTIEPGSNVCIVGPSGRGKSTITSLLLRYY 540
             P +G++ F +VS SY  RPG  +  K ++  I+ G  + I G +G GKSTI S L R  
Sbjct: 1169 -PSNGEVVFDNVSLSY--RPGLPLVLKGVSLNIKGGEKIGICGRTGAGKSTIMSALYRLC 1225

Query: 541  NPSSGQITIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLT-YGLQSE-------- 591
              + G++ ID  D S+L    LRR L ++ Q+P+L  GSI+ NL  +G + +        
Sbjct: 1226 ELNEGRVLIDGVDTSKLGLYDLRRKLSIIPQDPVLFKGSIRKNLDPFGEREDEELWSALV 1285

Query: 592  ----VSMDEIRSVAKK--------CFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIA 639
                +  +E+  V  +           H F        D  +   G + S G++Q +A+ 
Sbjct: 1286 RSGTIEAEEVEKVKNQHRDESGSSTGLHKF------HLDQEVEDDGTNFSLGERQLLALT 1339

Query: 640  RALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSENVIV 699
            RAL+++ KILILDEATS++D E++  I   + +  +    TI+ IAHRL TI   + ++V
Sbjct: 1340 RALVRQSKILILDEATSSVDHETDAKIQSLIAQ--EFNRCTILCIAHRLKTILNYDRLVV 1397

Query: 700  LGNDGSVVEVGKFKDLYADQQSELYKLLNDK 730
            L N G+V E    + L+  + + +++ + DK
Sbjct: 1398 LDN-GTVKEFDTPRSLFRIKDT-IFREMCDK 1426

 Score = 86.3 bits (212), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 79/272 (29%), Positives = 125/272 (45%), Gaps = 38/272 (13%)

Query: 506 FNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRH 565
           F  LNF I+ G  V I G  G GKS++ + L  +   + G I    ++ S L C      
Sbjct: 571 FKNLNFQIQKGELVIITGSIGTGKSSLLNALAGFMKKTEGDIF---KNGSLLLCGY---- 623

Query: 566 LGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIR--SVAKKCFCHGFVTKFPNGYDTIIGP 623
                  P + + +++ N+ +G     S D++R   V + C     +   P G  T IG 
Sbjct: 624 -------PWIQNTTVRDNILFG----SSFDDVRYKEVIRVCALQADLDILPAGDFTEIGE 672

Query: 624 RGASLSGGQKQRIAIARALMKKPKILILDEATSALDVE-SEGAINYTLGKLMKSKELTII 682
           RG +LSGGQK RI +AR++ K   I + D+  SA+D    +  ++  L  ++  K  T I
Sbjct: 673 RGITLSGGQKARINLARSVYKSMDIYLFDDVLSAVDARVGKHIMDECLMGMLDGK--TRI 730

Query: 683 SIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQSELYKLLNDKKRDKPTPRVQSD 742
              H+LS I R+  VI LG  GS  ++G  ++L  ++ S   KL+             S 
Sbjct: 731 LATHQLSLIERASRVIFLGAGGS-FDIGTVEEL-KERNSGFVKLME-----------FST 777

Query: 743 PEKDREQEHQIDNQVREQVANDFNLDQKSSKL 774
             K   Q  ++D+   E +    N  Q+ +KL
Sbjct: 778 QTKSANQREEVDDHAEENLGQ--NCQQEIAKL 807

>KNAG0I00990 Chr9 (188695..193302) [4608 bp, 1535 aa] {ON} Anc_8.303
            YDR135C
          Length = 1535

 Score =  128 bits (322), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 164/621 (26%), Positives = 273/621 (43%), Gaps = 89/621 (14%)

Query: 176  VIGMVLDAIKNTYSSATGPVGLDDL----------PPIVNDLSMYEFLGI-FAGALVIGT 224
            V+ ++L  I + + S  G V L             P     L +Y  LG+  A + +I T
Sbjct: 956  VVILILFIILSMFLSVMGNVWLKHWSEVNTEYGGNPHATRYLLIYFALGVGSALSTLIQT 1015

Query: 225  VANFGRIVLLRVLGEKLVARLRSNVIRKIIHQDAEFFDRNKVGDLISRLSSDAYVVS--- 281
            V  +   V   + G K +  + +N + +       FF+   +G +++R S+D Y V    
Sbjct: 1016 VILW---VFCTIHGSKYLHTVMTNAVFR---APMSFFETTPIGRILNRFSNDIYKVDSLL 1069

Query: 282  -RSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTSALLMFA-PPLLIGALIYGKRIRMISR 339
             R+ +Q + +  K                I  T+   +F   PL +  + Y +     SR
Sbjct: 1070 GRTFSQFLVNAVKVVFTMIV---------ICWTTWQFIFIIGPLGVLYIYYQQYYLRTSR 1120

Query: 340  DLQESTGNLTRVS-----EEQLSGVKTIQSFVAEGKELQRYNTAIRKVFLYGKKEALTNA 394
            +L+    ++TR       +E L G+ TI+     G   QR    I    +     A    
Sbjct: 1121 ELRR-LDSITRSPIYSHFQETLGGMSTIR-----GYNQQRRFDHINHCRIDNNMSA---- 1170

Query: 395  TFFSSTNVLGDLSFLIVLAYGSHLVL-----------QGGLTVGDLTAFMLYTEYTGSAV 443
             F+ S N    L+F +  + GS ++L           QG LT G +   + Y       +
Sbjct: 1171 -FYPSINANRWLAFRLE-SIGSVIILGAATLSIYRLGQGTLTAGMVGLSLSYALQITQTL 1228

Query: 444  FGLSNFYSELMKGAGAASRLFEMTD---HAPSI----KPTAGKPYVPGSGKISFKDVSFS 496
              +     E+     +  R+ E ++    AP +    +P A   + P SG I F   S  
Sbjct: 1229 NWIVRMTVEVETNIVSVERIKEYSELKSEAPLVIEEKRPAA---HWPDSGDIRFDHYSTR 1285

Query: 497  YPTRPG-NQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDIS 555
            Y  RP  + +   +N  I+P   + IVG +G GKS++T  L R    SSG I ID   I 
Sbjct: 1286 Y--RPELDLVLRDVNLHIKPREKIGIVGRTGAGKSSLTLALFRIVEASSGGIVIDGVRID 1343

Query: 556  RLSCKSLRRHLGVVQQEPMLMSGSIKYNL----TYGLQSEVSMDEIRSVAKKCFCHGFVT 611
             +    LR +L ++ Q+  +  G+I+ N+    TY      + DEI  V +    +  V 
Sbjct: 1344 EIGLHDLRHNLSIIPQDSQVFQGTIRENVDPTETY------TDDEIWRVLELSHLNRHVE 1397

Query: 612  KF-PNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTL 670
               P G    +   G++LS GQ+Q + +ARAL+   KILILDEAT+A+DVE++  I  T+
Sbjct: 1398 SMGPRGLLNEVNEGGSNLSVGQRQLMCLARALLVPSKILILDEATAAVDVETDQVIQETI 1457

Query: 671  GKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQSELYKLLNDK 730
                + +  TI++IAHR++TI  S+ ++VL + G V E     +L  ++ S+ + L  + 
Sbjct: 1458 RSAFRDR--TILTIAHRINTIMDSDRIVVL-DGGRVTEFDTPTNLLRNEGSQFHSLCQEA 1514

Query: 731  ---KRDKPTPRVQSDPEKDRE 748
                R +       DP+ ++E
Sbjct: 1515 GLLTRAQEAGAEGRDPKANKE 1535

 Score =  102 bits (253), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 113/461 (24%), Positives = 205/461 (44%), Gaps = 64/461 (13%)

Query: 310 ISLTSALLMFAPPLLIGALIY------GKRIRMISRDLQESTGNL----TRVSEEQLSGV 359
           I L S   +  P + IG +I          +  I + LQ+S        T V  E L+ +
Sbjct: 434 ICLVSLYKLLGPSMWIGVVILLVMTPLNTFLAKIQKRLQKSQMGFKDERTSVISEILNNI 493

Query: 360 KTIQSFVAE---GKELQ--RYNTAIRKVFLYGKKEALTNATFFSSTNVLGDLSFLIVLAY 414
           K+++ +  E    K+L+  R +  ++ +   G   A+T+  F     ++   +F  V  Y
Sbjct: 494 KSLKLYAWEEPYKKKLEHVRNDKELKNLTKLGCFMAITSFQFNVVPFLVSCCTF-AVFVY 552

Query: 415 GSHLVLQGGLTVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHAPSIK 474
                L   L    LT F L +      +F + N  +  ++ + + +RLF    +    K
Sbjct: 553 TEDRALTVDLVFPALTLFNLLS----FPLFVIPNVMTSFIEASVSVTRLFNFLTNEELQK 608

Query: 475 PTAGK-PYVPGSGKISFK---DVSFSYPTRPGNQI-FNKLNFTIEPGSNVCIVGPSGRGK 529
            +  + P V   G ++ K   D +F +  +P  ++    +NF  + G   C+VG  G GK
Sbjct: 609 DSVQRLPKVTNVGDVAVKVGDDATFLWRRKPEYKVALKNINFEAKKGQLTCVVGRVGSGK 668

Query: 530 STITSLLLRYYNPSSGQITIDDQDISRLS-CKSLRRHLGVVQQEPMLMSGSIKYNLTYGL 588
           S +   L       SG       D+ R+    ++   +  V Q   +M+G++K N+ +G 
Sbjct: 669 SALIQSL-------SG-------DLFRVKGFATVHGSVAYVSQVAWIMNGTVKENILFGH 714

Query: 589 QSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKI 648
           + +    +     K C     +    +G +T++G +G SLSGGQK R+++ARA+  +   
Sbjct: 715 RYDPEFYD--KTIKACALTIDLAVLVDGDETLVGEKGISLSGGQKARLSLARAVYARADT 772

Query: 649 LILDEATSALDVESEGA--INYTLG---------KLMKSKELTIISIAHRLSTIRRSENV 697
            +LD+  +A+D E  G   + + LG         K++ + +++++SIA R          
Sbjct: 773 YLLDDPLAAVD-EHVGKHLLEHVLGPTGLLRTKTKILATNKISVLSIADR---------- 821

Query: 698 IVLGNDGSVVEVGKFKDLYADQQSELYKLLNDKKRDKPTPR 738
           I L  +G +VE G + ++ AD  S L KL+ D  R    P+
Sbjct: 822 IALLENGEIVEQGSYDEVTADGDSALSKLIRDYGRKDNKPK 862

>SAKL0H23958g Chr8 complement(2062067..2066743) [4677 bp, 1558 aa]
            {ON} similar to uniprot|P14772 Saccharomyces cerevisiae
            YLL015W BPT1 ABC type transmembrane transporter of
            MRP/CFTR family found in vacuolar membrane involved in
            the transport of unconjugated bilirubin and in heavy
            metal detoxification via glutathione conjugates along
            with Ycf1p
          Length = 1558

 Score =  128 bits (321), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 142/561 (25%), Positives = 240/561 (42%), Gaps = 70/561 (12%)

Query: 207  LSMYEFLGIFAGALVIGTVANFGRIVLLRVLGEKLVARLRSNVIRKIIHQDAEFFDRNKV 266
            +++Y  +G+ + A  I        ++++     K   +L   + R ++     FF+   V
Sbjct: 1016 VAVYALIGLGSAAFTI-----LRSVIMMIYCSIKGSKKLHDTMARAVLRSPMSFFETTPV 1070

Query: 267  GDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTSAL-LMFAPPLLI 325
            G +I+R SSD  VV + +  + +  F                 IS    L L+F   LL+
Sbjct: 1071 GRIINRFSSDVNVVDQGLQFSFTYFF-----IYILNYLFTVILISFNMPLFLLFNGILLV 1125

Query: 326  GALIYGKRIRMISRDLQE----STGNLTRVSEEQLSGVKTIQSFVAEGKELQRYNTAIRK 381
                Y      +SR+L+     S   +  +  E L G   I ++    K LQR       
Sbjct: 1126 LYFYYQIYYITLSRELKRLTSISYSPIMSLLSETLGGHLVINAY----KHLQR------- 1174

Query: 382  VFLYGKKEAL---TNATF-FSSTNVLGDLSFLIV---------LAYGSHLVLQGGLTVGD 428
             F Y   E++    N  F F STN    +    +         L   S +     L+ G 
Sbjct: 1175 -FTYLNNESIQFNINCMFNFRSTNRWLSMRLQTIGAVLVLLTALLSLSTINTDKALSSGM 1233

Query: 429  LTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHAPS----IKPTAGKPYVPG 484
            +   M Y     +++  +     ++     +  R+ E  +  P     I+ +      P 
Sbjct: 1234 VGLLMSYALQVTTSLTWIVRMSVQVETDIVSVERILEYCNLPPEADAIIEESRPPKEWPS 1293

Query: 485  SGKISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSS 544
             G I+F++ S  Y     + +   +   I+P   + IVG +G GKST++  L R   PS 
Sbjct: 1294 RGAITFQNYSTKYRENL-DPVLKDITVEIKPQEKIGIVGRTGAGKSTLSLALFRLLEPSG 1352

Query: 545  GQITIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLT-YGLQSEVSMDEIRSVAKK 603
            G I ID  DI++L    LR +L ++ Q+     G+IK NL  +G  S+   +EI    + 
Sbjct: 1353 GSIVIDGIDIAKLGLSDLRGNLAIIPQDAQAFEGTIKSNLDPFGQYSD---EEIWRALEL 1409

Query: 604  CFCHGFVTKFPNGYDTI------------------IGPRGASLSGGQKQRIAIARALMKK 645
                  + K  +  +T                   I   G +LS GQ+Q + ++RAL+  
Sbjct: 1410 SHLKPHILKMASEENTENSETTTEATRSHELLSARITENGGNLSIGQRQLLCLSRALLNH 1469

Query: 646  PKILILDEATSALDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGS 705
             KIL+LDEAT+A+D+E++  I  T+    K +  TI++IAHR+ T+  S+ ++VL + G 
Sbjct: 1470 SKILVLDEATAAVDMETDKIIQETIKTAFKDR--TILTIAHRIDTVMDSDKIMVL-DKGE 1526

Query: 706  VVEVGKFKDLYADQQSELYKL 726
            V E     +L AD+ +  Y L
Sbjct: 1527 VKEFDTPTNLLADKSTIFYNL 1547

 Score = 95.9 bits (237), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 75/282 (26%), Positives = 141/282 (50%), Gaps = 24/282 (8%)

Query: 507 NKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRHL 566
           N  +F    G   CIVG  G GKST    +L      SG   +D+    +L  ++  + +
Sbjct: 647 NIRHFEARKGDLTCIVGRVGSGKSTFLQAILGQLPCISG---LDEHVPPKLIIRA--KSI 701

Query: 567 GVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGA 626
               Q+P +M+ S+K N+ +G    ++ D  ++  +KC     +   P+G  T++G +G 
Sbjct: 702 AYCPQQPWIMNASLKDNVIFG--HRLNEDYYKATIRKCQLLPDLDILPDGDQTLVGEKGI 759

Query: 627 SLSGGQKQRIAIARALMKKPKILILDEATSALDVE-SEGAINYTLGK---LMKSKELTII 682
           SLSGGQK R+++ARA+  +  + +LD+  SA+D E S+  +   L +   ++K+K  T+I
Sbjct: 760 SLSGGQKARLSLARAVYARADVYLLDDILSAVDAEVSKNIVEQVLNRGTGILKNK--TVI 817

Query: 683 SIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQSELYKLL-------NDKKRDKP 735
              + +S ++ S+N+  L  DG +VE   + D  +   S + K L        + + D  
Sbjct: 818 LTTNAVSVLKHSQNIYALL-DGEIVENKSYADAMSCDDSSILKTLIQEFDSNENSREDTK 876

Query: 736 TPRVQSDPEKDREQEHQIDNQVREQVAND---FNLDQKSSKL 774
             +  S  + D++  H I ++  ++ +     ++LD + + L
Sbjct: 877 DGQPSSTAKDDQKSFHSIKDEQEDRASTTKLVYSLDTEENML 918

>Smik_11.367 Chr11 (644116..648903) [4788 bp, 1595 aa] {ON} YKR103W
            (REAL)
          Length = 1595

 Score =  128 bits (321), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 126/559 (22%), Positives = 250/559 (44%), Gaps = 43/559 (7%)

Query: 221  VIGTVANF---GRIVLLRVLGEKLVARLRSNVIRKIIHQDAEFFDRNKVGDLISRLSSDA 277
            +IG +++F   G++ +  + G     ++ + ++  I      F D   VG +++R S D 
Sbjct: 1047 IIGFISSFLTAGKVWVAVLFGTNATKKIFAKLLSSIFLAKLRFHDITPVGRIMNRFSKDM 1106

Query: 278  YVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTSALLMFAPPLLIGALIYGKRIRMI 337
             ++ + +  N    F +                 +T   L+FA PL     I G      
Sbjct: 1107 DIIDQQLIPNFEGLFYSVVVCLWVIFLIGY----ITPRFLLFAIPLCALYYIVGSLYLRA 1162

Query: 338  SRDLQE----STGNLTRVSEEQLSGVKTIQSFVAEGKELQRYNTAIRK-----VFLYGKK 388
            SR+L+     +   + ++  E + GV TI++   E + + +   AI K      +L    
Sbjct: 1163 SRELKRIDNINVSPIHQLFTEAIKGVATIRALADERRFITQTLVAIDKSNAPFFYLNLAT 1222

Query: 389  EALTNATFFSSTNVLGDLSFLIVLAYGSHLVLQGGLTVGDLTAFMLYTEYTGSAVFGLSN 448
            E +T         +L   S +IVL          G+ + +  +F    ++      G+  
Sbjct: 1223 EWITYRVDIIGALILFSSSLMIVLKAPYLDAGLAGILLSNAFSFTETAQWIIKVFSGVEL 1282

Query: 449  FYSELMKGAGAASRLFEMTDHAPSIKPTAGKPYVPGSGKISFKDVSFSYPTRPGNQIFNK 508
              S + +         E ++      P A  P    +G I F++++  Y     ++  + 
Sbjct: 1283 LMSSVERIKEYVDVPLESSESNNYATPLANWP---QTGDIEFENLTLRYSPH-SSKALDG 1338

Query: 509  LNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRHLGV 568
            ++F ++ G+ V IVG +G GKS+I + + R  +   G I ID++DI  +  + LR  +  
Sbjct: 1339 VSFKVKAGTKVGIVGRTGAGKSSIIAAIYRLSDWEDGTIIIDNKDIKYVPLECLRNSISC 1398

Query: 569  VQQEPMLMSGSIKYNLT-YGLQSEVSMDE-------IRSVAKKCFCHGFVTKFPNGY--- 617
            + Q P L  G+I+ NL  +   S+V + E       I      C   G    +P+ +   
Sbjct: 1399 IPQNPTLFEGTIRSNLDPWDQYSDVQVFEALEKVGLIEQSEGLCSLPGQKLSYPSNHKLR 1458

Query: 618  ------DTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLG 671
                  +T++   G+++S GQ+Q + +AR+++    I+++DEAT+++D  S+  I  T+ 
Sbjct: 1459 NRFIDLNTVVKSGGSNISQGQRQLLCLARSMLGARNIMLIDEATASIDYVSDAKIQKTIR 1518

Query: 672  KLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQSELYKLLNDKK 731
            + M++   T+++IAHRL ++   + ++V+ + G V E     +L +D+ +  ++L    K
Sbjct: 1519 ETMRNT--TVLTIAHRLRSVIDYDKILVM-DMGRVEEYDHPYNLISDKNTIFHRLC---K 1572

Query: 732  RDKPTPRVQSDPEKDREQE 750
            R     ++ S  EK  + E
Sbjct: 1573 RSGEFEKLFSLAEKSFKNE 1591

 Score = 81.6 bits (200), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 81/279 (29%), Positives = 127/279 (45%), Gaps = 30/279 (10%)

Query: 506 FNKLNFTIEPGSNV--CIVGPSGRGKSTITSLLLRYYNPSSGQI---TIDDQDISRLSCK 560
           F   N +I+   N    I+GP+G GKS++   LL   N  SG+I   T+  +D   +   
Sbjct: 681 FKLKNISIDFKQNTLNAIIGPTGSGKSSLLLGLLGELNLRSGKINVPTVHSRDDLEIGID 740

Query: 561 SLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTI 620
            +   +    Q P L+SG+IK N+ +G     +  +   V K C     +     G  T 
Sbjct: 741 GMANSMAYCSQSPWLISGTIKDNIVFG--EFFNQQKFDDVIKCCCLEKDIKAMTAGLKTD 798

Query: 621 IGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAI--NYTLGKLMKSKE 678
           +G  G SLSGGQ+QRIA+ARA+    + L+ D+  SA+D E+   I      G +MK + 
Sbjct: 799 VGEGGFSLSGGQQQRIALARAIYSSSRYLLFDDCLSAVDPETALHIYEECLCGPMMKGR- 857

Query: 679 LTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYAD-----------------QQS 721
            T I  +H +S I +    +V+ ++G V   GK  DL                     Q 
Sbjct: 858 -TCIVTSHNISLIIKQAQWLVILDNGEVKAQGKPSDLIESSKFLKESINNDPGDKSYNQI 916

Query: 722 ELYKLLNDKKRDKPTPRVQSDPEKDREQEHQIDNQVREQ 760
           +L +    KK +   P ++ DP+ D E   + +N   E+
Sbjct: 917 KLKQFKTLKKTENVLP-IEEDPQ-DEENPQEAENPQEEE 953

>Skud_18.2 Chr18 (5442..10184) [4743 bp, 1580 aa] {ON} YHL035C (REAL)
          Length = 1580

 Score =  127 bits (320), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 140/556 (25%), Positives = 254/556 (45%), Gaps = 70/556 (12%)

Query: 212  FLGIFAGALVIGTVANF---GRIVLLRVLGEKLVARLRSNVIRKIIHQDAEFFDRNKVGD 268
            FL  +A   +IG +++F   G++ +  + G     ++ S ++  I      F D   VG 
Sbjct: 1028 FLLFYA---IIGLISSFLTAGKVWVAMLSGTNATKKIFSKLLSSIFEAKLRFHDITPVGR 1084

Query: 269  LISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTSALLMFAPPL----- 323
            +++R S D  ++ + +  N    F +                 +T   L+FA PL     
Sbjct: 1085 IMNRFSKDMDIIDQQLIPNFEGLFYSVVVCLWIVILIGY----VTPRFLIFAIPLCGLYY 1140

Query: 324  LIGALIYGKRIRMISRDLQESTGNLTRVSEEQLSGVKTIQSFVAEGKELQRYNTAIRKVF 383
             +GAL Y +  R + R    +   + ++  E + GV TI++   E +            F
Sbjct: 1141 FVGAL-YLRASRELKRIDNINVSPIHQLFTEAIKGVVTIRALADERR------------F 1187

Query: 384  LYGKKEAL--TNATFFS----------STNVLGDL----SFLIVLAYGSHLVLQGGLTVG 427
            +    EA+  +NA FF             +++G L    S L+++A   +L    GL   
Sbjct: 1188 ITHTLEAIDGSNAPFFYLSVATEWITYRVDIIGALVLFSSSLMIIARAPYL--DAGLAGI 1245

Query: 428  DLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHAPSIKPTAGKPY-VPGSG 486
             L+    +TE T   +  + +    LM          E+         +A  P   P +G
Sbjct: 1246 LLSNAFSFTE-TAQWIIKVFSGVELLMSSVERIKEYIEVPLEFSKSNDSATSPVDWPQTG 1304

Query: 487  KISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQ 546
            +I FK++S  Y       + N ++F +  G+ V IVG +G GKS+I + + R  +  SG 
Sbjct: 1305 EIEFKNLSLRYSPHSSKALDN-VSFKVRTGTKVGIVGRTGAGKSSIIAAIYRLSDWESGT 1363

Query: 547  ITIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLT-YGLQSEVSM-DEIRSVA--- 601
            I ID++DI  +S + LR  +  + Q P L  G+I+ NL  Y   S+  + D +  V    
Sbjct: 1364 IIIDNKDIKCVSLECLRNSISCIPQNPTLFDGTIRSNLDPYNQYSDKQVFDALAKVGLIE 1423

Query: 602  -KKCFCHGFVTK-------FPNGY---DTIIGPRGASLSGGQKQRIAIARALMKKPKILI 650
              +  C   VT         PN +   ++++   G++LS GQ+Q + +AR+++   KI++
Sbjct: 1424 RNEVLC--LVTDRQQSSSFSPNKFSDLNSVVRSGGSNLSQGQRQLLCLARSMLGSRKIML 1481

Query: 651  LDEATSALDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVG 710
            +DEAT+++D  S+  I  T+ + M++   TI++IAHRL ++     ++V+ + G V E  
Sbjct: 1482 IDEATASIDYISDAKIQKTIRETMENT--TILTIAHRLRSVIDYNKILVM-DMGRVKEYD 1538

Query: 711  KFKDLYADQQSELYKL 726
               +L +D+ +  + L
Sbjct: 1539 HPYNLISDKNTIFHHL 1554

 Score = 75.1 bits (183), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 84/283 (29%), Positives = 139/283 (49%), Gaps = 14/283 (4%)

Query: 487 KISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQ 546
           K+ FKD +  +     +     ++   +  S   I+GP+G GKS++   LL   N  SGQ
Sbjct: 663 KVGFKDANMEWDADETSFKLKNISIEFKLNSLNAIIGPTGSGKSSLLLGLLGELNLCSGQ 722

Query: 547 I---TIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKK 603
           I   ++D +D   +    +   +    Q P L+SG+I+ N+ +G     +     +V K 
Sbjct: 723 IYVPSVDSRDDLEVGIDGMTNSMAYCSQSPWLISGTIEDNIVFG--ERPNQRRFNAVIKA 780

Query: 604 CFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVESE 663
           C     V     G  T +G  G SLSGGQ+QR+A+ARA+    + L+LD+  SA+D E+ 
Sbjct: 781 CCLEKDVKAMSAGLKTSVGGGGFSLSGGQQQRVALARAIYSSSRFLLLDDCLSAVDPETA 840

Query: 664 GAI--NYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQS 721
             I      G +MK +  T I  +H +S I +    +V+ ++G V   GK  DL A+  +
Sbjct: 841 LNIYEKCLCGPIMKGR--TCIITSHNISLITKKAEWLVILDNGEVKGQGKPSDL-AESNN 897

Query: 722 ELYKLLNDKKRDKPTPRVQSDPE-KDREQEHQIDN-QVREQVA 762
            L + +N+   D+     Q+ P+ K     H  DN  V+E+++
Sbjct: 898 FLKESMNNGLADESGN--QAKPKSKTAATLHDTDNADVQEEIS 938

>TPHA0F00410 Chr6 (98503..103215) [4713 bp, 1570 aa] {ON} Anc_4.52
            YLL015W
          Length = 1570

 Score =  126 bits (317), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 135/567 (23%), Positives = 246/567 (43%), Gaps = 76/567 (13%)

Query: 207  LSMYEFLGIFAGALVIGTVANFGRIVLLRVLGEKLVARLRSNVIRKIIHQDAEFFDRNKV 266
            +++Y  +G+ + A       N   +++L     +   +L   +   ++     FF+   +
Sbjct: 1024 VTIYAIIGLLSAAF-----NNIRTVIMLLYCSIRGSKKLHDGMALSVMRSPMSFFETTPI 1078

Query: 267  GDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXX---XXXSISLTSALLMFAPPL 323
            G +++R SSD   +   +    S  F++                  I+L + L+M     
Sbjct: 1079 GRIVNRFSSDLEAIDSGLQYIFSFFFRSVLIYVVSLILVGYNLPWFIALNAVLIMIY--- 1135

Query: 324  LIGALIYGKRIRMISRDLQE----STGNLTRVSEEQLSGVKTIQSFVAEGKELQRYNTAI 379
                  Y     M+SR+L+     S   +  +  E L G   I +F        R+N   
Sbjct: 1136 ----FYYQAYYIMLSRELKRLTTISYSPIMSLISETLGGFSVINAF----DHTSRFN--- 1184

Query: 380  RKVFLYGKKEALTNATF-FSSTNV-----LGDLSFLIVLAYG----SHLVLQGGLTVGDL 429
               F +   +   +  F F STN      L  +  LI+LA G    + L  +  L+ G +
Sbjct: 1185 --FFNFETVQYNIDCVFQFRSTNRWLSVRLQTIGNLIILATGLLSFATLGTKKQLSSGMV 1242

Query: 430  TAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHAPSI-------KPTAGKPYV 482
               M Y+    S++  +     ++     +  R  E  +  P         +P  G P  
Sbjct: 1243 GLLMSYSLQVTSSLMWIVRMTVQIETRIVSVERTLEYCELKPEALEIIENSRPPEGWP-- 1300

Query: 483  PGSGKISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNP 542
               G I F + +  Y     + +   +N +I+P   + IVG +G GKST+T  L R    
Sbjct: 1301 -REGAIEFNNYTTKYRENL-DPVLKDINVSIKPKEKIGIVGRTGAGKSTLTLALFRLIEA 1358

Query: 543  SSGQITIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYN-----------------LT 585
            + G I+ID  DIS++  + LR +L ++ Q+     G+I+ N                 L+
Sbjct: 1359 TGGSISIDGIDISKIGLEDLRSNLAIIPQDAQAFEGTIRSNLDPFDQHSDEELWRAVELS 1418

Query: 586  YGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYD------TIIGPRGASLSGGQKQRIAIA 639
            +  Q  + M+E  +  +       +T  P+ ++      T I   G+++S GQ+Q + ++
Sbjct: 1419 HLKQHILRMNEEANDRESDSSRTDITT-PDSHNIKELLATPISKNGSNVSVGQRQLLCLS 1477

Query: 640  RALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSENVIV 699
            RAL+   K+LILDEAT+A+D+E++  +  T+    + KE TI++IAHR+ T+   + ++V
Sbjct: 1478 RALLNPSKVLILDEATAAIDMETDKIVQDTIKN--EFKERTILTIAHRIDTVMNYDKILV 1535

Query: 700  LGNDGSVVEVGKFKDLYADQQSELYKL 726
            L + G V E     +L +D+ +  YKL
Sbjct: 1536 L-DKGEVAEFDTVSNLLSDKNTMFYKL 1561

 Score = 89.7 bits (221), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 67/213 (31%), Positives = 116/213 (54%), Gaps = 19/213 (8%)

Query: 510 NFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQI-TIDDQDISRLSCKSLR-RHLG 567
           NFT++ GS  CIVG  G GKSTI   +L       GQ+  I   D +R    ++R   + 
Sbjct: 650 NFTVKKGSLTCIVGKVGSGKSTILHAIL-------GQLPCISALDQTRAPKVTIRATSIA 702

Query: 568 VVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGAS 627
              QE  +M+ S+K N+ +G + + +   +  V + C     ++  P+G +TI+G +G S
Sbjct: 703 YCPQEAWIMNSSVKENIVFGHKHDENYYNL--VIQACQLASDLSILPDGDETIVGEKGIS 760

Query: 628 LSGG-QKQRIAIARALMKKPKILILDEATSALDVE-SEGAINYTLGK---LMKSKELTII 682
           L GG QK RI++ARA+  +  + +LD+  SA+D   S+  I Y L K   L+++K  TII
Sbjct: 761 LVGGVQKARISLARAVYARADVYLLDDILSAVDAHVSKNIIKYVLSKETGLLRNK--TII 818

Query: 683 SIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDL 715
              + ++ ++ S+ +  +   G +VE   ++++
Sbjct: 819 LSTNNVNVLKNSQKIYAI-EKGEIVEESDYENV 850

>Kwal_56.23844 s56 complement(733654..738138) [4485 bp, 1494 aa] {ON}
            YDR135C (YCF1) - metal resistance protein, similar to
            multidrug resistance proteins and cystic fibrosis protein
            CFTR [contig 171] FULL
          Length = 1494

 Score =  126 bits (317), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 138/557 (24%), Positives = 251/557 (45%), Gaps = 76/557 (13%)

Query: 211  EFLGIFAGALVIGTVANFGRIVLLRVL----GEKLVARLRSNVIRKIIHQDAEFFDRNKV 266
            ++LGI+    V   ++   + ++L V     G K +  + ++ I K       FF+   +
Sbjct: 970  KYLGIYFLLGVGSALSTLTQTIILWVYCTIHGSKYLHDIMADAIFK---APMTFFETTPI 1026

Query: 267  GDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTSALLMFAPPLLIG 326
            G +++R S+D Y V   + +  S  F                  S T   +    PL   
Sbjct: 1027 GRVLNRFSNDIYKVDELLGRTFSQFF----VNAVKVSFTIIVICSSTWQFVFVIIPLGTL 1082

Query: 327  ALIYGKRIRMISRDLQESTGNLTRVS-----EEQLSGVKTIQSFVAEGKELQRYNTAIRK 381
             + Y +     SR+L+    ++TR       +E L G+ TI+ +  +G+           
Sbjct: 1083 YIYYQQYYLRTSRELRR-LDSVTRSPIYAHFQETLGGISTIRGYQQQGR----------- 1130

Query: 382  VFLYGKKEALTN--ATFFSSTNVLGDLSF-------LIVLAYGSHLVL---QGGLTVGDL 429
             FL+  +  + N  + F+ S N    L+F       +I+L   +  V    QG LT G +
Sbjct: 1131 -FLHINQARVDNNMSAFYPSVNANRWLAFRLEFIGSIIILGAATLSVFRLKQGALTPGMI 1189

Query: 430  TAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFE---MTDHAPSIKPTAGKPY--VPG 484
               + Y      ++  +     E+     +  R+ E   +T  AP++  +  +P    P 
Sbjct: 1190 GLSVSYALQITQSLNWIVRMTVEVETNIVSVERIKEYANITPEAPAVIES-NRPAEDWPT 1248

Query: 485  SGKISFKDVSFSYPTRPGNQI-FNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPS 543
             G I F++ S  Y  RP   +    +N  I+P   + IVG +G GKS++T  L R    +
Sbjct: 1249 HGAIKFENYSARY--RPELDLSLRNINIDIKPQERIGIVGRTGAGKSSLTLALFRIIEAA 1306

Query: 544  SGQITIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYN-----------LTYGLQSEV 592
             G+I ID      +  + LR HL ++ Q+  +  G+++ N           + + L+   
Sbjct: 1307 EGRIIIDGVPTDSIGLRDLRHHLSIIPQDSQVFEGTVRENIDPTNEYTDEEIWHALELAH 1366

Query: 593  SMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILD 652
              D I+S+ K            +  ++++   G +LS GQ+Q + +ARAL+   +IL+LD
Sbjct: 1367 LKDHIKSLGK------------DELESMLTEGGGNLSVGQRQLMCLARALLIPTRILVLD 1414

Query: 653  EATSALDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKF 712
            EAT+A+DVE++  I  T+    K++  TI++IAHR++TI  S+ ++VL + G + E    
Sbjct: 1415 EATAAVDVETDQVIQETIRTAFKNR--TILTIAHRINTILDSDRILVL-DSGKIAEFDSP 1471

Query: 713  KDLYADQQSELYKLLND 729
            + L  +++S  Y L  +
Sbjct: 1472 EALLKNRESLFYSLCQE 1488

 Score = 99.0 bits (245), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 76/307 (24%), Positives = 148/307 (48%), Gaps = 46/307 (14%)

Query: 479 KPYVPGSGKISFK---DVSFSYPTRPGNQI-FNKLNFTIEPGSNVCIVGPSGRGKSTITS 534
           KP V  +G+++     D +F +  +P  ++    +NF  + G   CIVG  G GKS +  
Sbjct: 600 KPKVTKTGEVAINVGADATFLWQRKPEYKVALKNINFQAKKGELTCIVGKVGSGKSALIQ 659

Query: 535 LLLRYYNPSSGQITIDDQDISRLS-CKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVS 593
            +L               D+ R+    S+   +  V Q P +M+G++K N+ +G + +  
Sbjct: 660 GIL--------------GDLFRVKGFASVHGSIAYVSQVPWIMNGTVKENILFGHKYDA- 704

Query: 594 MDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDE 653
            D   +  + C     ++  P G +T++G +G SLSGGQK RI++ARA+  +    +LD+
Sbjct: 705 -DFYDTTLRACALAVDLSILPKGDETLVGEKGISLSGGQKARISLARAVYARADTYLLDD 763

Query: 654 ATSALDVE-SEGAINYTLG---------KLMKSKELTIISIAHRLSTIRRSENVIVLGND 703
             +A+D   ++  I + LG         K++ + +++++SIA  +S          L  +
Sbjct: 764 PLAAVDEHVAKHLIEHVLGSQGLLSSKVKVLATNKISVLSIADHIS----------LLEN 813

Query: 704 GSVVEVGKFKDLYADQQSELYKLLNDKKRDKPTPRVQSDPEKDREQEHQIDNQVREQVAN 763
           G +++ G ++++ +D+ S L K++ +  + +   +    PE         D++V E   +
Sbjct: 814 GEIIQQGSYEEVTSDKSSALSKIIANYGKKQTKGKGDESPESSTP-----DSEVAEASID 868

Query: 764 DFNLDQK 770
              LD K
Sbjct: 869 LQKLDDK 875

>KLTH0G12716g Chr7 (1080818..1085320) [4503 bp, 1500 aa] {ON} highly
            similar to uniprot|P39109 Saccharomyces cerevisiae
            YDR135C
          Length = 1500

 Score =  126 bits (316), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 129/498 (25%), Positives = 224/498 (44%), Gaps = 63/498 (12%)

Query: 260  FFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTSALLMF 319
            FF+   +G +++R S+D + V   + +  +  F                 +S T  ++ F
Sbjct: 1026 FFETTPIGRILNRFSNDIFKVDELLGRTFAQFF------------VNAIKVSFTIIVICF 1073

Query: 320  APPLLIGALI-YGKRIRMISRDLQESTGNLTRVS-----------EEQLSGVKTIQSFVA 367
            +    I  ++  G       +    ++  L R+            +E L G+ TI+    
Sbjct: 1074 STWQFILVILPMGTLYIYYQQYYLRTSRELRRLDSVTRSPIYAHFQETLGGISTIRG--- 1130

Query: 368  EGKELQRYNTAIRKVFLYGKKEALTNATFFSSTNVLGDLSF-------LIVLAYGSHLVL 420
                   YN   R V +   +     + ++ S N    L+F       +I+LA  S  VL
Sbjct: 1131 -------YNQQKRFVHINQARVDNNMSAYYPSVNANRWLAFRLEFIGSVIILAASSLSVL 1183

Query: 421  ---QGGLTVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFE---MTDHAPSI- 473
               QG LT G +   + Y      ++  +     E+     +  R+ E   +   AP++ 
Sbjct: 1184 RLKQGALTPGMIGLSVSYALQITQSLNWIVRMTVEVETNIVSVERIKEYANLESEAPAVI 1243

Query: 474  ---KPTAGKPYVPGSGKISFKDVSFSYPTRPGNQI-FNKLNFTIEPGSNVCIVGPSGRGK 529
               +P+   P     G I F++ S  Y  RP  ++    +N  I+P   + IVG +G GK
Sbjct: 1244 ESNRPSEDWP---SQGSIKFENYSARY--RPELELSLKDINLDIKPQERIGIVGRTGAGK 1298

Query: 530  STITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQ 589
            S++T  L R    +SG+I ID   I  +  + LR HL ++ Q+  L  G+I+ N+     
Sbjct: 1299 SSLTLALFRIIEAASGRIYIDGLPIDSIGLRDLRHHLSIIPQDSQLFEGTIRENI--DPT 1356

Query: 590  SEVSMDEIRSVAKKCFCHGFVTKF-PNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKI 648
            +E + ++I    +       V        D  +   G++LS GQ+Q + +ARAL+   KI
Sbjct: 1357 NEYTDEQIWRALELSHLKDHVKGLGKEELDAPLTEGGSNLSVGQRQLMCLARALLIPSKI 1416

Query: 649  LILDEATSALDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVE 708
            L+LDEAT+A+DVE++  I  T+    K++  TI++IAHR++TI  S+ ++VL + G V E
Sbjct: 1417 LVLDEATAAVDVETDQVIQETIRTAFKNR--TILTIAHRINTILDSDRILVL-DSGKVAE 1473

Query: 709  VGKFKDLYADQQSELYKL 726
                 +L  + +S  Y L
Sbjct: 1474 FDTPDNLLKNPESLFYSL 1491

 Score = 88.2 bits (217), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 67/274 (24%), Positives = 129/274 (47%), Gaps = 47/274 (17%)

Query: 492 DVSFSYPTRPGNQI-FNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITID 550
           D +F +  +P  ++    +NF  + G   C+VG  G GKS +   +L             
Sbjct: 621 DATFLWQRKPEYKVALKNINFAAKKGKLTCVVGKVGSGKSALIQAIL------------- 667

Query: 551 DQDISRLS-CKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGF 609
             D+ R+    S+   +  V Q P +M+G++K N+ +G + + S   +    K C     
Sbjct: 668 -GDLFRVKGFASVHGSIAYVSQVPWIMNGTVKDNILFGHKYDESFYTM--TLKACALIVD 724

Query: 610 VTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVE-SEGAINY 668
           +   P G  T++G +G SLSGGQK R+++ARA+  +    +LD+  +A+D   ++  + +
Sbjct: 725 LAVLPKGDQTLVGEKGISLSGGQKARLSLARAVYARADTYLLDDPLAAVDEHVTKHLVEH 784

Query: 669 TLG---------KLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQ 719
            LG         K++ + ++T++SIA            I L  +G +++ G + D+ + +
Sbjct: 785 VLGPNGLLASKTKVLATNKITVLSIADH----------IALLENGEIIQQGSYDDVTSAK 834

Query: 720 QSELYKLLNDKKRDKPTPRVQSDPEKDREQEHQI 753
            S L K+++   +          PEK +  E+ +
Sbjct: 835 SSALSKIISTFGK---------KPEKSKTGENTV 859

>Kpol_1033.28 s1033 complement(69924..74519) [4596 bp, 1531 aa] {ON}
            complement(69924..74519) [4596 nt, 1532 aa]
          Length = 1531

 Score =  126 bits (316), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 145/558 (25%), Positives = 247/558 (44%), Gaps = 76/558 (13%)

Query: 211  EFLGIFAGALVIGTVANFGRIVLLRVL----GEKLVARLRSNVIRKIIHQDAEFFDRNKV 266
             +L I+ G  V    A   + V+L V     G K    L S+++  I+     FF+   +
Sbjct: 998  HYLLIYFGFGVTSAFATLCQTVVLWVFCTIHGSKY---LHSSMVSSILRAPMTFFETTPI 1054

Query: 267  GDLISRLSSDAY----VVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTSALLMFAPP 322
            G +++R S+D Y    V+ RS +Q   +  K                   T   ++   P
Sbjct: 1055 GRILNRFSNDVYKIDEVLGRSFSQFFVNAVKVSFTILVICWN--------TWQFILLVIP 1106

Query: 323  LLIGALIYGKRIRMISRDLQE----STGNLTRVSEEQLSGVKTIQSFVAEGKELQRYNTA 378
            + +  L Y +     SR+L+     +   +    +E L G+ TI+     G E Q     
Sbjct: 1107 MGVLYLYYQQYYLRTSRELRRLDSITKSPIYAHFQESLGGLATIR-----GYEQQ----- 1156

Query: 379  IRKVFLYGKKEALTN--ATFFSSTNVLGDLSF-------LIVLAYGSHLVLQ---GGLTV 426
              K F++  +  + N  + ++ S N    L++       LI+    S  +L+   G LT 
Sbjct: 1157 --KRFIHINQARVDNNMSAYYPSINSNRWLAYRLEFLGSLIIFGAASLSILKLRDGTLTA 1214

Query: 427  GDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRL---FEMTDHAPSI----KPTAGK 479
            G +   + Y      ++  +     E+     +  R+    E+   AP I    +P+   
Sbjct: 1215 GMIGLSLSYALQVTQSLNWIVRMTVEVETNIVSVERIKEYAELKSEAPLIIEEKRPSENW 1274

Query: 480  PYVPGSGKISFKDVSFSYPTRPG-NQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLR 538
            P     G I F++ S  Y  RP  + +   ++  I+P   V IVG +G GKS++T  L R
Sbjct: 1275 P---ERGAIKFENYSTRY--RPDLDLVLKNISLDIKPQEKVGIVGRTGAGKSSLTLALFR 1329

Query: 539  YYNPSSGQITIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDE-I 597
                + G I +D  +IS +    LR  L ++ Q+  +  G+I+ N+     + +  DE I
Sbjct: 1330 IIEAAEGSIIVDGLNISEIGLYDLRHKLSIIPQDSQVFEGTIRENID---PTNIYTDEQI 1386

Query: 598  RSVAKKCFCHGFVTKF---------PNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKI 648
             +  +       + +           N   T +   G +LS GQ+Q + +ARAL+   KI
Sbjct: 1387 WNALELSHLKQHILRMNEESVNGSENNALYTRVTEGGNNLSVGQRQLMCLARALLVPSKI 1446

Query: 649  LILDEATSALDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVE 708
            LILDEAT+A+DVE++  I  T+    K +  TI++IAHRL+TI  S+ ++VL + G V E
Sbjct: 1447 LILDEATAAVDVETDSLIQETIRTAFKDR--TILTIAHRLNTIMDSDKIVVL-DKGEVAE 1503

Query: 709  VGKFKDLYADQQSELYKL 726
                ++L  + +S  Y L
Sbjct: 1504 FDTPQNLLKNTESLFYSL 1521

 Score = 95.9 bits (237), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 98/395 (24%), Positives = 181/395 (45%), Gaps = 38/395 (9%)

Query: 349 TRVSEEQLSGVKTIQSFVAEGK-----ELQRYNTAIRKVFLYGKKEALTNATFFSSTNVL 403
           TRV  E L+ +K+++ +  E       E  R    ++ +   G   A+TN  F +    L
Sbjct: 485 TRVINEILNNIKSLKLYAWEQPYKEKLEHVRNEKELKNLTRIGVFNAMTNFQF-NLVPFL 543

Query: 404 GDLSFLIVLAYGSHLVLQGGLTVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRL 463
              S   V  Y     L   L    LT F L T    +    ++ F    ++ + + SRL
Sbjct: 544 VSCSTFAVFVYIEDKPLTTDLVFPALTLFNLLTFPLAALPIVITAF----IEASVSMSRL 599

Query: 464 FE-MTDHAPSIKPTAGKPYVPGSGKISFK---DVSFSYPTRPGNQI-FNKLNFTIEPGSN 518
           F  MT+           P V   G I+     + +F +  +P  ++    + F  + G  
Sbjct: 600 FSFMTNEELQTDAIQRLPPVKKQGDIAVNIGDNATFLWKRKPEYKVALKNIEFQAKKGEL 659

Query: 519 VCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLS-CKSLRRHLGVVQQEPMLMS 577
            CIVG  G GKS     +L               D+ R+    ++  ++  V Q P +M+
Sbjct: 660 ACIVGKVGSGKSAFIQSIL--------------GDLFRVKGFATIHGNVAYVSQLPWIMN 705

Query: 578 GSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIA 637
           G++K N+ +G +      E     + C     ++  P+G  T++G +G SLSGGQK R++
Sbjct: 706 GTVKDNILFGHKYNQEFYE--KTLRACALTIDLSILPDGDQTLVGEKGISLSGGQKARLS 763

Query: 638 IARALMKKPKILILDEATSALDVE-SEGAINYTLGK--LMKSKELTIISIAHRLSTIRRS 694
           +ARA+  +  + +LD+  +A+D   S+  I + +G   L+ +K  T +   +++S +  +
Sbjct: 764 LARAVYARADVYLLDDPLAAVDEHVSKHLIQHVIGPNGLLHTK--TRVLATNKISVLSIA 821

Query: 695 ENVIVLGNDGSVVEVGKFKDLYADQQSELYKLLND 729
           +N+ +L +DG +V+ G + ++  +  S L KL+++
Sbjct: 822 DNITLL-DDGEIVQQGTYNEVTDNINSPLCKLISE 855

>Kpol_YGOB_1041.45 s1041 complement(118923..123629) [4707 bp, 1568 aa]
            {ON} ANNOTATED BY YGOB -
          Length = 1568

 Score =  125 bits (315), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 142/558 (25%), Positives = 238/558 (42%), Gaps = 59/558 (10%)

Query: 208  SMYEFLGIFAGALVIGTVANFGR-IVLLRVLGEKLVARLRSNVIRKIIHQDAEFFDRNKV 266
            +++ F+G++A   +I    N  R IV+L     +   +L  N+   +++    FF+   +
Sbjct: 1012 NLWMFVGVYALIGIISAAFNNLRSIVMLIFCSIRGSKKLHDNMALSVVYSPMSFFETTPI 1071

Query: 267  GDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTSALLMFAPPLLIG 326
            G +I+R S D   V   +    S  F++                       +F   L++ 
Sbjct: 1072 GRIINRFSGDLDSVDSGLQFIFSHFFRSLLGYIVTVILVGYN----MPWFFVFNIFLIVI 1127

Query: 327  ALIYGKRIRMISRDLQESTG----NLTRVSEEQLSGVKTIQSFVAEGKELQRYNTAIRKV 382
               Y     + SR+L+  T      +  +  E L+G   I +          YN A R  
Sbjct: 1128 YFYYQAYYIVTSRELKRLTSITYSPIMSLISETLAGYLVINA----------YNHAKR-- 1175

Query: 383  FLYGKKEAL---TNATF-FSSTNV-----LGDLSFLIVLAYG----SHLVLQGGLTVGDL 429
            F Y   E++    +  F F STN      L  +  LIVLA G    S +     LT G +
Sbjct: 1176 FSYFNFESVQFNIDCLFNFRSTNRWLSVRLQAIGALIVLATGLLSLSTIGTSKQLTAGMV 1235

Query: 430  TAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHAPSIKP----TAGKPYVPGS 485
               M Y+    +++  +     ++     +  R+ E  +  P        T  +   P  
Sbjct: 1236 GLLMSYSLQVTNSLMWIVRMSVQIETNIVSVERILEYCELPPEPPHEIEETKPEKSWPAH 1295

Query: 486  GKISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSG 545
            G I F D S  Y  +  + + NK+N  IEP   + IVG +G GKST+T  L R    + G
Sbjct: 1296 GSIKFIDYSTKY-RKNLDPVLNKINLEIEPREKIGIVGRTGAGKSTLTLALFRILEATDG 1354

Query: 546  QITIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNL-------TYGLQSEVSMDEIR 598
            +I ID  DIS L    LR +L ++ Q+     G+I+ NL          L   +    ++
Sbjct: 1355 KIVIDGVDISTLGLSDLRSNLAIIPQDAQAFEGTIRTNLDPFDQHSDEELWKAIEASHLK 1414

Query: 599  SVAKKCFCH----------GFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKI 648
               ++   +              K  N  +  I   G++LS GQ+Q + ++RAL+   KI
Sbjct: 1415 PHLERIISNRDDNSESEETNVSAKDNNLLEIKINENGSNLSVGQRQLLCLSRALLNHSKI 1474

Query: 649  LILDEATSALDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVE 708
            L+LDEAT+++D+E++  I  T+      +  TI++IAHR+ T+   + ++VL + G V E
Sbjct: 1475 LVLDEATASVDMETDKIIQETIRNEFSDR--TILTIAHRIDTVLGYDKILVL-DKGEVRE 1531

Query: 709  VGKFKDLYADQQSELYKL 726
                  L  ++ S  Y L
Sbjct: 1532 FDSPDTLLENKNSIFYNL 1549

 Score = 92.8 bits (229), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 118/479 (24%), Positives = 217/479 (45%), Gaps = 52/479 (10%)

Query: 332 KRIRMISRDLQESTGNLTRVSEEQLSGVKTIQSFVAEGKELQRYNTAIRKVFL--YGKKE 389
           K+++ ++++  +      R   E L+ +K+I+ +  E   L+R +     + L  + K  
Sbjct: 451 KKVKSLNKEQMKYKDIRIRTLTEILNSIKSIKLYSWEKPMLKRLDHVRNDLELESFKKIG 510

Query: 390 ALTNATFFSSTNV--LGDLSFLIVLAYGSHLVLQGGLTVGDLTAFMLYTEYTGSAVFGLS 447
            ++N  FF+   V  +   S  I+ A  S + L   +    L  F +  +    A++ + 
Sbjct: 511 IVSNCIFFAWNCVPIMVTCSSFIIFALTSGMALTPDIVFPALALFNILND----AIYSVP 566

Query: 448 NFYSELMKGAGAASRL--FEMTDHAPSIKPTAGKPYVPG-SGKISFKDVSFSY------- 497
           +  + +++ + +  RL  F  T+           P   G S  +   + +F +       
Sbjct: 567 STITNIIEVSVSLGRLKNFLATEELDRSFIEQSDPKNDGHSCAVEIDNATFLWKGKKNLV 626

Query: 498 --------PTRPGNQI-FNKLN-FTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSG-Q 546
                    T    Q+ F  +N F ++ GS  CIVG  G GK+T+   +L      SG Q
Sbjct: 627 SSENGDEESTIDNTQVAFKNVNHFEVKEGSLTCIVGRVGSGKTTLLRAVLGQLPCISGAQ 686

Query: 547 ITIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFC 606
            +I  + I R         +    Q+  +M+ S+K N+ +G + +     +    + C  
Sbjct: 687 ESIPPKLIIR------GNSIAYCPQQAWIMNSSVKENILFGHKYDEHYYNL--TIEACQL 738

Query: 607 HGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVE-SEGA 665
              +   P+G +TI+G +G SLSGGQK R+++ARA+  +  I +LD+  SA+D E S+  
Sbjct: 739 TEDLKMLPDGDETIVGEKGISLSGGQKARLSLARAVYSRSDIYLLDDILSAVDAEVSKNI 798

Query: 666 INYTLGK---LMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLY-ADQQS 721
           I   L +   L+KSK  TII   + +S ++ S+ +  L N   ++E G + D+  + + S
Sbjct: 799 IEKVLDEQTGLLKSK--TIILTTNAISVLKHSQKIYALEN-CEIIEEGAYDDVMNSSEDS 855

Query: 722 ELYKLLN--DKKRDKPTPRVQSDPEKDREQEHQ---IDNQVREQVANDFNLDQKSSKLT 775
           +L  L+N  D  RD  +    S+  K  E+      ID+ + E   +D NL + +   T
Sbjct: 856 KLKALINEFDNDRDNNSKEEVSEERKTSEETSDVVPIDDNLIEN--DDDNLAESTVAYT 912

>Kpol_1041.45 s1041 complement(118923..123713) [4791 bp, 1596 aa]
            {OFF} complement(118923..123713) [4791 nt, 1597 aa]
          Length = 1596

 Score =  125 bits (315), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 142/558 (25%), Positives = 238/558 (42%), Gaps = 59/558 (10%)

Query: 208  SMYEFLGIFAGALVIGTVANFGR-IVLLRVLGEKLVARLRSNVIRKIIHQDAEFFDRNKV 266
            +++ F+G++A   +I    N  R IV+L     +   +L  N+   +++    FF+   +
Sbjct: 1040 NLWMFVGVYALIGIISAAFNNLRSIVMLIFCSIRGSKKLHDNMALSVVYSPMSFFETTPI 1099

Query: 267  GDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTSALLMFAPPLLIG 326
            G +I+R S D   V   +    S  F++                       +F   L++ 
Sbjct: 1100 GRIINRFSGDLDSVDSGLQFIFSHFFRSLLGYIVTVILVGYN----MPWFFVFNIFLIVI 1155

Query: 327  ALIYGKRIRMISRDLQESTG----NLTRVSEEQLSGVKTIQSFVAEGKELQRYNTAIRKV 382
               Y     + SR+L+  T      +  +  E L+G   I +          YN A R  
Sbjct: 1156 YFYYQAYYIVTSRELKRLTSITYSPIMSLISETLAGYLVINA----------YNHAKR-- 1203

Query: 383  FLYGKKEAL---TNATF-FSSTNV-----LGDLSFLIVLAYG----SHLVLQGGLTVGDL 429
            F Y   E++    +  F F STN      L  +  LIVLA G    S +     LT G +
Sbjct: 1204 FSYFNFESVQFNIDCLFNFRSTNRWLSVRLQAIGALIVLATGLLSLSTIGTSKQLTAGMV 1263

Query: 430  TAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHAPSIKP----TAGKPYVPGS 485
               M Y+    +++  +     ++     +  R+ E  +  P        T  +   P  
Sbjct: 1264 GLLMSYSLQVTNSLMWIVRMSVQIETNIVSVERILEYCELPPEPPHEIEETKPEKSWPAH 1323

Query: 486  GKISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSG 545
            G I F D S  Y  +  + + NK+N  IEP   + IVG +G GKST+T  L R    + G
Sbjct: 1324 GSIKFIDYSTKY-RKNLDPVLNKINLEIEPREKIGIVGRTGAGKSTLTLALFRILEATDG 1382

Query: 546  QITIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNL-------TYGLQSEVSMDEIR 598
            +I ID  DIS L    LR +L ++ Q+     G+I+ NL          L   +    ++
Sbjct: 1383 KIVIDGVDISTLGLSDLRSNLAIIPQDAQAFEGTIRTNLDPFDQHSDEELWKAIEASHLK 1442

Query: 599  SVAKKCFCH----------GFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKI 648
               ++   +              K  N  +  I   G++LS GQ+Q + ++RAL+   KI
Sbjct: 1443 PHLERIISNRDDNSESEETNVSAKDNNLLEIKINENGSNLSVGQRQLLCLSRALLNHSKI 1502

Query: 649  LILDEATSALDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVE 708
            L+LDEAT+++D+E++  I  T+      +  TI++IAHR+ T+   + ++VL + G V E
Sbjct: 1503 LVLDEATASVDMETDKIIQETIRNEFSDR--TILTIAHRIDTVLGYDKILVL-DKGEVRE 1559

Query: 709  VGKFKDLYADQQSELYKL 726
                  L  ++ S  Y L
Sbjct: 1560 FDSPDTLLENKNSIFYNL 1577

 Score = 93.2 bits (230), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 118/479 (24%), Positives = 217/479 (45%), Gaps = 52/479 (10%)

Query: 332 KRIRMISRDLQESTGNLTRVSEEQLSGVKTIQSFVAEGKELQRYNTAIRKVFL--YGKKE 389
           K+++ ++++  +      R   E L+ +K+I+ +  E   L+R +     + L  + K  
Sbjct: 479 KKVKSLNKEQMKYKDIRIRTLTEILNSIKSIKLYSWEKPMLKRLDHVRNDLELESFKKIG 538

Query: 390 ALTNATFFSSTNV--LGDLSFLIVLAYGSHLVLQGGLTVGDLTAFMLYTEYTGSAVFGLS 447
            ++N  FF+   V  +   S  I+ A  S + L   +    L  F +  +    A++ + 
Sbjct: 539 IVSNCIFFAWNCVPIMVTCSSFIIFALTSGMALTPDIVFPALALFNILND----AIYSVP 594

Query: 448 NFYSELMKGAGAASRL--FEMTDHAPSIKPTAGKPYVPG-SGKISFKDVSFSY------- 497
           +  + +++ + +  RL  F  T+           P   G S  +   + +F +       
Sbjct: 595 STITNIIEVSVSLGRLKNFLATEELDRSFIEQSDPKNDGHSCAVEIDNATFLWKGKKNLV 654

Query: 498 --------PTRPGNQI-FNKLN-FTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSG-Q 546
                    T    Q+ F  +N F ++ GS  CIVG  G GK+T+   +L      SG Q
Sbjct: 655 SSENGDEESTIDNTQVAFKNVNHFEVKEGSLTCIVGRVGSGKTTLLRAVLGQLPCISGAQ 714

Query: 547 ITIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFC 606
            +I  + I R         +    Q+  +M+ S+K N+ +G + +     +    + C  
Sbjct: 715 ESIPPKLIIR------GNSIAYCPQQAWIMNSSVKENILFGHKYDEHYYNL--TIEACQL 766

Query: 607 HGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVE-SEGA 665
              +   P+G +TI+G +G SLSGGQK R+++ARA+  +  I +LD+  SA+D E S+  
Sbjct: 767 TEDLKMLPDGDETIVGEKGISLSGGQKARLSLARAVYSRSDIYLLDDILSAVDAEVSKNI 826

Query: 666 INYTLGK---LMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLY-ADQQS 721
           I   L +   L+KSK  TII   + +S ++ S+ +  L N   ++E G + D+  + + S
Sbjct: 827 IEKVLDEQTGLLKSK--TIILTTNAISVLKHSQKIYALEN-CEIIEEGAYDDVMNSSEDS 883

Query: 722 ELYKLLN--DKKRDKPTPRVQSDPEKDREQEHQ---IDNQVREQVANDFNLDQKSSKLT 775
           +L  L+N  D  RD  +    S+  K  E+      ID+ + E   +D NL + +   T
Sbjct: 884 KLKALINEFDNDRDNNSKEEVSEERKTSEETSDVVPIDDNLIEN--DDDNLAESTVAYT 940

>KLLA0F20075g Chr6 complement(1868786..1873336) [4551 bp, 1516 aa]
            {ON} similar to uniprot|P39109 Saccharomyces cerevisiae
            YDR135C
          Length = 1516

 Score =  125 bits (314), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 149/580 (25%), Positives = 258/580 (44%), Gaps = 62/580 (10%)

Query: 176  VIGMVLDAIKNTYSSATGPVGLDD--LPPIVNDLSMYEFLGI-FAGALVIGTVANFGRIV 232
            ++ M+L  I N +      V  +    P     L +Y  LG+  A A +I T+  +   V
Sbjct: 962  ILSMLLAVIGNFWLKHWSEVNTEKGYNPHATRYLMIYLALGVGSALATLIQTIVLW---V 1018

Query: 233  LLRVLGEKLVARLRSNVIRKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGF 292
               + G K    L   +   ++     FF+   +G +++R S+D Y V   + +  +  F
Sbjct: 1019 FCTIHGSKY---LHDAMASSVLKAPMSFFETTPIGRILNRFSNDIYKVDEILGRTFAQFF 1075

Query: 293  KAXXXXXXXXXXXXXXSISLTSALLMFAPPLLIGALIYGKRIRMISRDLQESTGNLTRVS 352
                                T   +    PL +  + Y +     SR+L+    ++TR  
Sbjct: 1076 ANVVKVSFTIVVICMA----TWQFIFIVLPLSVLYIYYQQYYLRTSRELRR-LDSVTRSP 1130

Query: 353  -----EEQLSGVKTIQSFVAEGKELQRYNTAIRKVFLYGKKEALTN--ATFFSSTNVLGD 405
                 +E L G+ TI+ +  + +            F++  +  + N  + F+ S N    
Sbjct: 1131 IYAHFQETLGGLTTIRGYSQQNR------------FVHINQTRVDNNMSAFYPSVNANRW 1178

Query: 406  LSF-------LIVLAYGSHLVLQ---GGLTVGDLTAFMLYTEYTGSAVFGLSNFYSELMK 455
            L+F       +I+LA     V++   G LT G +   + +      ++  +     E+  
Sbjct: 1179 LAFRLEFIGSVIILAASMLAVIRLGNGTLTAGMIGLSLSFALQITQSLNWIVRMTVEVET 1238

Query: 456  GAGAASRL---FEMTDHAPSI----KPTAGKPYVPGSGKISFKDVSFSYPTRPGNQ-IFN 507
               +  R+    E+   AP I    +P A  P    SG+I F  V++S   RP  + I  
Sbjct: 1239 NIVSVERIKEYAELKSEAPYIIKDHRPPASWP---ESGEIKF--VNYSTRYRPELELILK 1293

Query: 508  KLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRHLG 567
             ++  I P   + IVG +G GKS++T  L R    +SG I ID   I  +    LR  L 
Sbjct: 1294 DIDLHIHPKEKIGIVGRTGAGKSSLTLALFRIIEAASGHIVIDGIPIDSIGLADLRHGLS 1353

Query: 568  VVQQEPMLMSGSIKYNLTYGLQSEVSMDEI-RSVAKKCFCHGFVTKFPNGYDTIIGPRGA 626
            ++ Q+  +  G+++ N+     +  + +EI  ++A        +    NG +T++   G+
Sbjct: 1354 IIPQDSQIFEGTVRENI--DPTNRYTDEEIWNALALSHLKDHILGMGSNGLETMLTEGGS 1411

Query: 627  SLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTIISIAH 686
            +LS GQ+Q + +ARAL+    ILILDEAT+A+DVE++  I  T+      KE TI++IAH
Sbjct: 1412 NLSVGQRQLMCLARALLISSNILILDEATAAVDVETDQLIQKTIRNAF--KERTILTIAH 1469

Query: 687  RLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQSELYKL 726
            R++TI  S+ +IVL + G V E    ++L   + S  Y L
Sbjct: 1470 RINTIMDSDRIIVL-DKGRVTEFDTPQNLLQKKDSIFYSL 1508

 Score = 99.4 bits (246), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 108/432 (25%), Positives = 194/432 (44%), Gaps = 68/432 (15%)

Query: 332 KRIRMISRDLQESTGNLTRVSEEQLSGVKTIQSFVAEGKELQ--------RYNTAIRKVF 383
           ++I+M ++D +      TRV+ E L+ +K+++ +   G E+         R    ++ + 
Sbjct: 471 QKIQMKNKDER------TRVTSEILNNIKSLKVY---GWEIPYKAKLDHVRNEKELKNLK 521

Query: 384 LYGKKEALTNATFFSSTNVLGDLSFLIVLAYGSHLVLQGGLTVGDLTAFMLYTEYTGSAV 443
             G   AL N  F +    L   S   V  Y     L   L    LT F L +       
Sbjct: 522 KMGCTLALANFQF-NIVPFLVSCSTFAVFVYTEERPLSTDLVFPALTLFNLLS------- 573

Query: 444 FGLS---NFYSELMKGAGAASRLFE-MTDHAPSIKPTAGKPYVPGSGK--ISFKDVSFSY 497
           F L+   N  S  ++ + + +RLF  +T+          +P V   G   +   D +F +
Sbjct: 574 FPLAVVPNAISSFIEASVSINRLFAFLTNEELQNDAVLREPKVKNIGDEGVKVNDATFLW 633

Query: 498 PTRPGNQI-FNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISR 556
             +P  ++    +NF  + G   CIVG  G GKS +   LL       G  T+   D++ 
Sbjct: 634 QRKPEYKVALKNINFVAKKGELTCIVGKVGSGKSALIQSLLGDLIRVKGFATVHG-DVAN 692

Query: 557 LSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNG 616
           +S            Q P +M+G++K N+ +G + +    ++    K C     ++  P+G
Sbjct: 693 VS------------QVPWIMNGTVKDNILFGHKYDPEFYQL--TIKACALSIDLSMLPDG 738

Query: 617 YDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVE-SEGAINYTLG---- 671
             T++G +G SLSGGQK R+++ARA+  +    +LD+  +A+D   ++  I + LG    
Sbjct: 739 DQTLVGEKGISLSGGQKARLSLARAVYSRADTYLLDDPLAAVDEHVAKHLIEHVLGPHGL 798

Query: 672 -----KLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQSELYKL 726
                K++ + ++T++SIA          + I L  +G +++ G +  +     S L KL
Sbjct: 799 LHSKTKVLATNKITVLSIA----------DSITLMENGEIIQQGSYDQVNESTNSPLSKL 848

Query: 727 LND-KKRDKPTP 737
           + +  K+ KPTP
Sbjct: 849 IAEFGKKGKPTP 860

>TPHA0A05620 Chr1 (1273220..1277653) [4434 bp, 1477 aa] {ON} Anc_5.10
            YGR281W
          Length = 1477

 Score =  125 bits (313), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 139/579 (24%), Positives = 232/579 (40%), Gaps = 98/579 (16%)

Query: 207  LSMYEFLGIFAGALVIGTVANFGRIVLLRVLGEKLVARLRSNVIRKIIHQDAEFFDRNKV 266
            + +Y F  +F GA +  T     +  +L  +G      L    +++IIH    F D   +
Sbjct: 936  MGLYSFF-VF-GAYIFMT----SQFTILCYIGIGASKNLNIQALKRIIHTPMSFMDTTPI 989

Query: 267  GDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTSALLMFAP----- 321
            G +++R + D   +   + +NV                     + +    +++ P     
Sbjct: 990  GRILNRFTKDTDSLDNELIENVR-----------LTVSQFANIVGVCVMCIVYLPWFAIA 1038

Query: 322  -PLLIGALIYG-----------KRIRMISRDLQESTGNLTRVSEEQLSGVKTIQSFVAEG 369
             P L+   ++            KR+  I R    +  N      E L G+ TI+ + +E 
Sbjct: 1039 VPFLVFIFVFIQNHYQSAGREIKRLEAIQRSFVYNNFN------EILGGMDTIKFYKSEE 1092

Query: 370  KELQRYNTAIRKVFLYGKKEALTNATFFSSTNVLGDLSFLIVLAYGSHLVL-----QGGL 424
            + + + +  I K+     +             +L D+   I +A+   + L     Q  +
Sbjct: 1093 RYIAKSDYLIDKM----NEAGYLTVCVQRWVAILVDM---IAVAFALIITLLCVTRQFHI 1145

Query: 425  TVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRL--------FEMTDHAPSIKPT 476
            +   +   + Y          L    S++     +  RL         E   H P   P 
Sbjct: 1146 SASSVGVLLTYVLQLPGLFNTLLRAVSQVENDMNSTERLVSYATDLPLEAQYHKPETAPP 1205

Query: 477  AGKPYVPGSGKISFKDVSFSYPTRPGNQIFNK-LNFTIEPGSNVCIVGPSGRGKSTITSL 535
                  P  G I F++V F+Y  RPG  I  K +N  I     + I G +G GKSTI + 
Sbjct: 1206 ES---WPEEGTIKFENVDFAY--RPGLPIVLKNINLQINGTEKIGICGRTGAGKSTIMTA 1260

Query: 536  LLRYYNPSSGQITIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQ------ 589
            L R    +SG I IDD DI++L    LR+ L ++ Q+P+L  G I+ NL    +      
Sbjct: 1261 LYRLNELTSGSILIDDVDINKLGLHELRKKLAIIPQDPVLFRGDIRKNLDPFHERTDEEL 1320

Query: 590  ---------------SEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQ 634
                           +E     I         H F        D ++   GA+ S G++Q
Sbjct: 1321 WDVLVRGGAIAPEDLAETKAQHITEDGTSADLHKF------HLDKVVEEDGANFSLGERQ 1374

Query: 635  RIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRRS 694
             +A+ RAL++  KILILDEATS++D E++  I   +         TI+ IAHRL TI   
Sbjct: 1375 ILALTRALVRNTKILILDEATSSVDYETDRKIQERIATAF--SHCTILCIAHRLKTILNY 1432

Query: 695  ENVIVLGNDGSVVEVGKFKDLYADQQSELYKLLNDKKRD 733
            + ++VL + G V E     +L+ D+ +  + +   KK D
Sbjct: 1433 DRILVLEH-GEVAEFDTPMNLFKDETTIFHNMC--KKSD 1468

 Score = 98.6 bits (244), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 72/223 (32%), Positives = 117/223 (52%), Gaps = 22/223 (9%)

Query: 506 FNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRH 565
           F  LNF I+ G  V I GP G GK+++ +    +   +SG I I+  D+           
Sbjct: 612 FTNLNFEIKKGEFVMITGPIGTGKTSLLNSFAGFMEKTSGTIQING-DL----------- 659

Query: 566 LGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRG 625
             ++   P + + +++ N+ +G  S    D+ + V + C     +   P G  T IG RG
Sbjct: 660 --LMGGYPWIQNATVRDNIIFG--SPYEEDKYKEVLRACSLESDLDILPAGDKTEIGERG 715

Query: 626 ASLSGGQKQRIAIARALMKKPKILILDEATSALDVE-SEGAINYTLGKLMKSKELTIISI 684
            +LSGGQK RI +AR + K+  I +LD+  SA+D    +  ++  L KL+ +K  T +  
Sbjct: 716 ITLSGGQKARINLARCVYKEKDIYLLDDVLSAVDSRVGKHIMDECLTKLIGNK--TRLLA 773

Query: 685 AHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQSELYKLL 727
            H+LS I ++  +IVLGNDGS VE+G  +  Y  + ++  K+L
Sbjct: 774 THQLSLIDKASRIIVLGNDGS-VEIGDVQ--YMKETNKTLKVL 813

>KLTH0B00396g Chr2 complement(38234..42757) [4524 bp, 1507 aa] {ON}
            similar to uniprot|P32386 Saccharomyces cerevisiae
            YLL048C
          Length = 1507

 Score =  125 bits (313), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 148/547 (27%), Positives = 247/547 (45%), Gaps = 59/547 (10%)

Query: 207  LSMYEFLGIFAGALVIGTVANFGRIVLLRVL--GEKLVARLRSNVIRKIIHQDAEFFDRN 264
            LS Y  +G+F         A+   +++L+ L  G +  +++ + ++ +++H    FFD  
Sbjct: 963  LSTYAAIGLFH--------ASVTTLIMLKFLCIGLEASSKVFAEILNRVLHAKMTFFDFT 1014

Query: 265  KVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTSALLMFAPPLL 324
              G +++R++ D  ++ + +   +     A                 + +  L+FA   L
Sbjct: 1015 PAGRILNRITRDFEILEQELMVLLLQLLFAITSLGAILLLISV----IATKFLIFA--FL 1068

Query: 325  IGALIYGKRIRMI---SRDLQESTGNLTRVS-----EEQLSGVKTIQSFVAEGKELQRYN 376
            +G +IY   I       RDL+   G +TR        E LSG  TI+ F   GKE     
Sbjct: 1069 LG-IIYAVMITSYIPAFRDLKRYEG-ITRSPIFEQFSELLSGFVTIRGF---GKEKSCMG 1123

Query: 377  TAIRKVFLYGKKE---ALTNATFFSSTNVLGDLSFLIVLAYGSHLVLQGGLTVGDLTAFM 433
               RK+ L  +     ++          VLG L    VL   + L L   L   +L A +
Sbjct: 1124 QLFRKLDLNNRPAYYVSVVQLWLCLRVEVLGSL----VLGATATLSL---LNAKELGAGL 1176

Query: 434  LYTEYTGSAVFGLSNFYSELMKG-----AGAASRLFEMT--DHAPSIKPTAGKPYVPGSG 486
                 T +  F  S  ++  +         +  R+ E T  D   +           G  
Sbjct: 1177 AGLALTYAMPFSQSALWTATVSSNVEIKMTSVERIKEYTEIDCEDTKAGALINTQWSGGA 1236

Query: 487  KISFKDVSFSY-PTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSG 545
            +ISF  V   Y P  P   +   ++FT+ P S V IVG +G GKST+   L R    ++G
Sbjct: 1237 EISFDHVYVRYAPHLP--DVLKNVSFTLLPNSKVAIVGRTGSGKSTVMMSLFRLIELTNG 1294

Query: 546  QITIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLT-YGLQSEVSMDEIRSVAKKC 604
             I I   DI+ L+ ++LRR L V+ Q+P L SG+IK N+  +G  S+    E+   A++ 
Sbjct: 1295 TIRIGGIDIASLNLQTLRRELTVIPQDPSLFSGTIKSNIDPFGRYSD---QELTHFARRI 1351

Query: 605  --FCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVES 662
              F      +  N   +++   G ++S GQ+Q + +ARAL++K KILILDEAT+++D E+
Sbjct: 1352 GLFSGTDDVRTFNSLGSLVSEGGENMSQGQRQLLCLARALLQKSKILILDEATASIDHET 1411

Query: 663  EGAINYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQSE 722
            +  I   +     S    +I++AHR+STI   + VIVL  D  +V+      L   Q   
Sbjct: 1412 DATIQQVVRDF--SSGGIVITVAHRMSTIIDYDQVIVL--DSGIVKENNHPYLLLKQNGA 1467

Query: 723  LYKLLND 729
             +++  +
Sbjct: 1468 FHQMCKE 1474

 Score = 95.9 bits (237), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 76/286 (26%), Positives = 136/286 (47%), Gaps = 19/286 (6%)

Query: 487 KISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQ 546
           ++ F++ S ++       +   L    E      I+GPSG GKS++   LL   +   G 
Sbjct: 634 EMGFRNASLTWNRFDTGFMLKNLTIDFELHKLNVIIGPSGSGKSSVLLALLGELDLIEGS 693

Query: 547 ITIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFC 606
           I +    +    C           Q P + + ++K N+ +   S+ +    + V   C  
Sbjct: 694 IRVPRGYMHDDRCS-----FAFCSQTPWITNATVKENIVFS--SQFNTKRYQEVLHACGL 746

Query: 607 HGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAI 666
              + +   G +T++G +G +LSGGQ+QR+A+ARA+    + L+LD+  SA+D      I
Sbjct: 747 EEDILEMQEGDETVVGDKGMTLSGGQRQRLALARAVYSGAEHLLLDDCLSAVDPGMAVWI 806

Query: 667 --NYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQ---- 720
                +G LMK K  T I   H ++ +++  ++I+L ++G V ++GK +D   D +    
Sbjct: 807 FQKCIMGPLMKGK--TCILATHNIALVQKHADMIILLDNGRVSKIGKARDFNFDSEFDYS 864

Query: 721 --SELYKL-LNDKKRDKPTPRVQSDPEKDREQEHQIDNQVREQVAN 763
             S+L K  +   K+ K    +Q D    RE EH+ D  ++ +V N
Sbjct: 865 KPSKLEKAEMKPNKKPKKEMILQPDTGFSRE-EHKEDGSIKIEVYN 909

>TDEL0F04300 Chr6 complement(802866..807410) [4545 bp, 1514 aa] {ON}
            Anc_8.303 YDR135C
          Length = 1514

 Score =  124 bits (312), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 135/541 (24%), Positives = 244/541 (45%), Gaps = 46/541 (8%)

Query: 212  FLGIFAGALVIGTVANFGRIVLLRVLGEKLVAR-LRSNVIRKIIHQDAEFFDRNKVGDLI 270
            +LGI+    +   ++   + ++L V      +R L S +   ++     FF+   +G ++
Sbjct: 993  YLGIYLALGLSSALSTLIQTIILWVFCTIRGSRYLHSIMAASVLRAPMVFFETTPIGRIL 1052

Query: 271  SRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTSALLMF-APPLLIGALI 329
            +R S+D Y V   + +  +  F                 I +T+   +F   P+++  + 
Sbjct: 1053 NRFSNDIYKVDELLGRTFAQFF-----VNVTKVSFTIIVICVTTWQFIFLILPMIVLYVY 1107

Query: 330  YGKRIRMISRDLQE----STGNLTRVSEEQLSGVKTIQSFVAEGKELQRYNTAIRKVFLY 385
            Y +     SR+L+     +   +    +E L G+ TI+ +  + +            F +
Sbjct: 1108 YQQYYLRTSRELRRLDSVTKSPVYAHFQESLGGLSTIRGYDQQDR------------FTH 1155

Query: 386  GKKEALTN--ATFFSSTNVLGDLSF-------LIVLAYGSHLVLQ---GGLTVGDLTAFM 433
              +  + N  + F+ S N    L+F       +I+    S  +L+   G LT G +   +
Sbjct: 1156 INQSRIDNNMSAFYPSVNANRWLAFRLEFIGTIIIFGAASLSMLRLKAGSLTPGMIGLSL 1215

Query: 434  LYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTD---HAPSIKPTAGKPY-VPGSGKIS 489
             Y      ++  +     E+     +  R+ E ++    AP +      P   P  G I 
Sbjct: 1216 SYALQITQSLNWIVRMTVEVETNIVSVERIKEYSEIKSEAPLVIEDHRPPADWPSKGDIK 1275

Query: 490  FKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITI 549
            F+  S  Y     N +   +N  ++P   + IVG +G GKS++T  L R    + G+I I
Sbjct: 1276 FEHYSTRY-RENMNLVLKDINLHVKPQEKIGIVGRTGAGKSSLTLALFRIIEAAEGRIVI 1334

Query: 550  DDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGF 609
            D   I+ +    LR  L ++ Q+  +  G+++ N+     ++ S +EI  V +       
Sbjct: 1335 DGVPINEIGLHDLRHKLSIIPQDSQVFEGTVRENI--DPTNQYSDEEIWRVLELSHLKNH 1392

Query: 610  VTKFP-NGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINY 668
            V     +G  T +   GA+LS GQ+Q + +ARAL+   +ILILDEAT+A+DVE++  I  
Sbjct: 1393 VLSMSKDGLMTRLTEGGANLSVGQRQLMCLARALLIPSRILILDEATAAVDVETDQVIQE 1452

Query: 669  TLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQSELYKLLN 728
            T+    K +  TI++IAHRL+TI  S+ ++VL + G V E    ++L   Q S  Y L +
Sbjct: 1453 TIRTAFKDR--TILTIAHRLNTIMDSDRILVL-DAGEVREFDTPENLLKQQGSIFYSLCS 1509

Query: 729  D 729
            D
Sbjct: 1510 D 1510

 Score = 91.7 bits (226), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 89/369 (24%), Positives = 160/369 (43%), Gaps = 75/369 (20%)

Query: 382 VFLYGKKEALTNATFFSSTNVLGDLSF-LIVLAYGSHLVLQGGLTVGDLTAFMLYTEYTG 440
           VF+Y +K+ LT    F +  +   LSF L V+       ++  ++V  L +F+   E   
Sbjct: 555 VFVYTEKKPLTTDLVFPALALFNLLSFPLNVVPMVLTAFIEASVSVNRLYSFLTNEELQK 614

Query: 441 SAVFGLSNFYSELMKGAGAASRLFEMTDHAPSIKPTAGKPYVPGSGKISFK---DVSFSY 497
            AV  L                            P A K     +G ++ K   D +F +
Sbjct: 615 DAVHHL----------------------------PKAQK-----AGDVAIKISDDANFLW 641

Query: 498 PTRPGNQI-FNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISR 556
             +P  Q+    +N  ++ G   C+VG  G GKS +   LL               D+ R
Sbjct: 642 KRKPQYQVALKNINLEVKKGELACVVGKVGSGKSALVQSLL--------------GDLYR 687

Query: 557 LS-CKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPN 615
           +    ++      V Q P +M+G++K N+ +G + +    ++    K C     +   P+
Sbjct: 688 VKGYAAVHGSTAYVSQVPWIMNGTVKDNILFGHKYDPVFYDL--TIKACALTIDLGILPD 745

Query: 616 GYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVE-SEGAINYTLG--- 671
           G  T++G +G SLSGGQK R+++ARA   +    +LD+  +A+D   ++  I + LG   
Sbjct: 746 GDQTMVGEKGISLSGGQKARLSLARATYARADTYLLDDPLAAVDEHVAQHLIEHVLGPRG 805

Query: 672 ------KLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQSELYK 725
                 KL+ + ++T++SIA  +S +            G +++ G ++D+  D  S L  
Sbjct: 806 LLKSKTKLLATNKITVLSIASSISLVE----------GGEIIQHGSYEDISKDLDSPLSN 855

Query: 726 LLNDKKRDK 734
           L+ +  + K
Sbjct: 856 LVKEFGKKK 864

>YKR104W Chr11 (656836..657756) [921 bp, 306 aa] {ON} Putative
           transporter of the multidrug resistance-associated
           protein (MRP) subfamily; contains a stop codon in S288C;
           adjacent ORFs YKR103W and YKR104W are merged in
           different strain backgrounds
          Length = 306

 Score =  117 bits (294), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 87/296 (29%), Positives = 153/296 (51%), Gaps = 42/296 (14%)

Query: 459 AASRLFEMTDHAPS-----IKPTAGKPYVPGSGKISFKDVSFSYPTRPGNQIFNKLNFTI 513
           +  R+ E TD  PS     I P A     P +G +  K++S  Y       + N ++F +
Sbjct: 3   SVERIKEYTD-IPSESNGYISPPAN---WPQTGDVELKNLSLRYSPHSSKALDN-VSFKV 57

Query: 514 EPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRHLGVVQQEP 573
           + G+ V IVG +G GKS+I + + R  +  +G ITID++DI  +  + LR  +  + Q+P
Sbjct: 58  KAGTKVGIVGRTGAGKSSIIAAIYRLSDWENGTITIDNKDIKHIPLERLRNSISCIPQDP 117

Query: 574 MLMSGSIKYNL----------TYGLQSEVSMDEIRSVAKKC--FCHGFVTKFPN------ 615
            L  G+++ NL           YG+ S+V + E      +C   C  F  + PN      
Sbjct: 118 TLFDGTVRSNLDPFDRYSDVQIYGVLSKVGLIE------ECDELCLIFEQEQPNFSSHKL 171

Query: 616 -----GYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTL 670
                  +T++   G++LS GQ+Q + +AR+++    I+++DEAT+++D  S+  I  T+
Sbjct: 172 RNRFIDLNTVVKSGGSNLSQGQRQLLCLARSMLGARNIMLIDEATASIDYISDAKIQKTI 231

Query: 671 GKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQSELYKL 726
            + MK+   TI++IAHRL ++   + ++V+   G V E      L +D+ +  Y+L
Sbjct: 232 RETMKNT--TILTIAHRLRSVIDYDKILVM-EMGRVKEYDHPYTLISDRNTIFYRL 284

>AGR047W Chr7 (802679..807157) [4479 bp, 1492 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YDR135C (YCF1)
          Length = 1492

 Score =  123 bits (309), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 128/513 (24%), Positives = 229/513 (44%), Gaps = 61/513 (11%)

Query: 245  LRSNVIRKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXX 304
            L  +++  ++     FF+   +G +++R S+D Y V   + +  S  F            
Sbjct: 1003 LHESMLAAVLRAPMSFFETTPIGRILNRFSNDIYKVDELLARTFSQFFANTTRVSFTIIV 1062

Query: 305  XXXXSISLTSALLMFAPPLLIGALIYGKRIRMISRDLQE----STGNLTRVSEEQLSGVK 360
                +   T     F  PL +  + Y +     SR+L+     +   +    +E L+GV 
Sbjct: 1063 ICVTTWQFT----FFVIPLAMLYIYYQQYYLKTSRELRRLDSVTKSPVYAHFQETLNGVS 1118

Query: 361  TIQSFVAEGKELQRYNTAIRKVFLYGKKEALTNAT--FFSSTNVLGDLSFLIVLAYGSHL 418
            +I+ +     +L R        F++  +  + N T  ++ S NV   L++ +    GS +
Sbjct: 1119 SIRGY----GQLDR--------FIHINQARINNNTSAYYPSMNVNRWLAYRLEFI-GSCI 1165

Query: 419  VLQGGLTVGDLTAFMLYTEYTGSAVFGLSNFYS---------------ELMKGAGAASRL 463
            +         L+ F L +    S + GLS  Y+               E+     +  R+
Sbjct: 1166 IF----FAATLSVFRLASGSLTSGMVGLSLSYALQITQSLNWIVRMTVEVETNIVSVERI 1221

Query: 464  FEMTDHAPS----IKPTAGKPYVPGSGKISFKDVSFSYPTRPG-NQIFNKLNFTIEPGSN 518
             E  +  P     I  +      P  G+I F++ S  Y  RPG + I   +N  I+P   
Sbjct: 1222 KEYAELEPEAPQFIANSVPSGDWPKDGEIKFENYSTRY--RPGLDLILRGINLHIKPHER 1279

Query: 519  VCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRHLGVVQQEPMLMSG 578
            V IVG +G GKS++   L R    + G I+ID   I  +    LR+ L ++ Q+  +  G
Sbjct: 1280 VGIVGRTGAGKSSLALSLFRIIEAAEGHISIDGVPIDTIGLTDLRKKLSIIPQDSQVFEG 1339

Query: 579  SIKYNL----TYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQ 634
            +++ N+     Y  +      E+  +A      G      +G DT +   G +LS GQ+Q
Sbjct: 1340 TVRDNIDPTKQYTDEQIWKALELSHLADHVKGMG-----SDGLDTPLTEGGKNLSVGQRQ 1394

Query: 635  RIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRRS 694
             + +ARAL+   +IL+LDEAT+A+DVE++  I  T+      +  TI++IAHR++TI  S
Sbjct: 1395 LMCLARALLIPFRILVLDEATAAIDVETDKVIQDTIRSSFNDR--TILTIAHRINTIMDS 1452

Query: 695  ENVIVLGNDGSVVEVGKFKDLYADQQSELYKLL 727
            + ++VL + G+V E    ++L   ++  ++  L
Sbjct: 1453 DKIVVL-DKGTVAEFDTPENLLKKKEESIFYTL 1484

 Score = 95.9 bits (237), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 141/678 (20%), Positives = 288/678 (42%), Gaps = 115/678 (16%)

Query: 108 QKTVESQAKTPA-DKESQKSGTMEDEESPNMGYKEVIRLFKLATHDWKLLTFAIGLLAIS 166
           Q   E  A+T + D E +    +     P++ +     LF   +H    +  A+      
Sbjct: 235 QLPAEHDARTLSEDMEKRWQRELNKRARPSLAWV----LFSSFSHK---ILLAVLFKICH 287

Query: 167 SVIGMSIPKVIGMVLDAIKNTYSSATGPVGLDDLPPIVNDLSMYEFLGIFAGALVIGTVA 226
            ++  + P+++ +++  +   YS A G +  ++  P+V    +   +G+F  ++V  TV 
Sbjct: 288 DILAFTQPQLLRLLIKFVTE-YSKARGDISAEEDVPLVRGFMLA--VGMFLVSVVQTTVL 344

Query: 227 NFGRIVLLRVL--GEKLVARLRSNVIRKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSM 284
              +   L+    G  L + + S + +K +H   E    +  GD+++ +S DA  + R +
Sbjct: 345 ---QQYFLQAFDTGTDLRSGITSLIYKKALHLSNEASGTSATGDIVNLMSVDAQRL-RDL 400

Query: 285 TQN---VSDGFKAXXXXXXXXXXXXXXSISLTSALLMFAPPLLIGALIYGKRIRMISRDL 341
           TQ    +  G                  I +   LL+F  PL   + I  + ++ + ++ 
Sbjct: 401 TQWGNVIWSGPFQLCLCLYSLHRLLGPCIWVGVVLLLFTLPL--NSYI-SRVLKRLQKEQ 457

Query: 342 QESTGNLTRVSEEQLSGVKTIQ------------SFVAEGKELQ--------------RY 375
            ++    TR+  E L+ +K+++             +V   KEL+              +Y
Sbjct: 458 MKNKDERTRLISEILNNIKSLKLYAWEIPYKEKLDYVRNQKELKTLRKMGLTTAFANFQY 517

Query: 376 N-------TAIRKVFLYGKK-EALTNATFFSSTNVLGDLSF-LIVLAYGSHLVLQGGLTV 426
           N        +   VF+  +K   LT    F +  +   LSF L VL       ++  + +
Sbjct: 518 NIIPFLVSCSTFAVFVLTQKGRPLTTDLVFPALTLFNLLSFPLAVLPIAITSFIEASVAI 577

Query: 427 GDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHAPSIKPTAGKPYVPGSG 486
           G LT F+   E    A+                           P++K        PG  
Sbjct: 578 GRLTNFLTAEELQRDAI------------------------TREPAVK-------APGGV 606

Query: 487 KISFKD-VSFSYPTRPGNQI-FNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSS 544
            ++  D  +F +  +P  ++    +NF  +     CI+G  G GKS +   +L       
Sbjct: 607 AVALADNATFLWQRKPEYKVALKNINFRAKKSELTCIIGKVGSGKSALIQAML------- 659

Query: 545 GQITIDDQDISRLSCKSLRR-HLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKK 603
                   D+ R++  ++ R ++  V Q   +M+G+++ N+ +G + +      +   K 
Sbjct: 660 -------GDLFRVNGSAVVRGNVAYVSQVAWIMNGTVRDNILFGHKYDAKF--YQQTIKA 710

Query: 604 CFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVE-S 662
           C     ++  P+G +T +G +G SLSGGQK R+++ARA+  +    +LD+  +A+D   +
Sbjct: 711 CALTVDLSILPDGDNTFVGEKGISLSGGQKARLSLARAVYARADTYLLDDPLAAVDEHVA 770

Query: 663 EGAINYTLGK--LMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQ 720
           +  +    G   L+KSK   + +  ++++ +  ++++++L N G +V+ G F ++ +D+ 
Sbjct: 771 KHLLQNVFGPNGLLKSKARVLTT--NKITALEIADHIVLLEN-GEIVQQGTFSEVISDED 827

Query: 721 SELYKL-LNDKKRDKPTP 737
           S + KL L+  K+    P
Sbjct: 828 SAISKLVLHHGKKQNGAP 845

>Kwal_26.9532 s26 complement(1256241..1260656) [4416 bp, 1471 aa] {ON}
            YGR281W (YOR1) - ABC transporter [contig 363] FULL
          Length = 1471

 Score =  120 bits (301), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 132/527 (25%), Positives = 226/527 (42%), Gaps = 46/527 (8%)

Query: 212  FLGIFAGALVIGTVANFGRIVLLRVLGEKLVARLRSNVIRKIIHQDAEFFDRNKVGDLIS 271
            ++G++   +     A   +  +L  +G      L    +++++H    F D   +G +++
Sbjct: 928  YMGLYTFFVFFNYFATTSQFSVLCYMGLSAAKWLNLKAVKRLLHTPMSFLDTTPIGRVLN 987

Query: 272  RLSSDAYVVSRSMTQNVSDG-FKAXXXXXXXXXXXX---XXSISLTSALLMFAPPLLIGA 327
            R + D   +   +T++V    F+A                 +I++   LL+FA      A
Sbjct: 988  RFTKDTDTLDTELTESVRLFLFQASNIVGVVIMCIIYLPWFAIAVPFLLLIFAAV----A 1043

Query: 328  LIYGKRIRMISRDLQESTGNLTRVSEEQLSGVKTIQSFVAEGKELQRYNTAIRKVFLYGK 387
              Y    R I R       ++     E LSG+ TI+++  E + L + +  I K+   G 
Sbjct: 1044 DHYQSSSREIKRLEAVQRSHVFNNFNEVLSGMDTIRAYRGEARFLTKSDFLINKMNEAGY 1103

Query: 388  KE-ALTNATFFSSTNVLGDLSFLIVLAYGSHLVLQGGLTVGDLTAFMLYTEYTGSAVFGL 446
               A+      +   +    + +I L   +        +VG L  ++L          GL
Sbjct: 1104 VVVAIQRWVSIALDMIAMAFALIITLLCVTRQFSISAASVGVLLTYVLQLP-------GL 1156

Query: 447  SNFYSELM----KGAGAASRLFEMTDHAP----SIKPTAGKPY-VPGSGKISFKDVSFSY 497
             N     M        +A RL       P      +P    P   P  G I F  VS +Y
Sbjct: 1157 LNTLMRAMTQGENDMNSAERLISYATDLPLEAAYRRPETSPPESWPSEGAIDFDHVSLAY 1216

Query: 498  PTRPG-NQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISR 556
              RPG   + + ++  +  G  + I G +G GKSTI S L R      G ITID  DI++
Sbjct: 1217 --RPGLPLVLHDVSLHVRGGEKIGICGRTGAGKSTIMSALYRMIELHDGSITIDGIDIAQ 1274

Query: 557  LSCKSLRRHLGVVQQEPMLMSGSIKYNLT-YGLQSE-------------VSMDEIRSVAK 602
            L    LR  L ++ Q+P+L  G ++ NL  +  +S+              + DE  + A 
Sbjct: 1275 LGLYELRSKLAIIPQDPVLFKGDVRKNLDPFHERSDNELWDALVRAGAIATEDEAAARAV 1334

Query: 603  KCFCHGFVTKFPNGY-DTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVE 661
                 G +T     + +  +   G++ S G++Q +A+ RAL++  +ILILDEATS++D E
Sbjct: 1335 TRATAGALTNLHKFHLEQEVEEDGSNFSLGERQLLALTRALVRSSRILILDEATSSVDYE 1394

Query: 662  SEGAINYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVE 708
            ++  I   +       E T++ IAHRL+TI   + ++VL + G V E
Sbjct: 1395 TDAKIQARIADAF--SECTVLCIAHRLNTILDYDRILVL-DQGRVCE 1438

 Score = 76.6 bits (187), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 76/284 (26%), Positives = 128/284 (45%), Gaps = 35/284 (12%)

Query: 506 FNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRH 565
           F  LN  I  G  V + G  G GKS++ + +  +    SG I    ++ S L C      
Sbjct: 594 FKNLNIEIAKGELVIVTGSVGTGKSSLLAAMSGFMKKKSGDIY---KNGSLLLCGY---- 646

Query: 566 LGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIR--SVAKKCFCHGFVTKFPNGYDTIIGP 623
                  P + + ++K N+ +G       DE R     + C     +   P G  T IG 
Sbjct: 647 -------PWIQNTTVKDNILFG----SPFDEARYKETIRVCSLQADLDLLPAGDKTEIGE 695

Query: 624 RGASLSGGQKQRIAIARALMKKPKILILDEATSALDVE-SEGAINYTLGKLMKSKELTII 682
           RG +LSGGQK RI +AR++ KK  I + D+  SA+D    +  ++  +   +  K  T +
Sbjct: 696 RGITLSGGQKARINLARSVYKKKDIYLFDDVLSAVDARVGKHIMDECMMGALDGK--TRV 753

Query: 683 SIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQSELYKLL---------NDKKRD 733
              H+LS I R+  VI +  DG+ V+ G   +L + + +   KL+          ++ +D
Sbjct: 754 LATHQLSLIARASKVIFIDLDGT-VDSGTLDELKS-RHAGFVKLMEYSNHTSTDEEEGQD 811

Query: 734 KPTPRVQSDPEKDREQEHQIDNQVREQVANDFNL-DQKSSKLTP 776
                 ++ P   R Q     +++++QV+    L D++ SK  P
Sbjct: 812 GEVEHEENRPGPHRSQSEIEASELKKQVSKRSQLQDEQGSKGGP 855

>TBLA0A06840 Chr1 (1666910..1670086) [3177 bp, 1058 aa] {ON} Anc_5.10
            YGR281W possible pseudogene; NNN added to avoid internal
            stop codon; truncated at 5' end
          Length = 1058

 Score =  119 bits (299), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 134/560 (23%), Positives = 243/560 (43%), Gaps = 78/560 (13%)

Query: 208  SMYEFLGIFAGALVIGTVANFGRIVLLRVLGEKLVARLRSNVIRKIIHQDAEFFDRNKVG 267
            S YE  G+++  +V+  +    +  +   +G     +L    + K++H    F +   +G
Sbjct: 521  SFYE--GLYSLFIVLFFIFLVCQFCVCFFVGLNSSKKLNLRAVHKVLHTPMSFIESTPIG 578

Query: 268  DLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTSALLMFAP--PLLI 325
             +++R + D   +   +  NV   F                 I     L  FA   P LI
Sbjct: 579  RIMNRFTKDTDNLDGQILDNVRLTF-------YHMSTMFGICIMCIVYLPWFAIVIPFLI 631

Query: 326  GALIYG-----------KRIRMISRDLQESTGNLTRVSEEQLSGVKTIQSFVAEGKELQR 374
              +++            +R+  + R    +  N      + L G+  I+++  + + + +
Sbjct: 632  FTIVFIFNFYQGSSREIRRLEAVRRSFIFNNIN------DVLGGLDIIKAYQVQNRFIFK 685

Query: 375  YNTAIRKV----FLYGKKEALTNATFFSSTNVLGDLSFLIV--LAYGSHLVLQGGLTVGD 428
             +  I K     +LY   +   N       +++G L  LI+  L       + G  T G 
Sbjct: 686  SDYLINKTNEASYLYTGVQLWNNIL----VSIIGVLFALIISLLCVTKQFKISGSST-GV 740

Query: 429  LTAFMLYTEYTGSAVFGLSNFYSELMKGA----GAASRLFEMTDHAP----SIKPTAGKP 480
            L  ++L        +  + N+  + +K A     +  RL     + P    S KP     
Sbjct: 741  LLTYVL-------QIPNILNYLLDTLKKAENDMNSVERLVTYATNLPQERTSSKPETSPG 793

Query: 481  YV-PGSGKISFKDVSFSYPTRPG-NQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLR 538
            ++ P +GKI FKD +F Y  + G   I    N  ++ G  + I G +G GKSTI + L R
Sbjct: 794  HIWPENGKIQFKDANFRY--KEGLPLILKNFNMLVQSGEKIGICGRTGAGKSTIMNCLFR 851

Query: 539  YYNPSSGQITIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNL-------------T 585
                + G I IDD DIS L    LR++L ++ Q+P+L  G+I+ NL              
Sbjct: 852  LDELTDGAIYIDDIDISTLGLHDLRKNLSIIPQDPILFEGTIRKNLDPFSYFDDATLWEA 911

Query: 586  YGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKK 645
              L   +  D     ++K   +  +TKF       +   G + S G+KQ +A  RA++  
Sbjct: 912  MILSGFIDRDTFGHFSEKPVNNKELTKFH--LTAHVEEDGTNYSLGEKQLLAFTRAIIHH 969

Query: 646  PKILILDEATSALDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGS 705
             K+++LDEA+S++D E++  I   + K       TI+ IAHRL+TI + + ++VL + G+
Sbjct: 970  SKVVVLDEASSSVDYETDAKIQTLISKQFSHN--TILCIAHRLNTILKYDRILVL-DHGN 1026

Query: 706  VVEVGKFKDLYADQQSELYK 725
            ++     + L+  + +EL++
Sbjct: 1027 IIGFENPRVLF--ENNELFR 1044

 Score = 82.4 bits (202), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 68/214 (31%), Positives = 104/214 (48%), Gaps = 26/214 (12%)

Query: 506 FNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRH 565
           FN LNF+I  G  + I GP G GK+++   +        G I ID               
Sbjct: 205 FNNLNFSIX-GEFIIITGPIGTGKTSLLYAMSGLMKKLEGTIEID--------------- 248

Query: 566 LGVVQQ--EPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGP 623
            G +Q    P + + +++ N+ +G  S+   ++   V + C     +  F     T IG 
Sbjct: 249 -GNLQLCGYPWVQNTTVRDNIIFG--SKYEKEKFDHVIRICALTEDLENFSGKDLTEIGE 305

Query: 624 RGASLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAI--NYTLGKLMKSKELTI 681
            G +LSGGQK RI +ARA+ K   I + D+  SA+D      I  N  LG L  S +   
Sbjct: 306 LGITLSGGQKARINLARAIYKTSDIYLFDDILSAVDSRVGNFIMENCLLGAL--SGKTXX 363

Query: 682 ISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDL 715
           I   H+LS I++++ ++VLGND S  E+G +K+L
Sbjct: 364 ILATHQLSLIKKADRIVVLGNDNS-FEIGPYKEL 396

>CAGL0L06402g Chr12 (720723..725330) [4608 bp, 1535 aa] {ON} highly
            similar to uniprot|P39109 Saccharomyces cerevisiae
            YDR135c YCF1 or uniprot|P14772 Saccharomyces cerevisiae
            YLL015w BPT1
          Length = 1535

 Score =  119 bits (298), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 144/557 (25%), Positives = 251/557 (45%), Gaps = 64/557 (11%)

Query: 199  DLPPIVNDLSMYEFLGI-FAGALVIGTVANFGRIVLLRVLGEKLVARLRSNVIRKIIHQD 257
            D P  +  L++Y  LG+  A + +I TV  +   +   + G   +  L +N + +     
Sbjct: 1006 DNPHAIRYLAIYFALGVGSAFSTLIQTVILW---IFCTIHGSTYLHNLMTNAVFR---AP 1059

Query: 258  AEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTSALL 317
              FF+   +G +++R S+D Y V   + +  S  F                 I+ T+   
Sbjct: 1060 MSFFETTPIGRILNRFSNDIYKVDSILGRTFSQFF-----VNTVKVLFTIGVIAYTTWQF 1114

Query: 318  MFA-PPLLIGALIYGKRIRMISRDLQESTGNLTRVS-----EEQLSGVKTIQSFVAEGKE 371
            +F   PL I  + Y +     SR+L+    ++TR       +E L G+ TI+ +  + K 
Sbjct: 1115 VFVIVPLGIFYIYYQQYYLRTSRELRR-LESVTRSPIFSHFQETLGGLATIRGY-GQQKR 1172

Query: 372  LQRYNTAIRKVFLYGKKEALTNATFFSSTNVLGDLSFLIVLAYGSHLVLQGGLTVGDLTA 431
             +  N           +     + F+ S N    L++   L +   +++ G  T   L+ 
Sbjct: 1173 FEHINEC---------RVDNNMSAFYPSINANRWLAYR--LEFIGSVIILGAAT---LSI 1218

Query: 432  FMLYTEYTGSAVFGLSNFYS---------------ELMKGAGAASRLFEMTD---HAPSI 473
            F L      + + GLS  Y+               E+     +  R+ E ++    AP +
Sbjct: 1219 FKLRAGTMTAGMIGLSLSYALQITQTLNWIVRMTVEVETNIVSVERIKEYSELKSEAPLV 1278

Query: 474  KPTAGKPY-VPGSGKISFKDVSFSYPTR---PGNQIFNKLNFTIEPGSNVCIVGPSGRGK 529
              +   P   P +G+I F+     Y TR     + +   +N  I+P   + IVG +G GK
Sbjct: 1279 IESNRPPKEWPVAGEIKFE----HYYTRYREDLDYVLKDINLEIKPREKIGIVGRTGAGK 1334

Query: 530  STITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQ 589
            S++T  L R    +SG I ID   I+ +    LR HL ++ Q+  +  G+I+ N+    Q
Sbjct: 1335 SSLTLALFRIIEATSGGILIDGVHINEIGLHDLRHHLSIIPQDSQVFEGTIRENIDPTNQ 1394

Query: 590  SEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKIL 649
                 D  R++         +    +G  T++   G++LS GQ+Q + +ARAL+   K+L
Sbjct: 1395 F-TDADIWRALELSHLKEHIMQMGGDGLMTMMTEGGSNLSVGQRQLMCLARALLVPSKVL 1453

Query: 650  ILDEATSALDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEV 709
            +LDEAT+A+DVE++  I  T+    K +  TI++IAHR++TI  ++ +IVL + G VVE 
Sbjct: 1454 VLDEATAAVDVETDKVIQETIRTSFKDR--TILTIAHRINTIMDNDRIIVL-DKGKVVEF 1510

Query: 710  GKFKDLYADQQSELYKL 726
               + L  +  S  Y L
Sbjct: 1511 DTPEALLKNTNSIFYSL 1527

 Score = 88.2 bits (217), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 107/449 (23%), Positives = 195/449 (43%), Gaps = 48/449 (10%)

Query: 310 ISLTSALLMFAPPLLIGALIYGKRIRM------ISRDLQESTGNL----TRVSEEQLSGV 359
           + L S   +    + +G LI    I +      I ++LQ+S        TRV  E L+ +
Sbjct: 454 LCLISLYKLLGHSMWVGVLILTIMIPVNSFLMKIQKNLQKSQMKFKDERTRVISEILNNM 513

Query: 360 KTIQSFVAEGK-----ELQRYNTAIRKVFLYGKKEALTNATFFSSTNVLGDLSFLIVLAY 414
           K+++ +  E       E  R    ++ +   G   A T+  F +    L   S   V  Y
Sbjct: 514 KSLKLYAWEQPYKEKLEYVRNEKELKNLKKLGVYMACTSFQF-NIVPFLVSCSTFAVFVY 572

Query: 415 GSHLVLQGGLTVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHAPSIK 474
                L   L    LT F L +      +  + N  + +++ + + SRLF    +    K
Sbjct: 573 TEDKALTTDLVFPALTLFNLLS----FPLMVIPNVITAIIESSVSVSRLFNFLTNEELQK 628

Query: 475 PTAGK-PYVPGSGKISFK---DVSFSYPTRPGNQI-FNKLNFTIEPGSNVCIVGPSGRGK 529
               + P V   G ++     + +F +  +P  ++    +N+  + G   CIVG  G GK
Sbjct: 629 DAVQRLPKVKEIGDVAVNVGDNATFLWKRKPEYKVALKNINYQAKKGELSCIVGKVGSGK 688

Query: 530 STITSLLLRYYNPSSGQITIDDQDISRLS-CKSLRRHLGVVQQEPMLMSGSIKYNLTYGL 588
           S     LL               D+ R+    ++   +  V Q   +M+G+++ N+ +G 
Sbjct: 689 SAFLQSLL--------------GDLFRVKGFATIHGSVAYVSQVAWIMNGTVRDNVLFGH 734

Query: 589 QSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKI 648
           + +    E     K C     +    +G  T++G +G SLSGGQK R+++ARA+  +   
Sbjct: 735 KYDPEFYE--KTIKACALTIDLATLVDGDQTLVGEKGISLSGGQKARLSLARAVYARADT 792

Query: 649 LILDEATSALDVE-SEGAINYTLGK--LMKSKELTIISIAHRLSTIRRSENVIVLGNDGS 705
            +LD+  +A+D   S   + + LG   L+ SK  T I   +++S +  ++++ +L N G 
Sbjct: 793 YLLDDPLAAVDEHVSRHLVEHVLGPNGLLHSK--TRILATNKISVLSAADSITLLEN-GE 849

Query: 706 VVEVGKFKDLYADQQSELYKLLNDKKRDK 734
           + + G + D   D++S L KLL +  R +
Sbjct: 850 ITQQGTYADCRKDEESALGKLLKEFGRKE 878

>TDEL0G00330 Chr7 complement(58587..62984) [4398 bp, 1465 aa] {ON}
            Anc_5.10 YGR281W
          Length = 1465

 Score =  118 bits (296), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 85/250 (34%), Positives = 133/250 (53%), Gaps = 21/250 (8%)

Query: 483  PGSGKISFKDVSFSYPTRPGNQIFNK-LNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYN 541
            P  G+I F+DVSF+Y  RPG  +  K ++  I+    + I G +G GKSTI S L R   
Sbjct: 1199 PSKGEIVFEDVSFAY--RPGLPVVLKGISLDIKSQEKIGICGRTGAGKSTIMSALYRLNE 1256

Query: 542  PSSGQITIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQ------------ 589
             S G+I ID  DI ++    LR+ L ++ Q+P+L  G+I+ NL    +            
Sbjct: 1257 LSDGKIFIDSVDIGQIGLYDLRKKLSIIPQDPVLFRGTIRKNLDPFQEHPDELLWKSLVS 1316

Query: 590  -SEVSMDEIRSV-AKKCFCHGFVTKFPNGY-DTIIGPRGASLSGGQKQRIAIARALMKKP 646
               +S +E+  V  +K    G ++     + D  +   GA+ S G++Q +A+ RAL+++ 
Sbjct: 1317 GGAISAEEVEVVKGQKPDSIGSLSSMHKFHLDQKVEEEGANFSLGERQLLALTRALVRQS 1376

Query: 647  KILILDEATSALDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSV 706
            KILILDEATS++D E++  I   +       + TI+ IAHRL TI   + ++VL   G +
Sbjct: 1377 KILILDEATSSVDYETDNKIQSRIAAAF--GDCTILCIAHRLKTILTYDRILVL-EQGEI 1433

Query: 707  VEVGKFKDLY 716
             E    + LY
Sbjct: 1434 EEFDTPRSLY 1443

 Score = 96.3 bits (238), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 72/212 (33%), Positives = 102/212 (48%), Gaps = 22/212 (10%)

Query: 506 FNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRH 565
           F  LN  I+ G  V I GP G GKS++ S +  +   +SG + +D      L C      
Sbjct: 596 FKNLNIDIKKGDFVMITGPIGTGKSSLLSAMAGFMRKTSGTVEVDGD---LLMCGY---- 648

Query: 566 LGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRG 625
                  P + + +++ N+ +G  S    +    V + C     +   P G  T IG RG
Sbjct: 649 -------PWIQNATVRDNIIFG--SPYDKERFDEVVRVCSLKADIDILPGGELTEIGERG 699

Query: 626 ASLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAI--NYTLGKLMKSKELTIIS 683
            +LSGGQK RI +AR++ K   I + D+  SA+D      I     LG+L   K  T I 
Sbjct: 700 ITLSGGQKARINLARSVYKDKDIFLFDDVLSAVDSRVGKHIMDECLLGRL---KGKTRIL 756

Query: 684 IAHRLSTIRRSENVIVLGNDGSVVEVGKFKDL 715
             H+LS I ++  VIVLG DGS  E GK +DL
Sbjct: 757 ATHQLSLIEKASVVIVLGVDGS-FEAGKLEDL 787

>TBLA0C06400 Chr3 complement(1545011..1549144) [4134 bp, 1377 aa] {ON}
            Anc_5.10 YGR281W
          Length = 1377

 Score =  117 bits (294), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 128/533 (24%), Positives = 237/533 (44%), Gaps = 67/533 (12%)

Query: 207  LSMYEFLGIFAGALVIGTVANFGRIVLLRVLGEKLVARLRSNVIRKIIHQDAEFFDRNKV 266
            + MY F  +F G++V  T    G+  LL  +G +    L    + ++IH    F +   +
Sbjct: 841  MGMYSFF-VF-GSIVFLT----GQFSLLCYIGLRASKSLNLQAVNRVIHSPMWFMESTPM 894

Query: 267  GDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTSALLMFAPPLLIG 326
            G +++R + D    + S+   + D  +                + ++   +++ P   I 
Sbjct: 895  GRIMNRFTKD----TESLDNQILDNLRFVVYQACTI-------VGISVLCIIYLPWFAIA 943

Query: 327  ALIYGKRIRMISRDLQESTGNLTRVSEEQ-----------LSGVKTIQSFVAEGKELQRY 375
                G  + +     Q S   + R+   Q           L GV TI+++ AE +   + 
Sbjct: 944  IPGLGLILFVACSHYQSSAREIKRLEAVQRSFIYNHLNDVLGGVDTIRAYGAEERFSYKL 1003

Query: 376  NTAIRKV----FLYGKKEALTNATFFSSTNVLGDLSFLIV---LAYGSHLVLQGGLTVGD 428
            +  I K     +LY   +   N       N++G +SF ++   L       L G  T   
Sbjct: 1004 DYLIDKTNEASYLYTAVQRWINIVI----NLVG-ISFTLIVSLLCVTKVFNLSGASTGVV 1058

Query: 429  LTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHAPSIKPTAGKPYVPGSGKI 488
            L+  +L  +   + +  ++   +++       +   E+   A   +    K + P +G+I
Sbjct: 1059 LSYVLLIPDLLNNTLTMVTQTENDMNSVERLVTYATELPQEASHGEEVPSKTW-PENGEI 1117

Query: 489  SFKDVSFSYPTRPG-NQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQI 547
             F++V +++  R G   + +K    I  G  V I G +G GKST+   L R     SG++
Sbjct: 1118 KFENVRYTH--RDGLPAVLDKFTLKIAAGERVGICGRTGAGKSTVLGALYRLREVESGRV 1175

Query: 548  TIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLT-YGLQSEVSMDEIRSVAKKCFC 606
             IDD D+S+L+  +LR  L ++ Q+P+L  GS+++NL  +G   E   D +++   +C  
Sbjct: 1176 MIDDVDVSKLNLTALRSRLAIIPQDPVLFQGSVRHNLDPFG---EYDDDVLKNALMRCTV 1232

Query: 607  -----------HGFVTKFPNG------YDTIIGPRGASLSGGQKQRIAIARALMKKPKIL 649
                        G  T   NG       D  +   G + S G++Q +A+ARAL++   IL
Sbjct: 1233 GKFNKTGNESTEGIDTDADNGLVGKFRLDQDVEENGCNFSVGERQVLALARALIRNSSIL 1292

Query: 650  ILDEATSALDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGN 702
            +LDEAT+A+D  ++  +   + +  K +  T++ +AHRL TI   + ++VL N
Sbjct: 1293 VLDEATAAVDAATDAHVQRLVAEAFKGR--TVLCVAHRLDTILNYDRILVLEN 1343

 Score =  104 bits (260), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 118/479 (24%), Positives = 216/479 (45%), Gaps = 72/479 (15%)

Query: 314 SALLMFAPPLLIGALIYGKRIRMISRDLQESTGNLTRVSEEQLSGVKTIQSFVAEGKELQ 373
           S + +F   +++   ++G  ++M   ++ + T     +  E L+ +K ++ +  E    Q
Sbjct: 329 SGVGLFFVTIIVVIFLFGIVMKM-RLNINQVTDQRVSILREVLNNIKMVKLYCWE----Q 383

Query: 374 RYNTAIRKV-----FLYGKKEALTNATF---FSSTNVLGDLSFLIVLAYGSHLVLQGGLT 425
            Y  +I+K+         + E L N  F   FS  N+   ++FL +        + GGL 
Sbjct: 384 AYEKSIKKIRSLETSKLTRMEILKNVIFSVTFSLPNICSLMTFLALFK------IHGGLK 437

Query: 426 VGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAG-----AASRLFEMTDHAPS-----IKP 475
                A  +++  +   +  L +FY  L  G       +  R  E  +   S     I+ 
Sbjct: 438 ----NAATIFSSLSLFKILSLLSFYIPLSLGTAIDIVTSLDRFQEFLEAEESKETRIIRE 493

Query: 476 TAGKPYVPGSGKISFKDVSFSYPTRPGNQI-------FNKLNFTIEPGSNVCIVGPSGRG 528
           T  + Y   +  I     SF + T   +         F+ LNF I  G  + IVGP G G
Sbjct: 494 TNSEIYGDNTVAIKASHCSFRWDTEEKDNNEEKEFSGFHDLNFEIMKGELIIIVGPIGSG 553

Query: 529 KST----ITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNL 584
           K++    I  L+ +Y N   G++ +D    S +SC             P + + +++ N+
Sbjct: 554 KTSLLNAICGLMPQYGN--EGELEVDG---SLVSCGY-----------PWIQNTTVRDNI 597

Query: 585 TYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYD-TIIGPRGASLSGGQKQRIAIARALM 643
            +G  S+    + + V + C     + K  + YD T IG RG +LSGGQK RI +AR+L 
Sbjct: 598 LFG--SKYDESKFKRVIRMCSLEEDLEKL-SAYDMTEIGERGVTLSGGQKSRINLARSLY 654

Query: 644 KKPKILILDEATSALDVE-SEGAINYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGN 702
           K+  I + D+  SA+D    +  +   L + +K+K  T +   H+LS I +++ +IVLGN
Sbjct: 655 KEKDIYLFDDILSAVDSRVGQSIMKECLMEGLKNK--TRVLATHQLSLIGKADQLIVLGN 712

Query: 703 DGSVVEVGKFKDLYADQQSELYKLLNDKKRDKPTPRVQSDPEKDREQEHQIDNQVREQV 761
           DG   ++G+++DL    ++    L+N  +  K    +Q   E  +++  + +  + E +
Sbjct: 713 DGK-FDMGRYEDLIKTNET----LINLMQYAKLQEEIQEKEEVIKDKNEKTETTISENL 766

>TBLA0C07100 Chr3 (1721628..1726085) [4458 bp, 1485 aa] {ON} 
          Length = 1485

 Score =  117 bits (293), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 138/546 (25%), Positives = 235/546 (43%), Gaps = 70/546 (12%)

Query: 212  FLGIFAGALVIGTVANFGRIVLLRVLGEKLVARLRSNVIRKIIHQDAEFFDRNKVGDLIS 271
            ++G+++  +    +   G+  LL  +G      L    + KI+H    F D N +G +++
Sbjct: 943  YMGLYSFFVFGSYIFMNGQYTLLCYMGVVASKTLNLQALHKILHTPMSFMDTNPLGRILN 1002

Query: 272  RLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTSALLMFAPPLLIGALIYG 331
            R + D   +   +T+N+                    +I    A+ +   P    A+ + 
Sbjct: 1003 RFTKDTDALDNELTENLR------------LAMSQIANIIGVGAMCIIYLPWFAIAIPFL 1050

Query: 332  KRIRMISRDLQESTGNLTRVSE------------EQLSGVKTIQSFVAEGKELQRYNTAI 379
              I ++  D  +STG   +  E            E L+G+ TI+++ A+ +       A 
Sbjct: 1051 LLIFLLIADHYQSTGREVKRLEAIQRSFVYNNLNEMLTGMDTIKAYNAQDR------FAT 1104

Query: 380  RKVFLYGKKEALTNATFFSSTNVLGDLSFLIVLAYGSHLVLQ----------GGLTVGDL 429
            +  FL  K   +  A + S         FL ++A    L++            G   G L
Sbjct: 1105 KSEFLIDK---MNEAAYISIAVQRWAGIFLDLVAVAFALIITLLCVTRQFHISGADTGVL 1161

Query: 430  TAFMLYTEYTGSAVF-GLSNFYSELMKGAGAASRLFEMTDHAPSIKPTAGKPY-VPGSGK 487
              ++L      + V   L+   +++       S   ++   A   KP    P   P +G 
Sbjct: 1162 LTYVLQLPGLLNTVLRALTQTENDMNSTERLVSYATQLPQEAQYRKPECSPPIDWPQNGH 1221

Query: 488  ISFKDVSFSYPTRPGNQIFNK-LNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQ 546
            I F++++F+Y  RPG  I  K  N  I+P   + I G +G GKSTI + L R    ++G+
Sbjct: 1222 IVFENINFAY--RPGLPIILKNFNLIIKPNEKIGICGRTGAGKSTIMNALYRLTELTTGK 1279

Query: 547  ITIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNL----------------TYGLQS 590
            I IDD DIS L    LR  L ++ Q+P+L  G+I+ NL                  G   
Sbjct: 1280 IIIDDIDISNLGLYELRSKLAIIPQDPVLFRGNIRRNLDPFDEYQDDLLWESLVKAGAID 1339

Query: 591  EVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILI 650
               ++ ++S  K       + KF    +  +   G + S G++Q +A+ RAL+++ KILI
Sbjct: 1340 SQELETVKSQDKNSDAKN-LHKF--HLNQSVDEDGNNFSLGERQVLALTRALVRQSKILI 1396

Query: 651  LDEATSALDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVG 710
            LDEATS++D E++  I   +         TI+ IAHRL TI   + ++VL   G V E  
Sbjct: 1397 LDEATSSVDYETDAKIQNLIATAF--NHCTILCIAHRLKTILNYDRILVL-EKGEVAEFD 1453

Query: 711  KFKDLY 716
               +L+
Sbjct: 1454 TPWNLF 1459

 Score = 82.4 bits (202), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 61/214 (28%), Positives = 102/214 (47%), Gaps = 21/214 (9%)

Query: 505 IFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRR 564
           + + +NFTI  G  V + GP G GK+++   L       SG++   +     L C     
Sbjct: 624 LLSNINFTIPKGEFVVVTGPVGSGKTSLLFALAGLMEQLSGEM---NHSGDLLLC----- 675

Query: 565 HLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPR 624
             G+    P + + +I+ N+ +G   + +    + V   C     +   P    T +G R
Sbjct: 676 --GI----PWVQNATIRDNILFGSPYDPTF--YKRVLHVCALESDLENLPAHDKTEVGER 727

Query: 625 GASLSGGQKQRIAIARALMKKPKILILDEATSALDVE-SEGAINYTLGKLMKSKELTIIS 683
           G +LSGGQK RI++ARA+ K   I + D+  SA+D       ++Y +   +  K  T I 
Sbjct: 728 GVTLSGGQKARISLARAVYKNKDIYLFDDVLSAVDARVGRHIMDYCMNDHLSDK--TRIL 785

Query: 684 IAHRLSTIRRSENVIVLGN--DGSVVEVGKFKDL 715
             H+LS + +++ +IVL    D    E+G FK+L
Sbjct: 786 ATHQLSLVEKADRIIVLSTSKDAPHFEIGTFKEL 819

>Zrou_YGOB_Anc_5.10 Chr3 complement(92067..95045) [2979 bp, 992 aa]
           {ON} ANNOTATED BY YGOB -
          Length = 992

 Score =  114 bits (284), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 131/526 (24%), Positives = 224/526 (42%), Gaps = 58/526 (11%)

Query: 230 RIVLLRVLGEKLVARLRSNVIRKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVS 289
           +  +L  LG      L    ++ I+H    F D   +G +++R + D    + SM   ++
Sbjct: 467 QFTVLCFLGVTASKFLNLKAVKGILHTPLSFMDTTPLGRILNRFTKD----TDSMDNELT 522

Query: 290 DGFKAXXXXXXXXXXXXXXSISLTSALLMFAPPLLIGALIYG----------KRIRMISR 339
           +  +                I       +  P LLI  ++            KR+  + R
Sbjct: 523 EDIRLMMFQLGNIIGVIVMCIVYLPWFAIAVPFLLIMFVMIADHYQSSGREVKRLEAVQR 582

Query: 340 DLQESTGNLTRVSEEQLSGVKTIQSFVAEGKELQRYNTAIRKVFLYGKKEALTN---ATF 396
               +  N      E L G+ TI+++ ++ + L + +  I K+   G   A      A F
Sbjct: 583 SFVYNNLN------EVLGGLDTIRAYRSQDRFLVKSDFLINKMNEAGYMVAALQRWVAIF 636

Query: 397 FSSTNVLGDLSFLIVLAYGSHLVLQGGLTVGDLTAFMLYTEYTGSAVFGLSNFYSELMKG 456
                V+   + +I L   +        + G L  ++L      + V       ++   G
Sbjct: 637 LDMLAVI--FALIITLLCVTRQFKISPSSTGVLLTYVLQLPGLLNTVL---RALTQAENG 691

Query: 457 AGAASRL----FEMTDHAPSIKPTAGKPY-VPGSGKISFKDVSFSY-PTRPGNQIFNKLN 510
             +A RL     ++   A   +P    P   P  G+I F+ VSF+Y P+ P   +    +
Sbjct: 692 MNSAERLVTYALDLPQEAEYRRPEMSPPENWPDRGEIKFEGVSFAYRPSLP--PVLKNFS 749

Query: 511 FTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRHLGVVQ 570
             I  G  + I G +G GKSTI S L R      G+I ID+ +I+ L    LR  L ++ 
Sbjct: 750 LNIGSGEKIGICGRTGAGKSTIMSALYRINEVIDGKIFIDNINIADLGLFELRSKLAIIP 809

Query: 571 QEPMLMSGSIKYNLT-YGLQSEVSMDE--IRSVA--------------KKCFCHGFVTKF 613
           Q+P+L  G+IK NL  +G +++  + E  +R  A                   H  + KF
Sbjct: 810 QDPVLFRGTIKKNLDPFGEKTDQELWESLVRGGAIAPEDIEETKAQQPDASGSHSKMHKF 869

Query: 614 PNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKL 673
               +  +   G + S G+KQ +A+ RAL++  +ILILDEATS++D E++  I   + + 
Sbjct: 870 --HLEQKVEEEGGNFSLGEKQLLALTRALVRNSRILILDEATSSVDYETDDKIQSRIVEA 927

Query: 674 MKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQ 719
               + TI+ IAHRL+TI   + ++VL   G V E     +L+  +
Sbjct: 928 F--GDCTILCIAHRLNTILNYDRILVL-EQGEVAEFDTPWNLFTKE 970

 Score = 99.4 bits (246), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 77/276 (27%), Positives = 136/276 (49%), Gaps = 32/276 (11%)

Query: 506 FNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRH 565
           F  LNF I+ G  + + GP G GK+++ S +  +   S G + ++ +    LSC      
Sbjct: 106 FQNLNFDIKKGEFIIVTGPIGTGKTSLLSAMAGFMARSGGSVEVNGR---LLSCGY---- 158

Query: 566 LGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRG 625
                  P + + +++ N+ +G   E +  + R V K C     +   P G  T IG RG
Sbjct: 159 -------PWIQNATVRDNIIFGSPYEKA--KYRKVIKACSLDSDLEILPAGDMTEIGERG 209

Query: 626 ASLSGGQKQRIAIARALMKKPKILILDEATSALDVE-SEGAINYTLGKLMKSKELTIISI 684
            +LSGGQK RI +AR + K   I + D+  SA+D    +  ++  L  L+  K  T I  
Sbjct: 210 INLSGGQKARINLARCVYKDKDIYLFDDVLSAVDARVGKHIMDECLLGLLGQK--TRILA 267

Query: 685 AHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQSELYKLL-----------NDKKRD 733
            H+L+ I ++  +IVLGNDGS   +G +++L     S+L KLL           ND+K++
Sbjct: 268 THQLALIEKATRLIVLGNDGSFT-IGTYEEL-QKSNSQLKKLLQFTSDKSEEDDNDQKQN 325

Query: 734 KPTPRVQSDPEKDREQEHQIDNQVREQVANDFNLDQ 769
           +    V ++  +  +++ +I    + +  ++ N ++
Sbjct: 326 ENDKEVHAEDLEGLDEKAKIGEVAKYEGEDEMNWEE 361

>KLTH0B09724g Chr2 complement(796023..800483) [4461 bp, 1486 aa] {ON}
            similar to uniprot|P53049 Saccharomyces cerevisiae
            YGR281W YOR1 Plasma membrane transporter of the ATP-
            binding cassette (ABC) family mediates export of many
            different organic anions including oligomycin
          Length = 1486

 Score =  112 bits (280), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 135/555 (24%), Positives = 226/555 (40%), Gaps = 84/555 (15%)

Query: 212  FLGIFAGALVIGTVANFGRIVLLRVLGEKLVARLRSNVIRKIIHQDAEFFDRNKVGDLIS 271
            ++G++   +         +  L+  +G     RL    +++++H    F D   +G +++
Sbjct: 943  YMGMYTFFVFFNYFVTTSQFSLICYIGLSAAKRLNLKAVQRLLHTPMSFLDTTPIGRVLN 1002

Query: 272  RLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTSALLMFAPPLLIGALIYG 331
            R + D   V   +T++V                     + +    +++ P   I      
Sbjct: 1003 RFTKDTDTVDTELTESVR-----------LFVFQLSNIVGVIVMCIIYLPWFAIAVPFLM 1051

Query: 332  KRIRMISRDLQESTGNLTRVSEEQLSGVKTIQSFVAEGKELQRYNTAIRKVFLYGKKEAL 391
                 ++   Q S+  + R+   Q S V    + V  G +  R   A R     G++  L
Sbjct: 1052 LVFVGVADHYQSSSREIKRLEAVQRSHVFNNFNEVLGGMDTIR---AYR-----GERRFL 1103

Query: 392  TNATFFSSTNVLGDLSFLIV------------LAYGSHLVLQ----------GGLTVGDL 429
            T + F   TN + +  +L+V            +A    L++              +VG L
Sbjct: 1104 TKSDFL--TNKMNEAGYLVVAIQRWVAIALDMIAMAFALIVTLLCVTRQFHISAASVGVL 1161

Query: 430  TAFMLYTEYTGSAVFGLSNFYSELM----KGAGAASRLF----EMTDHAPSIKPTAGKPY 481
              ++L        + GL N     M        +  RL     E+   A   +P    P 
Sbjct: 1162 LTYVL-------QLPGLLNMLLRAMTQGENDMNSTERLISYATELPLEAAYRRPEMSPPA 1214

Query: 482  -VPGSGKISFKDVSFSYPTRPG-NQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRY 539
              P  G+I F  VS +Y  RPG   +   +   +  G  + I G +G GKSTI S L R 
Sbjct: 1215 EWPTDGRIEFDHVSLAY--RPGLPLVLKDVTLHVAAGEKIGICGRTGAGKSTIMSALYRM 1272

Query: 540  YNPSSGQITIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEI-- 597
                 G ITID  DIS L    LR  L ++ Q+P++  G ++ NL      E + DE+  
Sbjct: 1273 CELHDGSITIDGVDISTLGLYDLRSKLSIIPQDPVMFKGDVRKNLDPF--HERTDDELWH 1330

Query: 598  ----------RSVAK-KCFCHGFVTKFPNGY----DTIIGPRGASLSGGQKQRIAIARAL 642
                       S+A  +   H       N +       +   G + S G++Q +A+ RAL
Sbjct: 1331 ALVRGGAIPAESLATVRAQTHENAGSLSNMHKFHLQQEVEEDGTNFSLGERQLLALTRAL 1390

Query: 643  MKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGN 702
            +++ KILILDEATS++D E++  I   + +   +   TI+ IAHRL+TI   + ++VL +
Sbjct: 1391 VRQSKILILDEATSSVDYETDAKIQTRIVEAFSN--CTILCIAHRLNTILDYDRILVL-D 1447

Query: 703  DGSVVEVGKFKDLYA 717
             G V E      LYA
Sbjct: 1448 QGRVCEFDTPAALYA 1462

 Score = 84.7 bits (208), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 82/289 (28%), Positives = 128/289 (44%), Gaps = 39/289 (13%)

Query: 506 FNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRH 565
           F+ LN  I  G  V + G  G GKS++   L  +   + G I    +D + L C      
Sbjct: 603 FDNLNIQITKGELVIVTGSVGTGKSSLLYALSGFMKKTGGDIY---KDGTMLLCGY---- 655

Query: 566 LGVVQQEPMLMSGSIKYNLTYGL-QSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPR 624
                  P + + +++ N+ +G   +E   +EI  V   C     +   P G  T IG R
Sbjct: 656 -------PWIQNATVRDNILFGSPYNEARYNEIIRV---CSLQADLELLPAGDRTEIGER 705

Query: 625 GASLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAI--NYTLGKLMKSKELTII 682
           G +LSGGQK RI +ARA+ KK  I + D+  SA+D      I     +GKL  S   T +
Sbjct: 706 GITLSGGQKARINLARAVYKKKDIYLFDDVLSAVDARVGKHIMDECLMGKLEGS---TRV 762

Query: 683 SIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQS--ELYKLLNDKKRDKPTPRVQ 740
              H+LS I R+  VI +  DGS V+VG  ++L   +     L +  N  + +K    V+
Sbjct: 763 LATHQLSLIARASKVIYIDLDGS-VDVGSVEELKKRKPGFVNLMQYSNHSESEKKPGEVE 821

Query: 741 SD-------------PEKDREQEHQIDNQVREQVANDFNLDQKSSKLTP 776
            +             PE D  Q     +++++QV+    L  +   + P
Sbjct: 822 EEKRQEAGAGAQPVRPEIDSRQSELEASELKKQVSKRSQLQDEQKGVAP 870

>AGL346W Chr7 (61232..65434) [4203 bp, 1400 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YGR281W (YOR1)
          Length = 1400

 Score =  111 bits (277), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 78/243 (32%), Positives = 129/243 (53%), Gaps = 19/243 (7%)

Query: 487  KISFKDVSFSYPTRPGNQI-FNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSG 545
            +I F++VSF+Y  RPG  +    ++F +  G  + I G +G GK+++T+ L R     SG
Sbjct: 1144 EIVFQEVSFAY--RPGLPLALCGVSFHVRAGEKIGICGRTGAGKTSVTTALYRLSELESG 1201

Query: 546  QITIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNL------TYG-LQSEVSMDEIR 598
             I ID  DI+ L    LR  L ++ Q+P+L  G+++ NL      T G L S +    + 
Sbjct: 1202 SIKIDGVDIATLGLHDLRSALSIIPQDPLLFRGTVRKNLDPFAEHTDGTLWSALVRSGVV 1261

Query: 599  SVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSAL 658
                    H F        D  +   GA+ S G++Q +A+ARAL++  +ILILDEATS++
Sbjct: 1262 PAGVVPTSHKF------HLDQEVDEGGANFSLGERQLLALARALVRSTRILILDEATSSV 1315

Query: 659  DVESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYAD 718
            D  ++  +   +    + ++ T++ +AHRL TI   + ++VL + G V E      L+A 
Sbjct: 1316 DYATDARVQARIAA--EFRQATVLCVAHRLRTIISYDRILVL-DQGRVAEFDTPYRLFAR 1372

Query: 719  QQS 721
            + S
Sbjct: 1373 KDS 1375

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 80/296 (27%), Positives = 140/296 (47%), Gaps = 47/296 (15%)

Query: 506 FNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRH 565
            N L F+I+ G  + ++G  G GK+++ + +  Y   ++G + ++    S L C      
Sbjct: 551 LNDLLFSIKKGEFIIVIGAIGTGKTSLLNAVAGYMKKTTGSVHVNG---SLLFC------ 601

Query: 566 LGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIR--SVAKKCFCHGFVTKFPNGYDTIIGP 623
            GV    P + + +I+ N+ +G     S D+ R   V   C        FP G  T +G 
Sbjct: 602 -GV----PWIQNATIRDNIIFG----SSFDQTRYDEVVNACALEADFKIFPAGDKTEVGE 652

Query: 624 RGASLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTIIS 683
           RG +LSGGQK RI++ARA+ K   I + D+  SA+D      I      L + +  T I 
Sbjct: 653 RGITLSGGQKARISLARAIYKDRDIYLFDDIISAVDANVAAHITQKC-LLDRLQNRTRIL 711

Query: 684 IAHRLSTIRRSENVIVLGNDGSVVEVG----------KFKDLYA------DQQSELYKLL 727
             H+L+ ++ +  VI LG DGS  ++G          +F++L +       ++SE+  + 
Sbjct: 712 ATHQLALVQEASRVIFLGQDGS-FDMGTPAELHEKNPQFRNLMSLSSQTNAEESEMESIR 770

Query: 728 NDKKRDKPTPRVQSDPEKDRE--------QEHQIDNQVREQVANDFNL-DQKSSKL 774
           +  K  K +    S P+ + E        +E +  N ++ +V  D+ +  +KSSK+
Sbjct: 771 SQSKSKKASTAPVSMPDFNEEIDDGRITSKEERAVNALKFKVYKDYLMAGEKSSKM 826

>TBLA0A03800 Chr1 complement(947158..951798) [4641 bp, 1546 aa] {ON}
           Anc_8.303 YDR135C
          Length = 1546

 Score =  105 bits (262), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 111/464 (23%), Positives = 210/464 (45%), Gaps = 64/464 (13%)

Query: 332 KRIRMISRDLQESTGNLTRVSEEQLSGVKTIQSFVAEGK-----ELQRYNTAIRKVFLYG 386
           ++I+M ++D +      TR+  E L+ +K+++ +  E       E  R    ++ +   G
Sbjct: 457 QKIQMKNKDER------TRLISEILNNIKSLKLYAWEAPYKEKLEYVRNEKELKNLTKMG 510

Query: 387 KKEALTNATFFSSTNVLGDLSFLIVLAYGSHLVLQGGLTVGDLTAFMLYTEYTGSAVFGL 446
              A T+  F +    L   S   V  +     L   L    LT F L +    +    +
Sbjct: 511 CYVAFTHFQF-NIVPFLVSCSTFAVFVWTQDRPLTTDLVFPALTLFNLLSFPMAAIPIMI 569

Query: 447 SNFYSELMKGAGAASRLFEMTDHAPSIKPTAGK-PYVPGSGKISFK---DVSFSYPTRPG 502
           ++F    ++ + + +RLF    +    K    + P V  +G +S K   D +F +  +P 
Sbjct: 570 TSF----IEASISINRLFSFLTNEELQKDAVQRLPNVKNTGDVSIKLGDDATFLWKRKPE 625

Query: 503 NQI-FNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLS-CK 560
            ++    +NF    G   CIVG  G GKS +   +L               D+ R+    
Sbjct: 626 YKVALKNINFQARKGELTCIVGKVGSGKSALIQSIL--------------GDLFRVKGFA 671

Query: 561 SLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTI 620
           ++   +  V Q P +M+G++K N+ +G + +    E     K C     ++  P+G  T+
Sbjct: 672 TVHGDVAYVSQVPWIMNGTVKENILFGHKFDKKFYE--KTIKACALTIDLSILPDGDSTL 729

Query: 621 IGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGA--INYTLG------- 671
           +G +G SLSGGQK R+++ARA+  +    + D+  +A+D E  G   I + LG       
Sbjct: 730 VGEKGISLSGGQKARLSLARAVYARADTYLFDDPLAAVD-EHVGKHLIEHVLGPNGLLHS 788

Query: 672 --KLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQSELYKLLND 729
             K++ + ++T+++IA          + I L ++G +++ GK++++ +D  S L KL+N+
Sbjct: 789 KTKVLATNKITVLNIA----------DYITLLDNGEIIQRGKYEEVTSDPGSPLCKLINE 838

Query: 730 ---KKRDKPTPRVQSDPEKDREQEHQIDNQVRE-QVANDFNLDQ 769
              K    P   V S   K+      +++++RE    +D +L Q
Sbjct: 839 YGKKHESTPGTMVSSSMSKEPSPNVPLEDELRELHKLDDLDLAQ 882

 Score = 78.2 bits (191), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 71/112 (63%), Gaps = 3/112 (2%)

Query: 615  NGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLM 674
            N  +T +   G++LS GQ+Q + +ARAL+    IL+LDEAT+A+DVE++  I  T+    
Sbjct: 1424 NALNTKLSEGGSNLSVGQRQLMCLARALLVPSNILVLDEATAAVDVETDQLIQETIRSAF 1483

Query: 675  KSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQSELYKL 726
            K++  TI++IAHRL+TI  S+ ++VL + G + E    + L  D+ S  Y L
Sbjct: 1484 KNR--TILTIAHRLNTIMDSDRILVL-DKGEIKEFDSPQTLLGDKDSLFYSL 1532

 Score = 67.0 bits (162), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 88/405 (21%), Positives = 165/405 (40%), Gaps = 60/405 (14%)

Query: 212  FLGIFAGALVIGTVANFGRIVLLRVL----GEKLVARLRSNVIRKIIHQDAEFFDRNKVG 267
            +LGI+        ++   + V+L V     G K+   L S ++  ++     FF+   +G
Sbjct: 975  YLGIYFALGFSSALSQLLQTVILWVFCTIHGSKI---LHSQMLASVLRAPMSFFETTPIG 1031

Query: 268  DLISRLSSDAYVVS----RSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTSALLMFAPPL 323
             +++R S+D Y V     R+ +Q  S+  K                   T   + F  P+
Sbjct: 1032 RILNRFSNDMYKVDELLGRTFSQFFSNAVKVTFTLVVICVS--------TWQFIFFIVPM 1083

Query: 324  LIGALIYGKRIRMISRDLQ--ESTGNLTRVS--EEQLSGVKTIQSFVAEGKELQRYNTAI 379
                + Y +     SR+L+  +S      +S  +E L G+ TI+ +  E +         
Sbjct: 1084 SFLYIYYQQYYMRTSRELRRLDSVTRSPTISHFQETLGGISTIRGYSQENR--------- 1134

Query: 380  RKVFLYGKKEALTN--ATFFSSTNVLGDLSF-------LIVLA---YGSHLVLQGGLTVG 427
               F++  ++ + N  + ++ S N    L+F       +I+L     G + + QG +T G
Sbjct: 1135 ---FIHINQQRVDNNMSAYYPSINCNRWLAFRLEFLGSVIILGASTLGIYRLSQGNMTPG 1191

Query: 428  DLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRL---FEMTDHAPSIKPTAGKPYV-- 482
             +   + Y      ++  +     E+     +  R+    E+   APSI     +P V  
Sbjct: 1192 MIGLSLSYALQITQSLNWIVRMTVEVETNIVSVERIKEYSELASEAPSIVEDK-RPDVNW 1250

Query: 483  PGSGKISFKDVSFSYPTR---PGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRY 539
            P  G + F      Y TR     + +   +   I+P   + IVG +G GKS++T  L R 
Sbjct: 1251 PQDGAVKFNH----YYTRYRADLDYVLKDITLDIKPREKIGIVGRTGAGKSSLTLALFRI 1306

Query: 540  YNPSSGQITIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNL 584
               S G I +D  +   +    LR  L ++ Q+  +  G+++ N+
Sbjct: 1307 IEASEGNINVDGINTDEIGLYDLRHKLSIIPQDSQVFEGTVRDNI 1351

>Ecym_5660 Chr5 complement(1331316..1335926) [4611 bp, 1536 aa] {ON}
           similar to Ashbya gossypii AGL346W
          Length = 1536

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 73/257 (28%), Positives = 123/257 (47%), Gaps = 27/257 (10%)

Query: 506 FNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRH 565
           F+ L+F ++ G  + I G  G GK+++ + L  + + ++G I  + +    L C +    
Sbjct: 590 FSDLSFEVKKGELLVITGAIGTGKTSLLNALAGFMHKTNGDIQYNGR---MLFCGA---- 642

Query: 566 LGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRG 625
                  P + + +I+ N+T+G  S    +  R V + C     ++  P G  T +G RG
Sbjct: 643 -------PWIQNATIRDNITFG--SPYDENLYREVMRVCSLDRDMSVLPAGDKTEVGERG 693

Query: 626 ASLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAI--NYTLGKLMKSKELTIIS 683
            +LSGGQK RI +AR + K   I + D+  SA+D     +I  +  LGKL    + T I 
Sbjct: 694 ITLSGGQKARINLARCVYKVRDIYLFDDILSAVDARVGASIMNDCLLGKL---GDKTRIL 750

Query: 684 IAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYAD--QQSELYKLLNDKKRDKPTPRVQS 741
             H++S   ++  VI LG DGS  ++G   +L     Q + L KL +  + +     + S
Sbjct: 751 ATHQISLTEQASRVIYLGTDGS-FDIGTVDELKTRNVQFANLMKLASQTESESKDDNISS 809

Query: 742 ---DPEKDREQEHQIDN 755
              D E    Q  Q+D+
Sbjct: 810 EKFDREDQLRQLQQLDD 826

 Score = 85.5 bits (210), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 95/418 (22%), Positives = 175/418 (41%), Gaps = 63/418 (15%)

Query: 207  LSMYEFLGIFAGALVIGTVANFGRIVLLRVLGEKLVARLRSNVIRKIIHQDAEFFDRNKV 266
            + MY F   F  A  + T   F    L+  LG +    +    + +++H    F D   +
Sbjct: 922  MGMYFF---FVMANYLSTNIQFS---LVSYLGLRASKNINLQSLHRLLHVPVSFIDTTPL 975

Query: 267  GDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSISLTSALLMFAPPLLIG 326
            G +++R + D  ++   +T+++    +               SI       ++ P   + 
Sbjct: 976  GRILNRFTKDTDILDNELTESL----RMFSYQFTVIWGVIIMSI-------IYLPWFAVA 1024

Query: 327  ALIYGKRIRMISRDLQESTGNLTRVS-----------EEQLSGVKTIQSFVAEGKELQRY 375
              +      ++S   Q S   + R+             E +SGV TI+++ AE + L++ 
Sbjct: 1025 VPLLVVVFILVSDHYQCSAREIKRLEAVQRSFVLNNFNEVISGVDTIKAYHAEARFLKKS 1084

Query: 376  NTAIRKVFLYGKKEALTNATF--FSSTNVLGDLSFLIVLAYG---SHLVLQGGLTVGDLT 430
            +  I +         +   TF  ++S   +  L  +I + +    S L + G   +   +
Sbjct: 1085 DILIDR---------MNEMTFPLYASQRWVSILIGMIAVLFALIISILCVTGWFNISPAS 1135

Query: 431  AFMLYTEYTGSAVFGLSNFYSELMKGA-------GAASRLFEMTDHAPSIKP-----TAG 478
              +L T      V  L N ++ L++          +A R+    +  P   P      A 
Sbjct: 1136 TGVLLT-----YVLQLPNLFNTLLRAMTQLENDMNSAERVLSYANSLPKEAPYRIPEMAP 1190

Query: 479  KPYVPGSGKISFKDVSFSYPTRPG-NQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLL 537
                P  G I+F +V+ +Y  RPG   +   ++F I  G  + I G +G GKSTIT+ L 
Sbjct: 1191 PKAWPERGAITFDNVALAY--RPGLPLVLQDVSFHISSGEKIGICGRTGAGKSTITNALY 1248

Query: 538  RYYNPSSGQITIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLT-YGLQSEVSM 594
            R    S+G +TID  DI+ +   +LR  L ++ Q+P+L  G+I+ NL  +G  S+  +
Sbjct: 1249 RLVELSNGSVTIDGVDIATIGLYNLRSKLSIIPQDPLLFRGTIRKNLDPFGEHSDTEL 1306

 Score = 67.8 bits (164), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 39/113 (34%), Positives = 70/113 (61%), Gaps = 4/113 (3%)

Query: 618  DTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSK 677
            D  +   G++ S G++Q +A+ARAL+++ KILILDEATS++D E++  I   +  + + +
Sbjct: 1418 DQTVEEDGSNFSVGERQFLALARALVRQTKILILDEATSSVDYETDAQIQARI--VQEFQ 1475

Query: 678  ELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQSELYKLLNDK 730
              TI+ +AHRL TI   + ++V+   G V E      LY ++Q  +++ + D+
Sbjct: 1476 HATIMCVAHRLKTILHYDRILVM-EKGRVAEFDTPLRLY-NEQGSIFRSMCDQ 1526

>YKR103W Chr11 (653080..656736) [3657 bp, 1218 aa] {ON}
           NFT1Putative transporter of the multidrug
           resistance-associated protein (MRP) subfamily; adjacent
           ORFs YKR103W and YKR104W are merged in different strain
           backgrounds.
          Length = 1218

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 57/186 (30%), Positives = 90/186 (48%), Gaps = 6/186 (3%)

Query: 548 TIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCH 607
           T++ +D   +    +   +    Q P L+SG+IK N+ +G     +  +   V K C   
Sbjct: 714 TVESRDDLEIGKDGMTNSMAYCSQTPWLISGTIKDNVVFG--EIFNKQKFDDVMKSCCLD 771

Query: 608 GFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAI- 666
             +     G  T +G  G SLSGGQ+QRIA+ARA+    + LILD+  SA+D E+   I 
Sbjct: 772 KDIKAMTAGIRTDVGDGGFSLSGGQQQRIALARAIYSSSRYLILDDCLSAVDPETALYIY 831

Query: 667 -NYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQSELYK 725
                G +MK +  T I  +H +S + +  + +V+ + G V   GK  DL    +     
Sbjct: 832 EECLCGPMMKGR--TCIITSHNISLVTKRADWLVILDRGEVKSQGKPSDLIKSNEFLRES 889

Query: 726 LLNDKK 731
           + ND K
Sbjct: 890 INNDSK 895

>Kpol_175.1 s175 complement(1..4131) [4131 bp, 1377 aa] {ON}
           complement(1..4131) [4131 nt, 1377 aa]
          Length = 1377

 Score = 78.6 bits (192), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 69/252 (27%), Positives = 124/252 (49%), Gaps = 22/252 (8%)

Query: 521 IVGPSGRGKSTITSLLLRYYNPSSGQI---TIDDQDISRLSCKSLRRHLGVVQQEPMLMS 577
           + GP+G GKS +   LL   +   G+I   ++  +    +    L   +    Q P +++
Sbjct: 724 VAGPTGAGKSLLLMSLLGETHLFKGEIHVPSLASKHELMIHGDGLTNSISYCSQIPWIIN 783

Query: 578 GSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIA 637
            SIK N+ +G  SE ++     V + C     +    +G ++I+G RG +LSGGQ+QR++
Sbjct: 784 DSIKNNILFG--SEFNLKRYNDVIRACCLTNDLRLLQDGDNSIVGDRGQNLSGGQRQRVS 841

Query: 638 IARALMKKPKILILDEATSALDVESEGAINYTL---GKLMKSKELTIISIAHRLS-TIRR 693
           +ARA+  K   +ILD+  SA+D +    I Y L   G LMK +  T I ++H +   I++
Sbjct: 842 LARAIYSKSMHIILDDCLSAVDSKCAKDI-YDLCLTGPLMKGR--TCILVSHNVELVIKK 898

Query: 694 SENVIVLGNDGSVVEVGKFKDLYADQQSEL------YKLLNDKKRDKPTPRVQSDPE--- 744
           +  +++L N  +  + G   DL  D+          +  LN+   ++ T  V   P+   
Sbjct: 899 AAYLLILDNRTTAYK-GPPGDLLKDKALRQRYCKFDFNELNENCPNQCTTSVVHKPDYYL 957

Query: 745 KDREQEHQIDNQ 756
           +DR+   +  +Q
Sbjct: 958 EDRDSSSKTQSQ 969

 Score = 46.2 bits (108), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 68/311 (21%), Positives = 121/311 (38%), Gaps = 38/311 (12%)

Query: 238  GEKLVARLRSNVIRKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXX 297
            G     R+   ++R ++     FF++  +G +++  S D     RS+   +S   +    
Sbjct: 1086 GINACNRIFIKILRNVVSSKLIFFEKTPIGSIMNNFSKDI----RSLDFELSPFIEGTFS 1141

Query: 298  XXXXXXXXXXXSISLTSALLMFAPPLLIGALIYGKRIRMISRDLQ--ESTGN--LTRVSE 353
                          +    +  A  + +     G      SR+L+  ES     + +   
Sbjct: 1142 CTLQTLMSLILITYVNPNFIFPAIFIFLFCCFIGHSYLCCSRELKRYESITKTPIYQHFS 1201

Query: 354  EQLSGVKTIQSFVAEGKELQRYNTAIRKVFLYGKKEALTNATFFSSTNVLGDLSFLI--- 410
            E L+G+ +I++F   G EL+       +V  Y K       +FF        LSF I   
Sbjct: 1202 ESLAGLVSIRAF---GDELRFIKVIFTRVDEYNK-------SFFYLWEANNWLSFRIELI 1251

Query: 411  ----VLAYGSHLVLQGGLTVGDLT--AFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLF 464
                +LA G  L+    +    L    F     +T SA++ +  FY+ +     +  RL+
Sbjct: 1252 GSITILATGLFLLSNANMVDSGLAGITFTYAIAFTESALWMIK-FYATMEMNMNSVERLY 1310

Query: 465  EMTD-----HAPSIKPTAGKPYVPGSGKISFKDVSFSY-PTRPGNQIFNKLNFTIEPGSN 518
            E T+     ++  I     +   P SG I FK+V+  Y P  P  ++   + F I     
Sbjct: 1311 EYTNLEQEPYSRCITNVDNQW--PNSGDIKFKNVTLRYSPELP--KVLQDVTFVIGDKEK 1366

Query: 519  VCIVGPSGRGK 529
            + +VG +G GK
Sbjct: 1367 IGVVGRTGAGK 1377

>Kwal_26.8730 s26 complement(918498..920993) [2496 bp, 831 aa] {ON}
           YPL147W (PXA1) - ABC family long-chain fatty acid
           transporter [contig 67] FULL
          Length = 831

 Score = 74.3 bits (181), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 69/292 (23%), Positives = 129/292 (44%), Gaps = 57/292 (19%)

Query: 468 DHAPSIKPTAGKPYVPGSGK-----ISFKDVSFSYPT---RPGNQIFNKLNFTIEP---- 515
           D   SI P+A    V G+ +     I F+++    P+   R G ++ N+L F + P    
Sbjct: 521 DSVDSIDPSANSELVCGTVQRNFNGIRFENIDVVIPSKFGRDGIKLINRLRFQVPPVIGL 580

Query: 516 --------------------GSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDIS 555
                               GS++ I+GP+G GK++I  ++   + P   +  +      
Sbjct: 581 DNNNSDSQINLSQKLMFKGPGSSMLILGPNGSGKTSIQRIIAEIW-PIYNKNGL------ 633

Query: 556 RLSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMD------EIRSVAKKCFCHGF 609
            LS  + R  + + Q+   +  G+ +  + Y + ++   D      E+  V K+     +
Sbjct: 634 -LSVPAERELICIPQKPYFIQGGTFREQIIYPMSADQYFDLGYRDKELVHVLKEVKLE-Y 691

Query: 610 VTKFPNGYDTI--IGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAIN 667
           + K   G+  +  +      LSGG++QR+  AR +  KPK ++LDEAT+A+  + E    
Sbjct: 692 LLKRDKGWRYLDAVAEWKDVLSGGERQRMNFARIMFHKPKFVVLDEATNAISADMEDY-- 749

Query: 668 YTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQ 719
             L  ++K      I+I+ R S I+  +  + +G D    E  + +DL  D+
Sbjct: 750 --LFNMLKRYRFNFITISQRPSLIKYHDLALEIGAD----ESWRLQDLGTDE 795

>SAKL0F01606g Chr6 (133318..135144) [1827 bp, 608 aa] {ON} highly
           similar to uniprot|P40024 Saccharomyces cerevisiae
           YER036C
          Length = 608

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 47/187 (25%), Positives = 83/187 (44%), Gaps = 45/187 (24%)

Query: 488 ISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQI 547
           ++F D+SFSY   P N ++ KLNF ++  S + +VGP+G GKST+  ++     P SG++
Sbjct: 391 LAFDDISFSYDDNPENNLYEKLNFGVDMDSRIALVGPNGVGKSTLLKIMTGQLMPQSGRV 450

Query: 548 --------------TIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVS 593
                         + D  D+++   + +R     + Q+     G +     YGL  E  
Sbjct: 451 SRHTHVKLGVYSQHSQDQLDLTKSPLEFVRDKYPNISQDFQYWRGQLG---RYGLTGEAQ 507

Query: 594 MDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDE 653
             ++                             +LS GQ+ R+  A   +++P +L+LDE
Sbjct: 508 TSQM----------------------------GTLSEGQRSRVVFALLALEQPNVLLLDE 539

Query: 654 ATSALDV 660
            T+ LD+
Sbjct: 540 PTNGLDI 546

 Score = 45.1 bits (105), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 41/66 (62%), Gaps = 4/66 (6%)

Query: 621 IGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELT 680
           I  +   +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+       L + +K  + T
Sbjct: 218 ITKKTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRT 273

Query: 681 IISIAH 686
           ++ ++H
Sbjct: 274 LVLVSH 279

>ZYRO0E04092g Chr5 (308495..311683) [3189 bp, 1062 aa] {ON} similar
           to uniprot|P25371 Saccharomyces cerevisiae YCR011C ADP1
           Shows homology to ATP-dependent permeases Active
           transport ATPase
          Length = 1062

 Score = 72.4 bits (176), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 76/292 (26%), Positives = 135/292 (46%), Gaps = 37/292 (12%)

Query: 488 ISFKDVSFSYPTRPGNQ--IFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLL--RYYNPS 543
           ++FKD+ +  P    N   + N+++  ++PG  + ++G SG GK+T+  +L   +     
Sbjct: 396 LTFKDIVYQVPINRDNSETVLNEVSGVVQPGEMMALLGGSGAGKTTLLDILAMKKKAGKV 455

Query: 544 SGQITIDDQDISRLSCKSLRRHLGVVQQEPMLMS---------GSIKYNLTYGLQSEVSM 594
           SGQI ++ + IS+   K   + +G V Q+  L+           S    L   L  E   
Sbjct: 456 SGQIKVNGKSISK---KDYTKLIGFVDQDDYLLQTLTVFETVLNSALLRLPRALPFEAKR 512

Query: 595 DEIRSVAKKCFCHGFVTKFPNGYDTIIG---PRGASLSGGQKQRIAIARALMKKPKILIL 651
             +  V ++        +  +  D IIG    RG  +SGG+K+R++IA  L+  P IL L
Sbjct: 513 SRVYKVLEE-------LRILDIKDKIIGNEFERG--ISGGEKRRVSIACELVTSPLILFL 563

Query: 652 DEATSALDVESEGAINYTLGKLMKSKELT-IISIAHRLSTIRRSENVIVLGNDGSVVEVG 710
           DE TS LD  +   +   L +L ++   T ++SI    S I +  + +VL ++G +V   
Sbjct: 564 DEPTSGLDANNASNVVDCLVRLARNYGRTLVLSIHQPRSNIFQMFDKLVLLSNGEMV--- 620

Query: 711 KFKDLYADQQSELYKLLNDKKRDKPTPRVQSDPEKDREQEHQIDNQVREQVA 762
                Y+ +   + + L +     PT    +D   D   E Q+ ++ R + A
Sbjct: 621 -----YSGEAIRVNEFLRNNGYQCPTEYNIADYLIDITFETQLQSKKRARAA 667

>YER036C Chr5 complement(223367..225199) [1833 bp, 610 aa] {ON}
           ARB1ATPase of the ATP-binding cassette (ABC) family
           involved in 40S and 60S ribosome biogenesis, has
           similarity to Gcn20p; shuttles from nucleus to
           cytoplasm, physically interacts with Tif6p, Lsg1p
          Length = 610

 Score = 71.6 bits (174), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 59/242 (24%), Positives = 108/242 (44%), Gaps = 56/242 (23%)

Query: 488 ISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQI 547
           ++F D+SF Y + P   ++  LNF ++  S + +VGP+G GKST+  ++     P SG++
Sbjct: 393 LAFDDISFHYESNPSENLYEHLNFGVDMDSRIALVGPNGVGKSTLLKIMTGELTPQSGRV 452

Query: 548 --------------TIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSI-KYNLTYGLQSEV 592
                         + D  D+++ + + +R     + Q+     G + +Y LT G    V
Sbjct: 453 SRHTHVKLGVYSQHSQDQLDLTKSALEFVRDKYSNISQDFQFWRGQLGRYGLT-GEGQTV 511

Query: 593 SMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILD 652
            M                               A+LS GQ+ R+  A   +++P +L+LD
Sbjct: 512 QM-------------------------------ATLSEGQRSRVVFALLALEQPNVLLLD 540

Query: 653 EATSALDVES----EGAIN-YTLGKLMKSKELTIIS-IAHRLSTIRRSENVIVLGNDGSV 706
           E T+ LD+ +      AIN +  G ++ S +  ++  IA  +  +   EN      DGS+
Sbjct: 541 EPTNGLDIPTIDSLADAINEFNGGVVVVSHDFRLLDKIAQDIFVV---ENKTATRWDGSI 597

Query: 707 VE 708
           ++
Sbjct: 598 LQ 599

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 39/59 (66%), Gaps = 4/59 (6%)

Query: 628 LSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTIISIAH 686
           +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+       L + +K  + T++ ++H
Sbjct: 227 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 281

>AFR232C Chr6 complement(859612..861435) [1824 bp, 607 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER036C
           (ARB1)
          Length = 607

 Score = 71.2 bits (173), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 54/242 (22%), Positives = 110/242 (45%), Gaps = 56/242 (23%)

Query: 488 ISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQI 547
           ++F ++SFSY   P N ++ KLNF ++  S   +VGP+G GKST+  ++     P  G++
Sbjct: 390 LAFDEISFSYDGNPENNLYEKLNFGVDMDSRTALVGPNGVGKSTLLKIMTGELTPHGGRV 449

Query: 548 --------------TIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVS 593
                         + D  D+++ + + +R     + ++     G +     YGL  E  
Sbjct: 450 SRHTHVKLGVYSQHSQDQLDLTKSALEFVRDKYAHISEDFQFWRGQLG---RYGLTGEAQ 506

Query: 594 MDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDE 653
             ++                            A+LS GQ+ R+  A   +++P +L+LDE
Sbjct: 507 TAQM----------------------------ATLSEGQRSRVVFALLALEQPNVLLLDE 538

Query: 654 ATSALDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRR-SENVIVLGN------DGSV 706
            T+ LD+ +   I+ +L   + +    ++ ++H    + R ++++ V+ N      DGS+
Sbjct: 539 PTNGLDIPT---ID-SLADAIDAFNGGVVVVSHDFRLLDRIAKDIYVVENKTATRWDGSI 594

Query: 707 VE 708
           ++
Sbjct: 595 LD 596

 Score = 45.1 bits (105), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 41/66 (62%), Gaps = 4/66 (6%)

Query: 621 IGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELT 680
           I  +   +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+       L + +K  + T
Sbjct: 217 INRKTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRT 272

Query: 681 IISIAH 686
           ++ ++H
Sbjct: 273 LVLVSH 278

>Smik_5.159 Chr5 complement(228179..230011) [1833 bp, 610 aa] {ON}
           YER036C (REAL)
          Length = 610

 Score = 70.9 bits (172), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 47/188 (25%), Positives = 84/188 (44%), Gaps = 47/188 (25%)

Query: 488 ISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQI 547
           ++F D+SF Y + P   ++  LNF ++  S + +VGP+G GKST+  ++     P SG++
Sbjct: 393 LAFDDISFHYESNPSENLYEHLNFGVDMDSRIALVGPNGVGKSTLLKIMTGELTPQSGRV 452

Query: 548 --------------TIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSI-KYNLTYGLQSEV 592
                         + D  D+++ + + +R     + Q+     G + +Y LT G    V
Sbjct: 453 SRHTHVKLGVYSQHSQDQLDLTKSALEFVRDKYSNISQDFQFWRGQLGRYGLT-GEGQTV 511

Query: 593 SMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILD 652
            M                               A+LS GQ+ R+  A   +++P +L+LD
Sbjct: 512 QM-------------------------------ATLSEGQRSRVVFALLALEQPNVLLLD 540

Query: 653 EATSALDV 660
           E T+ LD+
Sbjct: 541 EPTNGLDI 548

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 39/59 (66%), Gaps = 4/59 (6%)

Query: 628 LSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTIISIAH 686
           +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+       L + +K  + T++ ++H
Sbjct: 227 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 281

>Skud_5.145 Chr5 complement(221173..223005) [1833 bp, 610 aa] {ON}
           YER036C (REAL)
          Length = 610

 Score = 70.5 bits (171), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 47/188 (25%), Positives = 84/188 (44%), Gaps = 47/188 (25%)

Query: 488 ISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQI 547
           ++F D+SF Y + P   ++  LNF ++  S + +VGP+G GKST+  ++     P SG++
Sbjct: 393 LAFDDISFHYESNPSENLYEHLNFGVDMDSRIALVGPNGVGKSTLLKIMTGELTPQSGRV 452

Query: 548 --------------TIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSI-KYNLTYGLQSEV 592
                         + D  D+++ + + +R     + Q+     G + +Y LT G    V
Sbjct: 453 SRHTHVKLGVYSQHSQDQLDLTKSALEFVRDKYSNISQDFQFWRGQLGRYGLT-GEGQTV 511

Query: 593 SMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILD 652
            M                               A+LS GQ+ R+  A   +++P +L+LD
Sbjct: 512 QM-------------------------------ATLSEGQRSRVVFALLALEQPNVLLLD 540

Query: 653 EATSALDV 660
           E T+ LD+
Sbjct: 541 EPTNGLDI 548

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 39/59 (66%), Gaps = 4/59 (6%)

Query: 628 LSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTIISIAH 686
           +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+       L + +K  + T++ ++H
Sbjct: 227 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 281

>Ecym_1194 Chr1 (393697..395526) [1830 bp, 609 aa] {ON} similar to
           Ashbya gossypii AFR232C
          Length = 609

 Score = 70.5 bits (171), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 47/187 (25%), Positives = 84/187 (44%), Gaps = 45/187 (24%)

Query: 488 ISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQI 547
           ++F ++SFSY  +P N ++  LNF ++  S V +VGP+G GKST+  ++     P  G++
Sbjct: 392 LAFDEISFSYDEKPENNLYENLNFGVDMDSRVALVGPNGVGKSTLLKIMTGELTPQGGRV 451

Query: 548 --------------TIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVS 593
                         + D  D+++ + + +R   G + ++     G +     YGL  E  
Sbjct: 452 SRHTHVKLGVYSQHSQDQLDLTKSALEFVRDKYGHISEDFQYWRGQLG---RYGLTGE-- 506

Query: 594 MDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDE 653
                                 G    +G    +LS GQ+ R+  A   + +P +L+LDE
Sbjct: 507 ----------------------GQTVQMG----TLSEGQRSRVVFALLALDQPNVLLLDE 540

Query: 654 ATSALDV 660
            T+ LD+
Sbjct: 541 PTNGLDI 547

 Score = 45.4 bits (106), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 41/66 (62%), Gaps = 4/66 (6%)

Query: 621 IGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELT 680
           I  +   +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+       L + +K  + T
Sbjct: 219 INKKTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRT 274

Query: 681 IISIAH 686
           ++ ++H
Sbjct: 275 LVLVSH 280

>TPHA0A05890 Chr1 complement(1334117..1335949) [1833 bp, 610 aa]
           {ON} Anc_3.534 YER036C
          Length = 610

 Score = 70.5 bits (171), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 53/240 (22%), Positives = 106/240 (44%), Gaps = 56/240 (23%)

Query: 488 ISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQI 547
           +SF D+SF+Y  +P N ++N LNF ++  S + +VGP+G GKST+  ++       SG++
Sbjct: 393 LSFDDISFAYDGKPENNLYNHLNFGVDMDSRIALVGPNGVGKSTLLKIMTGELQAQSGRV 452

Query: 548 --------------TIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVS 593
                         + D  D+++ + + +R     + Q+     G +     YGL  E  
Sbjct: 453 SRHSHVKLGVYSQHSQDQLDLTKSALEFVRDKYPEISQDFQYWRGQLG---RYGLTGEAQ 509

Query: 594 MDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDE 653
             ++                             +LS GQ+ R+  A   ++ P +L+LDE
Sbjct: 510 TVQM----------------------------GTLSEGQRSRVVFALLALEAPNVLLLDE 541

Query: 654 ATSALDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRR-SENVIVLGN------DGSV 706
            T+ LD+ +  ++   + +        ++ ++H    + R ++++ V+ N      DGS+
Sbjct: 542 PTNGLDIPTIDSLADAINEFNGG----VVVVSHDFRLLDRIAKDIFVVENQTATRWDGSI 597

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 39/59 (66%), Gaps = 4/59 (6%)

Query: 628 LSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTIISIAH 686
           +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+       L + +K  + T++ ++H
Sbjct: 227 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 281

>Suva_5.134 Chr5 complement(199609..201441) [1833 bp, 610 aa] {ON}
           YER036C (REAL)
          Length = 610

 Score = 70.5 bits (171), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 48/188 (25%), Positives = 84/188 (44%), Gaps = 47/188 (25%)

Query: 488 ISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQI 547
           ++F D+SF Y + P   ++  LNF ++  S + +VGP+G GKST+  ++     P SG++
Sbjct: 393 LAFDDISFHYESNPSENLYENLNFGVDMDSRIALVGPNGVGKSTLLKIMTGELTPQSGRV 452

Query: 548 --------------TIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSI-KYNLTYGLQSEV 592
                         + D  D+++ + + +R     V Q+     G + +Y LT G    V
Sbjct: 453 SRHTHVKLGVYSQHSQDQLDLTKSALEFVRDKYPSVSQDFQYWRGQLGRYGLT-GEGQTV 511

Query: 593 SMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILD 652
            M                               A+LS GQ+ R+  A   +++P +L+LD
Sbjct: 512 QM-------------------------------ATLSEGQRSRVVFALLALEQPNVLLLD 540

Query: 653 EATSALDV 660
           E T+ LD+
Sbjct: 541 EPTNGLDI 548

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 42/68 (61%), Gaps = 4/68 (5%)

Query: 619 TIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKE 678
           T I  +   +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+       L + +K  +
Sbjct: 218 TTILKKTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFD 273

Query: 679 LTIISIAH 686
            T++ ++H
Sbjct: 274 RTLVLVSH 281

>SAKL0D10208g Chr4 complement(855378..857636) [2259 bp, 752 aa] {ON}
           highly similar to uniprot|P43535 Saccharomyces
           cerevisiae YFR009W GCN20 Positive regulator of the Gcn2p
           kinase activity forms a complex with Gcn1p proposed to
           stimulate Gcn2p activation by an uncharged tRNA
          Length = 752

 Score = 70.5 bits (171), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 65/247 (26%), Positives = 102/247 (41%), Gaps = 48/247 (19%)

Query: 488 ISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQI 547
           I  +DVSF Y     + +   +N  ++  S + +VG +G GK+T+  +++    P+ G  
Sbjct: 532 IQLQDVSFGY--EENSPLLKDVNLDVQMDSRIALVGANGCGKTTLLKVMMEQLRPTKG-- 587

Query: 548 TIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCH 607
                                V + P L  G       Y  Q  V   ++ + A      
Sbjct: 588 --------------------YVSRNPRLRIG-------YFTQHHVDSMDLNTSAVDWMSK 620

Query: 608 GFVTKFPNGYDTIIGPRGAS----------LSGGQKQRIAIARALMKKPKILILDEATSA 657
            F  K    Y   +G  G +          LSGGQK R+A A   +  P IL+LDE ++ 
Sbjct: 621 TFPGKTDEEYRRHLGAFGITGSLGLQKMQLLSGGQKSRVAFAALCLNNPHILVLDEPSNH 680

Query: 658 LDVESEGAI-----NYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKF 712
           LD     A+     N+T G LM S ++++I   H  S I  SE+  V   DG++ +   +
Sbjct: 681 LDTAGLDALIDALKNFTGGVLMVSHDISVID--HVCSEIWVSEDGTVKRFDGTIYDYRSY 738

Query: 713 KDLYADQ 719
               ADQ
Sbjct: 739 ILASADQ 745

 Score = 45.4 bits (106), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 62/241 (25%), Positives = 100/241 (41%), Gaps = 38/241 (15%)

Query: 480 PYVPGSGKISFKDV---SFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLL 536
           P   GSG    KDV   +F      G +I +    T+  G    +VG +G GKST+   L
Sbjct: 186 PLDFGSGAGKSKDVKIDTFDLYVGDGQRILSDAQLTLSYGRRYGLVGQNGIGKSTLLRAL 245

Query: 537 LRYYNPSSGQITI--DDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLTY----GLQS 590
            R        I+I   +Q++     K+L+  L        L+S   K N        L+ 
Sbjct: 246 SRRELNVPKHISILHVEQELRGDETKALQSVLDADVWRKQLLSEESKINERLQEIEKLRE 305

Query: 591 EVSMD--EIRSV----------------------AKKCFCHGFVTKFPNGYDTIIGPRGA 626
           E   D  E++ +                      + K         +  G+ T    +  
Sbjct: 306 EFDEDSLEVKKLDNEREDLDNHLEQISEKLVDMESDKAEARAASILYGLGFSTEAQQKPT 365

Query: 627 -SLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTIISIA 685
            S SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y L + +K+   T++ ++
Sbjct: 366 NSFSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LSEYLKTYPATVLVVS 421

Query: 686 H 686
           H
Sbjct: 422 H 422

>YOL075C Chr15 complement(189658..193542) [3885 bp, 1294 aa] {ON}
           Putative ABC transporter
          Length = 1294

 Score = 70.5 bits (171), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 70/238 (29%), Positives = 113/238 (47%), Gaps = 38/238 (15%)

Query: 489 SFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPS----- 543
           ++K+ +F + T+   +I   +N   +PG    I+GPSG GKS++ +L+      S     
Sbjct: 696 NWKEGNFHHETK---EILQSVNAIFKPGMINAIMGPSGSGKSSLLNLISGRLKSSVFAKF 752

Query: 544 --SGQITIDDQDISRLSCKSLRRHLGVVQQEPMLMSG-----SIKY-------NLTYGLQ 589
             SG I  +D  +S L  K++  +  V Q +  L++      ++KY       +LT   +
Sbjct: 753 DTSGSIMFNDIQVSELMFKNVCSY--VSQDDDHLLAALTVKETLKYAAALRLHHLTEAER 810

Query: 590 SEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGAS-LSGGQKQRIAIARALMKKPKI 648
            E + + IRS+  K  C           + IIG      +SGG+K+R+ +   L+  P I
Sbjct: 811 MERTDNLIRSLGLK-HCE----------NNIIGNEFVKGISGGEKRRVTMGVQLLNDPPI 859

Query: 649 LILDEATSALDVESEGAINYTLGKLMKSKELTIISIAH--RLSTIRRSENVIVLGNDG 704
           L+LDE TS LD  +   I   L KL + +  TII   H  R    +R  NV++L   G
Sbjct: 860 LLLDEPTSGLDSFTSATILEILEKLCREQGKTIIITIHQPRSELFKRFGNVLLLAKSG 917

 Score = 48.9 bits (115), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 51/175 (29%), Positives = 75/175 (42%), Gaps = 29/175 (16%)

Query: 618 DTIIGPRGA-SLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKS 676
           DT++G      LSGG+K+R++I   ++  P I+ LDE T+ LD  S   +  TL KL K 
Sbjct: 175 DTLVGDNSHRGLSGGEKRRLSIGTQMISNPSIMFLDEPTTGLDAYSAFLVIKTLKKLAKE 234

Query: 677 KELT-IISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQSELY---KLLN---- 728
              T I+SI    S I    + + + + G+VV   K  +     +S  Y   +L+N    
Sbjct: 235 DGRTFIMSIHQPRSDILFLLDQVCILSKGNVVYCDKMDNTIPYFESIGYHVPQLVNPADY 294

Query: 729 -------DKKRDKPTPRVQS------DPEKDREQEH-------QIDNQVREQVAN 763
                  D + DK     QS      D   D E+ H        I N    Q+ N
Sbjct: 295 FIDLSSVDSRSDKEEAATQSRLNSLIDHWHDYERTHLQLQAESYISNATEIQIQN 349

>TPHA0A00840 Chr1 complement(163812..167750) [3939 bp, 1312 aa] {ON}
            Anc_3.133 YOL075C
          Length = 1312

 Score = 70.1 bits (170), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 86/304 (28%), Positives = 129/304 (42%), Gaps = 48/304 (15%)

Query: 504  QIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPS-------SGQITIDDQDISR 556
            +I N +N T +PG    I+GPSG GKS++ +L+      S        G I ++D +IS 
Sbjct: 727  EILNSINATFKPGMINAIMGPSGSGKSSLLNLISAKQKSSMFATFSKEGSIALNDNEISE 786

Query: 557  LSCKSLRRHLGVVQQEPMLMSG-----SIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVT 611
               KSL  +  V Q +  L+S      S K+     L    S +    +       G   
Sbjct: 787  EMFKSLCAY--VSQDDDHLLSKLTVRESFKFAADLRLHYMCSDERDEKIDTLIRALGLT- 843

Query: 612  KFPNGYDTIIGPRGAS-LSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTL 670
               N  +TIIG      +SGG+K+R+++   L+K P IL+LDE TS LD  +   +   L
Sbjct: 844  ---NCQNTIIGDEFVKGISGGEKRRVSMGIQLLKDPPILLLDEPTSGLDSFTSLTVLEIL 900

Query: 671  GKLMKSKELTIISIAH--RLSTIRRSENVIVLGNDGSVVEVGK-------FKDL------ 715
             +L      T+I   H  R    ++  NV++L   G     G        FK+L      
Sbjct: 901  EQLSADFGKTVIITIHQPRAELFKKFGNVLLLAKSGRTAFNGSPKEMINYFKNLGYVCPA 960

Query: 716  ---YADQQSELYKL--LNDKKRDKPTPRVQS--DPEKDREQEHQIDN-------QVREQV 761
                AD   ++  L   N+K  +  T RV S  D   +  +E  ID         V EQ 
Sbjct: 961  FTNIADYFLDIISLNKQNEKNTEISTKRVTSIIDSWNNHFKELNIDTPQKENKVMVDEQF 1020

Query: 762  ANDF 765
             N++
Sbjct: 1021 LNEY 1024

 Score = 42.0 bits (97), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 41/73 (56%), Gaps = 5/73 (6%)

Query: 618 DTIIGP---RGASLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLM 674
           DT++G    RG  LSGG+K+R++I   ++  P ++ LDE T+ LD  S   +  T+ +L 
Sbjct: 185 DTLVGDSSHRG--LSGGEKRRLSIGTQMISNPSLMYLDEPTTGLDAYSAFLVIKTIKRLA 242

Query: 675 KSKELTIISIAHR 687
           +    T I   H+
Sbjct: 243 QFGGRTFIMSIHQ 255

>SAKL0H21010g Chr8 (1835185..1839528) [4344 bp, 1447 aa] {ON} similar
            to uniprot|P32568 Saccharomyces cerevisiae YDR011W SNQ2
            ABC transporter
          Length = 1447

 Score = 68.9 bits (167), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 63/240 (26%), Positives = 121/240 (50%), Gaps = 19/240 (7%)

Query: 486  GKISFKDVSFSYPTRPGNQ-IFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYN--- 541
            G   +KDV +  P +   + + +K++  ++PG    ++G SG GK+T+ ++L +  +   
Sbjct: 800  GVFMWKDVDYVIPYKGSEKKLLDKVSGFVKPGLT-ALMGASGAGKTTLLNVLAQRMDFGI 858

Query: 542  PSSGQITIDDQDISRLSCKSLRRHLGVVQQE-----PMLMSGSIKYNLTYGLQSEVSMDE 596
             SSG+I +D + + R      +R +G VQQ+      + +  S++++        V   E
Sbjct: 859  VSSGEILVDAKPVDR----KFKRSVGYVQQQDIHTQELTVRESLQFSARLRRPDSVPDAE 914

Query: 597  IRSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILI-LDEAT 655
                 +K      V    +  D ++G  G  L+  Q+++++I   L+ KP +L+ LDE T
Sbjct: 915  KMEYVEKIIV---VLGMQDYSDAVVGEAGFGLNVEQRKKLSIGVELVAKPTLLLFLDEPT 971

Query: 656  SALDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRRS-ENVIVLGNDGSVVEVGKFKD 714
            S LD +S  AI   L +L ++ +  + +I    +T+  S + +++L + GSVV  G   D
Sbjct: 972  SGLDSQSSWAILQLLRRLAEAGQAILCTIHQPSATLFESFDRLLLLKDGGSVVYWGNIGD 1031

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 58/238 (24%), Positives = 103/238 (43%), Gaps = 50/238 (21%)

Query: 504 QIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLR 563
           +I +++NF I+PG    ++G  G G S+     LR      G  T  D +IS        
Sbjct: 117 KILSQINFLIKPGEMCLVLGRPGAGCSS----FLRTVAGELGNFTDVDGEIS-------- 164

Query: 564 RHLGVVQQEPM-LMSGSIKYN-----------LTYGLQSEVSMDEIRS-----VAKKCFC 606
            + G+ Q+E +    G I YN           ++  L+  ++  E  S     + KK   
Sbjct: 165 -YDGIPQKEMIKHFKGDIIYNGEMDVHFPHLTVSQTLEMAIACKEPHSLSDEKIPKKQHI 223

Query: 607 HGF------VTKFPNGYDTIIGP---RGASLSGGQKQRIAIARALMKKPKILILDEATSA 657
           HG       +    + ++T +G    RG  +SGG+++R++IA A+  +  +   D ++  
Sbjct: 224 HGNRDLYAGIFHLTHTFNTKVGNDFVRG--VSGGERKRVSIAEAMAARGSVYCWDNSSRG 281

Query: 658 LDVESEGAINY-----TLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVG 710
           LD  S  A +Y     T+  L+KS  +  ++I      I R  + + +  DG  +  G
Sbjct: 282 LD--SSSAYDYIKAIRTVSDLIKS--VAFVAIYQAGENIYRKFDKVTVLYDGRQIYYG 335

>TBLA0I03330 Chr9 complement(806242..808074) [1833 bp, 610 aa] {ON}
           Anc_3.534 YER036C
          Length = 610

 Score = 68.2 bits (165), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 46/187 (24%), Positives = 84/187 (44%), Gaps = 45/187 (24%)

Query: 488 ISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQI 547
           ++F D+SFSY  +P N ++  LNF ++  S + +VGP+G GKST+  ++       SG++
Sbjct: 393 LAFDDISFSYDGKPENNLYEHLNFGVDMDSRIALVGPNGVGKSTLLKIMTGELMSQSGRV 452

Query: 548 --------------TIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVS 593
                         + D  D+++ + + +R     + Q+     G +     YGL  E  
Sbjct: 453 SRHTHVKLGVYSQHSQDQLDLTKSALEFVRDKYSNISQDFQYWRGQLG---RYGLTGEAQ 509

Query: 594 MDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDE 653
                                     ++G    +LS GQ+ R+  A   +++P +L+LDE
Sbjct: 510 T------------------------VLMG----TLSEGQRSRVVFALLALEQPNVLLLDE 541

Query: 654 ATSALDV 660
            T+ LD+
Sbjct: 542 PTNGLDI 548

 Score = 45.8 bits (107), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 42/68 (61%), Gaps = 4/68 (5%)

Query: 619 TIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKE 678
           T I  +   +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+       L + +K  +
Sbjct: 218 TTILKKTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFD 273

Query: 679 LTIISIAH 686
            T++ ++H
Sbjct: 274 RTLVLVSH 281

>TPHA0D01170 Chr4 complement(245675..248422) [2748 bp, 915 aa] {ON}
           Anc_8.661 YPL147W
          Length = 915

 Score = 68.2 bits (165), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 62/216 (28%), Positives = 104/216 (48%), Gaps = 34/216 (15%)

Query: 503 NQIFN-KLNFTIEPGSNVCIVGPSGRGKSTITSLLLRY---YNPSSGQITIDDQDISRLS 558
           N I++  L F+  PGS++ I+GP+  GKS+I  ++      YN  +G ++I  +D   L 
Sbjct: 669 NSIYDMTLPFSYGPGSSLLILGPNSCGKSSIQRIIAEIWPIYN-KNGLMSIPAED--ELM 725

Query: 559 CKSLRRHLGVVQQEPML-MSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCH-------GFV 610
           C         + Q P     G+ +  + Y + S+   D  R +  K            ++
Sbjct: 726 C---------IPQRPYFSKGGTFRDQIIYPMGSDEFFD--RGLKDKLLVQILADVKLEYL 774

Query: 611 TKFPNGY---DTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAIN 667
            K   G+   D +   +   LSGG+KQR+  AR L  KP+ +ILDEAT+A+ V+ E    
Sbjct: 775 LKRDKGWSYFDAVFDWKDV-LSGGEKQRMNFARILFHKPRFVILDEATNAISVDMEDY-- 831

Query: 668 YTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGND 703
             L K++K      ISI+ R S ++  + ++ +  D
Sbjct: 832 --LFKMLKKYRFNFISISQRPSLVKYHDLLLEISED 865

>CAGL0K10472g Chr11 (1020845..1023103) [2259 bp, 752 aa] {ON} highly
           similar to uniprot|P43535 Saccharomyces cerevisiae
           YFR009w GCN20 positive effector of GCN2P
          Length = 752

 Score = 67.8 bits (164), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 59/211 (27%), Positives = 87/211 (41%), Gaps = 46/211 (21%)

Query: 488 ISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQI 547
           I  +DVSF Y   P   +   +N  I+  S + +VG +G GK+T+  ++L    P SG  
Sbjct: 532 IQLQDVSFGYS--PDKLLLKDVNLDIQMDSRIALVGANGCGKTTLLKVMLEQLRPLSG-- 587

Query: 548 TIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCH 607
                                V + P L  G       Y  Q  V   ++ + A      
Sbjct: 588 --------------------YVSRNPRLRIG-------YFTQHHVDSMDLSTSAVDWMSK 620

Query: 608 GFVTKFPNGYDTIIGPRGAS----------LSGGQKQRIAIARALMKKPKILILDEATSA 657
            F  K    Y   +G  G +          LSGGQK R+A A   +  P ILILDE ++ 
Sbjct: 621 TFPGKTDEEYRRHLGSFGITGTLGLQKMQLLSGGQKSRVAFAALCLNNPHILILDEPSNH 680

Query: 658 LDVESEGAI-----NYTLGKLMKSKELTIIS 683
           LD     A+     N+T G LM S ++++I+
Sbjct: 681 LDTTGIDALVDAMKNFTGGILMVSHDISVIN 711

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 41/60 (68%), Gaps = 4/60 (6%)

Query: 627 SLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTIISIAH 686
           S SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y L + +KS   T+++++H
Sbjct: 367 SFSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LAEYLKSYPSTVLTVSH 422

>NCAS0A08570 Chr1 (1693304..1696486) [3183 bp, 1060 aa] {ON}
           Anc_1.427
          Length = 1060

 Score = 67.8 bits (164), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 72/257 (28%), Positives = 119/257 (46%), Gaps = 50/257 (19%)

Query: 485 SGKISFKDVSFSYPTRPGN---------QIFNKLNFTIEPGSNVCIVGPSGRGKSTITSL 535
           S  +SF+++++  P+   N         ++   ++  ++PG    I+G SG GK+T+  +
Sbjct: 387 SATLSFENITYEVPSLNKNHKSQPNSNVKVLKSIDGIVKPGQIFAIMGGSGAGKTTLLDI 446

Query: 536 LL--RYYNPSSGQITIDDQDISRLSCKSLRRHLGVVQQ-----------EPMLMSGSIKY 582
           L   R      G+I ++   +SR   KS  + +G V Q           E +L S  ++ 
Sbjct: 447 LAMKRKTGQVGGEIKVNGNIMSR---KSYSKLIGFVDQNDYLHPTLTVYETVLNSALLRL 503

Query: 583 NLTYGLQSEVS-----MDEIRSVAKKCFCHGFVTKFPNGYDTIIG---PRGASLSGGQKQ 634
             T   +S+ S     ++E+R    K              D IIG    RG  +SGG+K+
Sbjct: 504 PRTMSFESKQSRVFQILEELRIFDIK--------------DRIIGNDFERG--ISGGEKR 547

Query: 635 RIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTIISIAHR-LSTIRR 693
           R++IA  L+  P IL LDE TS LD  +   +  +L +L K+   T+I   H+  S I  
Sbjct: 548 RVSIACELVTSPLILFLDEPTSGLDANNANNVITSLVRLAKNYNRTLILTIHQPRSNIFN 607

Query: 694 SENVIVLGNDGSVVEVG 710
             N +VL + G +V  G
Sbjct: 608 QFNKLVLLSQGEMVFSG 624

>CAGL0C02343g Chr3 (236112..236391,236790..238672) [2163 bp, 720 aa]
           {ON} highly similar to uniprot|P40024 Saccharomyces
           cerevisiae YER036c ARB1
          Length = 720

 Score = 67.4 bits (163), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 47/190 (24%), Positives = 84/190 (44%), Gaps = 47/190 (24%)

Query: 488 ISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQI 547
           ++F D+SF+Y   P N ++  LNF ++  S   +VGP+G GKST+  ++     P SG++
Sbjct: 503 LAFDDISFAYDGNPENNLYEHLNFGVDMDSRTALVGPNGVGKSTLLKIMTGELMPQSGRV 562

Query: 548 --------------TIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSI-KYNLTYGLQSEV 592
                         + D  D+++ + + +R     + Q+     G + +Y LT G   +V
Sbjct: 563 SRHTHVKLGVYSQHSQDQLDLTKSALEFVRDKYSNISQDFQYWRGQLGRYGLT-GDAQKV 621

Query: 593 SMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILD 652
            M                                +LS GQ+ R+  A   ++ P +L+LD
Sbjct: 622 QM-------------------------------GTLSEGQRSRVVFALLALENPNVLLLD 650

Query: 653 EATSALDVES 662
           E T+ LD+ +
Sbjct: 651 EPTNGLDIPT 660

 Score = 45.1 bits (105), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 39/60 (65%), Gaps = 4/60 (6%)

Query: 627 SLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTIISIAH 686
            +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+       L + +K  + T++ ++H
Sbjct: 336 DMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 391

>ZYRO0G01144g Chr7 (89341..91599) [2259 bp, 752 aa] {ON} highly
           similar to uniprot|P43535 Saccharomyces cerevisiae
           YFR009W GCN20 Positive regulator of the Gcn2p kinase
           activity forms a complex with Gcn1p proposed to
           stimulate Gcn2p activation by an uncharged tRNA
          Length = 752

 Score = 67.4 bits (163), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 69/276 (25%), Positives = 110/276 (39%), Gaps = 65/276 (23%)

Query: 455 KGAGAASRLFEMTDHAPSIKPTAGKPYV----PGSGKIS-----FKDVSFSYPTRPGNQI 505
           K   A SR+ ++ +  P ++P  G+  V    P   K+S      +DV+F Y     N +
Sbjct: 491 KSQEAQSRIKKL-EKLPVLEPPEGEKSVSFKFPECSKLSPPIIQLQDVTFGY--NENNLL 547

Query: 506 FNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRH 565
              +N  ++  S + +VG +G GK+T+  +++    P  G                    
Sbjct: 548 LKDVNLDVQLNSRIALVGANGCGKTTLLKIMMETLTPLKG-------------------- 587

Query: 566 LGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRG 625
              V + P L  G       Y  Q  V   ++ + A +     F  +    Y   +G  G
Sbjct: 588 --YVSRNPRLRLG-------YFAQHHVDAMDLNASAVEWMSKTFPGRSDEEYRRHLGSFG 638

Query: 626 AS----------LSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAI-----NYTL 670
            +          LSGGQK R+A A   +  P +LILDE ++ LD     A+     N+T 
Sbjct: 639 ITGSLGLQRMELLSGGQKSRVAFAALCLNNPHVLILDEPSNHLDTSGIDALVDALKNFTG 698

Query: 671 GKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSV 706
           G LM         ++H +S I    N I +  DGS 
Sbjct: 699 GVLM---------VSHDISVINSVCNEIWVSEDGSA 725

 Score = 45.8 bits (107), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 40/60 (66%), Gaps = 4/60 (6%)

Query: 627 SLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTIISIAH 686
           S SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y L + +KS   TI+ ++H
Sbjct: 367 SFSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LSEYLKSYPSTILVVSH 422

>ZYRO0E08800g Chr5 complement(702554..704386) [1833 bp, 610 aa] {ON}
           highly similar to uniprot|P40024 Saccharomyces
           cerevisiae YER036C
          Length = 610

 Score = 67.0 bits (162), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 53/243 (21%), Positives = 112/243 (46%), Gaps = 58/243 (23%)

Query: 488 ISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQI 547
           ++F ++SF+Y   P + ++  LNF ++  S + +VGP+G GKST+  ++     P +G++
Sbjct: 393 LAFDEISFAYDGNPEHNLYENLNFGVDMDSRIALVGPNGVGKSTLLKIMTGDLTPQAGRV 452

Query: 548 --------------TIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSI-KYNLTYGLQSEV 592
                         + D  D+++ + + +R     + Q+     G + +Y LT       
Sbjct: 453 SRHTHVKLGVYSQHSQDQLDLTKSALEFVREKYSHISQDFQYWRGQLGRYGLT------- 505

Query: 593 SMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILD 652
                                 +G    +G    +LS GQ+ R+  A   ++ P IL+LD
Sbjct: 506 ---------------------GDGQKAQMG----TLSEGQRSRVVFALLALQAPNILLLD 540

Query: 653 EATSALDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRR-SENVIVLGN------DGS 705
           E T+ LD+ +   I+ +L + + +    ++ ++H    + + ++++ V+ N      DGS
Sbjct: 541 EPTNGLDIPT---ID-SLAEAINTFNGGVVVVSHDFRLLDKIAQDIFVVENKTAYRWDGS 596

Query: 706 VVE 708
           ++E
Sbjct: 597 ILE 599

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 30/42 (71%)

Query: 621 IGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVES 662
           I  +   +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+
Sbjct: 220 IQKKTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA 261

>TDEL0D06020 Chr4 complement(1087102..1088934) [1833 bp, 610 aa]
           {ON} Anc_3.534 YER036C
          Length = 610

 Score = 66.6 bits (161), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 45/187 (24%), Positives = 84/187 (44%), Gaps = 45/187 (24%)

Query: 488 ISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQI 547
           ++F +++FSY   P N ++  LNF ++  S + +VGP+G GKST+  ++     P +G++
Sbjct: 393 LAFDEINFSYDGNPENNLYEHLNFGVDMDSRIALVGPNGVGKSTLLKIMTGELTPQAGRV 452

Query: 548 --------------TIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVS 593
                         + D  D+++ + + +R     + Q+     G +     YGL  E  
Sbjct: 453 SRHTHVKLGVYSQHSQDQLDLTKSALEFVRDKYPQISQDFQYWRGQLG---RYGLTGE-- 507

Query: 594 MDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDE 653
                                 G    +G    +LS GQ+ R+  A   +++P +L+LDE
Sbjct: 508 ----------------------GQTVQMG----TLSEGQRSRVVFALLALEQPNVLLLDE 541

Query: 654 ATSALDV 660
            T+ LD+
Sbjct: 542 PTNGLDI 548

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 39/60 (65%), Gaps = 4/60 (6%)

Query: 627 SLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTIISIAH 686
            +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+       L + +K  + T++ ++H
Sbjct: 226 DMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 281

>Kwal_47.19116 s47 complement(1101559..1103382) [1824 bp, 607 aa]
           {ON} YER036C (KRE30) - Hypothetical ORF [contig 188]
           FULL
          Length = 607

 Score = 66.6 bits (161), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 57/241 (23%), Positives = 105/241 (43%), Gaps = 54/241 (22%)

Query: 488 ISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQI 547
           ++F D+SF+Y  +P N ++  LNF ++  S V +VGP+G GKST+  ++       SG++
Sbjct: 390 LAFDDISFAYDGKPENNLYEHLNFGVDMDSRVALVGPNGVGKSTLLKIMTGELATQSGRV 449

Query: 548 --------------TIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVS 593
                         + D  D+++   + +R     +  +     G +     YGL  E  
Sbjct: 450 SRHTHVKLGVYSQHSQDQLDLTKSPLEFVRDKYSHISHDFQYWRGQLG---RYGLTGEGQ 506

Query: 594 MDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDE 653
             ++                            A+LS GQ+ R+  A   ++ P +L+LDE
Sbjct: 507 TSQM----------------------------ATLSEGQRSRVVFALLALQAPNVLLLDE 538

Query: 654 ATSALDVES----EGAIN-YTLGKLMKSKELTIIS-IAHRLSTIRRSENVIVLGNDGSVV 707
            T+ LD+ +      AIN +  G ++ S +  ++  IA  +  +   EN      DGS++
Sbjct: 539 PTNGLDIATIDSLADAINEFNGGVVVVSHDFRLLDKIAKDIFVV---ENKTATRWDGSIL 595

Query: 708 E 708
           +
Sbjct: 596 D 596

 Score = 45.4 bits (106), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 41/66 (62%), Gaps = 4/66 (6%)

Query: 621 IGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELT 680
           I  +   +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+       L + +K  + T
Sbjct: 217 INKKTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRT 272

Query: 681 IISIAH 686
           ++ ++H
Sbjct: 273 LVLVSH 278

>KLTH0D10890g Chr4 complement(891012..893504) [2493 bp, 830 aa] {ON}
           similar to uniprot|P41909 Saccharomyces cerevisiae
           YPL147W PXA1 Pxa1p and Pxa2p appear to be subunits of a
           peroxisomal ATP-binding cassette transporter necessary
           for transport of long-chain fatty acids into peroxisomes
           ABC family long-chain fatty acid transporter
          Length = 830

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 52/201 (25%), Positives = 94/201 (46%), Gaps = 25/201 (12%)

Query: 515 PGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRHLGVVQQEPM 574
           PGS++ I+GP+G GK++I  ++   +   +    +     S L C         V Q+P 
Sbjct: 599 PGSSMLILGPNGSGKTSIQRIIAEIWPIYNKNGLLSIPPASDLFC---------VPQKPY 649

Query: 575 LMSG-SIKYNLTYGLQSEVSMDEIRSVAKKCFCH-------GFVTKFPNGYDTI--IGPR 624
            + G + +  + Y + ++   D       K   H        ++ K   G+  +  +   
Sbjct: 650 FIQGGTFREQIIYPMSADQYFD--MGYRDKELTHILGEVKLDYLLKRDKGWRYLDAVAEW 707

Query: 625 GASLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTIISI 684
              LSGG++QRI  AR +  KP+ ++LDEAT+A+  + E   +Y  G L+K      I+I
Sbjct: 708 KDVLSGGERQRINFARIMFHKPRFVVLDEATNAISADME---DYLFG-LLKRYRFNFITI 763

Query: 685 AHRLSTIRRSENVIVLGNDGS 705
           + R S I+  +  + +  DG+
Sbjct: 764 SQRPSLIKYHDLALDISTDGT 784

>KNAG0K00950 Chr11 complement(186381..190235) [3855 bp, 1284 aa]
           {ON} Anc_3.133 YOL075C
          Length = 1284

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 68/271 (25%), Positives = 122/271 (45%), Gaps = 33/271 (12%)

Query: 461 SRLFEMTDHAPSIKPTAGKPYVPGSGKISFKDVSFSYP-------TRPGNQIFNK----- 508
           SRL + +D    ++     PY     ++S KD++ +         ++  N+I N+     
Sbjct: 640 SRLIQNSDKDIDLESKDSHPY---EVEVSLKDITLTVDYIHVQGISQWRNKIINRERKKI 696

Query: 509 ---LNFTIEPGSNVCIVGPSGRGKSTITSLL-------LRYYNPSSGQITIDDQDISRLS 558
              +N T +PG    I+GPSG GKST+ +L+       L       G ++ +  ++S   
Sbjct: 697 LRSVNATFKPGMVNAIMGPSGSGKSTLLNLISGRVKSTLFSRFTKDGSMSFNGAEVSETM 756

Query: 559 CKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKF--PNG 616
            K +  +  V Q +  L+S  +    T+   S++ +  + +  ++   +  +      + 
Sbjct: 757 FKQICSY--VSQDDDHLLS-KLTVRETFKFASDLRLHHLNAKEREAKRNNLIIALGLKHC 813

Query: 617 YDTIIGPRGAS-LSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMK 675
            DTIIG      +SGG+K+R+ +   L+  P IL+LDE TS LD  +   I   L  L +
Sbjct: 814 EDTIIGNEFVKGISGGEKRRVTMGIQLLNDPPILLLDEPTSGLDSFTSSTILEILSNLCQ 873

Query: 676 SKELTIISIAH--RLSTIRRSENVIVLGNDG 704
               T+I   H  R    ++  NV++L   G
Sbjct: 874 EYGKTVILTIHQPRAELFKKFGNVLLLAKSG 904

 Score = 45.8 bits (107), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 52/94 (55%), Gaps = 6/94 (6%)

Query: 618 DTIIGP---RGASLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLM 674
           DTIIG    RG  LSGG+K+R++I   ++  P I+ LDE T+ LD  S   +  T+ KL 
Sbjct: 153 DTIIGDSSHRG--LSGGEKRRLSIGTQMIANPSIMFLDEPTTGLDAYSAYLVVKTIRKLA 210

Query: 675 KSK-ELTIISIAHRLSTIRRSENVIVLGNDGSVV 707
           +    + I+SI    S I    + + + + G++V
Sbjct: 211 EDDGRIFIMSIHQPRSDIMFLLDKVCILSKGNIV 244

>Suva_2.583 Chr2 (1030711..1035324) [4614 bp, 1537 aa] {ON} YDR406W
            (REAL)
          Length = 1537

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 61/240 (25%), Positives = 114/240 (47%), Gaps = 27/240 (11%)

Query: 490  FKDVSFSYPTRPGNQ-IFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPS--SGQ 546
            ++D+ +  P + G + I N ++  ++PG+   ++G SG GK+T+   L         +G 
Sbjct: 893  WRDLCYDVPVKGGERRILNNVDGWVKPGTLTALMGASGAGKTTLLDCLAERVTMGVITGN 952

Query: 547  ITIDDQDISRLSCKSLRRHLGVVQQEPM-LMSGSIKYNLTYGLQ----SEVSMDE----I 597
            I +D     RL  +S  R +G  QQ+ + L + +++ +L +       S VS++E    +
Sbjct: 953  IFVD----GRLRDESFPRSIGYCQQQDLHLKTATVRESLRFSAYLRQPSSVSLEEKDKYV 1008

Query: 598  RSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILI-LDEATS 656
              V K       + +     D ++G  G  L+  Q++R+ I   L  +PK+L+ LDE TS
Sbjct: 1009 EEVIK-------ILEMEKYSDAVVGVAGEGLNVEQRKRLTIGVELAARPKLLVFLDEPTS 1061

Query: 657  ALDVESEGAINYTLGKLMKSKELTIISIAHRLSTI--RRSENVIVLGNDGSVVEVGKFKD 714
             LD ++       + KL    +  + +I H+ S I  ++ + ++ L   G  V  G   D
Sbjct: 1062 GLDSQTAWDTCQLMRKLATHGQAILCTI-HQPSAILMQQFDRLLFLQRGGQTVYFGDLGD 1120

>NCAS0E00480 Chr5 (81549..83381) [1833 bp, 610 aa] {ON} 
          Length = 610

 Score = 65.9 bits (159), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 46/187 (24%), Positives = 83/187 (44%), Gaps = 45/187 (24%)

Query: 488 ISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQI 547
           ++F  +SFSY   P N ++  L+F ++  S + +VGP+G GKST+  ++     P SG++
Sbjct: 393 LAFDSISFSYDGNPENNLYENLDFGVDMDSRIALVGPNGVGKSTLLKIMTGELTPQSGRV 452

Query: 548 --------------TIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVS 593
                         + D  D+++ + + +R     + Q+     G +     YGL  E  
Sbjct: 453 SRHTHVKLGVYSQHSQDQLDLTKSALEFVRDKYPNISQDFQYWRGQLG---RYGLTGE-- 507

Query: 594 MDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDE 653
                                 G    +G    +LS GQ+ R+  A   +++P +L+LDE
Sbjct: 508 ----------------------GQTVQMG----TLSEGQRSRVVFALLALEQPNVLLLDE 541

Query: 654 ATSALDV 660
            T+ LD+
Sbjct: 542 PTNGLDI 548

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 39/60 (65%), Gaps = 4/60 (6%)

Query: 627 SLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTIISIAH 686
            +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+       L + +K  + T++ ++H
Sbjct: 226 DMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 281

>Smik_15.84 Chr15 complement(153969..157856) [3888 bp, 1295 aa] {ON}
           YOL075C (REAL)
          Length = 1295

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 65/224 (29%), Positives = 105/224 (46%), Gaps = 37/224 (16%)

Query: 504 QIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLL--------LRYYNPSSGQITIDDQDIS 555
           QI   +N   +PG    I+GPSG GKS++ +L+           +N ++G I ++D  +S
Sbjct: 709 QILQSVNAIFKPGMINAIMGPSGSGKSSLLNLISGRLKSSFFAKFN-TAGSIMLNDIQVS 767

Query: 556 RLSCKSLRRHLGVVQQEPMLMSG-----SIKY-------NLTYGLQSEVSMDEIRSVAKK 603
               K++  +  V Q +  L++      ++KY       +LT   + E + + IRS+  K
Sbjct: 768 EFMFKNVCSY--VSQDDDHLLATLTVKETLKYASALRLHHLTEAERMERTDNLIRSLGLK 825

Query: 604 CFCHGFVTKFPNGYDTIIGPRGAS-LSGGQKQRIAIARALMKKPKILILDEATSALDVES 662
             C           + IIG      +SGG+K+R+ +   L+  P IL+LDE TS LD  +
Sbjct: 826 -HCE----------NNIIGNEFVKGISGGEKRRVTMGVQLLNDPPILLLDEPTSGLDSFT 874

Query: 663 EGAINYTLGKLMKSKELTIISIAH--RLSTIRRSENVIVLGNDG 704
              I   L KL   +  T+I   H  R    +R  NV++L   G
Sbjct: 875 SATILEILEKLCTEQGKTVIITIHQPRSELFKRFGNVLLLAKSG 918

 Score = 48.5 bits (114), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 35/111 (31%), Positives = 58/111 (52%), Gaps = 2/111 (1%)

Query: 618 DTIIGPRGA-SLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKS 676
           DT++G      LSGG+K+R++I   ++  P ++ LDE T+ LD  S   +  TL KL K 
Sbjct: 175 DTLVGDNSHRGLSGGEKRRLSIGTQMISNPSVMFLDEPTTGLDAYSAYLVIKTLKKLAKE 234

Query: 677 KELT-IISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQSELYKL 726
              T I+SI    S I    + + + + G+VV   K  ++    +S  Y++
Sbjct: 235 DGRTFIMSIHQPRSDILFLLDQVCILSKGNVVYCDKMNNIIPYFESIGYRI 285

>TBLA0D04350 Chr4 complement(1076344..1079703) [3360 bp, 1119 aa]
           {ON} Anc_1.427 YCR011C
          Length = 1119

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 67/238 (28%), Positives = 116/238 (48%), Gaps = 17/238 (7%)

Query: 488 ISFKDVSFSYPTRPGNQ----IFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLL--RYYN 541
           +SF+++S++ P+   N     I   ++  ++PG  + I+G SG GK+T+  +L   R   
Sbjct: 433 LSFENISYNVPSISDNNSERDILKNVSGIVKPGEIMAILGGSGAGKTTLLDILAFKRKSG 492

Query: 542 PSSGQITIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYN--LTYGLQSEVSMDEIRS 599
             SG I I+ +++SR   + + + +G V Q+  L      Y   L   L    +      
Sbjct: 493 HVSGDIKINGKNVSR---EIISKMIGFVDQDDFLFPTLTVYEAVLNSALLRLPNSMTFYQ 549

Query: 600 VAKKCFCHGFVTKFPNGYDTIIG---PRGASLSGGQKQRIAIARALMKKPKILILDEATS 656
             ++ F      +  N  D +IG    RG  +SGG+K+R++IA  L+  P IL LDE TS
Sbjct: 550 KQQRVFQVLEELRIYNIKDRLIGDDFERG--ISGGEKRRVSIACELVTSPLILFLDEPTS 607

Query: 657 ALDVESEGAINYTLGKLMKSKELTIISIAHR-LSTIRRSENVIVLGNDGSVVEVGKFK 713
            LD  +   +   L +L K+   T++   H+  S I    + +VL + G +V  G+ +
Sbjct: 608 GLDSNNANNVVECLVRLAKNYNRTLVLTIHQPRSNIFHLFSKLVLLSSGEMVYSGEIR 665

>Suva_15.91 Chr15 complement(162469..166377) [3909 bp, 1302 aa] {ON}
           YOL075C (REAL)
          Length = 1302

 Score = 65.9 bits (159), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 66/236 (27%), Positives = 105/236 (44%), Gaps = 33/236 (13%)

Query: 490 FKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLL-------LRYYNP 542
           FK+   S       +I   +N   +PG    I+GPSG GKS++ +L+       L     
Sbjct: 702 FKNWKESKLHHETKEILQSVNAVFKPGMINAIMGPSGSGKSSLLNLISGRLKSSLFAKFD 761

Query: 543 SSGQITIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGL-----------QSE 591
           +SG I  +D  +S L  K++  ++     + +L + ++K  L Y             ++E
Sbjct: 762 TSGTIMFNDIQVSELMFKNVCSYVSQ-DDDHLLATLTVKETLKYAAALRLHHLNEAERTE 820

Query: 592 VSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGAS-LSGGQKQRIAIARALMKKPKILI 650
            + + IRS+  K  C           + IIG      +SGG+K+R+ +   L+  P IL+
Sbjct: 821 RTDNLIRSLGLK-HCE----------NNIIGNEFVKGISGGEKRRVTMGVQLLSDPPILL 869

Query: 651 LDEATSALDVESEGAINYTLGKLMKSKELTIISIAH--RLSTIRRSENVIVLGNDG 704
           LDE TS LD  +   I   L  L K    T+I   H  R    +R  NV++L   G
Sbjct: 870 LDEPTSGLDSFTSATILEILENLCKEHGKTVIITIHQPRSELFKRFGNVLLLAKSG 925

 Score = 49.7 bits (117), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 54/218 (24%), Positives = 96/218 (44%), Gaps = 32/218 (14%)

Query: 499 TRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLL-------------LRYY----N 541
           ++    + N  +  +  GS + ++G SG GK+T+ ++L             +RY      
Sbjct: 38  SKTNTTLVNSFSMDLPSGSVMAVMGGSGSGKTTLLNVLASKISGGLRHEGSIRYVLEDSE 97

Query: 542 PSSGQITIDDQDI----SRLSCKSLRRHLGVV-----QQEPMLMSGSIKYNLTYGLQSEV 592
           P SG  + +  D+    SRL  +       V+     QQ+  ++S  +    T    +++
Sbjct: 98  PGSGYGSEESVDVKAKNSRLDGEDHHTQKHVIMAYLPQQD--VLSPRLTCRETLNFAADL 155

Query: 593 SMDEIRSVAKKCFCHGFVTKFP--NGYDTIIGPRGA-SLSGGQKQRIAIARALMKKPKIL 649
            ++   S  KK      + +    +  DT++G      LSGG+K+R++I   ++  P I+
Sbjct: 156 KLNS-SSRTKKLMVEQLIEELGLRDCADTLVGDNSHRGLSGGEKRRLSIGTQMISNPSIM 214

Query: 650 ILDEATSALDVESEGAINYTLGKLMKSKELTIISIAHR 687
            LDE T+ LD  S   +  TL KL K    T I   H+
Sbjct: 215 FLDEPTTGLDAYSAFLVIKTLKKLAKEDGRTFIMSIHQ 252

>NCAS0A12060 Chr1 (2388467..2393098) [4632 bp, 1543 aa] {ON} Anc_5.500
          Length = 1543

 Score = 65.9 bits (159), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 59/234 (25%), Positives = 114/234 (48%), Gaps = 15/234 (6%)

Query: 490  FKDVSFSYPTRPG-NQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQIT 548
            ++D+ +  P +    +I N ++  ++PG+   ++G SG GK+T+   L      + G IT
Sbjct: 880  WRDLCYDVPIKKEVRRILNNVDGWVKPGTLTALMGASGAGKTTLLDCLAE--RVTMGTIT 937

Query: 549  IDDQDISRLSCKSLRRHLGVVQQEPM-LMSGSIKYNLTYGLQ----SEVSMDEIRSVAKK 603
             +     RL  +S  R +G  QQ+ + L + +++ +L +       + VS++E     ++
Sbjct: 938  GNIYVDGRLRDESFPRSIGYCQQQDLHLKTSTVRESLRFSAYLRQPAAVSIEEKNKYVEE 997

Query: 604  CFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILI-LDEATSALDVES 662
                  + +     D ++G  G  L+  Q++R+ I   L  KPK+L+ LDE TS LD ++
Sbjct: 998  VI---RILEMEAYADAVVGVAGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQT 1054

Query: 663  EGAINYTLGKLMKSKELTIISIAHRLSTI--RRSENVIVLGNDGSVVEVGKFKD 714
              A    + KL ++ +  + +I H+ S I  +  + ++ L   G  V  G   D
Sbjct: 1055 AWATCQLMRKLAENGQAILCTI-HQPSAILMQDFDRLLFLQKGGQTVYFGDLGD 1107

>TDEL0B05760 Chr2 (1017816..1020926) [3111 bp, 1036 aa] {ON}
           Anc_1.427 YCR011C
          Length = 1036

 Score = 65.5 bits (158), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 64/257 (24%), Positives = 121/257 (47%), Gaps = 48/257 (18%)

Query: 485 SGKISFKDVSFSYPT-RPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLL--RYYN 541
           +  +SF++++++  + +    I   ++  I+PG  + ++G SG GK+T+  +L   R   
Sbjct: 374 AAALSFENITYNVSSSKTDENILKGISGIIKPGQMMALLGGSGAGKTTLLDILAMKRKTG 433

Query: 542 PSSGQITIDDQDISRLSCKSLRRHLGVVQQ-----------EPMLMSGSIKYNLTYGLQS 590
             +G I ++  DI R   K   + +G V Q           E +L S  ++   ++   +
Sbjct: 434 QVTGSIKVNGSDIPR---KDFTKLIGFVDQDDYLLPTLTVYETVLNSALLRLPRSFSFAA 490

Query: 591 EVS-----MDEIRSVAKKCFCHGFVTKFPNGYDTIIG---PRGASLSGGQKQRIAIARAL 642
           + +     ++E+R +  K              D +IG    RG  +SGG+K+R++IA  L
Sbjct: 491 KQTRVYQVLEELRILDIK--------------DRVIGNDFERG--ISGGEKRRVSIACEL 534

Query: 643 MKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTIISIAH--RLSTIRRSENVIVL 700
           +  P IL LDE TS LD  +   +   L +L K+   T++   H  R +  +  + +++L
Sbjct: 535 VTSPLILFLDEPTSGLDANNANNVVECLVRLAKTYNRTLVLSIHQPRSNIFQLFDKLVLL 594

Query: 701 GN-----DGSVVEVGKF 712
            N      G  + VG+F
Sbjct: 595 SNGEMVYSGDAIRVGEF 611

>KLLA0A01452g Chr1 (130078..131901) [1824 bp, 607 aa] {ON} highly
           similar to uniprot|P40024 Saccharomyces cerevisiae
           YER036C
          Length = 607

 Score = 65.1 bits (157), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 58/224 (25%), Positives = 102/224 (45%), Gaps = 34/224 (15%)

Query: 450 YSELMKGAGAASRLFEMTDHAPSIKPTAGKPYV----PGSGKI-----SFKDVSFSYPTR 500
           Y+ L+K A +  ++ +  +    I+P A         P   ++     +F D+SFSY   
Sbjct: 343 YANLVKQAKSRQKILDKMEADGLIQPVAADKVFSFRFPEVERLPPPVLAFDDISFSYDGN 402

Query: 501 PGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCK 560
             N ++  L+F ++  S + +VGP+G GKST+  ++       +GQ+T     +SR S  
Sbjct: 403 SENNLYEHLDFGVDMDSRIALVGPNGVGKSTLLKIM-------TGQLTTQSGRVSRHS-- 453

Query: 561 SLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKC-FCHGFVTKF---PNG 616
                LGV  Q         K  L      E   D+   V++   +  G + ++     G
Sbjct: 454 --HVKLGVYSQHSQDQLDLTKSAL------EFVRDKYPHVSQDFQYWRGQLGRYGLTGEG 505

Query: 617 YDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDV 660
               +G    +LS GQ+ R+  A   +++P +L+LDE T+ LD+
Sbjct: 506 QTVQMG----TLSEGQRSRVVFALLALEQPNVLLLDEPTNGLDI 545

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 41/66 (62%), Gaps = 4/66 (6%)

Query: 621 IGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELT 680
           I  +   +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+       L + +K  + T
Sbjct: 217 INKKTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRT 272

Query: 681 IISIAH 686
           ++ ++H
Sbjct: 273 LVLVSH 278

>Skud_4.680 Chr4 (1201243..1205580) [4338 bp, 1445 aa] {ON} YDR406W
            (REAL)
          Length = 1445

 Score = 65.5 bits (158), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 60/232 (25%), Positives = 113/232 (48%), Gaps = 19/232 (8%)

Query: 490  FKDVSFSYPTRPGNQ-IFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPS--SGQ 546
            ++D+ +  P + G + I N +N  ++PG+   ++G SG GK+T+   L         +G 
Sbjct: 802  WRDLCYDVPVKGGERRILNNVNGWVKPGTLTALMGASGAGKTTLLDCLAERVTMGVITGG 861

Query: 547  ITIDDQDISRLSCKSLRRHLGVVQQEPM-LMSGSIKYNLTYGLQ----SEVSMDEIRSVA 601
            I +D     RL  +S  R +G  QQ+ + L + +++ +L +       S VS++E     
Sbjct: 862  IFVD----GRLRDESFPRSIGYCQQQDLHLKTATVRESLRFSAYLRQPSSVSVEEKNKYV 917

Query: 602  KKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILI-LDEATSALDV 660
            ++      + K+    D ++G  G  L+  Q++R+ I   L  +PK+L+ LDE TS LD 
Sbjct: 918  EEVIKILEMEKYS---DAVVGIAGEGLNVEQRKRLTIGVELAARPKLLVFLDEPTSGLDS 974

Query: 661  ESEGAINYTLGKLMKSKELTIISIAHRLSTI--RRSENVIVLGNDGSVVEVG 710
            ++       + KL    +  + +I H+ S I  ++ + ++ L   G  V  G
Sbjct: 975  QTAWDTCQLMRKLATHGQAILCTI-HQPSAILMQQFDRLLFLQRGGQTVYFG 1025

>Skud_4.681 Chr4 (1201243..1205580) [4338 bp, 1445 aa] {ON} YDR406W
            (REAL)
          Length = 1445

 Score = 65.5 bits (158), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 60/232 (25%), Positives = 113/232 (48%), Gaps = 19/232 (8%)

Query: 490  FKDVSFSYPTRPGNQ-IFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPS--SGQ 546
            ++D+ +  P + G + I N +N  ++PG+   ++G SG GK+T+   L         +G 
Sbjct: 802  WRDLCYDVPVKGGERRILNNVNGWVKPGTLTALMGASGAGKTTLLDCLAERVTMGVITGG 861

Query: 547  ITIDDQDISRLSCKSLRRHLGVVQQEPM-LMSGSIKYNLTYGLQ----SEVSMDEIRSVA 601
            I +D     RL  +S  R +G  QQ+ + L + +++ +L +       S VS++E     
Sbjct: 862  IFVD----GRLRDESFPRSIGYCQQQDLHLKTATVRESLRFSAYLRQPSSVSVEEKNKYV 917

Query: 602  KKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILI-LDEATSALDV 660
            ++      + K+    D ++G  G  L+  Q++R+ I   L  +PK+L+ LDE TS LD 
Sbjct: 918  EEVIKILEMEKYS---DAVVGIAGEGLNVEQRKRLTIGVELAARPKLLVFLDEPTSGLDS 974

Query: 661  ESEGAINYTLGKLMKSKELTIISIAHRLSTI--RRSENVIVLGNDGSVVEVG 710
            ++       + KL    +  + +I H+ S I  ++ + ++ L   G  V  G
Sbjct: 975  QTAWDTCQLMRKLATHGQAILCTI-HQPSAILMQQFDRLLFLQRGGQTVYFG 1025

>KAFR0A03790 Chr1 complement(770906..773536) [2631 bp, 876 aa] {ON}
           Anc_8.661 YPL147W
          Length = 876

 Score = 65.1 bits (157), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 58/216 (26%), Positives = 104/216 (48%), Gaps = 29/216 (13%)

Query: 503 NQIFNKLN--FTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCK 560
           N+I N ++  F    GS++ I+GP+G GKS+I  ++   + P   +        + L  K
Sbjct: 629 NEITNDISIPFLNSAGSSLLILGPNGCGKSSIQRIIAEIW-PIYNK--------NGLLSK 679

Query: 561 SLRRHLGVVQQEPMLM-SGSIKYNLTYGLQSEVSMDEIRSVAKKCFCH-------GFVTK 612
               +L  V Q+P     G+++  + Y + S+   D  R +  K            ++ K
Sbjct: 680 PTEANLLCVPQKPYFTRGGTLRDQIIYPMSSDEFFD--RGLKDKLLVQVLREVKLDYLLK 737

Query: 613 FPNGY---DTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYT 669
              G+   DT+   +   LSGG+KQR+  AR +  KP+ ++LDEAT+A+  + E      
Sbjct: 738 RDKGWSYLDTVSDWKDV-LSGGEKQRMNFARIMFHKPRFVVLDEATNAISADMEDY---- 792

Query: 670 LGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGS 705
           L  ++K      I+I+ R S I+  + ++ + +D S
Sbjct: 793 LFNVLKRYRFNFITISQRPSLIKYHDLLLEISDDNS 828

>KLLA0A10857g Chr1 complement(941784..944042) [2259 bp, 752 aa] {ON}
           highly similar to uniprot|P43535 Saccharomyces
           cerevisiae YFR009W GCN20 Positive regulator of the Gcn2p
           kinase activity forms a complex with Gcn1p proposed to
           stimulate Gcn2p activation by an uncharged tRNA
          Length = 752

 Score = 64.7 bits (156), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 59/229 (25%), Positives = 91/229 (39%), Gaps = 45/229 (19%)

Query: 488 ISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQI 547
           I  +DVSFSY  +  + +   +N  ++  S + +VG +G GK+T+  +++    P+ G  
Sbjct: 532 IQLQDVSFSY--KESDPLLTDVNLDVQMDSRISLVGANGCGKTTLLKVMMEQLRPTKG-- 587

Query: 548 TIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCH 607
                                V + P L  G       Y  Q  V   ++   A      
Sbjct: 588 --------------------FVSRNPRLRIG-------YFTQHHVDSMDLNQSAVDWMST 620

Query: 608 GFVTKFPNGYDTIIGPRGAS----------LSGGQKQRIAIARALMKKPKILILDEATSA 657
            F  K    Y   +G  G S          LSGGQK R+A A   +  P IL+LDE ++ 
Sbjct: 621 AFPGKTDEEYRRHLGAFGISGSLGIQRMQLLSGGQKSRVAFAALCLNNPHILVLDEPSNH 680

Query: 658 LDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSV 706
           LD     A    L   +KS    ++ ++H +S I    N I +   G V
Sbjct: 681 LDTAGLDA----LVDALKSFNGGVLMVSHDISVINSVCNEIWVSEGGKV 725

 Score = 45.1 bits (105), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 40/60 (66%), Gaps = 4/60 (6%)

Query: 627 SLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTIISIAH 686
           S SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y L + +K+   T++ ++H
Sbjct: 367 SFSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LAEYLKTYPATVLVVSH 422

>KNAG0C01960 Chr3 complement(380896..383154) [2259 bp, 752 aa] {ON}
           Anc_1.366 YFR009W
          Length = 752

 Score = 64.7 bits (156), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 56/233 (24%), Positives = 97/233 (41%), Gaps = 45/233 (19%)

Query: 488 ISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQI 547
           I  +DVSF Y  +  + +   +N  ++  S + +VG +G GK+T+  +++    P+SG +
Sbjct: 532 IQLQDVSFGYEEQ--SLLLKDVNLDVQMDSRIALVGANGCGKTTLLKVMMEQLRPTSGYV 589

Query: 548 TIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCH 607
           +           ++ R  +G                  Y  Q  V   ++ + A      
Sbjct: 590 S-----------RNGRLRIG------------------YFTQHHVDSMDLNTSAVDWMSK 620

Query: 608 GFVTKFPNGYDTIIGPRGAS----------LSGGQKQRIAIARALMKKPKILILDEATSA 657
            +  K    Y   +G  G +          LSGGQK R+A A   +  P IL+LDE ++ 
Sbjct: 621 TYPGKTDEEYRRHLGAFGITGTLGLQQMQLLSGGQKSRVAFAALCLNNPHILVLDEPSNH 680

Query: 658 LDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVG 710
           LD     A+   L K        ++ ++H +S I    N I +  DG+V + G
Sbjct: 681 LDTTGLEALVDALKKFTGG----VLMVSHDISVIDSVCNEIWVSEDGNVKKFG 729

 Score = 45.4 bits (106), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 41/60 (68%), Gaps = 4/60 (6%)

Query: 627 SLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTIISIAH 686
           S SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y L + +K+   T+++++H
Sbjct: 367 SFSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LAEYLKTYPSTVLTVSH 422

>KAFR0C05220 Chr3 (1042497..1046996) [4500 bp, 1499 aa] {ON} Anc_5.500
            YDR406W
          Length = 1499

 Score = 65.1 bits (157), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 59/234 (25%), Positives = 116/234 (49%), Gaps = 15/234 (6%)

Query: 490  FKDVSFSYPTRPGNQ-IFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQIT 548
            ++++ +  P + G + + + ++  ++PG+   ++G SG GK+T+   L      + G IT
Sbjct: 853  WRNLCYDIPIKHGTRRLLDNVDGWVKPGTLTALMGASGAGKTTLLDCLAE--RVTMGVIT 910

Query: 549  IDDQDISRLSCKSLRRHLGVVQQEPM-LMSGSIKYNLTYGLQ----SEVSMDEIRSVAKK 603
             D     R   +S  R +G  QQ+ + L + +++ +L +       +EVS++E  +  ++
Sbjct: 911  GDVLVDGRPRDESFPRSIGYCQQQDLHLKTSTVRESLRFSAYLRQPAEVSVEEKDAYVEE 970

Query: 604  CFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILI-LDEATSALDVES 662
                  + K+    D ++G  G  L+  Q++R+ I   L  KPK+L+ LDE TS LD ++
Sbjct: 971  VIKILEMEKYA---DAVVGVAGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQT 1027

Query: 663  EGAINYTLGKLMKSKELTIISIAHRLSTIRRSE--NVIVLGNDGSVVEVGKFKD 714
              +I   + KL    +  + +I H+ S I   E   ++ L + G     G+  D
Sbjct: 1028 AWSICQLMRKLASHGQAILCTI-HQPSAILMQEFDRLLFLQDGGQTTYFGELGD 1080

>YDR406W Chr4 (1279210..1283799) [4590 bp, 1529 aa] {ON}  PDR15Plasma
            membrane ATP binding cassette (ABC) transporter,
            multidrug transporter and general stress response factor
            implicated in cellular detoxification; regulated by
            Pdr1p, Pdr3p and Pdr8p; promoter contains a PDR
            responsive element
          Length = 1529

 Score = 65.1 bits (157), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 60/236 (25%), Positives = 113/236 (47%), Gaps = 27/236 (11%)

Query: 490  FKDVSFSYPTRPGNQ-IFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPS--SGQ 546
            ++D+ +  P + G + I N ++  ++PG+   ++G SG GK+T+   L         +G 
Sbjct: 886  WRDLCYDVPIKGGQRRILNNVDGWVKPGTLTALMGASGAGKTTLLDCLAERVTMGVITGN 945

Query: 547  ITIDDQDISRLSCKSLRRHLGVVQQEPM-LMSGSIKYNLTYGLQ----SEVSMDE----I 597
            I +D     RL  +S  R +G  QQ+ + L + +++ +L +       S VS++E    +
Sbjct: 946  IFVD----GRLRDESFPRSIGYCQQQDLHLKTATVRESLRFSAYLRQPSSVSIEEKNRYV 1001

Query: 598  RSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILI-LDEATS 656
              V K       + +     D ++G  G  L+  Q++R+ I   L  +PK+L+ LDE TS
Sbjct: 1002 EEVIK-------ILEMQQYSDAVVGVAGEGLNVEQRKRLTIGVELAARPKLLVFLDEPTS 1054

Query: 657  ALDVESEGAINYTLGKLMKSKELTIISIAHRLSTI--RRSENVIVLGNDGSVVEVG 710
             LD ++       + KL    +  + +I H+ S I  ++ + ++ L   G  V  G
Sbjct: 1055 GLDSQTAWDTCQLMRKLATHGQAILCTI-HQPSAILMQQFDRLLFLQKGGQTVYFG 1109

 Score = 31.6 bits (70), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 40/175 (22%), Positives = 65/175 (37%), Gaps = 27/175 (15%)

Query: 504 QIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISR--LSCKS 561
           QI   ++  + PG  + ++G  G G    T+LL    + S G     D  +S   LS   
Sbjct: 184 QILKPMDGCLNPGELLVVLGRPGSG---CTTLLKSISSNSHGFKIAKDSIVSYNGLSSSD 240

Query: 562 LRR-----------------HLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKC 604
           +R+                 HL V Q    +       N   G+  E   + +  VA   
Sbjct: 241 IRKHYRGEVVYNAESDIHLPHLTVYQTLFTVARMKTPQNRIKGVDREAYANHVTEVAMAT 300

Query: 605 FCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALD 659
           +          G D + G     +SGG+++R++IA   +   +    D AT  LD
Sbjct: 301 YGLSHTRDTKVGNDLVRG-----VSGGERKRVSIAEVAICGARFQCWDNATRGLD 350

>NDAI0C01220 Chr3 (246762..251291) [4530 bp, 1509 aa] {ON} Anc_5.500
          Length = 1509

 Score = 64.7 bits (156), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 59/210 (28%), Positives = 104/210 (49%), Gaps = 15/210 (7%)

Query: 492  DVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDD 551
            DV     TR   +I N ++  ++PG+   ++G SG GK+T+   L      + G IT + 
Sbjct: 872  DVQIKTETR---RILNNVDGWVKPGTLTALMGASGAGKTTLLDCLAE--RVTMGVITGEV 926

Query: 552  QDISRLSCKSLRRHLGVVQQEPM-LMSGSIKYNLTYGLQ----SEVSMDEIRSVAKKCFC 606
                RL  +S  R +G  QQ+ + L + +++ +L +       S+VS++E     ++   
Sbjct: 927  SVNGRLRDESFPRSIGYCQQQDLHLKTSTVRESLRFSAYLRQPSDVSIEEKNKYVEEIIK 986

Query: 607  HGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILI-LDEATSALDVESEGA 665
               + K+    D ++G  G  L+  Q++R+ I   L  KPK+L+ LDE TS LD ++  +
Sbjct: 987  ILEMEKYA---DAVVGVAGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWS 1043

Query: 666  INYTLGKLMKSKELTIISIAHRLSTIRRSE 695
            I   + KL    +  + +I H+ S I   E
Sbjct: 1044 ICQLMKKLADHGQAILCTI-HQPSAILMQE 1072

>KAFR0C04540 Chr3 complement(907385..909643) [2259 bp, 752 aa] {ON}
           Anc_1.366 YFR009W
          Length = 752

 Score = 64.3 bits (155), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 61/250 (24%), Positives = 106/250 (42%), Gaps = 60/250 (24%)

Query: 488 ISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQI 547
           I  +DVSF Y  +  N +   +N  ++  S + +VG +G GK+T+  +++    P  G +
Sbjct: 532 IQLQDVSFGYDEK--NLLLKDVNLDVQMDSRIALVGANGCGKTTLLKVMMEQLRPLQGYV 589

Query: 548 TIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCH 607
           +           ++ R  +G                  Y  Q  V   ++ + A      
Sbjct: 590 S-----------RNGRLRIG------------------YFTQHHVDSMDLTTSAVDWMSK 620

Query: 608 GFVTKFPNGYDTIIGPRGAS----------LSGGQKQRIAIARALMKKPKILILDEATSA 657
            F  K    Y   +G  G +          LSGGQK R+A A   +  P ILILDE ++ 
Sbjct: 621 TFPGKNDEEYRRHLGAFGITGSLGLQKMQLLSGGQKSRVAFAALCLNNPHILILDEPSNH 680

Query: 658 LDVESEGAI-----NYTLGKLMKSKELTII-SIAHRL-----STIRR--------SENVI 698
           LD     A+     N++ G LM S ++++I S+ + +      T+++         +++I
Sbjct: 681 LDTTGLDALIDALKNFSGGVLMVSHDISVINSVCNEIWVSEEGTVKKFGGSIYDYRDHII 740

Query: 699 VLGNDGSVVE 708
            L ND  VV+
Sbjct: 741 SLANDAGVVK 750

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 40/60 (66%), Gaps = 4/60 (6%)

Query: 627 SLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTIISIAH 686
           S SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y L + +K+   T++ ++H
Sbjct: 367 SFSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LSEYLKTYPATLLVVSH 422

>Smik_7.313 Chr7 (524077..526335) [2259 bp, 752 aa] {ON} YFR009W
           (REAL)
          Length = 752

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 60/232 (25%), Positives = 96/232 (41%), Gaps = 52/232 (22%)

Query: 488 ISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQI 547
           I  +DVSF Y  +  N +   +N  ++  S + +VG +G GK+T+  +++          
Sbjct: 532 IQLQDVSFGYDEK--NLLLKDVNLDVQMDSRIALVGANGCGKTTLLKIMM---------- 579

Query: 548 TIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCH 607
                       + LR   G V + P L  G       Y  Q  V   ++ + A      
Sbjct: 580 ------------EQLRPLKGFVSRNPRLRIG-------YFTQHHVDSMDLTTSAVDWMSK 620

Query: 608 GFVTKFPNGYDTIIGPRGAS----------LSGGQKQRIAIARALMKKPKILILDEATSA 657
            F  K    Y   +G  G +          LSGGQK R+A A   +  P IL+LDE ++ 
Sbjct: 621 SFPGKTDEEYRRHLGSFGITGTLGLQKMQLLSGGQKSRVAFAALCLNNPHILVLDEPSNH 680

Query: 658 LDVESEGAI-----NYTLGKLMKSKELTII-SIAHRL-----STIRRSENVI 698
           LD     A+     N+  G LM S ++++I S+   +      T++R E  I
Sbjct: 681 LDTTGLDALVDALKNFNGGVLMVSHDISVIDSVCKEIWVSEQGTVKRFEGTI 732

 Score = 45.4 bits (106), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 41/60 (68%), Gaps = 4/60 (6%)

Query: 627 SLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTIISIAH 686
           S SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y L + +K+   T+++++H
Sbjct: 367 SFSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LAEYLKTYPNTVLTVSH 422

>Smik_4.678 Chr4 (1200036..1204637) [4602 bp, 1533 aa] {ON} YDR406W
            (REAL)
          Length = 1533

 Score = 64.3 bits (155), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 58/232 (25%), Positives = 113/232 (48%), Gaps = 19/232 (8%)

Query: 490  FKDVSFSYPTRPGNQ-IFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPS--SGQ 546
            ++D+ +  P + G + I N ++  ++PG+   ++G SG GK+T+   L         +G 
Sbjct: 890  WRDLCYDVPVKGGQRRILNNVDGWVKPGTLTALMGASGAGKTTLLDCLAERVTMGVITGN 949

Query: 547  ITIDDQDISRLSCKSLRRHLGVVQQEPM-LMSGSIKYNLTYGLQ----SEVSMDEIRSVA 601
            I +D     RL  +S  R +G  QQ+ + L + +++ +L +       S VS++E     
Sbjct: 950  IFVD----GRLRDESFPRSIGYCQQQDLHLKTATVRESLRFSAYLRQPSSVSIEEKNKYV 1005

Query: 602  KKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILI-LDEATSALDV 660
            ++      + K+    D ++G  G  L+  Q++R+ I   L  +PK+L+ LDE TS LD 
Sbjct: 1006 EEVIKILEMEKYS---DAVVGIAGEGLNVEQRKRLTIGVELAARPKLLVFLDEPTSGLDS 1062

Query: 661  ESEGAINYTLGKLMKSKELTIISIAHRLSTI--RRSENVIVLGNDGSVVEVG 710
            ++       + KL    +  + +I H+ S I  ++ + ++ +   G  V  G
Sbjct: 1063 QTAWDTCQLMRKLATHGQAILCTI-HQPSAILMQQFDRLLFMQRGGQTVYFG 1113

>KNAG0B03870 Chr2 complement(741637..746178) [4542 bp, 1