Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_55.222215.423ON38038019670.0
KLTH0E16566g5.423ON38137914990.0
NDAI0B055905.423ON38037211141e-151
NCAS0F032905.423ON40437010981e-148
CAGL0I01276g5.423ON38037210951e-148
KAFR0E038605.423ON37837710931e-148
SAKL0G02222g5.423ON37837310901e-147
Skud_8.1735.423ON37837110761e-145
YHR112C5.423ON37837110721e-145
Suva_15.3085.423ON37837110711e-145
Smik_8.1905.423ON42037110641e-143
KNAG0F01580singletonON37937810601e-143
ZYRO0F09768g5.423ON37336610581e-143
ZYRO0F15664gsingletonON37337010331e-139
Kpol_1031.235.423ON37937110301e-138
KLLA0E21319g5.423ON38037210301e-138
TBLA0A036805.423ON38437110261e-138
Ecym_55235.423ON38137110251e-138
KNAG0C049905.423ON38037310201e-137
TBLA0B03020singletonON37937410091e-135
AER250C5.423ON37436910051e-135
CAGL0K05665gsingletonON37937010011e-134
TDEL0G00140singletonON3813819801e-131
NDAI0F00140singletonON3783739781e-131
TDEL0G04970singletonON3813789751e-130
TPHA0A06070na 1ON3733689491e-126
NDAI0B00595singletonON3783698921e-118
NCAS0F015207.97ON4293953352e-34
KAFR0K007607.97ON3923963313e-34
Skud_1.497.97ON3943973262e-33
NDAI0H024007.97ON3933953243e-33
Smik_1.557.97ON3943973235e-33
TPHA0L005707.97ON3913963225e-33
YAL012W (CYS3)7.97ON3943973226e-33
SAKL0B09614g7.97ON3923953201e-32
CAGL0H06369g7.97ON3913963182e-32
Kpol_1044.107.97ON3913903183e-32
Suva_1.567.97ON3953983157e-32
TDEL0H035307.97ON3914003085e-31
KLTH0D02728g7.97ON3923963085e-31
Ecym_26297.97ON3923903086e-31
KLLA0F07909g7.97ON3913943078e-31
AEL341W7.97ON3933933061e-30
TBLA0E022407.97ON3873943024e-30
ZYRO0D05742g7.97ON3913923014e-30
KNAG0D047407.97ON3903942972e-29
ZYRO0G19162g8.145ON4554062111e-17
TDEL0B046608.145ON4643902083e-17
Smik_7.375na 1ON4012641984e-16
CAGL0L06094g8.145ON4504001951e-15
TDEL0D06630singletonON4023421923e-15
Ecym_84058.145ON4723991897e-15
KLTH0E06644g8.145ON4603851898e-15
TPHA0F004204.53ON4424301871e-14
Skud_19.6singletonON4012481842e-14
KLLA0C17028g8.145ON4604111843e-14
Suva_17.6singletonON4012591808e-14
SAKL0H24882g8.145ON4593911764e-13
ACL059C8.145ON4532511754e-13
Smik_7.898.145ON4653941746e-13
Kwal_47.172218.145ON4634011746e-13
Skud_7.888.145ON4654011739e-13
NDAI0D028804.53ON4474441702e-12
NCAS0A058104.53ON4474441693e-12
YGL184C (STR3)8.145ON4653951666e-12
KAFR0F030704.53ON4454311594e-11
KNAG0I029204.53ON4453261586e-11
TBLA0C044004.53ON4454291586e-11
Kpol_1041.444.53ON4444331561e-10
SAKL0H23892g4.53ON4424311551e-10
Suva_7.798.145ON4654001542e-10
YFR055W (IRC7)na 1ON3401991513e-10
Ecym_83654.53ON4443931462e-09
ADL031W4.53ON4674371443e-09
KLLA0D04037g4.53ON4444311363e-08
KLTH0D03652g4.53ON4443971274e-07
Smik_12.3834.53ON4444351265e-07
ZYRO0G22198g4.53ON4454311265e-07
CAGL0D06402g4.53ON4424271241e-06
YLR303W (MET17)4.53ON4444431231e-06
Suva_10.3974.53ON4444351203e-06
NCAS0A062704.354ON6592571186e-06
Skud_12.3844.53ON4444361142e-05
Ecym_51694.354ON6812791142e-05
Kwal_26.74374.53ON4443121114e-05
TDEL0E056204.53ON4464411104e-05
KLTH0G00418gsingletonON5682541071e-04
CAGL0M00550g4.354ON5692421017e-04
TDEL0E05710singletonON5562531009e-04
KLTH0D17930g4.354ON652278960.003
Smik_10.4234.354ON639257960.003
AER164C4.354ON645295960.003
Skud_10.3534.354ON640262940.005
Kwal_14.791na 2ON571250930.007
Kpol_1028.804.354ON68986920.008
KNAG0M003304.354ON631257920.009
TDEL0D006104.354ON652269900.014
Suva_13.684.354ON688242880.025
Kwal_26.7197singletonOFF8766800.033
YLL058Wna 2ON575274830.11
Kwal_26.71947.97ON152134780.14
TPHA0L003304.354ON71786800.24
NDAI0D032604.354ON69693780.38
ZYRO0B08338g4.354ON640275780.43
KLLA0B04378g4.354ON688108780.44
Smik_13.554.354ON699244770.55
Suva_10.8na 2ON572253760.78
Skud_12.10na 2ON571249750.87
CAGL0H04169g4.354ON69877750.99
YML082W4.354ON649244731.9
SAKL0G18172g4.354ON673285713.1
KLLA0B00825g5.534ON39437695.1
SAKL0H15378g8.331ON3729190695.9
Skud_13.594.354ON64977687.4
Skud_7.4323.481ON51358678.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_55.22221
         (380 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_55.22221 s55 (1160724..1161866) [1143 bp, 380 aa] {ON} YHR1...   762   0.0  
KLTH0E16566g Chr5 (1468783..1469928) [1146 bp, 381 aa] {ON} simi...   582   0.0  
NDAI0B05590 Chr2 complement(1367293..1368435) [1143 bp, 380 aa] ...   433   e-151
NCAS0F03290 Chr6 complement(667618..668832) [1215 bp, 404 aa] {O...   427   e-148
CAGL0I01276g Chr9 complement(104391..105533) [1143 bp, 380 aa] {...   426   e-148
KAFR0E03860 Chr5 complement(766029..767165) [1137 bp, 378 aa] {O...   425   e-148
SAKL0G02222g Chr7 complement(186449..187585) [1137 bp, 378 aa] {...   424   e-147
Skud_8.173 Chr8 complement(308322..309458) [1137 bp, 378 aa] {ON...   419   e-145
YHR112C Chr8 complement(334527..335663) [1137 bp, 378 aa] {ON} P...   417   e-145
Suva_15.308 Chr15 complement(536926..538062) [1137 bp, 378 aa] {...   417   e-145
Smik_8.190 Chr8 complement(310892..312154) [1263 bp, 420 aa] {ON...   414   e-143
KNAG0F01580 Chr6 complement(282872..284011) [1140 bp, 379 aa] {O...   412   e-143
ZYRO0F09768g Chr6 complement(793824..794945) [1122 bp, 373 aa] {...   412   e-143
ZYRO0F15664g Chr6 (1286078..1287199) [1122 bp, 373 aa] {ON} high...   402   e-139
Kpol_1031.23 s1031 complement(55637..56776) [1140 bp, 379 aa] {O...   401   e-138
KLLA0E21319g Chr5 (1904841..1905983) [1143 bp, 380 aa] {ON} high...   401   e-138
TBLA0A03680 Chr1 complement(919740..920894) [1155 bp, 384 aa] {O...   399   e-138
Ecym_5523 Chr5 complement(1060537..1061682) [1146 bp, 381 aa] {O...   399   e-138
KNAG0C04990 Chr3 (960378..961520) [1143 bp, 380 aa] {ON} Anc_5.4...   397   e-137
TBLA0B03020 Chr2 complement(700483..701622) [1140 bp, 379 aa] {O...   393   e-135
AER250C Chr5 complement(1098456..1099580) [1125 bp, 374 aa] {ON}...   391   e-135
CAGL0K05665g Chr11 complement(552804..553943) [1140 bp, 379 aa] ...   390   e-134
TDEL0G00140 Chr7 complement(20315..21460) [1146 bp, 381 aa] {ON}      382   e-131
NDAI0F00140 Chr6 (15124..16260) [1137 bp, 378 aa] {ON}                381   e-131
TDEL0G04970 Chr7 complement(925785..926930) [1146 bp, 381 aa] {O...   380   e-130
TPHA0A06070 Chr1 complement(1370008..1371129) [1122 bp, 373 aa] ...   370   e-126
NDAI0B00595 Chr2 (131225..132361) [1137 bp, 378 aa] {ON}              348   e-118
NCAS0F01520 Chr6 complement(303410..304699) [1290 bp, 429 aa] {O...   133   2e-34
KAFR0K00760 Chr11 (171591..172769) [1179 bp, 392 aa] {ON} Anc_7....   132   3e-34
Skud_1.49 Chr1 (106029..107213) [1185 bp, 394 aa] {ON} YAL012W (...   130   2e-33
NDAI0H02400 Chr8 complement(582916..584097) [1182 bp, 393 aa] {O...   129   3e-33
Smik_1.55 Chr1 (113765..114949) [1185 bp, 394 aa] {ON} YAL012W (...   129   5e-33
TPHA0L00570 Chr12 (97933..99108) [1176 bp, 391 aa] {ON} Anc_7.97...   128   5e-33
YAL012W Chr1 (130799..131983) [1185 bp, 394 aa] {ON}  CYS3Cystat...   128   6e-33
SAKL0B09614g Chr2 complement(813507..814685) [1179 bp, 392 aa] {...   127   1e-32
CAGL0H06369g Chr8 (627708..628883) [1176 bp, 391 aa] {ON} highly...   127   2e-32
Kpol_1044.10 s1044 (19232..20407) [1176 bp, 391 aa] {ON} (19232....   127   3e-32
Suva_1.56 Chr1 (107030..108217) [1188 bp, 395 aa] {ON} YAL012W (...   125   7e-32
TDEL0H03530 Chr8 complement(586031..587206) [1176 bp, 391 aa] {O...   123   5e-31
KLTH0D02728g Chr4 (267019..268197) [1179 bp, 392 aa] {ON} highly...   123   5e-31
Ecym_2629 Chr2 complement(1216179..1217357) [1179 bp, 392 aa] {O...   123   6e-31
KLLA0F07909g Chr6 (742468..743643) [1176 bp, 391 aa] {ON} highly...   122   8e-31
AEL341W Chr5 (9428..10609) [1182 bp, 393 aa] {ON} Syntenic homol...   122   1e-30
TBLA0E02240 Chr5 (554046..555209) [1164 bp, 387 aa] {ON} Anc_7.9...   120   4e-30
ZYRO0D05742g Chr4 (489953..491128) [1176 bp, 391 aa] {ON} highly...   120   4e-30
KNAG0D04740 Chr4 complement(851405..852577) [1173 bp, 390 aa] {O...   119   2e-29
ZYRO0G19162g Chr7 (1590120..1591487) [1368 bp, 455 aa] {ON} simi...    86   1e-17
TDEL0B04660 Chr2 complement(828468..829862) [1395 bp, 464 aa] {O...    85   3e-17
Smik_7.375 Chr7 (620194..621399) [1206 bp, 401 aa] {ON} YFR055W ...    81   4e-16
CAGL0L06094g Chr12 (693250..694602) [1353 bp, 450 aa] {ON} simil...    80   1e-15
TDEL0D06630 Chr4 complement(1200459..1201667) [1209 bp, 402 aa] ...    79   3e-15
Ecym_8405 Chr8 (839466..840884) [1419 bp, 472 aa] {ON} similar t...    77   7e-15
KLTH0E06644g Chr5 complement(608116..609498) [1383 bp, 460 aa] {...    77   8e-15
TPHA0F00420 Chr6 complement(103419..104747) [1329 bp, 442 aa] {O...    77   1e-14
Skud_19.6 Chr19 complement(5562..6767) [1206 bp, 401 aa] {ON} YF...    75   2e-14
KLLA0C17028g Chr3 complement(1487806..1489188) [1383 bp, 460 aa]...    75   3e-14
Suva_17.6 Chr17 (9922..11127) [1206 bp, 401 aa] {ON} YFR055W (REAL)    74   8e-14
SAKL0H24882g Chr8 (2167623..2169002) [1380 bp, 459 aa] {ON} high...    72   4e-13
ACL059C Chr3 complement(259732..261093) [1362 bp, 453 aa] {ON} S...    72   4e-13
Smik_7.89 Chr7 complement(149314..150711) [1398 bp, 465 aa] {ON}...    72   6e-13
Kwal_47.17221 s47 complement(306099..307490) [1392 bp, 463 aa] {...    72   6e-13
Skud_7.88 Chr7 complement(160235..161632) [1398 bp, 465 aa] {ON}...    71   9e-13
NDAI0D02880 Chr4 (669487..670830) [1344 bp, 447 aa] {ON} Anc_4.53      70   2e-12
NCAS0A05810 Chr1 (1143717..1145060) [1344 bp, 447 aa] {ON} Anc_4...    70   3e-12
YGL184C Chr7 complement(154615..156012) [1398 bp, 465 aa] {ON}  ...    69   6e-12
KAFR0F03070 Chr6 (610571..611908) [1338 bp, 445 aa] {ON} Anc_4.5...    66   4e-11
KNAG0I02920 Chr9 (573008..574345) [1338 bp, 445 aa] {ON} Anc_4.5...    65   6e-11
TBLA0C04400 Chr3 (1062021..1063358) [1338 bp, 445 aa] {ON} Anc_4...    65   6e-11
Kpol_1041.44 s1041 (117344..118678) [1335 bp, 444 aa] {ON} (1173...    65   1e-10
SAKL0H23892g Chr8 (2059083..2060411) [1329 bp, 442 aa] {ON} high...    64   1e-10
Suva_7.79 Chr7 complement(150082..151479) [1398 bp, 465 aa] {ON}...    64   2e-10
YFR055W Chr6 (264204..265226) [1023 bp, 340 aa] {ON}  IRC7Beta-l...    63   3e-10
Ecym_8365 Chr8 complement(732418..733752) [1335 bp, 444 aa] {ON}...    61   2e-09
ADL031W Chr4 (645776..647179) [1404 bp, 467 aa] {ON} Syntenic ho...    60   3e-09
KLLA0D04037g Chr4 (336499..337833) [1335 bp, 444 aa] {ON} highly...    57   3e-08
KLTH0D03652g Chr4 complement(358612..359946) [1335 bp, 444 aa] {...    54   4e-07
Smik_12.383 Chr12 (670676..672010) [1335 bp, 444 aa] {ON} YLR303...    53   5e-07
ZYRO0G22198g Chr7 complement(1827527..1828864) [1338 bp, 445 aa]...    53   5e-07
CAGL0D06402g Chr4 (602973..604301) [1329 bp, 442 aa] {ON} highly...    52   1e-06
YLR303W Chr12 (732542..733876) [1335 bp, 444 aa] {ON}  MET17Meth...    52   1e-06
Suva_10.397 Chr10 (693647..694981) [1335 bp, 444 aa] {ON} YLR303...    51   3e-06
NCAS0A06270 Chr1 complement(1239445..1241424) [1980 bp, 659 aa] ...    50   6e-06
Skud_12.384 Chr12 (673748..675082) [1335 bp, 444 aa] {ON} YLR303...    49   2e-05
Ecym_5169 Chr5 complement(353237..355282) [2046 bp, 681 aa] {ON}...    49   2e-05
Kwal_26.7437 s26 complement(365889..367223) [1335 bp, 444 aa] {O...    47   4e-05
TDEL0E05620 Chr5 complement(1043585..1044925) [1341 bp, 446 aa] ...    47   4e-05
KLTH0G00418g Chr7 complement(23130..24836) [1707 bp, 568 aa] {ON...    46   1e-04
CAGL0M00550g Chr13 (66078..67787) [1710 bp, 569 aa] {ON} similar...    44   7e-04
TDEL0E05710 Chr5 complement(1062353..1064023) [1671 bp, 556 aa] ...    43   9e-04
KLTH0D17930g Chr4 (1486259..1488217) [1959 bp, 652 aa] {ON} simi...    42   0.003
Smik_10.423 Chr10 complement(654265..656184) [1920 bp, 639 aa] {...    42   0.003
AER164C Chr5 complement(944867..946804) [1938 bp, 645 aa] {ON} S...    42   0.003
Skud_10.353 Chr10 complement(623771..625693) [1923 bp, 640 aa] {...    41   0.005
Kwal_14.791 s14 complement(49074..50789) [1716 bp, 571 aa] {ON} ...    40   0.007
Kpol_1028.80 s1028 (179685..181754) [2070 bp, 689 aa] {ON} (1796...    40   0.008
KNAG0M00330 Chr13 (48427..50322) [1896 bp, 631 aa] {ON} Anc_4.35...    40   0.009
TDEL0D00610 Chr4 (109396..111354) [1959 bp, 652 aa] {ON} Anc_4.3...    39   0.014
Suva_13.68 Chr13 (103103..105169) [2067 bp, 688 aa] {ON} YML082W...    39   0.025
Kwal_26.7197 s26 (258929..259192) [264 bp, 87 aa] {OFF} YAL012W ...    35   0.033
YLL058W Chr12 (23569..25296) [1728 bp, 575 aa] {ON} Putative pro...    37   0.11 
Kwal_26.7194 s26 (258018..258476) [459 bp, 152 aa] {ON} YAL012W ...    35   0.14 
TPHA0L00330 Chr12 (43495..45648) [2154 bp, 717 aa] {ON} Anc_4.35...    35   0.24 
NDAI0D03260 Chr4 complement(774579..776669) [2091 bp, 696 aa] {O...    35   0.38 
ZYRO0B08338g Chr2 complement(649933..651855) [1923 bp, 640 aa] {...    35   0.43 
KLLA0B04378g Chr2 (390701..392767) [2067 bp, 688 aa] {ON} simila...    35   0.44 
Smik_13.55 Chr13 (99421..101520) [2100 bp, 699 aa] {ON} YJR130C ...    34   0.55 
Suva_10.8 Chr10 (9213..10931) [1719 bp, 572 aa] {ON} YLL058W (REAL)    34   0.78 
Skud_12.10 Chr12 (10565..12280) [1716 bp, 571 aa] {ON} YLL058W (...    33   0.87 
CAGL0H04169g Chr8 (394311..396407) [2097 bp, 698 aa] {ON} simila...    33   0.99 
YML082W Chr13 (101862..103811) [1950 bp, 649 aa] {ON} Putative p...    33   1.9  
SAKL0G18172g Chr7 complement(1572652..1574673) [2022 bp, 673 aa]...    32   3.1  
KLLA0B00825g Chr2 (64284..65468) [1185 bp, 394 aa] {ON} similar ...    31   5.1  
SAKL0H15378g Chr8 complement(1328983..1340172) [11190 bp, 3729 a...    31   5.9  
Skud_13.59 Chr13 (101194..103143) [1950 bp, 649 aa] {ON} YML082W...    31   7.4  
Skud_7.432 Chr7 complement(715852..717393) [1542 bp, 513 aa] {ON...    30   8.5  

>Kwal_55.22221 s55 (1160724..1161866) [1143 bp, 380 aa] {ON} YHR112C
           - Hypothetical ORF [contig 697] FULL
          Length = 380

 Score =  762 bits (1967), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/380 (96%), Positives = 368/380 (96%)

Query: 1   MPFSATNAIHSDDYLNRVSDVAPPINVSTTFRYDNEHLVPATRETGMHTSDSPMIYSRLG 60
           MPFSATNAIHSDDYLNRVSDVAPPINVSTTFRYDNEHLVPATRETGMHTSDSPMIYSRLG
Sbjct: 1   MPFSATNAIHSDDYLNRVSDVAPPINVSTTFRYDNEHLVPATRETGMHTSDSPMIYSRLG 60

Query: 61  HPNADRLEAVLSQLLDSHAVVYASGLAAYHAILVHFKPKRLFLPHCYHGCKEVARIISRL 120
           HPNADRLEAVLSQLLDSHAVVYASGLAAYHAILVHFKPKRLFLPHCYHGCKEVARIISRL
Sbjct: 61  HPNADRLEAVLSQLLDSHAVVYASGLAAYHAILVHFKPKRLFLPHCYHGCKEVARIISRL 120

Query: 121 NGMEILSLEDIEAKCQEGDLVHIEDPINPFGETVDLAQYASRIHSAGGLMMLDSTLGPPP 180
           NGMEILSLEDIEAKCQEGDLVHIEDPINPFGETVDLAQYASRIHSAGGLMMLDSTLGPPP
Sbjct: 121 NGMEILSLEDIEAKCQEGDLVHIEDPINPFGETVDLAQYASRIHSAGGLMMLDSTLGPPP 180

Query: 181 LRNAWDYGADIIMHSGTKYFGGHSDLLSGIVCVSDEAIAEQLKNDRTYLGTIPAXXXXXX 240
           LRNAWDYGADIIMHSGTKYFGGHSDLLSGIVCVSDEAIAEQLKNDRTYLGTIPA      
Sbjct: 181 LRNAWDYGADIIMHSGTKYFGGHSDLLSGIVCVSDEAIAEQLKNDRTYLGTIPASLESFL 240

Query: 241 XXXXXXTMDIRVRRQSQNCTELVSYLANNSEKFSSVVQEIRHASLQTEAFVKQQMPGGFG 300
                 TMDIRVRRQSQNCTELVSYLANNSEKFSSVVQEIRHASLQTEAFVKQQMPGGFG
Sbjct: 241 LLRSLRTMDIRVRRQSQNCTELVSYLANNSEKFSSVVQEIRHASLQTEAFVKQQMPGGFG 300

Query: 301 PVFALILKSEDQCRKVVKNVSFFQHATSLGGVESLIEWRAMSDPTALKTLIRVSVGLENI 360
           PVFALILKSEDQCRKVVKNVSFFQHATSLGGVESLIEWRAMSDPTALKTLIRVSVGLENI
Sbjct: 301 PVFALILKSEDQCRKVVKNVSFFQHATSLGGVESLIEWRAMSDPTALKTLIRVSVGLENI 360

Query: 361 EDLIADLAGSLEKINKGELD 380
           EDLIADLAGSLEKINKGELD
Sbjct: 361 EDLIADLAGSLEKINKGELD 380

>KLTH0E16566g Chr5 (1468783..1469928) [1146 bp, 381 aa] {ON} similar
           to uniprot|P38716 Saccharomyces cerevisiae YHR112C
           Hypothetical ORF
          Length = 381

 Score =  582 bits (1499), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/379 (71%), Positives = 318/379 (83%)

Query: 1   MPFSATNAIHSDDYLNRVSDVAPPINVSTTFRYDNEHLVPATRETGMHTSDSPMIYSRLG 60
           MPFS+T  IH DD LNRVSDVAPPINVSTTFRYD+EHL PAT  TG HTSDSPMIYSRLG
Sbjct: 1   MPFSSTATIHGDDRLNRVSDVAPPINVSTTFRYDDEHLEPATISTGTHTSDSPMIYSRLG 60

Query: 61  HPNADRLEAVLSQLLDSHAVVYASGLAAYHAILVHFKPKRLFLPHCYHGCKEVARIISRL 120
           HPNADRLE VL+++LD   VVYASGLAAYHAIL+H  PKRLF PHCYHGC+ VA+IISR+
Sbjct: 61  HPNADRLEVVLTEILDGPTVVYASGLAAYHAILIHVNPKRLFQPHCYHGCEAVAKIISRI 120

Query: 121 NGMEILSLEDIEAKCQEGDLVHIEDPINPFGETVDLAQYASRIHSAGGLMMLDSTLGPPP 180
           +GMEIL LE++E KCQ GDLVH+EDP NP+GE V+L ++A +IH AG LM++DSTL PPP
Sbjct: 121 SGMEILPLENLEDKCQSGDLVHLEDPGNPYGEVVNLDEFAEKIHRAGALMLVDSTLAPPP 180

Query: 181 LRNAWDYGADIIMHSGTKYFGGHSDLLSGIVCVSDEAIAEQLKNDRTYLGTIPAXXXXXX 240
           LRN W++GADI+MHSGTKYFGGHSDLLSGIV V DE +A+QL+NDRTYLGTIPA      
Sbjct: 181 LRNTWEFGADIVMHSGTKYFGGHSDLLSGIVSVRDEKVAQQLRNDRTYLGTIPASLESYL 240

Query: 241 XXXXXXTMDIRVRRQSQNCTELVSYLANNSEKFSSVVQEIRHASLQTEAFVKQQMPGGFG 300
                 TM+IRV +QS NCT LV YLA++ ++++SVV++IRHASLQ E FVK+Q+PGG+G
Sbjct: 241 LLRSLRTMEIRVLKQSSNCTRLVEYLASHKDRYNSVVKDIRHASLQKEEFVKKQLPGGYG 300

Query: 301 PVFALILKSEDQCRKVVKNVSFFQHATSLGGVESLIEWRAMSDPTALKTLIRVSVGLENI 360
           PVF+L+L S++QC+ +VKN   FQHATSLGG ESLIEWRAMSDP A + LIRVSVGLEN 
Sbjct: 301 PVFSLLLFSQEQCKLLVKNTVLFQHATSLGGAESLIEWRAMSDPFANRNLIRVSVGLENA 360

Query: 361 EDLIADLAGSLEKINKGEL 379
           EDLI DLAG+LEKI KG+L
Sbjct: 361 EDLIEDLAGTLEKIEKGDL 379

>NDAI0B05590 Chr2 complement(1367293..1368435) [1143 bp, 380 aa]
           {ON} Anc_5.423
          Length = 380

 Score =  433 bits (1114), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 194/372 (52%), Positives = 272/372 (73%)

Query: 5   ATNAIHSDDYLNRVSDVAPPINVSTTFRYDNEHLVPATRETGMHTSDSPMIYSRLGHPNA 64
           +T  IHSDD  NRVSDVAPPINV+TTFRYDN+ LVP T    +   +   IYSRL HPN+
Sbjct: 5   STALIHSDDKDNRVSDVAPPINVTTTFRYDNDDLVPWTERENLDFMEKTPIYSRLAHPNS 64

Query: 65  DRLEAVLSQLLDSHAVVYASGLAAYHAILVHFKPKRLFLPHCYHGCKEVARIISRLNGME 124
            RLE++ S++LD HAV+Y+SGLAA+ A ++H+ PKR+F+   YHG + +A I++R    +
Sbjct: 65  TRLESIFSEILDGHAVIYSSGLAAFFAAMIHYNPKRIFIGQSYHGVRAIANILTRNFQTK 124

Query: 125 ILSLEDIEAKCQEGDLVHIEDPINPFGETVDLAQYASRIHSAGGLMMLDSTLGPPPLRNA 184
             +L++IE   Q GD+VH+E P+NPFG ++DL  +A + H  G L+++DST  PPPL+N 
Sbjct: 125 QHTLDEIEQFAQPGDIVHLETPVNPFGTSLDLEDFAKKAHEKGALLLVDSTFAPPPLQNV 184

Query: 185 WDYGADIIMHSGTKYFGGHSDLLSGIVCVSDEAIAEQLKNDRTYLGTIPAXXXXXXXXXX 244
           WD+  DIIMHS TKYFGGHSDLLSG++ V +EA+A QL++DR YLGT  A          
Sbjct: 185 WDFNVDIIMHSATKYFGGHSDLLSGVLVVKEEAVARQLRDDRIYLGTNVANLESFMLLRS 244

Query: 245 XXTMDIRVRRQSQNCTELVSYLANNSEKFSSVVQEIRHASLQTEAFVKQQMPGGFGPVFA 304
             T ++R+ +QS+N T++VS+L +N +K+  V++ I H+SLQ E+FVK+Q+ GG+GPVF+
Sbjct: 245 LRTFEMRMLKQSENATKIVSFLDSNRDKYDKVLKSITHSSLQKESFVKKQLKGGYGPVFS 304

Query: 305 LILKSEDQCRKVVKNVSFFQHATSLGGVESLIEWRAMSDPTALKTLIRVSVGLENIEDLI 364
           + L +++QC+K    + +F HATSLGG+ESL+EWRAM+DP   +TLIRVS+G EN +DLI
Sbjct: 305 ISLMNKEQCKKFPPMLKYFHHATSLGGIESLVEWRAMTDPYIEQTLIRVSIGCENADDLI 364

Query: 365 ADLAGSLEKINK 376
            DLA +LE + K
Sbjct: 365 QDLANALETLQK 376

>NCAS0F03290 Chr6 complement(667618..668832) [1215 bp, 404 aa] {ON}
           Anc_5.423 YHR112C
          Length = 404

 Score =  427 bits (1098), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 190/370 (51%), Positives = 271/370 (73%)

Query: 5   ATNAIHSDDYLNRVSDVAPPINVSTTFRYDNEHLVPATRETGMHTSDSPMIYSRLGHPNA 64
           +T  IH DD  NRVSDVAPPINV+TTFRYD   L+P +    +   D   IYSRLGHPN+
Sbjct: 31  STTLIHGDDKDNRVSDVAPPINVTTTFRYDPNDLIPWSERENLDFMDKTPIYSRLGHPNS 90

Query: 65  DRLEAVLSQLLDSHAVVYASGLAAYHAILVHFKPKRLFLPHCYHGCKEVARIISRLNGME 124
            RLE++ S++L+ HAV+Y+SG++A+ A +VH+ PKRLF+   YHGC+ +A I++R   +E
Sbjct: 91  TRLESIFSEVLNGHAVIYSSGVSAFFAAMVHYNPKRLFMGQSYHGCRAIANILTRNYNVE 150

Query: 125 ILSLEDIEAKCQEGDLVHIEDPINPFGETVDLAQYASRIHSAGGLMMLDSTLGPPPLRNA 184
              LEDIE   Q+GD+VH+E P+NP+G ++D++++A R H+ G L+ +DST  PPPL++ 
Sbjct: 151 QHPLEDIEKYAQKGDIVHLETPVNPYGTSLDISEFARRAHAKGALLCVDSTFAPPPLQDV 210

Query: 185 WDYGADIIMHSGTKYFGGHSDLLSGIVCVSDEAIAEQLKNDRTYLGTIPAXXXXXXXXXX 244
           W++ ADI+MHS TKYFGGHSDLLSG++ V DE +A QL++DR YLGT  A          
Sbjct: 211 WEFDADIVMHSATKYFGGHSDLLSGVLVVKDEDVARQLRDDRIYLGTNVANLESYLLLRS 270

Query: 245 XXTMDIRVRRQSQNCTELVSYLANNSEKFSSVVQEIRHASLQTEAFVKQQMPGGFGPVFA 304
             T  +R+ RQS+N T++V +L +N  KF +V+ +I H+SLQTE FVK+Q+ GG+ PVF+
Sbjct: 271 LRTFKMRIERQSENATKVVKFLNDNKGKFGNVLDKIYHSSLQTEPFVKKQLKGGYDPVFS 330

Query: 305 LILKSEDQCRKVVKNVSFFQHATSLGGVESLIEWRAMSDPTALKTLIRVSVGLENIEDLI 364
           + LK+++QC+K    + +F HATSLGG+ESL+EWRAM+DP   +TLIR+S+G E+ +DLI
Sbjct: 331 ITLKNKEQCKKFPLLLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRISIGCEDADDLI 390

Query: 365 ADLAGSLEKI 374
            DL+ +L K+
Sbjct: 391 NDLSAALNKL 400

>CAGL0I01276g Chr9 complement(104391..105533) [1143 bp, 380 aa] {ON}
           highly similar to uniprot|P38716 Saccharomyces
           cerevisiae YHR112c
          Length = 380

 Score =  426 bits (1095), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 196/372 (52%), Positives = 269/372 (72%)

Query: 5   ATNAIHSDDYLNRVSDVAPPINVSTTFRYDNEHLVPATRETGMHTSDSPMIYSRLGHPNA 64
           AT  IH DD  NRV DVAPPINV+TTFRYD   LVP      +   D   IYSRLGHPNA
Sbjct: 7   ATTLIHGDDIKNRVPDVAPPINVATTFRYDENDLVPWNEREDLEFMDRTPIYSRLGHPNA 66

Query: 65  DRLEAVLSQLLDSHAVVYASGLAAYHAILVHFKPKRLFLPHCYHGCKEVARIISRLNGME 124
            RLE++ S++L+ HAV+Y+SGLAA+HA + HF PK+LF+   YHG   +A I+SR  G+ 
Sbjct: 67  TRLESIFSEILEGHAVIYSSGLAAFHAAMTHFNPKQLFIGQSYHGVHGIADILSRNYGLI 126

Query: 125 ILSLEDIEAKCQEGDLVHIEDPINPFGETVDLAQYASRIHSAGGLMMLDSTLGPPPLRNA 184
             SL+DIE   Q+GD+VHIE P+NPFG + DL  +A + HS G L+M+DST  PPPL+ A
Sbjct: 127 QRSLDDIEEYAQKGDIVHIETPVNPFGTSYDLQSFADKAHSRGALLMVDSTFAPPPLQYA 186

Query: 185 WDYGADIIMHSGTKYFGGHSDLLSGIVCVSDEAIAEQLKNDRTYLGTIPAXXXXXXXXXX 244
           W++GADIIMHS TK+FGGHSDLLSG++   DE ++++LK+DR YLGT  A          
Sbjct: 187 WNFGADIIMHSATKFFGGHSDLLSGVLVTKDEEVSKRLKDDRIYLGTNVANLESHLLLRS 246

Query: 245 XXTMDIRVRRQSQNCTELVSYLANNSEKFSSVVQEIRHASLQTEAFVKQQMPGGFGPVFA 304
             T ++R+ +QSQN T++V +L +N +K+S V++++ H+SLQ E+FVK+Q+ GG+ PVF+
Sbjct: 247 LRTFEMRILKQSQNVTKIVEHLVSNRDKYSKVLRQVFHSSLQDESFVKKQLIGGYTPVFS 306

Query: 305 LILKSEDQCRKVVKNVSFFQHATSLGGVESLIEWRAMSDPTALKTLIRVSVGLENIEDLI 364
           + L +++QC+++   + +F HATSLGGVESLIEWRAM+DP   +TLIR S+G E+ +DLI
Sbjct: 307 ITLMNKEQCKQLPLKLKYFHHATSLGGVESLIEWRAMTDPYIDQTLIRFSIGCESADDLI 366

Query: 365 ADLAGSLEKINK 376
           ADL  +  ++ K
Sbjct: 367 ADLDAAFIELEK 378

>KAFR0E03860 Chr5 complement(766029..767165) [1137 bp, 378 aa] {ON}
           Anc_5.423 YHR112C
          Length = 378

 Score =  425 bits (1093), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 187/377 (49%), Positives = 273/377 (72%)

Query: 1   MPFSATNAIHSDDYLNRVSDVAPPINVSTTFRYDNEHLVPATRETGMHTSDSPMIYSRLG 60
           M    T+ IH+DD  NRVSDVAPPINVSTT+RYD   L+P      +   +   +YSRL 
Sbjct: 1   MTHLGTSLIHADDKDNRVSDVAPPINVSTTYRYDETDLIPWRERENLDFMEKKPVYSRLA 60

Query: 61  HPNADRLEAVLSQLLDSHAVVYASGLAAYHAILVHFKPKRLFLPHCYHGCKEVARIISRL 120
           HPNA RLE++ S++L+ HAV+Y+SG AA++A +VH+ PK++F+  CYHG + +A I++R 
Sbjct: 61  HPNATRLESLFSEILEGHAVIYSSGCAAFYAAMVHYNPKKIFMGQCYHGLRAIANIMTRN 120

Query: 121 NGMEILSLEDIEAKCQEGDLVHIEDPINPFGETVDLAQYASRIHSAGGLMMLDSTLGPPP 180
            G+E  +L+DIE   QEGD+V +E P+NP+G ++D+   A + HS G ++++DST  PPP
Sbjct: 121 YGVEQYTLDDIEKYAQEGDIVEVESPMNPYGTSIDIKSIAEKAHSKGAIVLVDSTFAPPP 180

Query: 181 LRNAWDYGADIIMHSGTKYFGGHSDLLSGIVCVSDEAIAEQLKNDRTYLGTIPAXXXXXX 240
           L+ AWD GAD+++HS TKYFGGHSDLLSG++ V DE + ++L++DR YLGT         
Sbjct: 181 LQYAWDLGADVVLHSATKYFGGHSDLLSGVIVVKDEEVCKKLRDDRIYLGTNVGNLESYM 240

Query: 241 XXXXXXTMDIRVRRQSQNCTELVSYLANNSEKFSSVVQEIRHASLQTEAFVKQQMPGGFG 300
                 + ++R+ +QS+N T++V +L  N E+F  V++E+ H+SLQ EAFVK+Q+ GG+G
Sbjct: 241 LLRSLRSYELRILKQSENATKVVEFLNLNKERFDKVLKEVYHSSLQKEAFVKKQLVGGYG 300

Query: 301 PVFALILKSEDQCRKVVKNVSFFQHATSLGGVESLIEWRAMSDPTALKTLIRVSVGLENI 360
           PVF++ L++ DQC+K    + +F HATSLGGVESL+EWRAM+DP   +TLIRVS+G+EN 
Sbjct: 301 PVFSMSLQTIDQCKKFPGKLKYFHHATSLGGVESLVEWRAMTDPYIDQTLIRVSIGVENA 360

Query: 361 EDLIADLAGSLEKINKG 377
           +DLI DL  +L++++ G
Sbjct: 361 DDLIKDLETALQELHNG 377

>SAKL0G02222g Chr7 complement(186449..187585) [1137 bp, 378 aa] {ON}
           highly similar to uniprot|P38716 Saccharomyces
           cerevisiae YHR112C Hypothetical ORF
          Length = 378

 Score =  424 bits (1090), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 193/373 (51%), Positives = 267/373 (71%)

Query: 6   TNAIHSDDYLNRVSDVAPPINVSTTFRYDNEHLVPATRETGMHTSDSPMIYSRLGHPNAD 65
           T  IH+DD  NRV+D+  PINV+TTFRYDN +L+           ++  +YSRL HPNA 
Sbjct: 6   TTLIHADDKDNRVTDIVSPINVATTFRYDNNNLIAWNDRENYDFLETTPVYSRLAHPNAT 65

Query: 66  RLEAVLSQLLDSHAVVYASGLAAYHAILVHFKPKRLFLPHCYHGCKEVARIISRLNGMEI 125
           RLE++ S++L  HAV+Y+SGLAAY A L H+ PK+LF+   YHGC  +A I +R NGM+ 
Sbjct: 66  RLESIFSEILGGHAVIYSSGLAAYFATLTHYNPKKLFIGQSYHGCHGIADIFTRNNGMKQ 125

Query: 126 LSLEDIEAKCQEGDLVHIEDPINPFGETVDLAQYASRIHSAGGLMMLDSTLGPPPLRNAW 185
             L+ IE    EGD+VH+E P+NPFG + D+  +A + H+ G L+++DST  PPPL++ W
Sbjct: 126 YPLDRIEELASEGDIVHLETPVNPFGTSYDIEDFARKAHAKGALLVIDSTFAPPPLQDVW 185

Query: 186 DYGADIIMHSGTKYFGGHSDLLSGIVCVSDEAIAEQLKNDRTYLGTIPAXXXXXXXXXXX 245
            +GAD+++HS TKYFGGHSDLLSG+V V    +A+++KNDR YLGT  A           
Sbjct: 186 KFGADVVIHSCTKYFGGHSDLLSGVVVVKSLEVAKKMKNDRIYLGTNIANLESYLLLRSL 245

Query: 246 XTMDIRVRRQSQNCTELVSYLANNSEKFSSVVQEIRHASLQTEAFVKQQMPGGFGPVFAL 305
            T ++RVR+QS+N T LV YL ++  +F+ V+ +I H+SLQTE FVK+Q+ GG+GPVF++
Sbjct: 246 RTFEMRVRKQSENATALVKYLDDHKSEFNKVLDKIYHSSLQTEDFVKKQLEGGYGPVFSI 305

Query: 306 ILKSEDQCRKVVKNVSFFQHATSLGGVESLIEWRAMSDPTALKTLIRVSVGLENIEDLIA 365
           +LKS+ QC+K+   +  FQHATSLGGVESL+EWRA++DP   +TLIRVSVG E +EDLI 
Sbjct: 306 VLKSKVQCKKLPGKLELFQHATSLGGVESLVEWRALTDPYIEQTLIRVSVGCEGVEDLIK 365

Query: 366 DLAGSLEKINKGE 378
           DLAG+L+++   E
Sbjct: 366 DLAGALKQLQDEE 378

>Skud_8.173 Chr8 complement(308322..309458) [1137 bp, 378 aa] {ON}
           YHR112C (REAL)
          Length = 378

 Score =  419 bits (1076), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 186/371 (50%), Positives = 272/371 (73%)

Query: 5   ATNAIHSDDYLNRVSDVAPPINVSTTFRYDNEHLVPATRETGMHTSDSPMIYSRLGHPNA 64
           +T  IH DD  NRV+DVAPPINVSTTFRYD++ L+P T    +   +   +YSRL HPN+
Sbjct: 5   STVLIHGDDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKKPVYSRLAHPNS 64

Query: 65  DRLEAVLSQLLDSHAVVYASGLAAYHAILVHFKPKRLFLPHCYHGCKEVARIISRLNGME 124
            RLE+V S++LD +AV+Y+SGLAA++A +VH+ PK++F+   YHG + +  I++R   ++
Sbjct: 65  TRLESVFSEILDGYAVIYSSGLAAFYAAMVHYNPKKIFIGQSYHGVRAITNILARNYDVK 124

Query: 125 ILSLEDIEAKCQEGDLVHIEDPINPFGETVDLAQYASRIHSAGGLMMLDSTLGPPPLRNA 184
              LEDIE    EGD+VH+E P+NP+G + D+   A R H+ G L+++DST   PPL+ A
Sbjct: 125 QYPLEDIEKYASEGDIVHLESPVNPYGTSYDIESLAHRAHTKGALLIVDSTFASPPLQYA 184

Query: 185 WDYGADIIMHSGTKYFGGHSDLLSGIVCVSDEAIAEQLKNDRTYLGTIPAXXXXXXXXXX 244
           W++GAD++++S TKYFGGHSDLLSG++ V DEA++ QLK+DR YLGT  A          
Sbjct: 185 WNFGADVVLYSATKYFGGHSDLLSGVLVVKDEAVSRQLKDDRIYLGTNVANLESFMLLRS 244

Query: 245 XXTMDIRVRRQSQNCTELVSYLANNSEKFSSVVQEIRHASLQTEAFVKQQMPGGFGPVFA 304
             T ++R+ +QS+N T+LV +L+++  +F  V++ I H+SLQTE FVK+Q+ GG+GPVFA
Sbjct: 245 LRTYEMRITKQSENATKLVKFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYGPVFA 304

Query: 305 LILKSEDQCRKVVKNVSFFQHATSLGGVESLIEWRAMSDPTALKTLIRVSVGLENIEDLI 364
           +IL +++QC+++   + +F HATSLGG+ESL+EWRAM+DP   +TLIRVSVG E+ EDLI
Sbjct: 305 IILHNKEQCKQLPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCESAEDLI 364

Query: 365 ADLAGSLEKIN 375
            DL+ +L+++ 
Sbjct: 365 KDLSSALKELQ 375

>YHR112C Chr8 complement(334527..335663) [1137 bp, 378 aa] {ON}
           Protein of unknown function; localizes to the cytoplasm
           and nucleus; overexpression affects protein trafficking
           through the endocytic pathway
          Length = 378

 Score =  417 bits (1072), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 187/371 (50%), Positives = 271/371 (73%)

Query: 5   ATNAIHSDDYLNRVSDVAPPINVSTTFRYDNEHLVPATRETGMHTSDSPMIYSRLGHPNA 64
           +T  IH DD  NRV+DVAPPINVSTTFRYD++ L+P T    +   +   +YSRL HPN+
Sbjct: 5   STALIHGDDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKKPVYSRLAHPNS 64

Query: 65  DRLEAVLSQLLDSHAVVYASGLAAYHAILVHFKPKRLFLPHCYHGCKEVARIISRLNGME 124
            RLE++ S++LD +AV+Y+SGLAA++A +VH+ PK++F+   YHG + +A I++R  G+E
Sbjct: 65  TRLESIFSEILDGYAVIYSSGLAAFYAAMVHYNPKKIFIGQSYHGVRAIANILTRNYGIE 124

Query: 125 ILSLEDIEAKCQEGDLVHIEDPINPFGETVDLAQYASRIHSAGGLMMLDSTLGPPPLRNA 184
              LEDIE    EGD+VH+E P+NP+G + D+   A R H+ G L+++DST   PPL+ A
Sbjct: 125 QHPLEDIEKCASEGDIVHLESPVNPYGTSSDIESLARRAHAKGALLIVDSTFASPPLQYA 184

Query: 185 WDYGADIIMHSGTKYFGGHSDLLSGIVCVSDEAIAEQLKNDRTYLGTIPAXXXXXXXXXX 244
           W++GADI+++S TKYFGGHSDLLSG++ V +EA + QLK+DR YLGT  A          
Sbjct: 185 WNFGADIVLYSATKYFGGHSDLLSGVLVVKEEATSRQLKDDRIYLGTNVANLESFMLLRS 244

Query: 245 XXTMDIRVRRQSQNCTELVSYLANNSEKFSSVVQEIRHASLQTEAFVKQQMPGGFGPVFA 304
             T ++R+ +QS+N T+LV +L+++  +F  V++ I H+SLQTE FVK+Q+ GG+GPVFA
Sbjct: 245 LRTYEMRITKQSENATKLVRFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYGPVFA 304

Query: 305 LILKSEDQCRKVVKNVSFFQHATSLGGVESLIEWRAMSDPTALKTLIRVSVGLENIEDLI 364
           + L +++QC+++   + +F HATSLGG+ESL+EWRAM+DP   +TLIRVSVG E+  DLI
Sbjct: 305 ITLYTKEQCKQLPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCESANDLI 364

Query: 365 ADLAGSLEKIN 375
            DLA +L+++ 
Sbjct: 365 KDLASALKELQ 375

>Suva_15.308 Chr15 complement(536926..538062) [1137 bp, 378 aa] {ON}
           YHR112C (REAL)
          Length = 378

 Score =  417 bits (1071), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 187/371 (50%), Positives = 271/371 (73%)

Query: 5   ATNAIHSDDYLNRVSDVAPPINVSTTFRYDNEHLVPATRETGMHTSDSPMIYSRLGHPNA 64
           +T  IH+DD  NRV+DVAPPINVSTTFRYD++ L+P T    +   +   +YSRL HPN+
Sbjct: 5   STALIHADDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKRPVYSRLAHPNS 64

Query: 65  DRLEAVLSQLLDSHAVVYASGLAAYHAILVHFKPKRLFLPHCYHGCKEVARIISRLNGME 124
            RLE+V S +LD +AVVY+SGLAA+ A +VH+ PK++F+   YHG + +A I++R   ++
Sbjct: 65  TRLESVFSDILDGYAVVYSSGLAAFFAAMVHYNPKKIFIGQSYHGVRAIANILTRNYDIK 124

Query: 125 ILSLEDIEAKCQEGDLVHIEDPINPFGETVDLAQYASRIHSAGGLMMLDSTLGPPPLRNA 184
              LEDIE    EGD+VH+E P+NP+G + D+  +A R H+ G L++LDST   PPL+ A
Sbjct: 125 QHPLEDIERYAAEGDIVHLESPVNPYGTSYDIESFARRAHAKGALLILDSTFASPPLQYA 184

Query: 185 WDYGADIIMHSGTKYFGGHSDLLSGIVCVSDEAIAEQLKNDRTYLGTIPAXXXXXXXXXX 244
           W++GADI+++S TKYFGGHSDLLSG++ V DEA++ +LK+DR YLGT  A          
Sbjct: 185 WNFGADIVLYSATKYFGGHSDLLSGVLVVKDEAVSRRLKDDRIYLGTNVANLESFMLLRS 244

Query: 245 XXTMDIRVRRQSQNCTELVSYLANNSEKFSSVVQEIRHASLQTEAFVKQQMPGGFGPVFA 304
             T ++R+ +QS+N T++V +L+++  +F  V++ I H+SLQTE FVK+Q+ GG+GPVFA
Sbjct: 245 LRTYELRINKQSENATKIVKFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYGPVFA 304

Query: 305 LILKSEDQCRKVVKNVSFFQHATSLGGVESLIEWRAMSDPTALKTLIRVSVGLENIEDLI 364
           + L++++QC+     + +F HATSLGG+ESL+EWRAM+DP   +TLIRVSVG E+ +DLI
Sbjct: 305 ITLRTKEQCKVFPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCESADDLI 364

Query: 365 ADLAGSLEKIN 375
            DLA +L+++ 
Sbjct: 365 RDLASALKELQ 375

>Smik_8.190 Chr8 complement(310892..312154) [1263 bp, 420 aa] {ON}
           YHR112C (REAL)
          Length = 420

 Score =  414 bits (1064), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 186/371 (50%), Positives = 270/371 (72%)

Query: 5   ATNAIHSDDYLNRVSDVAPPINVSTTFRYDNEHLVPATRETGMHTSDSPMIYSRLGHPNA 64
           +T+ IH DD  NRV+DVAPPINVSTTFRYD++ LVP T    +   +   IYSRL HPN+
Sbjct: 47  STSLIHGDDKDNRVTDVAPPINVSTTFRYDDDDLVPWTERENLDFMEKKPIYSRLAHPNS 106

Query: 65  DRLEAVLSQLLDSHAVVYASGLAAYHAILVHFKPKRLFLPHCYHGCKEVARIISRLNGME 124
            RLE++ S++LD +AV+Y+SGLAA++A +VH+ PKR+F+   YHG + +A I+SR   ++
Sbjct: 107 TRLESIFSEILDGYAVIYSSGLAAFYAAMVHYNPKRIFIGQSYHGVRAIANILSRNYDIK 166

Query: 125 ILSLEDIEAKCQEGDLVHIEDPINPFGETVDLAQYASRIHSAGGLMMLDSTLGPPPLRNA 184
              LEDIE    EGD+VH+E P+NP+G + D+   A R H+ G L+++DST   PPL+  
Sbjct: 167 QYPLEDIEKYASEGDIVHLETPVNPYGTSSDIESLAHRAHAKGALLIVDSTFASPPLQYV 226

Query: 185 WDYGADIIMHSGTKYFGGHSDLLSGIVCVSDEAIAEQLKNDRTYLGTIPAXXXXXXXXXX 244
           W++GADI+++S TKYFGGHSDLLSG++ V +E  + QLK+DR YLGT  A          
Sbjct: 227 WNFGADIVLYSATKYFGGHSDLLSGVLVVKEEETSRQLKDDRIYLGTNVANLESFMLLRS 286

Query: 245 XXTMDIRVRRQSQNCTELVSYLANNSEKFSSVVQEIRHASLQTEAFVKQQMPGGFGPVFA 304
             T ++R+ +QS+N T+LV +L+++  +F  V+++I H+SLQ E FVK+Q+ GG+GPVFA
Sbjct: 287 LRTYEMRITKQSENATKLVKFLSDHQSEFGKVLKKIYHSSLQREEFVKKQLVGGYGPVFA 346

Query: 305 LILKSEDQCRKVVKNVSFFQHATSLGGVESLIEWRAMSDPTALKTLIRVSVGLENIEDLI 364
           + L++++QC+++   + +F HATSLGG+ESL+EWRAM+DP   +TLIRVSVG E+  DLI
Sbjct: 347 ITLQTKEQCKQLPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCESANDLI 406

Query: 365 ADLAGSLEKIN 375
            DLA +L+++ 
Sbjct: 407 KDLASALKELQ 417

>KNAG0F01580 Chr6 complement(282872..284011) [1140 bp, 379 aa] {ON} 
          Length = 379

 Score =  412 bits (1060), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 195/378 (51%), Positives = 262/378 (69%)

Query: 1   MPFSATNAIHSDDYLNRVSDVAPPINVSTTFRYDNEHLVPATRETGMHTSDSPMIYSRLG 60
           M   AT+AIH+DD  NRV DVAPPINVS T+RYDN++L     +  +   DS  +YSR  
Sbjct: 1   MTHFATSAIHADDQNNRVPDVAPPINVSVTYRYDNDNLKICDEKECLEEMDSVPVYSRTA 60

Query: 61  HPNADRLEAVLSQLLDSHAVVYASGLAAYHAILVHFKPKRLFLPHCYHGCKEVARIISRL 120
           HPN  RLE+VLS +L+ HAVVY SG +A++A LVH+ PKRLF+   Y G   +A I++R 
Sbjct: 61  HPNCTRLESVLSSILNGHAVVYNSGCSAFYAALVHYNPKRLFIEESYDGMHAIADIMTRN 120

Query: 121 NGMEILSLEDIEAKCQEGDLVHIEDPINPFGETVDLAQYASRIHSAGGLMMLDSTLGPPP 180
            GM+  + ++IE   Q GD+VH+E P+NP+G + D+   A R H+ G L+M+DSTL PPP
Sbjct: 121 YGMQQHTFDNIEKYAQVGDIVHLESPLNPYGISSDIQALADRAHAKGALLMVDSTLAPPP 180

Query: 181 LRNAWDYGADIIMHSGTKYFGGHSDLLSGIVCVSDEAIAEQLKNDRTYLGTIPAXXXXXX 240
           L+N WD+G DIIMHS TKYFGGHSDLL+GI+   D+ ++ QLK DR YLGTIP       
Sbjct: 181 LQNTWDFGPDIIMHSATKYFGGHSDLLAGILVTKDKDVSIQLKGDRIYLGTIPGNLESFL 240

Query: 241 XXXXXXTMDIRVRRQSQNCTELVSYLANNSEKFSSVVQEIRHASLQTEAFVKQQMPGGFG 300
                 TM++RV +QS+N T++V YL +N E F  V+ EI H+SLQ E FV  QM GG+ 
Sbjct: 241 LLRSLRTMEMRVLKQSENATKIVQYLVDNKETFDKVLGEIYHSSLQDEPFVAAQMSGGYT 300

Query: 301 PVFALILKSEDQCRKVVKNVSFFQHATSLGGVESLIEWRAMSDPTALKTLIRVSVGLENI 360
           P+F+  L++ DQ +   + +  FQHATSLGG+ESLIEWR +S+P   +TL+R+SVG EN+
Sbjct: 301 PLFSFKLQTIDQAKHFPEKLKIFQHATSLGGIESLIEWRVLSEPELDQTLLRISVGCENV 360

Query: 361 EDLIADLAGSLEKINKGE 378
           +DLIADL  +L++  K E
Sbjct: 361 DDLIADLQNALQQAQKEE 378

>ZYRO0F09768g Chr6 complement(793824..794945) [1122 bp, 373 aa] {ON}
           highly similar to uniprot|P38716 Saccharomyces
           cerevisiae YHR112C Hypothetical ORF
          Length = 373

 Score =  412 bits (1058), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 187/366 (51%), Positives = 261/366 (71%), Gaps = 1/366 (0%)

Query: 9   IHSDDYLNRVSDVAPPINVSTTFRYDNEHLVPATRETGMHTSDSPMIYSRLGHPNADRLE 68
           +H DD  NRV+DVAPPINV++TFRYDN++L+P   +  +   D   +YSR GHPN  RLE
Sbjct: 9   LHGDDEHNRVTDVAPPINVASTFRYDNDNLIPWRDQPNLDFLDENPVYSREGHPNGVRLE 68

Query: 69  AVLSQLLDSHAVVYASGLAAYHAILVHFKPKRLFLPHCYHGCKEVARIISRLNGMEILSL 128
           A+ S+ L  HA+ Y+ GL  +  ++VHF PKR+F+  CYHG + +  I+ R  G+E   L
Sbjct: 69  ALFSRFLGGHAICYSCGLGGFLGVMVHFNPKRVFMDQCYHGVQGIVGILKRNYGVERYGL 128

Query: 129 EDIEAKCQEGDLVHIEDPINPFGETVDLAQYASRIHSAGGLMMLDSTLGPPPLRNAWDYG 188
            DIE   Q+GD+VH+E PINPFG ++D+++ A R HS G L+M+DST  PPPL+NAWD+G
Sbjct: 129 ADIEKHAQKGDIVHVETPINPFGTSLDISELARRAHSKGALLMVDSTFAPPPLQNAWDFG 188

Query: 189 ADIIMHSGTKYFGGHSDLLSGIVCVSDEAIAEQLKNDRTYLGTIPAXXXXXXXXXXXXTM 248
           AD+IMHS TKYF GHSDLLSG++ V D+ +A +LK DR YLG+  A            T 
Sbjct: 189 ADMIMHSATKYFAGHSDLLSGVLVVKDKEVASKLKEDRIYLGSNIANLESYLLLRSLRTY 248

Query: 249 DIRVRRQSQNCTELVSYLANNSEKFSSVVQEIRHASLQTEAFVKQQMPGGFGPVFALILK 308
           D+R+RRQ++N T++V YL ++ +K+ ++V E+ H+SLQTE FVK+Q+ GG+ PVF+L  K
Sbjct: 249 DLRIRRQAENATKVVKYLNDHKDKYPALV-ELYHSSLQTEEFVKKQLSGGYTPVFSLTFK 307

Query: 309 SEDQCRKVVKNVSFFQHATSLGGVESLIEWRAMSDPTALKTLIRVSVGLENIEDLIADLA 368
           +E+QC+K   ++  FQHATSLGGVESL+EWRAM D    + L+RVS+G E+ +DLI DL+
Sbjct: 308 TEEQCKKFCSSLKLFQHATSLGGVESLVEWRAMCDSDIDQCLVRVSIGCESADDLINDLS 367

Query: 369 GSLEKI 374
             L ++
Sbjct: 368 TVLSQL 373

>ZYRO0F15664g Chr6 (1286078..1287199) [1122 bp, 373 aa] {ON} highly
           similar to uniprot|P38716 Saccharomyces cerevisiae
           YHR112C Hypothetical ORF
          Length = 373

 Score =  402 bits (1033), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 187/370 (50%), Positives = 259/370 (70%), Gaps = 1/370 (0%)

Query: 5   ATNAIHSDDYLNRVSDVAPPINVSTTFRYDNEHLVPATRETGMHTSDSPMIYSRLGHPNA 64
           AT  +H DD  NRV+DVAPPINV++TFRYDN++LVP    T +   D   +YSR GHPN 
Sbjct: 5   ATLLLHGDDEHNRVTDVAPPINVASTFRYDNDNLVPWRDITNLDCLDEYPVYSREGHPNG 64

Query: 65  DRLEAVLSQLLDSHAVVYASGLAAYHAILVHFKPKRLFLPHCYHGCKEVARIISRLNGME 124
            RLEA+ S+ L  HAV Y+ GL  + + +VHF PKR+F+  CYHG + +  I+ R  G+E
Sbjct: 65  VRLEALFSRFLGGHAVCYSCGLGGFLSAMVHFNPKRVFMDQCYHGVQGIVGIMKRNYGVE 124

Query: 125 ILSLEDIEAKCQEGDLVHIEDPINPFGETVDLAQYASRIHSAGGLMMLDSTLGPPPLRNA 184
              L DIE   Q+GD+VH+E PINPFG ++D+++ A R H+ G L+M+DST  PPPL+NA
Sbjct: 125 RYGLADIEKHAQKGDIVHVETPINPFGTSLDISELARRAHAKGALLMVDSTFAPPPLQNA 184

Query: 185 WDYGADIIMHSGTKYFGGHSDLLSGIVCVSDEAIAEQLKNDRTYLGTIPAXXXXXXXXXX 244
           WD+GAD+IMHS TKYFGGHSDLLSG++ V D+  A +LK DR  LG+  +          
Sbjct: 185 WDFGADMIMHSATKYFGGHSDLLSGVLVVKDKETASKLKEDRICLGSNISNLDSYLLLRS 244

Query: 245 XXTMDIRVRRQSQNCTELVSYLANNSEKFSSVVQEIRHASLQTEAFVKQQMPGGFGPVFA 304
             T D+R++RQS++ T++V YL ++   F + + ++ H+SLQ++ FVK+Q+ GG+GPVF+
Sbjct: 245 LRTYDLRIKRQSESATKIVQYLNDHKNDFPA-LDKLYHSSLQSDDFVKKQLSGGYGPVFS 303

Query: 305 LILKSEDQCRKVVKNVSFFQHATSLGGVESLIEWRAMSDPTALKTLIRVSVGLENIEDLI 364
           L LK+E+QC+K   ++  FQHATSLGGVESL+EWRAM D    + L+RVS+G E+ EDL 
Sbjct: 304 LTLKTEEQCKKFCSSLKLFQHATSLGGVESLVEWRAMCDSDIDQCLVRVSIGCESAEDLT 363

Query: 365 ADLAGSLEKI 374
            DL   L ++
Sbjct: 364 NDLTTVLSQL 373

>Kpol_1031.23 s1031 complement(55637..56776) [1140 bp, 379 aa] {ON}
           complement(55637..56776) [1140 nt, 380 aa]
          Length = 379

 Score =  401 bits (1030), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 184/371 (49%), Positives = 256/371 (69%), Gaps = 2/371 (0%)

Query: 5   ATNAIHSDDYLNRVSDVAPPINVSTTFRYDNEHLVPATRETGMHTSDSPMIYSRLGHPNA 64
           +T  IH+DD  NRV+DVAPPINV+TTFRY+ + L+P      M   D   +YSR GHPN 
Sbjct: 5   STLLIHADDKNNRVTDVAPPINVTTTFRYEEQDLIPIIEREDMSFLDERPVYSREGHPNG 64

Query: 65  DRLEAVLSQLLDSHAVVYASGLAAYHAILVHFKPKRLFLPHCYHGCKEVARIISRLNGM- 123
            RLE + S+ L  HAV+Y+SGL+AY A ++ F PKR+F+   YHGC  +A +  R NGM 
Sbjct: 65  TRLETLFSEYLGGHAVIYSSGLSAYFAAIMSFNPKRIFMSQNYHGCIAIAEMFQR-NGMV 123

Query: 124 EILSLEDIEAKCQEGDLVHIEDPINPFGETVDLAQYASRIHSAGGLMMLDSTLGPPPLRN 183
           +  +L++IE   ++GD+VH+E P+NPFG + D+  +A R H+ G L+++D T  PPPL+N
Sbjct: 124 KKYTLDEIEQYAEKGDIVHLESPVNPFGTSYDIEAFAKRAHAKGALLLVDGTFAPPPLQN 183

Query: 184 AWDYGADIIMHSGTKYFGGHSDLLSGIVCVSDEAIAEQLKNDRTYLGTIPAXXXXXXXXX 243
            WD+GADI+MHS TKYFGGHSDLL G++ V D+   E LK DR  LGT  A         
Sbjct: 184 VWDFGADIVMHSATKYFGGHSDLLGGVLVVKDKKRQELLKEDRINLGTNIANLESYLLLR 243

Query: 244 XXXTMDIRVRRQSQNCTELVSYLANNSEKFSSVVQEIRHASLQTEAFVKQQMPGGFGPVF 303
              T ++R+ +QS+N T++V YL  N  K+  V+++I H+SLQ E FVK+Q+ GG+ PVF
Sbjct: 244 SLRTFEMRIMKQSENVTKIVKYLDENKGKYGKVLRDITHSSLQKEDFVKKQLKGGYNPVF 303

Query: 304 ALILKSEDQCRKVVKNVSFFQHATSLGGVESLIEWRAMSDPTALKTLIRVSVGLENIEDL 363
           ++ L + +QC+     + +FQHATSLGGVESL+EWRA+SDP   +TL+RVSVG E+ +DL
Sbjct: 304 SITLNTVEQCKSFASQLKYFQHATSLGGVESLVEWRALSDPHIDQTLVRVSVGCESADDL 363

Query: 364 IADLAGSLEKI 374
           I DLA +L+ +
Sbjct: 364 IKDLASALQNL 374

>KLLA0E21319g Chr5 (1904841..1905983) [1143 bp, 380 aa] {ON} highly
           similar to uniprot|P38716 Saccharomyces cerevisiae
           YHR112C Hypothetical ORF
          Length = 380

 Score =  401 bits (1030), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 184/372 (49%), Positives = 263/372 (70%), Gaps = 2/372 (0%)

Query: 5   ATNAIHSDDYLNRVSDVAPPINVSTTFRYDNEHLVPATRETGMHTSDSPMIYSRLGHPNA 64
           +T  +H+DD  NRV+D+  PINV+TTFRY+   L+P          +   IYSRL HPN+
Sbjct: 4   STELVHADDKHNRVTDIVSPINVATTFRYEEVDLIPWNEREDFSVLEKKPIYSRLAHPNS 63

Query: 65  DRLEAVLSQLLDSHAVVYASGLAAYHAILVHFKPKRLFLPHCYHGCKEVARIISRLNGME 124
            R+E+VLS++L+  AVVYA+GLAAY A+L ++ PKRLF+   YHGC+ +A I +R   +E
Sbjct: 64  LRVESVLSKVLEGEAVVYANGLAAYFAMLTYYNPKRLFIGEGYHGCRSIADIHTRNWNLE 123

Query: 125 --ILSLEDIEAKCQEGDLVHIEDPINPFGETVDLAQYASRIHSAGGLMMLDSTLGPPPLR 182
              L +++I     +GD+VHIE P+NP+G + D+  +A   HS G ++++DST  PPPL+
Sbjct: 124 QHKLEIDEILQHAGKGDVVHIETPVNPYGTSFDIKAFADATHSKGAILVIDSTFAPPPLQ 183

Query: 183 NAWDYGADIIMHSGTKYFGGHSDLLSGIVCVSDEAIAEQLKNDRTYLGTIPAXXXXXXXX 242
           N WD+G D+I+HS TKYFGGHSDLL+G++ V D+ +A +L+ DR YLGT  A        
Sbjct: 184 NPWDFGVDVILHSATKYFGGHSDLLAGVLAVKDKEVASKLRTDRIYLGTNIANLEAFLLL 243

Query: 243 XXXXTMDIRVRRQSQNCTELVSYLANNSEKFSSVVQEIRHASLQTEAFVKQQMPGGFGPV 302
               T ++R++ QS+N T+LVSYL  +   F  V++ + H+SLQTE FVK+Q+ GG+GPV
Sbjct: 244 RSLRTFEMRIQTQSENATKLVSYLIEHKSDFEGVLEGVFHSSLQTEPFVKEQLKGGYGPV 303

Query: 303 FALILKSEDQCRKVVKNVSFFQHATSLGGVESLIEWRAMSDPTALKTLIRVSVGLENIED 362
           FA+ L S++QCRK  + ++ FQHATSLGGVESL+EWRA++DP  + TLIRVSVG+EN++D
Sbjct: 304 FAVTLNSKEQCRKFPQLLTCFQHATSLGGVESLVEWRALTDPYIIPTLIRVSVGVENVDD 363

Query: 363 LIADLAGSLEKI 374
           LI D A +L+ +
Sbjct: 364 LIKDFANALKTL 375

>TBLA0A03680 Chr1 complement(919740..920894) [1155 bp, 384 aa] {ON}
           Anc_5.423 YHR112C
          Length = 384

 Score =  399 bits (1026), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 181/371 (48%), Positives = 259/371 (69%)

Query: 9   IHSDDYLNRVSDVAPPINVSTTFRYDNEHLVPATRETGMHTSDSPMIYSRLGHPNADRLE 68
           IH DD  NRV+DVAPPIN++TTFRYDNE L+P      +   ++  IYSRL HPN+ RLE
Sbjct: 14  IHGDDVNNRVTDVAPPINIATTFRYDNEDLIPWNERGDLSFMETKPIYSRLAHPNSSRLE 73

Query: 69  AVLSQLLDSHAVVYASGLAAYHAILVHFKPKRLFLPHCYHGCKEVARIISRLNGMEILSL 128
            + S++LD +AV+Y SG++A+ A + +F PKR+FL   YHGC     I+ R   ++  + 
Sbjct: 74  TLFSKILDGNAVIYNSGVSAFFAAMTYFNPKRVFLGQNYHGCTAAVNILERNGTLKKHTH 133

Query: 129 EDIEAKCQEGDLVHIEDPINPFGETVDLAQYASRIHSAGGLMMLDSTLGPPPLRNAWDYG 188
           ++IE   Q+GD+VH+E P+NP+G + D+ ++  + HS G L+M+DST  PPPL+  WD+ 
Sbjct: 134 KEIEEFAQKGDIVHLESPVNPYGTSYDIEEFVKKAHSKGVLVMIDSTFAPPPLQYVWDFD 193

Query: 189 ADIIMHSGTKYFGGHSDLLSGIVCVSDEAIAEQLKNDRTYLGTIPAXXXXXXXXXXXXTM 248
            DI+MHS TK+FGGHSDLLSG++ V DE IA+ L+ DR YLGT  A            T 
Sbjct: 194 VDIVMHSATKFFGGHSDLLSGVLVVKDENIAKDLREDRIYLGTNIANLESYLLLRSLRTF 253

Query: 249 DIRVRRQSQNCTELVSYLANNSEKFSSVVQEIRHASLQTEAFVKQQMPGGFGPVFALILK 308
           ++R+ +QS + T++V +L +N  KF+ V++EI H+SLQ E FVK+Q+ GG+ PVF+++L 
Sbjct: 254 EMRILKQSTSATQIVKFLNDNRHKFNKVLKEIYHSSLQKEDFVKKQLKGGYTPVFSIVLH 313

Query: 309 SEDQCRKVVKNVSFFQHATSLGGVESLIEWRAMSDPTALKTLIRVSVGLENIEDLIADLA 368
           +++QC+ +   + +F HATSLGGVESLIEWRA++DP  ++TLIRVSVG EN +DLI DL 
Sbjct: 314 NKEQCKALPNLLKYFIHATSLGGVESLIEWRALTDPYIIQTLIRVSVGCENTQDLINDLD 373

Query: 369 GSLEKINKGEL 379
            +L  I   +L
Sbjct: 374 QALTVIQLKQL 384

>Ecym_5523 Chr5 complement(1060537..1061682) [1146 bp, 381 aa] {ON}
           similar to Ashbya gossypii AER250C
          Length = 381

 Score =  399 bits (1025), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 192/371 (51%), Positives = 260/371 (70%), Gaps = 1/371 (0%)

Query: 5   ATNAIHSDDYL-NRVSDVAPPINVSTTFRYDNEHLVPATRETGMHTSDSPMIYSRLGHPN 63
           +T  IH+DD + + V+DVAPPINVSTTFRYDN++LV    +   + ++   +YSR GHPN
Sbjct: 5   STLLIHADDGVSDHVTDVAPPINVSTTFRYDNDNLVLPEGDCDGYATEGAPVYSREGHPN 64

Query: 64  ADRLEAVLSQLLDSHAVVYASGLAAYHAILVHFKPKRLFLPHCYHGCKEVARIISRLNGM 123
           ++R  ++LS  L+ +AV Y SGL+A+ A L H+ PKRLF+   YHGC ++A I  R  G+
Sbjct: 65  SNRCGSILSHALNGYAVAYNSGLSAFGAALTHYNPKRLFIGQSYHGCHKLADIWVRNYGL 124

Query: 124 EILSLEDIEAKCQEGDLVHIEDPINPFGETVDLAQYASRIHSAGGLMMLDSTLGPPPLRN 183
             L L++IE + Q GD+VHIE P+NP+G  VD+ +Y S+ H  G ++M+DST  PPPL+N
Sbjct: 125 LKLGLDEIEERAQPGDMVHIESPMNPYGTAVDIEEYVSKGHKKGAIVMIDSTFAPPPLQN 184

Query: 184 AWDYGADIIMHSGTKYFGGHSDLLSGIVCVSDEAIAEQLKNDRTYLGTIPAXXXXXXXXX 243
           AW++G DI+MHS TKY GGHSDLL G++ V D+A+  QL  DR YLGT  A         
Sbjct: 185 AWEFGVDILMHSCTKYLGGHSDLLGGVLVVKDKAVFRQLVADRIYLGTNIANLDSYLLIR 244

Query: 244 XXXTMDIRVRRQSQNCTELVSYLANNSEKFSSVVQEIRHASLQTEAFVKQQMPGGFGPVF 303
              T+++RV +QS   T+LV+YL  +  +FS V+ EIRH SLQ E FVK+Q+ GG  PVF
Sbjct: 245 SLRTLELRVMKQSDTATKLVAYLKQHISEFSDVLSEIRHTSLQQEEFVKKQLAGGHTPVF 304

Query: 304 ALILKSEDQCRKVVKNVSFFQHATSLGGVESLIEWRAMSDPTALKTLIRVSVGLENIEDL 363
           +++LK+ DQCR++ K + FF HATS GGVESLIEWRA+SDP   KTL+RVSVG E+  DL
Sbjct: 305 SIMLKTVDQCRELPKKLKFFHHATSFGGVESLIEWRALSDPEIEKTLVRVSVGCEDHNDL 364

Query: 364 IADLAGSLEKI 374
           I DLA +L  +
Sbjct: 365 INDLANALRYL 375

>KNAG0C04990 Chr3 (960378..961520) [1143 bp, 380 aa] {ON} Anc_5.423
           YHR112C
          Length = 380

 Score =  397 bits (1020), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 190/373 (50%), Positives = 257/373 (68%), Gaps = 2/373 (0%)

Query: 5   ATNAIHSDDYLNRVSDVAPPINVSTTFRYDNEHLVPATRETGMHTSDSPMIYSRLGHPNA 64
           AT  IH+DD  NRV DVAPPINVSTT+RYD + LVP      +   D   IYSRL HPN+
Sbjct: 5   ATTLIHADDRDNRVPDVAPPINVSTTYRYDKDDLVPWRDRESLEFMDKRPIYSRLAHPNS 64

Query: 65  DRLEAVLSQLLDSHAVVYASGLAAYHAILVHFKPKRLFLPHCYHGCKEVARIISRLNGME 124
            RLE++ SQ+L  HAVVY SGLAA+ A L+H+ PKRLF+   YHGC+ +A I++R  GM+
Sbjct: 65  TRLESLFSQILGGHAVVYNSGLAAFFAALIHYNPKRLFIDQSYHGCRAIAHILTRTTGMQ 124

Query: 125 ILSLEDIEAKCQEGDLVHIEDPINPFGETV-DLAQYASRIHSAGGLMMLDSTLGPPPLRN 183
             SL+D+    Q GD+VH+E P+NP G    D++  A + H  G ++++DST  PPPL++
Sbjct: 125 QCSLDDVPQMAQPGDVVHLESPVNPLGTVPRDMSLLAEQAHERGAVLIVDSTFAPPPLQD 184

Query: 184 AWDYGADIIMHSGTKYFGGHSDLLSGIVCVSDEAIAEQLKNDRTYLGTIPAXXXXXXXXX 243
            W +G D++MHS TKYFGGHSDLLSG++   D+  A  L++DR YLGT  A         
Sbjct: 185 PWRFGCDMVMHSATKYFGGHSDLLSGVLVTRDQQTAGALRDDRIYLGTNVANLEAYLLLR 244

Query: 244 XXXTMDIRVRRQSQNCTELVSYLANNSEKFSSVVQEIRHASLQT-EAFVKQQMPGGFGPV 302
              T ++R++RQS NCT +V+YL ++   +  V+ ++ H+SLQT E +V +Q+ GG  PV
Sbjct: 245 SLRTFELRIQRQSTNCTAVVAYLNDHRGDWPLVLDKLYHSSLQTGEPWVAEQLEGGHPPV 304

Query: 303 FALILKSEDQCRKVVKNVSFFQHATSLGGVESLIEWRAMSDPTALKTLIRVSVGLENIED 362
           FAL L+S DQC++  + + +FQHATSLGGVESL+EWRAM+DP   +TL+RVSVG EN ED
Sbjct: 305 FALTLRSIDQCKRFPQLLHYFQHATSLGGVESLVEWRAMTDPHIDQTLVRVSVGCENAED 364

Query: 363 LIADLAGSLEKIN 375
           LIADL  +L  + 
Sbjct: 365 LIADLTTALNALQ 377

>TBLA0B03020 Chr2 complement(700483..701622) [1140 bp, 379 aa] {ON} 
          Length = 379

 Score =  393 bits (1009), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 189/374 (50%), Positives = 256/374 (68%), Gaps = 3/374 (0%)

Query: 5   ATNAIHSDDYLNRVSDVAPPINVSTTFRYDNEHLVPATRETGMHTS--DSPMIYSRLGHP 62
           AT  IHSDD  NRV+DVAPPINVS+TFRYDN +L+PA        S   SP +YSR  HP
Sbjct: 5   ATTLIHSDDKNNRVTDVAPPINVSSTFRYDNNNLIPANEVDDFLASIEQSP-VYSRESHP 63

Query: 63  NADRLEAVLSQLLDSHAVVYASGLAAYHAILVHFKPKRLFLPHCYHGCKEVARIISRLNG 122
           N+ R++++LS LL  HAV+Y SG +A+HA++ H+ PKR F+   Y G   +A +I+R  G
Sbjct: 64  NSSRVQSILSDLLGGHAVIYNSGCSAFHAVMCHYNPKRFFMDGGYFGVHAIADLITRNYG 123

Query: 123 MEILSLEDIEAKCQEGDLVHIEDPINPFGETVDLAQYASRIHSAGGLMMLDSTLGPPPLR 182
           +E  SL++IE   Q GDLVH+E P+NPFG   D+   A R+HS G ++ +DSTL PPPL+
Sbjct: 124 LEQHSLDEIEEFAQPGDLVHLESPLNPFGTASDIKALADRVHSKGAILSIDSTLAPPPLQ 183

Query: 183 NAWDYGADIIMHSGTKYFGGHSDLLSGIVCVSDEAIAEQLKNDRTYLGTIPAXXXXXXXX 242
           N W++GADI++HS TKYFGGHSDLL+G++ V  +  A +L  DR +LGT           
Sbjct: 184 NVWNFGADIVLHSATKYFGGHSDLLAGVLAVKTKEQANELIEDRIHLGTNIGNLESYLLL 243

Query: 243 XXXXTMDIRVRRQSQNCTELVSYLANNSEKFSSVVQEIRHASLQTEAFVKQQMPGGFGPV 302
               T ++R+ +QS N T++V YL N+ E     ++EI H SLQ E+F+ +Q+ GG G V
Sbjct: 244 RSLRTYEMRIMKQSDNATKIVKYLHNHKESLKGSLKEIFHTSLQNESFINKQLSGGHGAV 303

Query: 303 FALILKSEDQCRKVVKNVSFFQHATSLGGVESLIEWRAMSDPTALKTLIRVSVGLENIED 362
           F++IL S +QC+K+  ++ +FQHATSLGG+ESLIEWRAMSD    + LIRVSVG EN+ED
Sbjct: 304 FSIILNSINQCKKLPLHLKYFQHATSLGGIESLIEWRAMSDDKIDQCLIRVSVGCENVED 363

Query: 363 LIADLAGSLEKINK 376
           LI DL  +L  + K
Sbjct: 364 LIKDLENALLTVAK 377

>AER250C Chr5 complement(1098456..1099580) [1125 bp, 374 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHR112C
          Length = 374

 Score =  391 bits (1005), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 187/369 (50%), Positives = 256/369 (69%)

Query: 6   TNAIHSDDYLNRVSDVAPPINVSTTFRYDNEHLVPATRETGMHTSDSPMIYSRLGHPNAD 65
           T+ IH+DD  NRV+DVAPPINV+TTFRY  + L+PA   T      +   YSR+ HPN  
Sbjct: 6   TSLIHADDNSNRVNDVAPPINVTTTFRYSEDDLIPAVERTADTAGSNGHFYSRVSHPNGA 65

Query: 66  RLEAVLSQLLDSHAVVYASGLAAYHAILVHFKPKRLFLPHCYHGCKEVARIISRLNGMEI 125
           R E +L++ L   AVVY+SGLAA+ A L HF PKRLF+   YHGC  VA I  R +G++ 
Sbjct: 66  RCEVLLAEALGGEAVVYSSGLAAFGAALTHFNPKRLFIGRGYHGCHGVADIWVRNHGLQK 125

Query: 126 LSLEDIEAKCQEGDLVHIEDPINPFGETVDLAQYASRIHSAGGLMMLDSTLGPPPLRNAW 185
           LSLE++  + + GDLVHIE PINP+G  VD+A  A+  H  G  ++LD+T  PPPL++ W
Sbjct: 126 LSLEEVSERSEPGDLVHIESPINPYGTLVDVAGIAAAAHEKGAYVVLDATFAPPPLQDRW 185

Query: 186 DYGADIIMHSGTKYFGGHSDLLSGIVCVSDEAIAEQLKNDRTYLGTIPAXXXXXXXXXXX 245
           + GAD+++HS TKYFGGHSDLL G+  V D A+A QL+ DR YLGT  A           
Sbjct: 186 EQGADVVVHSCTKYFGGHSDLLGGVHAVRDAAVARQLRQDRVYLGTNIANLEAYLLIRSM 245

Query: 246 XTMDIRVRRQSQNCTELVSYLANNSEKFSSVVQEIRHASLQTEAFVKQQMPGGFGPVFAL 305
            TM++RV RQS + T++V+YL ++  +F  V+ ++ H+SLQTE +V+Q + GG  PVF++
Sbjct: 246 RTMEMRVVRQSTSATKVVAYLESHKAEFGGVLVKVFHSSLQTEPYVQQYLRGGNAPVFSI 305

Query: 306 ILKSEDQCRKVVKNVSFFQHATSLGGVESLIEWRAMSDPTALKTLIRVSVGLENIEDLIA 365
           +L++ +QC+++   +  F HATSLGGVESLIEWRAMSD T  + L+R+SVG E+ EDLIA
Sbjct: 306 LLRTVEQCKRLPSLLKLFHHATSLGGVESLIEWRAMSDTTVEQNLLRISVGCESPEDLIA 365

Query: 366 DLAGSLEKI 374
           DLAG+  ++
Sbjct: 366 DLAGAFRQL 374

>CAGL0K05665g Chr11 complement(552804..553943) [1140 bp, 379 aa]
           {ON} highly similar to uniprot|P38716 Saccharomyces
           cerevisiae YHR112c
          Length = 379

 Score =  390 bits (1001), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 180/370 (48%), Positives = 254/370 (68%)

Query: 5   ATNAIHSDDYLNRVSDVAPPINVSTTFRYDNEHLVPATRETGMHTSDSPMIYSRLGHPNA 64
           AT  IH DD  NRVSDVAPPINVSTT+RY  E L+P  +       D   +YSR GHPN 
Sbjct: 5   ATKLIHDDDKHNRVSDVAPPINVSTTYRYAEEDLIPWAQRENFDFMDEAPVYSREGHPNC 64

Query: 65  DRLEAVLSQLLDSHAVVYASGLAAYHAILVHFKPKRLFLPHCYHGCKEVARIISRLNGME 124
            RLE + S +L+ HAV+YASGLAA+ A ++H+ PK++FL  CYHG   ++ + +R   ++
Sbjct: 65  TRLETIFSDILEGHAVLYASGLAAFFAAMMHYNPKQVFLGQCYHGVHCISDMFTRNFNVQ 124

Query: 125 ILSLEDIEAKCQEGDLVHIEDPINPFGETVDLAQYASRIHSAGGLMMLDSTLGPPPLRNA 184
             +LEDI    ++GD+VH+E P+NPFG  +D+ + A   HS G ++++DST  PPPL+ A
Sbjct: 125 QRTLEDIAEFAKKGDVVHLESPVNPFGTVIDVKKLADLAHSKGAIVIIDSTFAPPPLQYA 184

Query: 185 WDYGADIIMHSGTKYFGGHSDLLSGIVCVSDEAIAEQLKNDRTYLGTIPAXXXXXXXXXX 244
           WD GAD+IMHS TKYFGGHSDLL GI+   D+ I+  LK DR  LG++            
Sbjct: 185 WDLGADMIMHSATKYFGGHSDLLGGILVTKDKEISRALKEDRINLGSMIGNLESYLLMRS 244

Query: 245 XXTMDIRVRRQSQNCTELVSYLANNSEKFSSVVQEIRHASLQTEAFVKQQMPGGFGPVFA 304
             T ++R+ +QS+N  ++V YL +N EK+ +V+ +I H+S+Q++AFVK Q+ GG+  VF+
Sbjct: 245 LRTYEMRIMKQSENVVKIVKYLNDNKEKYPNVLGDIYHSSIQSDAFVKDQLVGGYNSVFS 304

Query: 305 LILKSEDQCRKVVKNVSFFQHATSLGGVESLIEWRAMSDPTALKTLIRVSVGLENIEDLI 364
             LKSE+QC+K    + +F HATSLGG+ESLIEWRA+SD    + L+RVSVG E+ +DLI
Sbjct: 305 FCLKSEEQCKKFPDKLKYFHHATSLGGIESLIEWRALSDDKIDQKLMRVSVGCESAKDLI 364

Query: 365 ADLAGSLEKI 374
            DL+ +L+++
Sbjct: 365 DDLSQALQEL 374

>TDEL0G00140 Chr7 complement(20315..21460) [1146 bp, 381 aa] {ON} 
          Length = 381

 Score =  382 bits (980), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 181/381 (47%), Positives = 254/381 (66%), Gaps = 1/381 (0%)

Query: 1   MPFSATNAIHSDDYLNRVSDVAPPINVSTTFRYDNEHLVPATR-ETGMHTSDSPMIYSRL 59
           M   +T  IH+DD  NRV+DVAPPINVSTTFRYDNE+LVP    E  + T +   +YSR 
Sbjct: 1   MTHLSTACIHADDIHNRVTDVAPPINVSTTFRYDNENLVPEVEIENFIETIEQTPVYSRE 60

Query: 60  GHPNADRLEAVLSQLLDSHAVVYASGLAAYHAILVHFKPKRLFLPHCYHGCKEVARIISR 119
            HPN+ RL+ VLS +L  HA VY SG++A+HA++ H+ PKR F+   Y G + +A +   
Sbjct: 61  SHPNSLRLQTVLSDILGGHATVYNSGVSAFHALIFHYNPKRFFMDDGYSGVRGIATLYQE 120

Query: 120 LNGMEILSLEDIEAKCQEGDLVHIEDPINPFGETVDLAQYASRIHSAGGLMMLDSTLGPP 179
            +G+E   L  IE   ++GDL+H+E P+NP+G   D+A  A R+H  G ++ +DSTL PP
Sbjct: 121 KHGLETYKLHQIEEFAEKGDLIHLEVPLNPYGTCRDIAALAKRVHKKGAILSIDSTLAPP 180

Query: 180 PLRNAWDYGADIIMHSGTKYFGGHSDLLSGIVCVSDEAIAEQLKNDRTYLGTIPAXXXXX 239
           PL++AWD+GAD++MHS TKY GGHSDLL+G+V V       +L  +R +LGT        
Sbjct: 181 PLQDAWDFGADVVMHSATKYLGGHSDLLAGVVVVKTMEQQRKLIRERIFLGTNVGNLESF 240

Query: 240 XXXXXXXTMDIRVRRQSQNCTELVSYLANNSEKFSSVVQEIRHASLQTEAFVKQQMPGGF 299
                  T ++RV +QS+N  ++VS+L  N  K+S V+ E+ H+SLQ EAFV++Q+ GG 
Sbjct: 241 LLLRSLRTFEMRVLKQSENAAKIVSFLHENKAKYSKVLNEVYHSSLQKEAFVQRQLAGGH 300

Query: 300 GPVFALILKSEDQCRKVVKNVSFFQHATSLGGVESLIEWRAMSDPTALKTLIRVSVGLEN 359
           G VF++ L+S +QC+K+   + +FQHATSLGGVESLIEWRA+SD      L+R+S+G EN
Sbjct: 301 GAVFSVTLRSVEQCKKLPAKLVYFQHATSLGGVESLIEWRALSDTKIDPFLVRLSIGCEN 360

Query: 360 IEDLIADLAGSLEKINKGELD 380
            +DLI DL  +L+ +     D
Sbjct: 361 ADDLIQDLDNALQVLQGAAKD 381

>NDAI0F00140 Chr6 (15124..16260) [1137 bp, 378 aa] {ON} 
          Length = 378

 Score =  381 bits (978), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 181/373 (48%), Positives = 255/373 (68%), Gaps = 1/373 (0%)

Query: 1   MPFSATNAIHSDDYLNRVSDVAPPINVSTTFRYDNEHLVPATR-ETGMHTSDSPMIYSRL 59
           M   +T  IH DD LNRV+DVAPPINVSTTFR+DN +L+PA   +  + + D   +Y+R 
Sbjct: 1   MAHLSTALIHGDDKLNRVTDVAPPINVSTTFRFDNNNLIPANEVKDFLQSIDENPVYARE 60

Query: 60  GHPNADRLEAVLSQLLDSHAVVYASGLAAYHAILVHFKPKRLFLPHCYHGCKEVARIISR 119
            HPN+ R++AVLS LL  HAV+Y SG +A+HA++ H+ PKR F+   Y G   +A +I+R
Sbjct: 61  SHPNSSRVQAVLSDLLGGHAVIYNSGCSAFHALMCHYNPKRFFMDGGYFGVHAIADLITR 120

Query: 120 LNGMEILSLEDIEAKCQEGDLVHIEDPINPFGETVDLAQYASRIHSAGGLMMLDSTLGPP 179
             G+E  SL++IE   Q GD+VH+E P+NPFG + D+   A R+H  G ++ +D+TL PP
Sbjct: 121 NYGLEQHSLDEIEEFAQAGDIVHLETPLNPFGTSSDIEALAKRVHDKGAILSIDATLAPP 180

Query: 180 PLRNAWDYGADIIMHSGTKYFGGHSDLLSGIVCVSDEAIAEQLKNDRTYLGTIPAXXXXX 239
           PL++AW +GADII+HS TKYFGGHSDLL+G++ V  +  A +L  DR +LGT        
Sbjct: 181 PLQDAWKFGADIILHSATKYFGGHSDLLAGVLVVKTKEQAYELIEDRIHLGTNIGNLESY 240

Query: 240 XXXXXXXTMDIRVRRQSQNCTELVSYLANNSEKFSSVVQEIRHASLQTEAFVKQQMPGGF 299
                  T ++R+ +Q  N  ++++YL  N  KF+ V+ +I H+SLQ + FV++Q+ G +
Sbjct: 241 LLLRSLRTYEMRIMKQENNTRKVITYLNENKSKFNKVLNKIYHSSLQDDDFVQKQLSGLY 300

Query: 300 GPVFALILKSEDQCRKVVKNVSFFQHATSLGGVESLIEWRAMSDPTALKTLIRVSVGLEN 359
            PVFA+ L S DQC+++   + +FQHATSLGGVESLIEWRAMSD    + LIRVS+G EN
Sbjct: 301 CPVFAITLHSIDQCKELPLYLKYFQHATSLGGVESLIEWRAMSDSDIDQCLIRVSIGCEN 360

Query: 360 IEDLIADLAGSLE 372
            +DLI DL  +L+
Sbjct: 361 ADDLIKDLENALQ 373

>TDEL0G04970 Chr7 complement(925785..926930) [1146 bp, 381 aa] {ON} 
          Length = 381

 Score =  380 bits (975), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 179/378 (47%), Positives = 254/378 (67%), Gaps = 1/378 (0%)

Query: 1   MPFSATNAIHSDDYLNRVSDVAPPINVSTTFRYDNEHLVP-ATRETGMHTSDSPMIYSRL 59
           M   +T +IH+DD  NRVSDVAPPINV+TTFR+DN++L+P A  E  +   +   +Y+R 
Sbjct: 1   MTHLSTTSIHADDIHNRVSDVAPPINVTTTFRFDNDNLIPEAELENFIEAIEESPVYARE 60

Query: 60  GHPNADRLEAVLSQLLDSHAVVYASGLAAYHAILVHFKPKRLFLPHCYHGCKEVARIISR 119
            HPN+ R++++LS +L  HA VY SG +A+HA++    PKR+F+   Y G + +A +I  
Sbjct: 61  THPNSIRVQSILSSILGGHAAVYNSGCSAFHALMFRLNPKRVFMDDAYGGVETIASLIKE 120

Query: 120 LNGMEILSLEDIEAKCQEGDLVHIEDPINPFGETVDLAQYASRIHSAGGLMMLDSTLGPP 179
             G++I  L+ IE   ++GDLVH+E P+NPFG   ++   A R+H  G L+ +DSTL PP
Sbjct: 121 KYGLKIFKLDQIEEFAEKGDLVHLETPLNPFGICTNIVALAERVHKKGALLSVDSTLAPP 180

Query: 180 PLRNAWDYGADIIMHSGTKYFGGHSDLLSGIVCVSDEAIAEQLKNDRTYLGTIPAXXXXX 239
           PL+NAWD+GADI+MHS TKY GGHSDLL+G++ V D      L  +R YLGT        
Sbjct: 181 PLQNAWDFGADIVMHSATKYLGGHSDLLAGVLVVKDVETQRALIKERIYLGTNLGNLESF 240

Query: 240 XXXXXXXTMDIRVRRQSQNCTELVSYLANNSEKFSSVVQEIRHASLQTEAFVKQQMPGGF 299
                  T ++RV +QS+N  ++V++L  NS K+  V+ ++ H+SLQ E FV++Q+ GG 
Sbjct: 241 LLLRSLRTFEMRVTKQSENALKVVTFLHENSAKYPKVLDQLYHSSLQKEEFVQKQLAGGH 300

Query: 300 GPVFALILKSEDQCRKVVKNVSFFQHATSLGGVESLIEWRAMSDPTALKTLIRVSVGLEN 359
           G VF++ILKS +Q +K+   + +FQHATSLGGVESLIEWRAMSD T    L+R+SVG EN
Sbjct: 301 GAVFSMILKSVEQAKKLPTKLVYFQHATSLGGVESLIEWRAMSDSTIDPCLVRLSVGCEN 360

Query: 360 IEDLIADLAGSLEKINKG 377
           ++DLI DL   L+ +   
Sbjct: 361 VDDLIQDLDQGLQALQNA 378

>TPHA0A06070 Chr1 complement(1370008..1371129) [1122 bp, 373 aa]
           {ON}  YFR055W
          Length = 373

 Score =  370 bits (949), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 173/368 (47%), Positives = 251/368 (68%), Gaps = 3/368 (0%)

Query: 15  LNRVSDVAPPINVSTTFRYDNEHLVPATRETGMHTS--DSPMIYSRLGHPNADRLEAVLS 72
           L ++SD+APPINVSTT+RYD  +L+PA       +S  ++P +YSR  H N+ R++ VLS
Sbjct: 6   LMKISDIAPPINVSTTYRYDEHNLIPAAEVKDFLSSIEENP-VYSRESHANSSRVQKVLS 64

Query: 73  QLLDSHAVVYASGLAAYHAILVHFKPKRLFLPHCYHGCKEVARIISRLNGMEILSLEDIE 132
           ++L+ HAV+Y SG +A+HA++ H+ PKR+F    Y G K +A +I+R  G++  SL+DI+
Sbjct: 65  KVLNGHAVIYNSGCSAFHALMCHYNPKRIFFDESYFGIKAIANLITRNYGLKQYSLKDID 124

Query: 133 AKCQEGDLVHIEDPINPFGETVDLAQYASRIHSAGGLMMLDSTLGPPPLRNAWDYGADII 192
              QEGD++HIE P+NPFG  +++ + A + H+   L+ +DSTL PPPL+NA+D+GADI+
Sbjct: 125 KFAQEGDIIHIETPLNPFGTAINIKEIAVKAHAKKALLSVDSTLAPPPLQNAFDFGADIV 184

Query: 193 MHSGTKYFGGHSDLLSGIVCVSDEAIAEQLKNDRTYLGTIPAXXXXXXXXXXXXTMDIRV 252
           +HS TKY GGHSDLL+G++ V  E  A  L  DR +LGT               T ++R+
Sbjct: 185 LHSATKYLGGHSDLLAGVLVVKTEKEARALIEDRIHLGTNIGNLESFLLLRSLRTYEMRL 244

Query: 253 RRQSQNCTELVSYLANNSEKFSSVVQEIRHASLQTEAFVKQQMPGGFGPVFALILKSEDQ 312
             QSQN  ++V++L  N  ++ +V+Q I H+SLQ E FV +Q+  G   VFA+I KS++Q
Sbjct: 245 STQSQNVVKIVNFLETNRCQYKNVIQHIYHSSLQKEVFVSEQLSKGHTAVFAVIFKSQEQ 304

Query: 313 CRKVVKNVSFFQHATSLGGVESLIEWRAMSDPTALKTLIRVSVGLENIEDLIADLAGSLE 372
           C+  V+ + +FQHATSLGGVESL+EWRAMSDP     LIR S+G EN EDLI DL  +L 
Sbjct: 305 CKNFVQYLKYFQHATSLGGVESLVEWRAMSDPDIDPCLIRFSIGCENAEDLIEDLKSALC 364

Query: 373 KINKGELD 380
           ++ K  ++
Sbjct: 365 RLEKENIN 372

>NDAI0B00595 Chr2 (131225..132361) [1137 bp, 378 aa] {ON}
          Length = 378

 Score =  348 bits (892), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 165/369 (44%), Positives = 246/369 (66%), Gaps = 1/369 (0%)

Query: 5   ATNAIHSDDYLNRVSDVAPPINVSTTFRYDNEHLVPATR-ETGMHTSDSPMIYSRLGHPN 63
           +T  IH DD LNRV+ VAPPINVSTTFR+D+ +L+PA   +  + + D   +Y++  +PN
Sbjct: 5   STTLIHGDDKLNRVTYVAPPINVSTTFRFDSNNLIPANEVKDFLQSIDENPVYAKESYPN 64

Query: 64  ADRLEAVLSQLLDSHAVVYASGLAAYHAILVHFKPKRLFLPHCYHGCKEVARIISRLNGM 123
           + R++AVLS LL  HAV+Y SG + +HA++ H+ PKR F+   Y G   +A +++R  G+
Sbjct: 65  SSRVQAVLSDLLGGHAVIYNSGCSFFHALMCHYNPKRFFMDGGYFGVHAIADLLTRNYGL 124

Query: 124 EILSLEDIEAKCQEGDLVHIEDPINPFGETVDLAQYASRIHSAGGLMMLDSTLGPPPLRN 183
           E   L++IE   Q GD+VH+E P+NPFG + D+     R+H+ G ++ +D+TL  PPL++
Sbjct: 125 EQQFLDEIEEFAQAGDIVHLETPLNPFGTSSDMEALGERVHTKGAILSIDATLASPPLQD 184

Query: 184 AWDYGADIIMHSGTKYFGGHSDLLSGIVCVSDEAIAEQLKNDRTYLGTIPAXXXXXXXXX 243
           AW +GADII+HS TKY GGHSDLL+G++ V  +  A +L  DR +LGT            
Sbjct: 185 AWKFGADIILHSATKYSGGHSDLLAGVLVVKTKEQAYELIEDRIHLGTNIGNLESYLLLR 244

Query: 244 XXXTMDIRVRRQSQNCTELVSYLANNSEKFSSVVQEIRHASLQTEAFVKQQMPGGFGPVF 303
              T ++R+ +Q +N  +++ YL  N  KF+ VV +I H+S Q + F+++Q+ G + PVF
Sbjct: 245 LLSTYEMRIMKQEKNTRKVIIYLNENKSKFNKVVNKIYHSSSQDDDFIQKQLSGLYCPVF 304

Query: 304 ALILKSEDQCRKVVKNVSFFQHATSLGGVESLIEWRAMSDPTALKTLIRVSVGLENIEDL 363
           A+ L S DQC+++  ++ +FQHATSLG  ESLIEWRA+SD    + LI VS+G EN +DL
Sbjct: 305 AITLHSIDQCKELPLHLKYFQHATSLGAAESLIEWRAVSDVDIDQCLIGVSIGCENADDL 364

Query: 364 IADLAGSLE 372
           I DL  +L+
Sbjct: 365 IKDLENALQ 373

>NCAS0F01520 Chr6 complement(303410..304699) [1290 bp, 429 aa] {ON}
           Anc_7.97 YAL012W
          Length = 429

 Score =  133 bits (335), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 112/395 (28%), Positives = 193/395 (48%), Gaps = 44/395 (11%)

Query: 5   ATNAIHSDDYLNRVSDVAPPINVSTTFRYDNEHLVPATRETGMHTSDSPMIYSRLGHPNA 64
           AT AIH+  + +    V  PI++STTF+  +    PA    G++       YSR  +PN 
Sbjct: 47  ATKAIHAGTHTDVHGSVIEPISLSTTFKQSS----PA-NPVGIYE------YSRSQNPNR 95

Query: 65  DRLEAVLSQLLD-SHAVVYASGLAAYHAILVHFKPK---RLFLPHCYHGCKEVARIISRL 120
           + LE  ++ L +  + + ++SG +A  A ++   P+    + +   Y G       ++  
Sbjct: 96  ENLENAIAALENGKYGLAFSSG-SATTATVLQSLPQGSHAISIGDVYGGTHRYFTKVANA 154

Query: 121 NGMEILSLEDIEAKC-----QEGDLVHIEDPINPFGETVDLAQYASRIHSAGG--LMMLD 173
           +G+E     D+  +      +   LV IE P NP  +  D+   A  I S     ++++D
Sbjct: 155 HGVETTFTNDLLKELPNLVKENTKLVWIESPTNPTLKVTDIQAVADAIKSLNKDIILVVD 214

Query: 174 STLGPPPLRNAWDYGADIIMHSGTKYFGGHSDLLSGIVCVSDEAIAEQLKNDRTYLGTIP 233
           +T   P L N  D+GADI++HS TKY  GHSD++ G++  +D+A+ E+L+  +  +G IP
Sbjct: 215 NTFLSPYLSNPLDFGADIVVHSATKYINGHSDVVLGVLATNDKALYEKLQFLQNAIGAIP 274

Query: 234 AXXXXXXXXXXXXTMDIRVRRQSQNCTELVSYLANNSEKFSSVVQEIRHASLQTE---AF 290
           +            T+ +RVR+ S N T++  +L +     S +V+ + +  L T    A 
Sbjct: 275 SPFDSWLAHRGLKTLHLRVRQASLNATKIAQFLQS-----SPLVKAVNYPGLPTHENYAV 329

Query: 291 VKQQMPG--GFGPVFALILKSEDQCRKVVKNVSFFQHATSLGGVESLIEWRAMSDPTALK 348
           V++Q     G G +   I    +   K   +   F  A SLGG+ESL+E  A+     + 
Sbjct: 330 VQKQHREALGGGMISFRIQGGSEAASKFSSSTRLFTLAESLGGIESLLEVPAVMTHGGIP 389

Query: 349 T-----------LIRVSVGLENIEDLIADLAGSLE 372
                       L+R+SVG+E+ +DL+ D+  +LE
Sbjct: 390 KEAREASGVYDDLVRLSVGIEDGDDLLDDIKQALE 424

>KAFR0K00760 Chr11 (171591..172769) [1179 bp, 392 aa] {ON} Anc_7.97
           YAL012W
          Length = 392

 Score =  132 bits (331), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 112/396 (28%), Positives = 190/396 (47%), Gaps = 44/396 (11%)

Query: 5   ATNAIHSDDYLNRVSDVAPPINVSTTFRYDNEHLVPATRETGMHTSDSPMIYSRLGHPNA 64
           AT AIH+  +++    V  PI++STTFR         T E           YSR  +PN 
Sbjct: 10  ATKAIHAGAHVDVHGSVIEPISLSTTFRQSAPAQPIGTYE-----------YSRSQNPNR 58

Query: 65  DRLEAVLSQLLD-SHAVVYASGLAAYHAILVHFKPK---RLFLPHCYHGCKEVARIISRL 120
           + LE  ++ L +  + + ++SG +A  A+++   P+    + +   Y G       ++  
Sbjct: 59  ENLEVAIASLENGKYGLAFSSG-SATTAVILQSLPQGSHAISIGDVYGGTHRYFTKVANA 117

Query: 121 NGMEILS----LEDIEAKCQEG-DLVHIEDPINPFGETVDLAQYASRIHSAGG--LMMLD 173
           +G+E       L D+    +E   LV IE P NP  +  D+   + ++ S     L+++D
Sbjct: 118 HGVETSFTNDLLNDLPKLVKENTKLVWIESPTNPTLKITDIEAVSQKVKSLNKDILLVVD 177

Query: 174 STLGPPPLRNAWDYGADIIMHSGTKYFGGHSDLLSGIVCVSDEAIAEQLKNDRTYLGTIP 233
           +T   P L N  ++GADI++HS TKY  GHSD++ G++  +++ I E+L+  +  +G IP
Sbjct: 178 NTFLSPYLSNPLNFGADIVVHSATKYINGHSDVVLGVLATNNKDIYERLQFLQNAIGAIP 237

Query: 234 AXXXXXXXXXXXXTMDIRVRRQSQNCTELVSYLANNSEKFSSVVQEIRHASLQTEA---F 290
           +            T+ +RVR+ S +  ++  +L NN       V+ + +  L T      
Sbjct: 238 SPFDAWLTHRGLRTLHLRVRQASLSAQKIAEFLQNNEN-----VEAVNYPGLPTHKDYDV 292

Query: 291 VKQQMPG--GFGPVFALILKSEDQCRKVVKNVSFFQHATSLGGVESLIEWRAMSDPTAL- 347
           VK+Q     G G +   I    +   K   +   F  A SLGGVESL+E  A+     + 
Sbjct: 293 VKKQHREALGGGMISFRIKGGAEAAAKFSSSTRLFALAESLGGVESLLEVPAVMTHGGIP 352

Query: 348 ----------KTLIRVSVGLENIEDLIADLAGSLEK 373
                       L+R+SVG+E+ +DL+ D+  +LEK
Sbjct: 353 KEAREASGVYDNLVRLSVGIEDGDDLLEDVKQALEK 388

>Skud_1.49 Chr1 (106029..107213) [1185 bp, 394 aa] {ON} YAL012W
           (REAL)
          Length = 394

 Score =  130 bits (326), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 106/397 (26%), Positives = 189/397 (47%), Gaps = 43/397 (10%)

Query: 5   ATNAIHSDDYLNRVSDVAPPINVSTTFRYDNEHLVPATRETGMHTSDSPMIYSRLGHPNA 64
           AT AIH+ ++++    V  PI++STTF+  +      T E           YSR  +PN 
Sbjct: 10  ATKAIHAGEHVDVHGSVIEPISLSTTFKQSSPANPIGTYE-----------YSRSQNPNR 58

Query: 65  DRLEAVLSQLLDS-HAVVYASGLAAYHAILVHFK--PKRLFLPHCYHGCKEVARIISRLN 121
           + LE  ++ L ++ + + ++SG A    IL         + +   Y G       ++  +
Sbjct: 59  ENLERAVAALENAQYGLAFSSGSATTATILQSLPQGAHAVSIGDVYGGTHRYFTKVANAH 118

Query: 122 GMEILSLEDIEAKCQE-----GDLVHIEDPINPFGETVDLAQYASRI--HSAGG--LMML 172
           G+E     D+     +       LV IE P NP  +  D+ + A  I  H+AG   ++++
Sbjct: 119 GVETSFTNDLLTDLPQLLKDNTKLVWIETPTNPTLKVTDIQKVADLIKKHAAGQDVILVV 178

Query: 173 DSTLGPPPLRNAWDYGADIIMHSGTKYFGGHSDLLSGIVCVSDEAIAEQLKNDRTYLGTI 232
           D+T   P + N  D+GADI++HS TKY  GHSD++ G++  + + + E+L+  +  +G I
Sbjct: 179 DNTFLSPYISNPLDFGADIVVHSATKYINGHSDVVLGVLATNSKPLYERLQFLQNAIGAI 238

Query: 233 PAXXXXXXXXXXXXTMDIRVRRQSQNCTELVSYLANNSEKFSSVVQEIRHASLQT----E 288
           P+            T+ +RVR+ + +  ++  +LA++ E   +V     +  L+T    +
Sbjct: 239 PSPFDAWLTHRGLKTLHLRVRQAALSAIKIAEFLASDKENIVAV----NYPGLKTHPNYD 294

Query: 289 AFVKQQMPGGFGPVFALILK-SEDQCRKVVKNVSFFQHATSLGGVESLIE---------- 337
             +KQ      G + +  +K   +   K   +   F  A SLGG+ESL+E          
Sbjct: 295 VVLKQHRDALGGGMISFRIKGGAEAASKFASSTRLFTLAESLGGIESLLEVPAVMTHGGI 354

Query: 338 -WRAMSDPTALKTLIRVSVGLENIEDLIADLAGSLEK 373
              A         LIR+SVG+E+ +DL+ D+  +L++
Sbjct: 355 PKEAREASGVFDDLIRISVGIEDTDDLLEDVKQALKQ 391

>NDAI0H02400 Chr8 complement(582916..584097) [1182 bp, 393 aa] {ON}
           Anc_7.97
          Length = 393

 Score =  129 bits (324), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 110/395 (27%), Positives = 185/395 (46%), Gaps = 44/395 (11%)

Query: 5   ATNAIHSDDYLNRVSDVAPPINVSTTFRYDNEHLVPATRETGMHTSDSPMIYSRLGHPNA 64
           AT AIH+  +++    V  PI++STTF+         T E           YSR  +PN 
Sbjct: 10  ATKAIHAGSHVDVHGSVIEPISLSTTFKQSAPAQPIGTYE-----------YSRSQNPNR 58

Query: 65  DRLEAVLSQLLD-SHAVVYASGLAAYHAILVHFKPKR---LFLPHCYHGCKEVARIISRL 120
           + LE  ++ L +  + + ++SG +A  AI++   P+    + +   Y G       ++  
Sbjct: 59  ENLENAIAALENGKYGLAFSSG-SATTAIILQSLPQNSHAISIGDVYGGTHRYFTKVANA 117

Query: 121 NGMEILSLEDIEAKC-----QEGDLVHIEDPINPFGETVDLAQYASRIHSAGG--LMMLD 173
           +G+E     D+         +   LV IE P NP  +  D+   +  I S     L+++D
Sbjct: 118 HGVETTFTNDLIKDLPNLVKENTKLVWIESPTNPTLKVTDIEAVSKSIKSLNKDILLVVD 177

Query: 174 STLGPPPLRNAWDYGADIIMHSGTKYFGGHSDLLSGIVCVSDEAIAEQLKNDRTYLGTIP 233
           +T   P L N  ++GADI++HS TKY  GHSD++ G++  +++ I E+L+  +  +G IP
Sbjct: 178 NTFLSPYLSNPLNFGADIVVHSATKYINGHSDVVLGVLATNNQEIYERLQFLQNAVGAIP 237

Query: 234 AXXXXXXXXXXXXTMDIRVRRQSQNCTELVSYLANNSEKFSSVVQEIRHASLQTEA---F 290
           +            T+ +RVR+ S   T++  +L+ N       V+ + +  L T      
Sbjct: 238 SPFDSWLTHRGLKTLHLRVRQASLTATKIAEFLSTNPN-----VKAVNYPGLPTHENYDI 292

Query: 291 VKQQMPG--GFGPVFALILKSEDQCRKVVKNVSFFQHATSLGGVESLIEWRAMSDPTALK 348
           VK+Q     G G +   I    +   K   +   F  A SLGG+ESL+E  A+     + 
Sbjct: 293 VKKQHREALGGGMISFRINGGSEAAAKFSSSTRLFTLAESLGGIESLLEVPAVMTHGGIP 352

Query: 349 T-----------LIRVSVGLENIEDLIADLAGSLE 372
                       LIR+SVG+E+  DL+ D+  +LE
Sbjct: 353 KESREASGVYDDLIRLSVGIEDAGDLLDDIKQALE 387

>Smik_1.55 Chr1 (113765..114949) [1185 bp, 394 aa] {ON} YAL012W
           (REAL)
          Length = 394

 Score =  129 bits (323), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 104/397 (26%), Positives = 192/397 (48%), Gaps = 43/397 (10%)

Query: 5   ATNAIHSDDYLNRVSDVAPPINVSTTFRYDNEHLVPATRETGMHTSDSPMIYSRLGHPNA 64
           AT AIH+ ++++    V  PI++STTF+  +      T E           YSR  +PN 
Sbjct: 10  ATKAIHAGEHIDVHGSVIEPISLSTTFKQSSPANPIGTYE-----------YSRSQNPNR 58

Query: 65  DRLEAVLSQLLDS-HAVVYASGLAAYHAILVHFK--PKRLFLPHCYHGCKEVARIISRLN 121
           + LE  ++ L ++ + + ++SG A    IL         + +   Y G       ++  +
Sbjct: 59  ENLEKAVAALENAQYGLAFSSGSATTATILQSLPQGSHAVSIGDVYGGTHRYFTKVANAH 118

Query: 122 GMEILSLEDI-----EAKCQEGDLVHIEDPINPFGETVDLAQYASRI--HSAGG--LMML 172
           G+E     D+     +       LV IE P NP  +  D+ + A  I  H+AG   ++++
Sbjct: 119 GVETSFTNDLLNDLPQLLKNNTKLVWIETPTNPTLKVTDIQKVADLIKKHAAGQDVILVV 178

Query: 173 DSTLGPPPLRNAWDYGADIIMHSGTKYFGGHSDLLSGIVCVSDEAIAEQLKNDRTYLGTI 232
           D+T   P + N  ++GADI++HS TKY  GHSD++ G++  +++ + E+L+  +  +G I
Sbjct: 179 DNTFLSPYISNPLNFGADIVVHSATKYINGHSDVVLGVLATNNKQLYERLQFLQNAIGAI 238

Query: 233 PAXXXXXXXXXXXXTMDIRVRRQSQNCTELVSYLANNSEKFSSVVQEIRHASLQT----E 288
           P+            T+ +RVR+ + +  ++  +LA++ E     V  + +  L+T    +
Sbjct: 239 PSPFDAWLTHRGLKTLHLRVRQAALSAIKIAEFLASDKEN----VVAVNYPGLKTHPNYD 294

Query: 289 AFVKQQMPGGFGPVFALILK-SEDQCRKVVKNVSFFQHATSLGGVESLIEWRAMSDPTAL 347
             +KQ      G + +  +K   +   K   +   F  A SLGG+ESL+E  A+     +
Sbjct: 295 VVLKQHRDALGGGMISFRIKGGAEAASKFASSTRLFTLAESLGGIESLLEVPAVMTHGGI 354

Query: 348 KT-----------LIRVSVGLENIEDLIADLAGSLEK 373
                        L+R+SVG+E+ +DL+ D+  +L++
Sbjct: 355 PKEAREASGVYDDLVRISVGIEDTDDLLEDVKQALKQ 391

>TPHA0L00570 Chr12 (97933..99108) [1176 bp, 391 aa] {ON} Anc_7.97
           YAL012W
          Length = 391

 Score =  128 bits (322), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 112/396 (28%), Positives = 187/396 (47%), Gaps = 44/396 (11%)

Query: 5   ATNAIHSDDYLNRVSDVAPPINVSTTFRYDNEHLVPATRETGMHTSDSPMIYSRLGHPNA 64
           AT AIH+  +++    V  PI++STTF+       PA    G +       YSR  +PN 
Sbjct: 10  ATKAIHAGSHVDVHGSVIEPISLSTTFKQS----APA-EPIGEYE------YSRSQNPNR 58

Query: 65  DRLEAVLSQLLD-SHAVVYASGLAAYHAILVHFKPKR---LFLPHCYHGCKEVARIISRL 120
             LE  ++ L +  + + ++SG +A  AI++   P+    + +   Y G       ++  
Sbjct: 59  KNLEDAIAALENGKYGLAFSSG-SATTAIILQSLPQNSHAISIGDVYGGTHRYFSKVANT 117

Query: 121 NGMEILSLEDIEAKC-----QEGDLVHIEDPINPFGETVDLAQYASRIHSAGG--LMMLD 173
           +G++     D+ A       +   LV IE P NP  +  D+   A  I S     L+++D
Sbjct: 118 HGVDTDFTNDLVADLPKLVKENTRLVWIESPTNPTLKVTDIELVAKTIKSLNKDILLVVD 177

Query: 174 STLGPPPLRNAWDYGADIIMHSGTKYFGGHSDLLSGIVCVSDEAIAEQLKNDRTYLGTIP 233
           +T   P L N  ++GADI++HS TKY  GHSD++ G++  +   I E+L+  +  +G IP
Sbjct: 178 NTFLSPYLSNPLNFGADIVVHSATKYINGHSDVVLGVLATNSRDIYERLQFLQNAVGAIP 237

Query: 234 AXXXXXXXXXXXXTMDIRVRRQSQNCTELVSYLANNSEKFSSVVQEIRHASLQTE---AF 290
           +            T+ +RVR+ + N T++  +LA      S  V  + +  L T    A 
Sbjct: 238 SPFDAWLTHRGLKTLHLRVRQAALNATKIAEFLAQ-----SDNVVAVNYPGLPTNPDYAI 292

Query: 291 VKQQMPG--GFGPVFALILKSEDQCRKVVKNVSFFQHATSLGGVESLIEWRAM------- 341
           VK+Q     G G +   +    +   K   +   F  A SLGG+ESL+E  A+       
Sbjct: 293 VKKQHRDALGGGMISFRVKGGAEAASKFASSTRLFTLAESLGGIESLLEVPAVMTHGGIP 352

Query: 342 ----SDPTALKTLIRVSVGLENIEDLIADLAGSLEK 373
                       L+R+SVG+E+ +DL+ D+  +L+K
Sbjct: 353 KEQREASGVFDDLVRLSVGIEDGDDLLEDVKAALQK 388

>YAL012W Chr1 (130799..131983) [1185 bp, 394 aa] {ON}
           CYS3Cystathionine gamma-lyase, catalyzes one of the two
           reactions involved in the transsulfuration pathway that
           yields cysteine from homocysteine with the intermediary
           formation of cystathionine
          Length = 394

 Score =  128 bits (322), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 106/397 (26%), Positives = 191/397 (48%), Gaps = 43/397 (10%)

Query: 5   ATNAIHSDDYLNRVSDVAPPINVSTTFRYDNEHLVPATRETGMHTSDSPMIYSRLGHPNA 64
           AT AIH+ ++++    V  PI++STTF+  +      T E           YSR  +PN 
Sbjct: 10  ATKAIHAGEHVDVHGSVIEPISLSTTFKQSSPANPIGTYE-----------YSRSQNPNR 58

Query: 65  DRLEAVLSQLLDS-HAVVYASGLAAYHAILVHFKPKR--LFLPHCYHGCKEVARIISRLN 121
           + LE  ++ L ++ + + ++SG A    IL         + +   Y G       ++  +
Sbjct: 59  ENLERAVAALENAQYGLAFSSGSATTATILQSLPQGSHAVSIGDVYGGTHRYFTKVANAH 118

Query: 122 GMEILS----LEDIEAKCQEG-DLVHIEDPINPFGETVDLAQYASRI--HSAGG--LMML 172
           G+E       L D+    +E   LV IE P NP  +  D+ + A  I  H+AG   ++++
Sbjct: 119 GVETSFTNDLLNDLPQLIKENTKLVWIETPTNPTLKVTDIQKVADLIKKHAAGQDVILVV 178

Query: 173 DSTLGPPPLRNAWDYGADIIMHSGTKYFGGHSDLLSGIVCVSDEAIAEQLKNDRTYLGTI 232
           D+T   P + N  ++GADI++HS TKY  GHSD++ G++  +++ + E+L+  +  +G I
Sbjct: 179 DNTFLSPYISNPLNFGADIVVHSATKYINGHSDVVLGVLATNNKPLYERLQFLQNAIGAI 238

Query: 233 PAXXXXXXXXXXXXTMDIRVRRQSQNCTELVSYLANNSEKFSSVVQEIRHASLQT----E 288
           P+            T+ +RVR+ + +  ++  +LA + E     V  + +  L+T    +
Sbjct: 239 PSPFDAWLTHRGLKTLHLRVRQAALSANKIAEFLAADKEN----VVAVNYPGLKTHPNYD 294

Query: 289 AFVKQQMPGGFGPVFALILK-SEDQCRKVVKNVSFFQHATSLGGVESLIE---------- 337
             +KQ      G + +  +K   +   K   +   F  A SLGG+ESL+E          
Sbjct: 295 VVLKQHRDALGGGMISFRIKGGAEAASKFASSTRLFTLAESLGGIESLLEVPAVMTHGGI 354

Query: 338 -WRAMSDPTALKTLIRVSVGLENIEDLIADLAGSLEK 373
              A         L+R+SVG+E+ +DL+ D+  +L++
Sbjct: 355 PKEAREASGVFDDLVRISVGIEDTDDLLEDIKQALKQ 391

>SAKL0B09614g Chr2 complement(813507..814685) [1179 bp, 392 aa] {ON}
           highly similar to uniprot|P31373 Saccharomyces
           cerevisiae YAL012W CYS3 Cystathionine gamma-lyase
           catalyzes one of the two reactions involved in the
           transsulfuration pathway that yields cysteine from
           homocysteine with the intermediary formation of
           cystathionine
          Length = 392

 Score =  127 bits (320), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 109/395 (27%), Positives = 191/395 (48%), Gaps = 44/395 (11%)

Query: 5   ATNAIHSDDYLNRVSDVAPPINVSTTFRYDNEHLVPATRETGMHTSDSPMIYSRLGHPNA 64
           AT AIH+  + +    V  PI++STTF+       PA +  G +       YSR  +PN 
Sbjct: 10  ATKAIHAGAHTDVHGSVIEPISLSTTFK----QTAPA-QPVGEYE------YSRSQNPNR 58

Query: 65  DRLEAVLSQLLDS-HAVVYASGLAAYHAILVHFKPK---RLFLPHCYHGCKEVARIISRL 120
             LE  ++ L ++ + + ++SG +A  A+++   P+    + +   Y G       ++  
Sbjct: 59  KNLEDAVAALENAKYGLAFSSG-SATTAVVLQSLPQGSHAVSIGDVYGGTHRYFTKVANA 117

Query: 121 NGMEILS----LEDIEAKCQEGD-LVHIEDPINPFGETVDLAQYASRIHSAGG--LMMLD 173
           +G+E       +ED+    +E   LV IE P NP  +  D+   +  I S     L+++D
Sbjct: 118 HGVETTFTNNLVEDLAQLVKENTRLVWIESPTNPTLKVTDIELVSKTIKSINKDILLVVD 177

Query: 174 STLGPPPLRNAWDYGADIIMHSGTKYFGGHSDLLSGIVCVSDEAIAEQLKNDRTYLGTIP 233
           +T   P L N  ++GADI++HS TKY  GHSD++ G++  +D+ I E+L+  +  +G IP
Sbjct: 178 NTFLSPYLSNPLNFGADIVVHSATKYINGHSDVVLGVLATNDKEIYERLQFLQNAIGAIP 237

Query: 234 AXXXXXXXXXXXXTMDIRVRRQSQNCTELVSYLANNSEKFSSVVQEIRHASLQT----EA 289
           +            T+ +RVR+ +   T++  +L+ + +     V  + +  L T      
Sbjct: 238 SPFDAWLSHRGLKTLHLRVRQAATTATKIAEFLSQSED-----VVAVNYPGLPTHPNHNV 292

Query: 290 FVKQQMPGGFGPVFALILK-SEDQCRKVVKNVSFFQHATSLGGVESLIEWRAM------- 341
            +KQ   G  G + +  +K   +   K   +   F  A SLGG+ESL+E  A+       
Sbjct: 293 VLKQHRDGLGGGMISFRIKGGAEAAAKFSSSTRLFTLAESLGGIESLLEVPAVMTHGGIP 352

Query: 342 ----SDPTALKTLIRVSVGLENIEDLIADLAGSLE 372
                       LIR+S+G+E+ +DL+ D+  +LE
Sbjct: 353 KDQREASGVFDDLIRLSIGIEDTDDLLDDIKQALE 387

>CAGL0H06369g Chr8 (627708..628883) [1176 bp, 391 aa] {ON} highly
           similar to uniprot|P31373 Saccharomyces cerevisiae
           YAL012w CYS3
          Length = 391

 Score =  127 bits (318), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 110/396 (27%), Positives = 186/396 (46%), Gaps = 44/396 (11%)

Query: 5   ATNAIHSDDYLNRVSDVAPPINVSTTFRYDNEHLVPATRETGMHTSDSPMIYSRLGHPNA 64
           AT AIH+  + +    V  PI++STTF+         T E           YSR  +PN 
Sbjct: 10  ATKAIHAGAHEDIHGSVIEPISLSTTFKQSEPAKPIGTYE-----------YSRSQNPNR 58

Query: 65  DRLEAVLSQLLD-SHAVVYASGLAAYHAILVHFKPK---RLFLPHCYHGCKEVARIISRL 120
           + LEA ++ L    + + ++SG +A  A+++   P+    + +   Y G       ++  
Sbjct: 59  ENLEAAIASLEGGKYGLAFSSG-SATTAVILQSLPQGSHAVSIGDVYGGTHRYFTKVANA 117

Query: 121 NGMEILS----LEDIEAKCQEG-DLVHIEDPINPFGETVDLAQYASRIHSAGG--LMMLD 173
           +G++       +ED+    ++   LV IE P NP  +  D+   A  +       L+++D
Sbjct: 118 HGVDTSFTNNLIEDLPKLVKDNTKLVWIESPTNPTLKVTDIQLVAENVKKINKDILLVVD 177

Query: 174 STLGPPPLRNAWDYGADIIMHSGTKYFGGHSDLLSGIVCVSDEAIAEQLKNDRTYLGTIP 233
           +T   P L N   +GADI++HS TKY  GHSD++ G++  + + I E+L+  +  +G IP
Sbjct: 178 NTFLSPYLSNPLKFGADIVVHSATKYINGHSDVVLGVLATNSKDIYERLQFLQNAIGCIP 237

Query: 234 AXXXXXXXXXXXXTMDIRVRRQSQNCTELVSYLANNSEKFSSVVQEIRHASLQTEA---F 290
           +            T+ +RVR+ S N T++ ++L +N       V  + +  LQ+      
Sbjct: 238 SPFDAWLTHRGLKTLHLRVRQASLNATKIATFLESNEN-----VVAVNYPGLQSHPNYDV 292

Query: 291 VKQQMPG--GFGPVFALILKSEDQCRKVVKNVSFFQHATSLGGVESLIE----------- 337
           VK+Q     G G +   I    +   K   +   F  A SLGG+ESL+E           
Sbjct: 293 VKKQHREALGGGMISFRIKGGAEAAAKFSSSTRLFTLAESLGGIESLLEVPAVMTHGGIP 352

Query: 338 WRAMSDPTALKTLIRVSVGLENIEDLIADLAGSLEK 373
             A         L+R+SVG+E+ EDL+ D+  +L+K
Sbjct: 353 KEAREASGVFDDLVRLSVGIEDGEDLLEDIKQALQK 388

>Kpol_1044.10 s1044 (19232..20407) [1176 bp, 391 aa] {ON}
           (19232..20407) [1176 nt, 392 aa]
          Length = 391

 Score =  127 bits (318), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 110/390 (28%), Positives = 186/390 (47%), Gaps = 34/390 (8%)

Query: 5   ATNAIHSDDYLNRVSDVAPPINVSTTFRYDNEHLVPATRETGMHTSDSPMIYSRLGHPNA 64
           AT AIH+  +++    V  PI++STTF+       PA +  G +       YSR  +PN 
Sbjct: 10  ATKAIHAGSHVDVHGSVIEPISLSTTFKQS----APA-QPIGEYE------YSRSQNPNR 58

Query: 65  DRLEAVLSQLLD-SHAVVYASGLAAYHAILVHFKPKR--LFLPHCYHGCKEVARIISRLN 121
             LE  ++ L +  + + ++SG A    IL         + +   Y G       ++  +
Sbjct: 59  KNLEDAIAALENGKYGLAFSSGSATTSVILQSLPQGSHAVSIGDVYGGTHRYFTKVANTH 118

Query: 122 GMEILS----LEDIEAKCQEGD-LVHIEDPINPFGETVDLAQYASRIHSAGG--LMMLDS 174
           G+E       +E++    +E   LV IE P NP  +  D+   +  I S     ++++D+
Sbjct: 119 GVETTFTNNLVEELPQLIKENTRLVWIESPTNPTLKVTDIGLVSQTIKSLKKDIILVVDN 178

Query: 175 TLGPPPLRNAWDYGADIIMHSGTKYFGGHSDLLSGIVCVSDEAIAEQLKNDRTYLGTIPA 234
           T   P L N  ++GADI++HS TKY  GHSD++ G++  +D+ I E+L+  +  +G IP+
Sbjct: 179 TFLSPYLSNPLNFGADIVVHSATKYINGHSDVVLGVLATNDKDIYERLQFLQNAIGAIPS 238

Query: 235 XXXXXXXXXXXXTMDIRVRRQSQNCTELVSYLANNSEKFSSVVQEIRHASLQTEAFVKQQ 294
                       T+ +RVR+ + N T++  +LA+N E   +V      +S   E   KQ 
Sbjct: 239 PFDSWLVHRGLKTLHLRVRQAALNATKIAEFLASN-ENVIAVNYPGLPSSENFEVVKKQH 297

Query: 295 MPGGFGPVFALILK-SEDQCRKVVKNVSFFQHATSLGGVESLIEWRAM-----------S 342
                G + +  +K   +   K   +   F  A SLGG+ESL+E  A+            
Sbjct: 298 RDALGGGMISFRIKGGAEAASKFSSSTRLFTLAESLGGIESLLEVPAVMTHGGIPKEQRE 357

Query: 343 DPTALKTLIRVSVGLENIEDLIADLAGSLE 372
                  LIR+SVG+E+ +DL+ D+  +L+
Sbjct: 358 ASGVFDDLIRLSVGIEDSDDLLDDIKQALQ 387

>Suva_1.56 Chr1 (107030..108217) [1188 bp, 395 aa] {ON} YAL012W
           (REAL)
          Length = 395

 Score =  125 bits (315), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 104/398 (26%), Positives = 187/398 (46%), Gaps = 44/398 (11%)

Query: 5   ATNAIHSDDYLNRVSDVAPPINVSTTFRYDNEHLVPATRETGMHTSDSPMIYSRLGHPNA 64
           AT AIH+ ++++    V  PI++STTF+  +      T E           YSR  +PN 
Sbjct: 10  ATKAIHAGEHVDVHGSVIEPISLSTTFKQSSPANPIGTYE-----------YSRSQNPNR 58

Query: 65  DRLEAVLSQLLDS-HAVVYASGLAAYHAILVHFKPKR--LFLPHCYHGCKEVARIISRLN 121
           + LE  ++ L ++ + + ++SG A    IL         + +   Y G       ++  +
Sbjct: 59  ENLERAVAALENAQYGLAFSSGSATTATILQSLPQGSHAVSIGDVYGGTHRYFTKVANAH 118

Query: 122 GMEILSLEDIEAKCQE-----GDLVHIEDPINPFGETVDLAQYASRI--HSAGG---LMM 171
           G+E     D+     +       LV IE P NP  +  D+ + A  I  H+A     +++
Sbjct: 119 GVETSFTNDLLKDLPQLLKDNTKLVWIETPTNPTLKVTDIQKVADAIKKHTAASQDVILV 178

Query: 172 LDSTLGPPPLRNAWDYGADIIMHSGTKYFGGHSDLLSGIVCVSDEAIAEQLKNDRTYLGT 231
           +D+T   P + N  ++GADI++HS TKY  GHSD++ G++  + + + E+L+  +  +G 
Sbjct: 179 VDNTFLSPYISNPLNFGADIVVHSATKYINGHSDVVLGVLATNSKPLYERLQFLQNAIGA 238

Query: 232 IPAXXXXXXXXXXXXTMDIRVRRQSQNCTELVSYLANNSEKFSSVVQEIRHASLQT---- 287
           IP+            T+ +RVR+ + +  ++  +LA + E   +V     +  L+T    
Sbjct: 239 IPSPFDAWLTHRGLKTLHLRVRQAALSAIKIAEFLAADKENIVAV----NYPGLKTHPNY 294

Query: 288 EAFVKQQMPGGFGPVFALILK-SEDQCRKVVKNVSFFQHATSLGGVESLIE--------- 337
           +  VKQ      G + +  +K   +   K   +   F  A SLGG+ESL+E         
Sbjct: 295 DVVVKQHRDALGGGMISFRIKGGAEAASKFASSTRLFTLAESLGGIESLLEVPAVMTHGG 354

Query: 338 --WRAMSDPTALKTLIRVSVGLENIEDLIADLAGSLEK 373
               A         L+R+SVG+E+ +DL+ D+  +L++
Sbjct: 355 IPKEAREASGVFDDLVRISVGIEDADDLLDDIKQALKQ 392

>TDEL0H03530 Chr8 complement(586031..587206) [1176 bp, 391 aa] {ON}
           Anc_7.97 YAL012W
          Length = 391

 Score =  123 bits (308), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 109/400 (27%), Positives = 193/400 (48%), Gaps = 46/400 (11%)

Query: 5   ATNAIHSDDYLNRVSDVAPPINVSTTFRYDNEHLVPATRETGMHTSDSPMIYSRLGHPNA 64
           AT AIH+  +++    V  PI++STTF+  +        E           YSR  +PN 
Sbjct: 10  ATKAIHAGAHVDIHGSVIEPISLSTTFKQSSPAAPLGEYE-----------YSRSQNPNR 58

Query: 65  DRLEAVLSQLLDS-HAVVYASGLAAYHAILVHFKPK---RLFLPHCYHGCKEVARIISRL 120
             LE  L+ L ++ + + ++SG +A  A+++   P+    + +   Y G       ++  
Sbjct: 59  KNLEEALAALENAKYGLAFSSG-SATTAVVLQSLPQGSHAVSIGDVYGGTHRYFTKVANA 117

Query: 121 NGMEILS----LEDIEAKCQEG-DLVHIEDPINPFGETVDLA---QYASRIHSAGGLMML 172
           +G++       ++D+ +  +E   LV IE P NP  +  D+A   + A +I+    L+++
Sbjct: 118 HGVDTSFTNDLIKDLPSLIKENTKLVWIESPTNPTLKVTDIALVVKTAKQINKEI-LVVV 176

Query: 173 DSTLGPPPLRNAWDYGADIIMHSGTKYFGGHSDLLSGIVCVSDEAIAEQLKNDRTYLGTI 232
           D+T   P L N  ++G DI++HS TKY  GHSD++ G++  +D+AI E+L+  +  +G I
Sbjct: 177 DNTFLSPYLSNPLNFGVDIVVHSATKYINGHSDVVLGVLATNDKAIYEKLQFLQNAIGAI 236

Query: 233 PAXXXXXXXXXXXXTMDIRVRRQSQNCTELVSYLANNSEKFSSVVQEIRHASLQT----E 288
           P+            T+ +RVR+ +   T++  +L  +S      V  + +  L +    E
Sbjct: 237 PSPFDSWLAHRGLKTLHLRVRQAALTATKIAEFLEQDSN-----VLAVNYPGLASNPDRE 291

Query: 289 AFVKQQMPGGFGPVFALILKSEDQ-CRKVVKNVSFFQHATSLGGVESLIEWRAMSDPTAL 347
              +Q   G  G + +  +K   Q   K   +   F  A SLGG+ESL+E  A+     +
Sbjct: 292 IVQRQHRDGLGGGMISFRIKGGAQAAAKFSSSTRLFTLAESLGGIESLLEVPAVMTHGGI 351

Query: 348 KT-----------LIRVSVGLENIEDLIADLAGSLEKINK 376
                        LIR+SVG+E+ +DL+ D+  +L    K
Sbjct: 352 PKEQREASGVYDDLIRLSVGIEDSDDLLTDIKEALAATTK 391

>KLTH0D02728g Chr4 (267019..268197) [1179 bp, 392 aa] {ON} highly
           similar to uniprot|P31373 Saccharomyces cerevisiae
           YAL012W CYS3 Cystathionine gamma-lyase catalyzes one of
           the two reactions involved in the transsulfuration
           pathway that yields cysteine from homocysteine with the
           intermediary formation of cystathionine
          Length = 392

 Score =  123 bits (308), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 108/396 (27%), Positives = 187/396 (47%), Gaps = 44/396 (11%)

Query: 5   ATNAIHSDDYLNRVSDVAPPINVSTTFRYDNEHLVPATRETGMHTSDSPMIYSRLGHPNA 64
           AT AIH+  + +    V  PI++STTF+       PA +  G +       YSR  +PN 
Sbjct: 10  ATLAIHAGAHTDVHGSVIEPISLSTTFKQS----APA-QPIGAYE------YSRSQNPNR 58

Query: 65  DRLEAVLSQLLDSH-AVVYASGLAAYHAILVHFKPK---RLFLPHCYHGCKEVARIISRL 120
             LEA ++ L  +   + ++SG +A  A+++   P     + +   Y G       ++  
Sbjct: 59  ANLEAAVAALERAQFGLAFSSG-SATTAVVLQSLPTDSHAISIGDVYGGTHRYFTQVAHA 117

Query: 121 NGMEILSLEDIEAKCQE-----GDLVHIEDPINPFGETVDLAQYASRIHSAGG--LMMLD 173
           +G++     D+E    +       LV +E P NP  +  D+ + A   H+A    L+++D
Sbjct: 118 HGVQTSFTNDLERDLPQLVRPNTRLVWLESPTNPTLKVTDIRRVADAAHAANPDILVVVD 177

Query: 174 STLGPPPLRNAWDYGADIIMHSGTKYFGGHSDLLSGIVCVSDEAIAEQLKNDRTYLGTIP 233
           +T   P + N   +GADI++HS TKY  GHSD++ G++  ++E + E+L+  +  +G +P
Sbjct: 178 NTFLSPYISNPLTHGADIVVHSATKYINGHSDVVLGVLATNNEPLYERLRFLQNAIGAVP 237

Query: 234 AXXXXXXXXXXXXTMDIRVRRQSQNCTELVSYLANNSEKFSSVVQEIRHASLQTE---AF 290
           +            T+ +RVR  +Q+   +  +L     + S  V+ + +  L +    A 
Sbjct: 238 SPFDSWLTHRGLKTLHLRVRAAAQSAQRIAKFL-----EASDRVEHVNYPGLSSHPAYAV 292

Query: 291 VKQQMPG--GFGPVFALILKSEDQCRKVVKNVSFFQHATSLGGVESLIEWRAM------- 341
           V++Q     G G +   I        +       F  A SLGG+ESL+E  A+       
Sbjct: 293 VQKQHRDALGGGMISFRIKGGAGAAARFTSTTRLFTLAESLGGIESLVEVPAVMTHGGIP 352

Query: 342 ----SDPTALKTLIRVSVGLENIEDLIADLAGSLEK 373
                       LIR+SVG+E+I+DL+ D+  +LEK
Sbjct: 353 REQREASGVFDNLIRLSVGIEDIDDLLEDVRQALEK 388

>Ecym_2629 Chr2 complement(1216179..1217357) [1179 bp, 392 aa] {ON}
           similar to Ashbya gossypii AEL341W
          Length = 392

 Score =  123 bits (308), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 103/390 (26%), Positives = 186/390 (47%), Gaps = 36/390 (9%)

Query: 5   ATNAIHSDDYLNRVSDVAPPINVSTTFRYDNEHLVPATRETGMHTSDSPMIYSRLGHPNA 64
           +T  +H+ ++++    V  PI++STTF+  +  +     E           YSR  +PN 
Sbjct: 10  STKVVHAGEHVDIHGSVIEPISLSTTFKQASPAVPVGAYE-----------YSRSQNPNR 58

Query: 65  DRLEAVLSQLLDS-HAVVYASGLAAYHAILVHFKPK---RLFLPHCYHGCKEVARIISRL 120
             LE  ++ L ++ H + ++SG +A  A+++   P+    + +   Y G       ++  
Sbjct: 59  KNLEDAIAVLENAKHGLAFSSG-SATTAVILQSLPQGSHAISIGDVYGGTHRYFNNVANA 117

Query: 121 NGMEILS----LEDIEAKCQEG-DLVHIEDPINPFGETVDLAQYASRIHSAGG--LMMLD 173
           +G+E       +ED+    +E   LV IE P NP  +  D+   +  I S+    ++++D
Sbjct: 118 HGVETTFTNNLVEDLPTLIRENTKLVWIESPTNPTLKVTDIQLVSQIIKSSNKDIILVVD 177

Query: 174 STLGPPPLRNAWDYGADIIMHSGTKYFGGHSDLLSGIVCVSDEAIAEQLKNDRTYLGTIP 233
           +T   P L N  ++GADI++HS TKY  GHSD++ G++  + + + ++L+  +  +G +P
Sbjct: 178 NTFLSPYLSNPLNFGADIVIHSATKYINGHSDVVLGVLATNSQVLYDKLQYLQNAIGAVP 237

Query: 234 AXXXXXXXXXXXXTMDIRVRRQSQNCTELVSYLANNSEKFSSVVQEIRHASLQTEAFVKQ 293
           +            T+ +RVR  S +  E+  +L   S+K  SV      +    +   KQ
Sbjct: 238 SPFDAWLTHRGLKTLHLRVRTASNSAQEIAEFLV-KSDKVISVNYPGLSSHPNNDIVKKQ 296

Query: 294 QMPGGFGPVFALILK-SEDQCRKVVKNVSFFQHATSLGGVESLIEWRAMSDPTALKT--- 349
              G  G + +  +K   D   K   +   F  A SLGG+ESL+E  A+     +     
Sbjct: 297 HRDGLGGGMISFRIKGGADGAAKFSASTRLFTLAESLGGIESLLEVPAVMTHGGIPKDQR 356

Query: 350 --------LIRVSVGLENIEDLIADLAGSL 371
                   LIR+SVG+E+  DL+ D+  +L
Sbjct: 357 EASGVYDDLIRLSVGIEDTGDLLKDIEQAL 386

>KLLA0F07909g Chr6 (742468..743643) [1176 bp, 391 aa] {ON} highly
           similar to uniprot|P31373 Saccharomyces cerevisiae
           YAL012W CYS3 Cystathionine gamma-lyase catalyzes one of
           the two reactions involved in the transsulfuration
           pathway that yields cysteine from homocysteine with the
           intermediary formation of cystathionine
          Length = 391

 Score =  122 bits (307), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 107/394 (27%), Positives = 188/394 (47%), Gaps = 44/394 (11%)

Query: 5   ATNAIHSDDYLNRVSDVAPPINVSTTFRYDNEHLVPATRETGMHTSDSPMIYSRLGHPNA 64
           AT AIH+  +++    V  PI++STTF+       PA +  G +       YSR  +PN 
Sbjct: 10  ATKAIHAGTHVDVHGSVIEPISLSTTFKQS----APA-QPIGEYE------YSRSQNPNR 58

Query: 65  DRLEAVLSQLLD-SHAVVYASGLAAYHAILVHFKPK---RLFLPHCYHGCKEVARIISRL 120
             LE  ++ L +  + + ++SG +A  A+++   P+    + +   Y G       ++  
Sbjct: 59  KNLEDAIAALENGKYGLAFSSG-SATTAVILQSLPQGSHAVSIGDVYGGTHRYFTKVANA 117

Query: 121 NGMEILSLEDIEAKC-----QEGDLVHIEDPINPFGETVDLAQYASRIHSAGG--LMMLD 173
           +G+E     ++ A+      +   LV IE P NP  +  D+   A    S     L+++D
Sbjct: 118 HGVETTFTNNLVAELPSLIKENTKLVWIETPTNPTLKVTDIELVAKTAKSINKDILLVVD 177

Query: 174 STLGPPPLRNAWDYGADIIMHSGTKYFGGHSDLLSGIVCVSDEAIAEQLKNDRTYLGTIP 233
           +T   P L N  ++GADI++HS TKY  GHSD++ G++  +D+ I E+L+  +  +G IP
Sbjct: 178 NTFLSPYLSNPLNFGADIVVHSATKYINGHSDVVLGVLATNDKVIYEKLQFLQNAIGAIP 237

Query: 234 AXXXXXXXXXXXXTMDIRVRRQSQNCTELVSYLANNSEKFSSVVQEIRHASLQTE---AF 290
           +            T+ +RVR+ S +  ++  +L++N       V  + +  L T    A 
Sbjct: 238 SPFDSWLVHRGVKTLHLRVRQASLSAHKIAEFLSSNEN-----VIAVNYPGLPTHESYAV 292

Query: 291 VKQQMPG--GFGPVFALILKSEDQCRKVVKNVSFFQHATSLGGVESLIEWRAMSDPTALK 348
           VK+Q     G G +   I    +       +   F  A SLGG+ESL+E  A+     + 
Sbjct: 293 VKKQHRDALGGGMISFRIKGGAEAASTFSSSTRLFTLAESLGGIESLLEVPAVMTHGGIP 352

Query: 349 T-----------LIRVSVGLENIEDLIADLAGSL 371
                       L+R+S+G+E+ +DL+ D+  +L
Sbjct: 353 KEQREASGVYDDLVRLSIGIEDTDDLLEDIKQAL 386

>AEL341W Chr5 (9428..10609) [1182 bp, 393 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YAL012W (CYS3)
          Length = 393

 Score =  122 bits (306), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 107/393 (27%), Positives = 186/393 (47%), Gaps = 36/393 (9%)

Query: 5   ATNAIHSDDYLNRVSDVAPPINVSTTFRYDNEHLVPATRETGMHTSDSPMIYSRLGHPNA 64
           AT AIH+  + +    V  PI++STTF+  +        E           YSR  +PN 
Sbjct: 10  ATKAIHAGAHTDLHGSVIEPISLSTTFKQSSPGNPVGAYE-----------YSRGQNPNR 58

Query: 65  DRLEAVLSQLLDS-HAVVYASGLAAYHAILVHFKPK---RLFLPHCYHGCKEVARIISRL 120
             LE  ++ L  + + + ++SG +A  A++V   P+    + +   Y G       ++  
Sbjct: 59  QNLEEAIAALESAKYGLAFSSG-SATTAVIVQSLPQGSHAISIGDVYGGTHRYFTKVANA 117

Query: 121 NGMEILS----LEDIEAKCQEGD-LVHIEDPINPFGETVDLAQYASRIHSAGG--LMMLD 173
           +G+E       LED+    ++   LV IE P NP  +  D+ Q A  + +     ++++D
Sbjct: 118 HGVETSFTNSLLEDLPKLVRDNTRLVWIESPTNPTLQVTDIQQVADTVKALNEDIILVVD 177

Query: 174 STLGPPPLRNAWDYGADIIMHSGTKYFGGHSDLLSGIVCVSDEAIAEQLKNDRTYLGTIP 233
           +T   P L N  ++GADI++HS TKY  GHSD++ G +  +  ++ E+L   +  +G IP
Sbjct: 178 NTFLSPYLSNPLNFGADIVIHSATKYINGHSDVVLGALATNSTSLYERLAFLQNAIGAIP 237

Query: 234 AXXXXXXXXXXXXTMDIRVRRQSQNCTELVSYLANNSEKFSSVVQEIRHASLQTEAFVKQ 293
           +            T+ +RVR+ +Q+  ++  YL   SE   SV      +    +   KQ
Sbjct: 238 SPFDAWLTHRGLKTLHLRVRQAAQSAQKIAEYL-EQSEHVVSVNYPGLPSHRGYQIAQKQ 296

Query: 294 QMPGGFGPVFALILKSEDQCRKVV-KNVSFFQHATSLGGVESLIEWRAMSDPTALKT--- 349
              G  G + +  +K   Q   ++ ++   F  A SLGG+ESL+E  A+     +     
Sbjct: 297 HRDGLGGGMISFRVKGGAQGAALLSQSTRLFTLAESLGGIESLLEVPAVMTHAGIPKEAR 356

Query: 350 --------LIRVSVGLENIEDLIADLAGSLEKI 374
                   L+RVSVG+E+ +DL+ D+  +L  +
Sbjct: 357 EASGVYDDLVRVSVGIEDTDDLLEDIKQALSVV 389

>TBLA0E02240 Chr5 (554046..555209) [1164 bp, 387 aa] {ON} Anc_7.97
           YAL012W
          Length = 387

 Score =  120 bits (302), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 103/394 (26%), Positives = 188/394 (47%), Gaps = 44/394 (11%)

Query: 5   ATNAIHSDDYLNRVSDVAPPINVSTTFRYDNEHLVPATRETGMHTSDSPMIYSRLGHPNA 64
           AT AIH+  +++    V  PI++STTF+         ++  G++       YSR  +PN 
Sbjct: 10  ATKAIHAGAHIDVHGSVIEPISLSTTFKQS-----APSQPIGIYE------YSRSQNPNR 58

Query: 65  DRLEAVLSQLLD-SHAVVYASGLAAYHAILVHFKPK---RLFLPHCYHGCKEVARIISRL 120
             LE  ++ L +  + + ++SG +A  A+++   P+    + +   Y G       ++  
Sbjct: 59  KNLEEAIATLENGKYGLAFSSG-SATTAVILQSLPQGSHSISIGDVYGGTHRYFTKVANA 117

Query: 121 NGMEILS----LEDIEAKCQEGD-LVHIEDPINPFGETVDLAQYASRIHSAGG--LMMLD 173
           +G+E       +E++    +    LV IE P NP  +  D+      +       L+++D
Sbjct: 118 HGVESTFSNNLIEELPTLVKPNTRLVWIESPTNPTLKVTDIQLVVDTVKKLNKDILVVVD 177

Query: 174 STLGPPPLRNAWDYGADIIMHSGTKYFGGHSDLLSGIVCVSDEAIAEQLKNDRTYLGTIP 233
           +T   P L N  ++GADI++HS TKY  GHSD++ G++  + + I E+L+  +  +G IP
Sbjct: 178 NTFLSPYLSNPLNFGADIVVHSATKYINGHSDVVLGVLATNSKEIYERLQFLQNAIGAIP 237

Query: 234 AXXXXXXXXXXXXTMDIRVRRQSQNCTELVSYLANNSEKFSSVVQEIRHASLQTEA---F 290
           +            T+ +RVR+ S +  ++  +LA +       V  + +  L++      
Sbjct: 238 SPFDAWLAHRGLKTLHLRVRQASLSAQKIAEFLAQDPN-----VIAVNYPGLESHPNRDI 292

Query: 291 VKQQMPGGFGP--VFALILKSEDQCRKVVKNVSFFQHATSLGGVESLIEWRAMSDPTALK 348
           VK+Q   G G   +   I    +   K  +    F  A SLGG+ESL+E  A+     + 
Sbjct: 293 VKKQHRDGLGGGMISFRIKGGAEGASKFTQKTRLFTLAESLGGIESLLEVPAVMTHGGIP 352

Query: 349 T-----------LIRVSVGLENIEDLIADLAGSL 371
                       L+R+SVG+E+++DL+AD+  +L
Sbjct: 353 KEAREATGVYDDLVRLSVGIEDVDDLLADVKQAL 386

>ZYRO0D05742g Chr4 (489953..491128) [1176 bp, 391 aa] {ON} highly
           similar to uniprot|P31373 Saccharomyces cerevisiae
           YAL012W CYS3 Cystathionine gamma-lyase catalyzes one of
           the two reactions involved in the transsulfuration
           pathway that yields cysteine from homocysteine with the
           intermediary formation of cystathionine
          Length = 391

 Score =  120 bits (301), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 105/392 (26%), Positives = 187/392 (47%), Gaps = 38/392 (9%)

Query: 5   ATNAIHSDDYLNRVSDVAPPINVSTTFRYDNEHLVPATRETGMHTSDSPMIYSRLGHPNA 64
           AT AIH+  +++    V  PI++STTF+       PA +  G +       YSR  +PN 
Sbjct: 10  ATKAIHAGAHVDVHGSVIEPISLSTTFKQS----APA-QPLGEYE------YSRSQNPNR 58

Query: 65  DRLEAVLSQLLD-SHAVVYASGLAAYHAILVHFKPK---RLFLPHCYHGCKEVARIISRL 120
             LE  ++ L +  H + ++SG +A  A+++   P+    + +   Y G       ++  
Sbjct: 59  KNLEDAIASLENGKHGLAFSSG-SATTAVILQSLPQGSHAISIGDVYGGTHRYFTKVANA 117

Query: 121 NGMEILS----LEDIEAKCQEG-DLVHIEDPINPFGETVDLAQYASRIHSAGG--LMMLD 173
           +G+++      ++D+ +  +    L+ IE P NP  +  D+A     +       L+++D
Sbjct: 118 HGVDVSFTNELVKDLPSLVKPNTKLLWIESPTNPTLQVTDIALVNKTVKELNKDILVVVD 177

Query: 174 STLGPPPLRNAWDYGADIIMHSGTKYFGGHSDLLSGIVCVSDEAIAEQLKNDRTYLGTIP 233
           +T   P L N  D+G D+++HS TKY  GHSD++ G++  +   + E+L+  +  +G IP
Sbjct: 178 NTFLSPYLSNPLDFGVDVVVHSATKYINGHSDVVLGVLATNSTELYERLQFLQNAIGAIP 237

Query: 234 AXXXXXXXXXXXXTMDIRVRRQSQNCTELVSYLANNSEKFSSVVQEIRHASLQTEAFVKQ 293
           +            T+ +RVR+ +   T++  +L +N    +  V     AS  +   V++
Sbjct: 238 SPFDAWLAHRGLKTLHLRVRQAATTATKIAEFLQSNDRVIA--VNYPGLASHPSHDVVQR 295

Query: 294 QMPGGFGP--VFALILKSEDQCRKVVKNVSFFQHATSLGGVESLIEWRAMSDPTAL---- 347
           Q   G G   +   I    +   K   N   F  A SLGG+ESL+E  A+     +    
Sbjct: 296 QHRDGLGGGMISFRIKGGAEGAAKFSSNTRLFTLAESLGGIESLLEVPAVMTHGGIPEDQ 355

Query: 348 -------KTLIRVSVGLENIEDLIADLAGSLE 372
                    LIR+SVG+E+ EDL+ D+  +L+
Sbjct: 356 REASGVYDDLIRLSVGIEDTEDLLEDIKQALK 387

>KNAG0D04740 Chr4 complement(851405..852577) [1173 bp, 390 aa] {ON}
           Anc_7.97 YAL012W
          Length = 390

 Score =  119 bits (297), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 108/394 (27%), Positives = 186/394 (47%), Gaps = 42/394 (10%)

Query: 5   ATNAIHSDDYLNRVSDVAPPINVSTTFRYDNEHLVPATRETGMHTSDSPMIYSRLGHPNA 64
           AT A+H+ ++ +    V  PI++STTF+  +    PA    G++       YSR  +PN 
Sbjct: 8   ATLAVHAGEHTDVHGSVIEPISLSTTFKQSS----PA-NPIGVYE------YSRSQNPNR 56

Query: 65  DRLEAVLSQLLDS-HAVVYASGLAAYHAILVHFK--PKRLFLPHCYHGCKEVARIISRLN 121
           D LE  ++ L  + + + ++SG AA   I+         + +   Y G       ++  +
Sbjct: 57  DNLENAIAALEKAQYGLAFSSGSAATSVIMQSLPQGSHAVSIGDVYGGTHRYFTKVANTH 116

Query: 122 GMEILS----LEDIEAKCQEGD-LVHIEDPINPFGETVDLAQYASRIHSAGG--LMMLDS 174
           G+E       LE++    ++   LV IE P NP  +  D+   ++ I       L+++D+
Sbjct: 117 GVETTFTNNLLEELPNLVKDNTRLVWIESPTNPTLKVTDIQAVSNAIKKINKDILLVVDN 176

Query: 175 TLGPPPLRNAWDYGADIIMHSGTKYFGGHSDLLSGIVCVSDEAIAEQLKNDRTYLGTIPA 234
           T   P L N   +GADI++HS TKY  GHSD++ G++  + + I E+L+  +  +G IP+
Sbjct: 177 TFLSPYLSNPLTFGADIVVHSATKYINGHSDVVLGVLATNSKDIYERLQFLQNAIGAIPS 236

Query: 235 XXXXXXXXXXXXTMDIRVRRQSQNCTELVSYLANNSEKFSSVVQEIRHASLQT---EAFV 291
                       T+ +RV++ S    ++  +L+      S  V+ + +  L+T    A V
Sbjct: 237 PFDAWLTHRGLKTLHLRVKQASVTAQKIAEFLSA-----SKHVEAVNYPGLKTHPNHAVV 291

Query: 292 KQQMPG--GFGPVFALILKSEDQCRKVVKNVSFFQHATSLGGVESLIEWRAMSDPTAL-- 347
           ++Q     G G +   +        K       F  A SLGG+ESL+E  A+     +  
Sbjct: 292 QRQHRDALGGGMISFRVKGGAAAAAKFSSTTRLFTLAESLGGIESLLEVPAVMTHGGIPK 351

Query: 348 ---------KTLIRVSVGLENIEDLIADLAGSLE 372
                      LIR+SVG+E+ EDL+ D+  +LE
Sbjct: 352 ESREASGVYDNLIRLSVGIEDTEDLLEDIKQALE 385

>ZYRO0G19162g Chr7 (1590120..1591487) [1368 bp, 455 aa] {ON} similar
           to uniprot|P53101 Saccharomyces cerevisiae YGL184C STR3
           Cystathionine beta-lyase converts cystathionine into
           homocysteine
          Length = 455

 Score = 85.9 bits (211), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 104/406 (25%), Positives = 165/406 (40%), Gaps = 58/406 (14%)

Query: 6   TNAIHSDDYLNRVSDVAPPINVSTTFRYDNEHLVPATRETGMHTSDSPMIYSRLGHPNAD 65
           +N++H D +   V     P+ +STTF+ D            + +      YSR G+P   
Sbjct: 9   SNSLHRDQHGASVQ----PVYMSTTFKVD------------LRSDGQAYDYSRSGNPTRS 52

Query: 66  RLEAVLSQLLDS-----HAVVYASGLAAYHAIL-------VHFKPKRLFLPHCYHGCKEV 113
            L   L QL +      HAV  +SG+ A  AI+           P  L     Y G   +
Sbjct: 53  LLHRQLGQLYNVPESQVHAV--SSGMTALDAIMRGLILSNTSHVPTILAGDDLYGGSDRL 110

Query: 114 ARII-SRLNGMEILSLEDIEAKCQEG-------DLVHIEDPINPFGETVDLAQYASRIHS 165
              + +R +   I        K QE        D VHIE P NP  + VD+ +  S + S
Sbjct: 111 LTFLKTRCHARTINVDTSNFDKFQEAFLSVDKVDCVHIESPTNPMCKVVDVPRIISFVKS 170

Query: 166 AG--GLMMLDSTLGPPPLRNAWDYGADIIMHSGTKYFGGHSDLLSGIVCVSDEAIAEQLK 223
                 +++D+T+    L N    GAD +  S TK+  GH D+++G+V   ++ IA+ + 
Sbjct: 171 VSPQTYVIVDNTMMSGLLCNPLSLGADAVYESATKFLNGHHDIMAGVVVSRNQKIADAIY 230

Query: 224 NDRTYLGTIPAXXXXXXXXXXXXTMDIRVRRQSQNCTELVSYLANN---SEKFSSVVQEI 280
                 G   A            T+ +R+ +Q  N   L  +L  +    +   + +   
Sbjct: 231 FVVNATGCGLAPMDSWLLIRGLKTLSVRLYQQQFNAMVLAEWLEQSCGFKQSKDNSLLRT 290

Query: 281 RHASLQT--EAFVKQQMPGGFGPVFALILKSEDQCRKVV--KNVSFFQHATSLGGVESLI 336
           R+  LQ+  +  + +    G G V +    S    R++V  K +  +    S G V SLI
Sbjct: 291 RYVGLQSHPQFSLHRSFNDGPGAVLSFETGSTPLSRRIVSSKALKIWSVTVSFGCVNSLI 350

Query: 337 EW-----RAMSDPTALKT------LIRVSVGLENIEDLIADLAGSL 371
                   A  DP   K       LIR+ VG+E+I DL  DL  ++
Sbjct: 351 SLPCSMSHASIDPNVRKEREFPEDLIRLCVGIEDIVDLQKDLLAAM 396

>TDEL0B04660 Chr2 complement(828468..829862) [1395 bp, 464 aa] {ON}
           Anc_8.145 YGL184C
          Length = 464

 Score = 84.7 bits (208), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 97/390 (24%), Positives = 166/390 (42%), Gaps = 65/390 (16%)

Query: 24  PINVSTTFRYDNEHLVPATRETGMHTSDSPMI-YSRLGHPNADRLEAVLSQLLD---SHA 79
           P+ +STTF+ D            +   +S +  YSR G+P    L+  + +L +    H 
Sbjct: 29  PLYLSTTFKVD------------LDNPESQVFDYSRSGNPTRSLLQYQIGKLYEVPVEHV 76

Query: 80  VVYASGLAAYHAIL-------------------VHFKPKRLFLPHCYHGCKEVARIISRL 120
           +  ASG+ A   IL                   ++    RL     Y   K  AR +  +
Sbjct: 77  LAVASGMTALDVILRGLVISSATHVPTIIAGDDLYGGSNRLL---AYLESKSHARAV-HV 132

Query: 121 NGMEILSLEDIEAKCQEGDLVHIEDPINPFGETVDLAQ---YASRIHSAGGLMMLDSTLG 177
           +  ++   + +     + D V +E P NP  + VD+ Q   Y  RI S   ++++D+T+ 
Sbjct: 133 DTTDMEKFKAVFGSLDKVDCVLLESPTNPLCKVVDVPQLVAYVKRI-SPSTVVIVDNTMM 191

Query: 178 PPPLRNAWDYGADIIMHSGTKYFGGHSDLLSGIVCVSDEAIAEQLKNDRTYLGTIPAXXX 237
                N  +YG D++  S TKY  GH D++ GI+      IA+++       G+  +   
Sbjct: 192 SGLQCNPLEYGCDVVYESATKYLNGHHDIMGGIIVGKTAEIAQEIYYVVNATGSGLSPMD 251

Query: 238 XXXXXXXXXTMDIRVRRQSQNCTELVSYLANN-----SEKFSSVVQEIRHASLQTE-AF- 290
                    T+ +R+ +Q  N   +  +L  +     +EK S++  + R+  L+T   F 
Sbjct: 252 SWLLNRGLKTLGVRMYQQQYNSMVIAQWLEESCGFKPTEKNSAL--KTRYVGLKTNPGFE 309

Query: 291 VKQQMPGGFGPVFALILKSEDQCRKVVKNVSF--FQHATSLGGVESLIEW-----RAMSD 343
           + +    G G V +    S +  +++V + +F  F    S G V SLI        A  D
Sbjct: 310 LHRSFNKGPGAVLSFETGSLEHSQRIVASKAFQLFSVTVSFGCVNSLISLPCKMSHASID 369

Query: 344 PTALKT------LIRVSVGLENIEDLIADL 367
           P   K       LIR+ VG+E++ DL  DL
Sbjct: 370 PEVRKQREFPEDLIRLCVGIEDVGDLQKDL 399

>Smik_7.375 Chr7 (620194..621399) [1206 bp, 401 aa] {ON} YFR055W
           (REAL)
          Length = 401

 Score = 80.9 bits (198), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 68/264 (25%), Positives = 120/264 (45%), Gaps = 26/264 (9%)

Query: 129 EDIEAKCQEGD-LVHIEDPINPFGETVDLAQYASRIHSAGGLMMLDSTLGPPPLRNAWDY 187
           EDIE   +    ++ +E P +   E  ++    S     G   +LD+T   P   +A  +
Sbjct: 139 EDIEKLVKPNTTVIFLESPGSGTMEIQNIPALVSVAKKHGIKTILDNTWATPLFFDAHGH 198

Query: 188 GADIIMHSGTKYFGGHSDLLSGIVCVSDEAIAEQLKNDRTYLGTIPAXXXXXXXXXXXXT 247
           G DI + +GTKY GGHSDLL G+V  ++E     L++    +  +P             T
Sbjct: 199 GIDISLEAGTKYLGGHSDLLLGLVSANEECWP-LLRSTYDAMAMLPGADDCLLALRGMRT 257

Query: 248 MDIRVRRQSQNCTELVSYLANNSEKFSSVVQEIRHASLQT----EAFVKQQMPGGFGPVF 303
           + +R++   +   +L ++     E     V+++ H + +     E +V+     G   +F
Sbjct: 258 LHLRLKEAERKALDLAAWFKKRDE-----VEKVLHPAFEDCPGHEYWVRDYK--GSSGLF 310

Query: 304 ALILK---SEDQCRKVVKNVSFFQHATSLGGVESLIEWRAMSDPTALKT--------LIR 352
           +++LK   +      +V N+  F+   S GG +SLI    ++ PT  K          +R
Sbjct: 311 SIVLKDGFTRSGLENMVDNMKVFELGYSWGGYDSLI--TPVNPPTQRKAAPWSHNGFALR 368

Query: 353 VSVGLENIEDLIADLAGSLEKINK 376
           + VGLE +EDL  DL    E++ +
Sbjct: 369 IQVGLEELEDLKRDLELGFERLTE 392

>CAGL0L06094g Chr12 (693250..694602) [1353 bp, 450 aa] {ON} similar
           to uniprot|P53101 Saccharomyces cerevisiae YGL184c
          Length = 450

 Score = 79.7 bits (195), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 94/400 (23%), Positives = 170/400 (42%), Gaps = 75/400 (18%)

Query: 24  PINVSTTFRYDNEHLVPATRETGMHTSDSPMIYSRLGHPNADRLEAVLSQLLD----SHA 79
           P+ +STTF+ D E+             ++   YSR G+P    L+  +++L D    +  
Sbjct: 11  PLYLSTTFKVDLEN------------ENNQYDYSRSGNPTRTLLQQQVAKLYDDIDPNFV 58

Query: 80  VVYASGLAAYHAILVHFKPKRLFLP-----HC-------YHGCKEVARIIS-RLNGM--E 124
              +SG+ A   +L      R FLP     HC       Y G + +  ++   ++ M  +
Sbjct: 59  FAVSSGMTALDVVL------RSFLPSETNNHCIIAGDDLYGGTQRLLNLLKISIDTMHFD 112

Query: 125 ILSLEDIEAKCQE--------GDLVHIEDPINPFGETVDLAQYAS--RIHSAGGLMMLDS 174
           +   E+ +AK  +         D++ +E P NP  + +D+       R +S   L+++D+
Sbjct: 113 LSHTENFKAKFYDLVTIKKTIVDIIVLESPTNPLCKIIDIPHLIKFIRKYSPETLIVIDN 172

Query: 175 TLGPPPLRNAWDYGADIIMHSGTKYFGGHSDLLSGIVCVSDEAIAEQLKNDRTYLGTIPA 234
           T+      N   +GAD++  S TKY  GH D+++G++   ++ +AE++       G+   
Sbjct: 173 TMMSGLNCNPLKFGADVVYESATKYLNGHHDIMAGVIIAKNKLLAEKIYFLINSTGSGLN 232

Query: 235 XXXXXXXXXXXXTMDIRVRRQSQNCTELVSYLA--------NNSEKFSSVVQEIRHASLQ 286
                       T+ IR+ +Q  N   +  +L         NN+    +     R+  L+
Sbjct: 233 PMDSWLLIRGLKTLSIRLHKQQLNALAISHWLEEGCGFKTHNNNNNLKT-----RYIGLK 287

Query: 287 T--EAFVKQQMPGGFGPVFALILKSEDQCRKVV--KNVSFFQHATSLGGVESLIEW---- 338
           +  +  + +    G G V +L   S    +K+V  K +  +    S G V SLI      
Sbjct: 288 SHPDYELHRSFNKGPGAVISLQTGSIPISKKIVASKLLKLWNVTVSFGCVNSLISMPCLM 347

Query: 339 -RAMSDPTALKT------LIRVSVGLENIEDLIADLAGSL 371
             A  DP   K       LIR+  G+E+++ L  DL G+ 
Sbjct: 348 SHASIDPELRKERQFPEDLIRLCCGIEDVKALQEDLLGAF 387

>TDEL0D06630 Chr4 complement(1200459..1201667) [1209 bp, 402 aa]
           {ON}  YFR055W
          Length = 402

 Score = 78.6 bits (192), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 88/342 (25%), Positives = 141/342 (41%), Gaps = 29/342 (8%)

Query: 56  YSRLGHPNADRLEAVLSQLLDSHAVVYA-SGLAAYH-AILVHFK-PKRLFLPHCYHG--- 109
           Y   G P    LE   ++L  +   V + +GL +   AIL   K    + LP   +G   
Sbjct: 57  YGTAGSPTIANLEDSWTELTGAAGTVLSPTGLGSISLAILSVVKHGDHILLPISVYGPTA 116

Query: 110 --CKEVARIIS-RLNGMEILSLEDIEAKCQEG-DLVHIEDPINPFGETVDLAQYASRIHS 165
             C  V R         + L  +DIE   +    L+ +E P +   E  D+         
Sbjct: 117 NFCNNVLRKFGVNSEFYDPLIGKDIEELIKTNTSLIFLESPCSQTMEIQDVPAIVKVAKK 176

Query: 166 AGGLMMLDSTLGPPPLRNAWDYGADIIMHSGTKYFGGHSDLLSGIVCVSDEAIAEQLKND 225
                +LD+T   P    A DYG DI + +GTKY GGHSDLL G+   +       L++ 
Sbjct: 177 HNVKTVLDNTWATPLFFKAHDYGIDISVEAGTKYVGGHSDLLLGLTSANSRCWP-ALRST 235

Query: 226 RTYLGTIPAXXXXXXXXXXXXTMDIRVRRQSQNCTELVSYLANNSEKFSSVVQEIRHASL 285
              +G +P             T+ +RV+   +    L  +L   +E     V+ I H + 
Sbjct: 236 YDAMGMLPGADDCHLALRGLRTLQLRVKEAERKALILAEWLEARNE-----VERILHPAF 290

Query: 286 QT---EAFVKQQMPGGFGPVFALILK---SEDQCRKVVKNVSFFQHATSLGGVESLIEWR 339
           +     +   +   G  G VF  ILK   S    + +++ +  F+   S GG ESL+   
Sbjct: 291 EDCPGHSLWVRDYSGSTG-VFTFILKDQFSRAGLKDMLEKMQIFKLGYSWGGYESLLIPV 349

Query: 340 AMSDPTALKTL------IRVSVGLENIEDLIADLAGSLEKIN 375
             +    ++T       +R+ VGLE+I+D + DL    E++ 
Sbjct: 350 NSTSRDRIRTWSHFGYALRIQVGLEDIDDQLRDLEMGFERLK 391

>Ecym_8405 Chr8 (839466..840884) [1419 bp, 472 aa] {ON} similar to
           Ashbya gossypii ACL059C
          Length = 472

 Score = 77.4 bits (189), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 92/399 (23%), Positives = 163/399 (40%), Gaps = 54/399 (13%)

Query: 23  PPINVSTTFRYDNEHLVPATRETGMHTSDSPMIYSRLGHPNADRLEAVLSQL---LDSHA 79
           PP+  STTF+   E   P  +E           Y+R G+P    +E  + +L        
Sbjct: 35  PPLYQSTTFK--QESFEPGCQEYD---------YTRSGNPTRSVVERQVGKLYGVCGEQV 83

Query: 80  VVYASGLAAYHAILVHF--------KPKRLFLPHCYHGCKEVARIISRLNGMEILSLE-- 129
           +  +SG++A   IL            P  +     Y G + +  I+     +++L ++  
Sbjct: 84  LAVSSGMSALDVILRSILGSYQAGKTPVVIAGDDLYGGTQRLLGILGIQGHVKVLHVDTS 143

Query: 130 ------DIEAKCQEGDLVHIEDPINPFGETVDLAQYASRIHS----AGGLMMLDSTLGPP 179
                 D+    +    V +E P NP  +  DL +  S + S    +G  +++D+T+   
Sbjct: 144 DAARFVDVFLSQRNVACVLLESPTNPLMKVADLPKLISFVKSHRGGSGCKIVVDNTMVSG 203

Query: 180 PLRNAWDYGADIIMHSGTKYFGGHSDLLSGIVCVSDEAIAEQLKNDRTYLGTIPAXXXXX 239
              N  + GAD++  S TK+  GH D+++G++  +   +A+ +      +G   A     
Sbjct: 204 INCNPLELGADLVYESATKFLNGHHDIMAGVIVAASVELAQDMYFIVNSMGAGLAPMDSW 263

Query: 240 XXXXXXXTMDIRVRRQSQNCTELVSYLANNSEKFSSVVQ----EIRHASLQT--EAFVKQ 293
                  T+ +R+ +Q  N   L  +L  +S  F+   Q      R   L++  +  + +
Sbjct: 264 LLIRGLKTLGVRMYQQQHNAMVLAHWL-QDSCGFAPTEQNSQLRTRFVGLKSHPQFHLHR 322

Query: 294 QMPGGFGPVFALILKSEDQCRKVV--KNVSFFQHATSLGGVESLIEW-----RAMSDPTA 346
               G G V ++     +   K+V  K   ++    S G V SLI        A  DP  
Sbjct: 323 SFNSGPGAVLSIETGDIELSEKIVCSKKFKYWNVTVSFGCVNSLISMPCKMSHASIDPEL 382

Query: 347 LK------TLIRVSVGLENIEDLIADLAGSLEKINKGEL 379
            K       LIR+  G+E++ DL  DL G+ E +   EL
Sbjct: 383 RKDRKFPEDLIRICCGIEDVSDLQWDLLGAFEDVGLLEL 421

>KLTH0E06644g Chr5 complement(608116..609498) [1383 bp, 460 aa] {ON}
           highly similar to uniprot|P53101 Saccharomyces
           cerevisiae YGL184C STR3 Cystathionine beta-lyase
           converts cystathionine into homocysteine
          Length = 460

 Score = 77.4 bits (189), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 90/385 (23%), Positives = 156/385 (40%), Gaps = 51/385 (13%)

Query: 23  PPINVSTTFRYDNEHLVPATRETGMHTSDSPMIYSRLGHPNADRLEAVLSQLLD---SHA 79
           PPI  STTF+  +              +  P  Y+R G+P    ++  + +L D   +  
Sbjct: 25  PPIYQSTTFKIGSLE----------DDASQPYDYTRSGNPTRTVVQHQIGKLYDVDAAQV 74

Query: 80  VVYASGLAAYHAILVHFK-------PKRLFLPHCYHGCKEVARIISRLNGMEILSLE--- 129
           +  +SG+ A   IL           P  +     Y G + +   +   N   +L ++   
Sbjct: 75  LAVSSGMTALDVILRALVLTNKSRVPTIIAGDDLYGGTQRLLTHLESRNHARVLHVDTAN 134

Query: 130 -----DIEAKCQEGDLVHIEDPINPFGETVDLAQYASRIHSA--GGLMMLDSTLGPPPLR 182
                ++  + +  D V +E P NP  +  DL +    I SA    L+ +D+T+    L 
Sbjct: 135 YETFVEVFKQQEHVDCVLLESPTNPLLKVADLPRLTHFIKSANEACLVAIDNTMMSGMLC 194

Query: 183 NAWDYGADIIMHSGTKYFGGHSDLLSGIVCVSDEAIAEQLKNDRTYLGTIPAXXXXXXXX 242
           N   +  D++  S TKY  GH D+++GIV      +A+++       G+  +        
Sbjct: 195 NPLKFQCDVVYESATKYLNGHHDIMAGIVVTQTLKMAQEIYFVINSTGSGLSPFDSWLLV 254

Query: 243 XXXXTMDIRVRRQSQNCTELVSYLANN----SEKFSSVVQEIRHASLQT--EAFVKQQMP 296
               T+ +R+ +Q  N   L  +L N+     +K        R   L++  +  + +   
Sbjct: 255 RGLKTLGVRLYQQQHNAMVLAHWLENSCGFVGKKGVKGSPRTRFVGLKSHPQFELHKSFN 314

Query: 297 GGFGPVFALILKSEDQCRKVV--KNVSFFQHATSLGGVESLIEW-----RAMSDPTALKT 349
            G G V +    S +  R++V  + +  +    S G V SLI        A  DP AL+ 
Sbjct: 315 AGPGAVLSFETGSYEHSRRLVSSRKIKIWAVTVSFGCVNSLISMPCKMSHAAIDP-ALRQ 373

Query: 350 -------LIRVSVGLENIEDLIADL 367
                  L+R+  G+ENI DL  DL
Sbjct: 374 ERDFPEDLVRLCCGIENISDLQNDL 398

>TPHA0F00420 Chr6 complement(103419..104747) [1329 bp, 442 aa] {ON}
           Anc_4.53 YLR303W
          Length = 442

 Score = 76.6 bits (187), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 106/430 (24%), Positives = 177/430 (41%), Gaps = 87/430 (20%)

Query: 22  APPINVSTTFRYDNEHLVPATRETGMHTSDSP-MIYSRLGHPNADRLEA-VLSQLLDSHA 79
           A PI  +T+F +++ H         +   + P  +YSR+G+P  D LE  + +    + A
Sbjct: 26  AVPIYQTTSFVFEDSH-----HGAQLFGLEKPGYMYSRVGNPTVDVLEKRLAALEGGAAA 80

Query: 80  VVYASGLAAYH-AI--LVHFKPKRLFLPHCYHGCKEVARIISRLNGMEILSL-----EDI 131
           V  +SG AA   AI  L H     +   + Y G     ++  +  G+++  +     ED 
Sbjct: 81  VCVSSGQAAQTLAITGLAHCGDNIVSTSYLYGGTYNQFKVAFKRLGIDVRFVLGDNPEDF 140

Query: 132 EAKCQEG-DLVHIEDPINPFGETVDLAQYASRIHSAGGLMMLDSTLGP-----PPLRNAW 185
           E    E    V+IE   NP     D  +  +  H  G  +++D+T G       P++   
Sbjct: 141 EKLFDEKTKAVYIESIGNPKYNVPDFEKIVAVAHKHGIPVVVDNTFGAGGFFCQPIK--- 197

Query: 186 DYGADIIMHSGTKYFGGHSDLLSGIVCVS------------------DEAIAEQLKND-- 225
            +G DI+ HS TK+ GGH   ++G++  S                   E     + ND  
Sbjct: 198 -HGVDIVTHSATKWIGGHGTTIAGVIVDSGKFPWKDYPEKFPQFSKPSEGYHGMIFNDAM 256

Query: 226 ---------RTY----LGTIPAXXXXXXXXXXXXTMDIRVRRQSQNCTELVSYLANNSEK 272
                    RT     LG +              T+ +R  RQ QN  +L  +L      
Sbjct: 257 GPLAYIAHVRTELLRDLGPVMEPIAAFLLLQGVETLSLRAERQGQNALKLAQWLEK---- 312

Query: 273 FSSVVQEIRHASLQTEAF---VKQQMPGGFGPVFALILK------SEDQCRK----VVKN 319
            S  V  + +  L +  +    K+ +  GFG V ++ +K        D  +K    VV N
Sbjct: 313 -SPHVNWVSYPGLPSHPYHDNAKKYLDNGFGGVLSIGVKPLKDVSDSDPFKKSGAQVVDN 371

Query: 320 VSFFQHATSLGGVESLI------EWRAMSDPTALKT-----LIRVSVGLENIEDLIADLA 368
           +    +  ++G  ++L+        + +SD   LK+     LIR+S+G E I+D+IAD  
Sbjct: 372 LKLALNLANVGDSKTLVIAPYFTTHQQLSDEDKLKSGVTEDLIRISIGTEFIDDIIADFE 431

Query: 369 GSLEKINKGE 378
            S EK+  G+
Sbjct: 432 QSFEKVFAGQ 441

>Skud_19.6 Chr19 complement(5562..6767) [1206 bp, 401 aa] {ON}
           YFR055W (REAL)
          Length = 401

 Score = 75.5 bits (184), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 62/248 (25%), Positives = 111/248 (44%), Gaps = 21/248 (8%)

Query: 140 LVHIEDPINPFGETVDLAQYASRIHSAGGLMMLDSTLGPPPLRNAWDYGADIIMHSGTKY 199
           ++ +E P +   E  D+    S     G   +LD+T   P   +A  +G DI + +GTKY
Sbjct: 151 VIFLESPGSGTMEIQDIPALVSVAKKHGIKTILDNTWATPLFFDAHGHGIDISLEAGTKY 210

Query: 200 FGGHSDLLSGIVCVSDEAIAEQLKNDRTYLGTIPAXXXXXXXXXXXXTMDIRVRRQSQNC 259
            GGHSDLL G+   ++E     L++    +  +P             T+ +R++   +  
Sbjct: 211 LGGHSDLLIGLTSANEECWP-LLRSTYDAMAMLPGADDCLLALRGMRTLHLRLKEAERKA 269

Query: 260 TELVSYLANNSEKFSSVVQEIRHASLQT----EAFVKQQMPGGFGPVFALILK---SEDQ 312
            +L ++L +  E     V+++ H + +     E +V+     G   +F+++LK   +   
Sbjct: 270 LDLAAWLEDRDE-----VEKVLHPAFKDCPGHEYWVRDYK--GSSGLFSIVLKDGYTRTG 322

Query: 313 CRKVVKNVSFFQHATSLGGVESLI------EWRAMSDPTALKTLIRVSVGLENIEDLIAD 366
              +V+ +  F    S GG ESLI        R  ++       +R+ VGLE + DL  D
Sbjct: 323 LENMVEKMKVFHLGFSWGGYESLITPVNPARQRKAANWPHRGFALRIQVGLEELTDLKRD 382

Query: 367 LAGSLEKI 374
           L    E++
Sbjct: 383 LELGFERL 390

>KLLA0C17028g Chr3 complement(1487806..1489188) [1383 bp, 460 aa]
           {ON} similar to uniprot|P53101 Saccharomyces cerevisiae
           YGL184C STR3 Cystathionine beta-lyase converts
           cystathionine into homocysteine
          Length = 460

 Score = 75.5 bits (184), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 97/411 (23%), Positives = 169/411 (41%), Gaps = 59/411 (14%)

Query: 10  HSDDYLNRVSDVAPPINVSTTFRYDNEHLVPATRETGMHTSDSPMIYSRLGHPNADRLEA 69
           H+D Y + V    PP+  STTF+        A+    +   D    Y+R G+P    L+ 
Sbjct: 15  HNDKYGSSV----PPLYQSTTFK--------ASSFDQLQEYD----YTRSGNPTRTVLQQ 58

Query: 70  VLSQLLD---SHAVVYASGLAAYHAILVHFKPKRLFLP------HCYHGCKEVARIISRL 120
            ++ L D         +SG+ A   IL         +P        Y G + +   +   
Sbjct: 59  QIANLYDVAPEQVFAVSSGMTALDIILRTLIDNSDHIPTIIAGDDLYGGTQRLLTFLQTR 118

Query: 121 NGMEILSLEDIEAKC--------QEGDLVHIEDPINPFGETVDLAQYASRIHSAGG---- 168
           N  +++  +  +A+          + D+V +E P NP  +  DL +    +   GG    
Sbjct: 119 NHAKVIHTDTTDAESFIKLYNSLGQVDIVLLESPTNPLMKVADLPRLCQFVKQKGGSSSN 178

Query: 169 -LMMLDSTLGPPPLRNAWDYGADIIMHSGTKYFGGHSDLLSG-IVCVSDEAIAEQLKNDR 226
             +++D+T+      N   +GAD++  SGTKY  GH D+++G I+   D A +     + 
Sbjct: 179 CKIVVDNTMMSGLNSNPLQFGADVVYESGTKYLNGHHDIMAGVIIAKKDVAPSVYFVINS 238

Query: 227 TYLGTIPAXXXXXXXXXXXXTMDIRVRRQSQNCTELVSYLAN-NSEKFSSVVQEIRHASL 285
           T  G  P             T+ +R+ +Q  N   L  +L +    K +   Q+++   +
Sbjct: 239 TGAGLSP--MDSWLLIRGLKTLSVRLYKQQINAMVLSHWLQDICGFKPTDNNQQLKTRFV 296

Query: 286 QTEAFVKQQMPGGF--GPVFALILKSED----QCRKVVKNVSFFQHATSLGGVESLIEW- 338
             E+  + ++   F  GP   L +++ D    +     K ++ +    S G V SLI   
Sbjct: 297 GLESHPQFELHKSFNNGPGAVLSIETGDLALSEAIVTSKRLNIWAVTVSFGCVNSLISMP 356

Query: 339 ----RAMSDPTALKT------LIRVSVGLENIEDLIADLAGSLEKINKGEL 379
                A  DP   K       LIR+  G+E+++DL  DL  + E+    EL
Sbjct: 357 CKMSHASIDPELRKQRAFPEDLIRLCCGIEDVKDLQYDLLAAFEEAGLIEL 407

>Suva_17.6 Chr17 (9922..11127) [1206 bp, 401 aa] {ON} YFR055W (REAL)
          Length = 401

 Score = 73.9 bits (180), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 65/259 (25%), Positives = 111/259 (42%), Gaps = 20/259 (7%)

Query: 129 EDIEAKCQEG-DLVHIEDPINPFGETVDLAQYASRIHSAGGLMMLDSTLGPPPLRNAWDY 187
           EDIE   +    ++ +E P +   E  D+    S     G   +LD+T   P   +A  +
Sbjct: 139 EDIEKLVKPNTSVIFLESPGSGTMEIQDIPALVSIAKKHGIRTILDNTWATPLFFDAHGH 198

Query: 188 GADIIMHSGTKYFGGHSDLLSGIVCVSDEAIAEQLKNDRTYLGTIPAXXXXXXXXXXXXT 247
           G DI + +GTKY GGHSD L G+   + E     L++    +  +P             T
Sbjct: 199 GIDISLEAGTKYLGGHSDFLLGLTSANQECWP-LLRSTYDAMAMLPGADDCQLALRGMRT 257

Query: 248 MDIRVRRQSQNCTELVSYLANNSEKFSSVVQEIRHASLQ---TEAFVKQQMPGGFGPVFA 304
           + +R++   +   +L ++L    E     V+ + H + +      +  +   G  G +F+
Sbjct: 258 LHLRLKEAERKALDLAAWLGKRDE-----VETVLHPAFEDCPGHKYWLRDYKGSSG-LFS 311

Query: 305 LILK---SEDQCRKVVKNVSFFQHATSLGGVESLI------EWRAMSDPTALKTLIRVSV 355
           ++LK   +      +V+ +  F    S GG ESLI      E R   +       +R+ V
Sbjct: 312 IVLKEGFTRAGLESMVEKMKIFHLGFSWGGYESLITPVKPAEQRKPHNWPHRGFALRIQV 371

Query: 356 GLENIEDLIADLAGSLEKI 374
           GLE + DL  DL    E++
Sbjct: 372 GLEELSDLKRDLELGFERL 390

>SAKL0H24882g Chr8 (2167623..2169002) [1380 bp, 459 aa] {ON} highly
           similar to uniprot|P53101 Saccharomyces cerevisiae
           YGL184C STR3 Cystathionine beta-lyase converts
           cystathionine into homocysteine
          Length = 459

 Score = 72.4 bits (176), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 86/391 (21%), Positives = 158/391 (40%), Gaps = 54/391 (13%)

Query: 22  APPINVSTTFRYDNEHLVPATRETGMHTSDSPMIYSRLGHPNADRLEAVLSQLLDS---H 78
            PP+  STTF+          + +    +D    Y+R G+P    L+  +++L +     
Sbjct: 24  VPPLYQSTTFK----------QSSLEDDADQEYDYTRSGNPTRSVLQEQIAKLYNVPGFQ 73

Query: 79  AVVYASGLAAYHAIL-------VHFKPKRLFLPHCYHGCKEVARIISRLNGMEILSLEDI 131
               +SG+     IL        +  P  +     Y G + +   + R N   ++ ++  
Sbjct: 74  VFAVSSGMTCLDVILRALVLGNSNHTPTIIAGDDLYGGTQRLLTFLERKNHARVIHVDTT 133

Query: 132 EAK--------CQEGDLVHIEDPINPFGETVDLAQYASRIHSAGGL--MMLDSTLGPPPL 181
           +          C   D V +E P NP  +  DL      I  A     +++D+T+     
Sbjct: 134 DFDKFVSAFNGCGFVDCVVLESPTNPLCKVADLPGLTKFIKQANPKCHVVVDNTMVSGLN 193

Query: 182 RNAWDYGADIIMHSGTKYFGGHSDLLSGIVCVSDEAIAEQLKNDRTYLGTIPAXXXXXXX 241
            N  ++  D++  SGTKY  GH D+++G++    + IA++L       G   +       
Sbjct: 194 CNPLEFQCDVVYESGTKYLNGHHDIMAGVIIGRSKEIAQELYFVINSTGCGLSPMDCWLL 253

Query: 242 XXXXXTMDIRVRRQSQNCTELVSYLAN------NSEKFSSVVQEIRHASLQT--EAFVKQ 293
                T+ IR+ +Q  N   L  +L +      NSE   + +   R+  L++  +  + +
Sbjct: 254 IRGLKTLSIRLYQQQHNAMILARWLYSSCGFRPNSE---NKLLRTRYVGLKSHPQFELHR 310

Query: 294 QMPGGFGPVFALILKSEDQCRKVV--KNVSFFQHATSLGGVESLIEW-----RAMSDPTA 346
               G G V +    S +  +++V  K +  +    S G V SLI        A  DP  
Sbjct: 311 SFNKGPGAVLSFDTGSFEHSKRLVSSKKLKIWAVTVSFGCVNSLISMPCKMSHASIDPEL 370

Query: 347 LKT------LIRVSVGLENIEDLIADLAGSL 371
            K       L+R+  G+E+++DL  DL  ++
Sbjct: 371 RKERDFPEDLVRLCCGIEDVKDLQKDLLAAM 401

>ACL059C Chr3 complement(259732..261093) [1362 bp, 453 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL184C
           (STR3)
          Length = 453

 Score = 72.0 bits (175), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 67/251 (26%), Positives = 109/251 (43%), Gaps = 22/251 (8%)

Query: 143 IEDPINPFGETVDLAQYASRI--HSAGGLMMLDSTLGPPPLRNAWDYGADIIMHSGTKYF 200
           +E P NP  +  D+    + +  H+ G  +++D+T+      N    GAD +  S TKY 
Sbjct: 148 LESPTNPLMKVADVPALVAHVKAHAPGCRVVVDNTMMSGLNCNPLRLGADYVYESATKYL 207

Query: 201 GGHSDLLSGIVCVSDEAIAEQLKNDRTYLGTIPAXXXXXXXXXXXXTMDIRVRRQSQNCT 260
            GH D+++G++  +  A+AE+       +G   A            T+ +R+ +Q  N  
Sbjct: 208 NGHHDIMAGVIVAATRALAEEAYFVVNSVGAGLAPMDAWLLIRGLKTLSLRLYKQQHNAM 267

Query: 261 ELVSYLANNSEKFSSV----VQEIRHASLQTEAFVKQQMPGGFGPVFALILKSEDQC--R 314
            L  +L      F +V      + R   L++    K       GP   L +++ D     
Sbjct: 268 VLAHWLREVC-GFRAVGGNHALQTRFVGLRSHPQHKLHRSFNRGPGAVLSIQTGDTALSE 326

Query: 315 KVV--KNVSFFQHATSLGGVESLIEW-----RAMSDPTALKT------LIRVSVGLENIE 361
           ++V  K + F+    S G V SLI        A  DP   K       LIR+S G+E++E
Sbjct: 327 RIVCSKKLQFWGVTVSFGCVNSLISMPCRMSHASIDPELRKARQFPEDLIRLSCGVEDVE 386

Query: 362 DLIADLAGSLE 372
           DL  DL  +LE
Sbjct: 387 DLQQDLLAALE 397

>Smik_7.89 Chr7 complement(149314..150711) [1398 bp, 465 aa] {ON}
           YGL184C (REAL)
          Length = 465

 Score = 71.6 bits (174), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 93/394 (23%), Positives = 157/394 (39%), Gaps = 57/394 (14%)

Query: 22  APPINVSTTFRYDNEHLVPATRETGMHTSDSPMIYSRLGHPNADRLEAVLSQLL---DSH 78
            PP+ +STTF+ D       + ET          YSR G+P    L+  + +L      +
Sbjct: 24  VPPVYLSTTFKVD------LSNETAQDYD-----YSRSGNPTRSVLQNQIGKLYRVPQEN 72

Query: 79  AVVYASGLAAYHAIL---VHFK------PKRLFLPHCYHGCKEVARIISR--------LN 121
            +  +SG+ A   IL   V F       P  +     Y G + +     +        ++
Sbjct: 73  VLAVSSGMTALDIILRGLVLFNGTDNHTPTIIAGDDLYGGTQRLLNFFKQQSHAVSVHVD 132

Query: 122 GMEILSLEDIEAKCQEGDLVHIEDPINPFGETVDLAQYASRIH--SAGGLMMLDST---- 175
             +    + +     + D V +E P NP  + VD+ +    +   S    +++D+T    
Sbjct: 133 TSDFEKFKTVFQSLDKVDCVLLESPTNPLCKVVDIPRILRFVKCISPETTVVVDNTMMSG 192

Query: 176 LGPPPLRNAWDYGADIIMHSGTKYFGGHSDLLSGIVCVSDEAIAEQLKNDRTYLGTIPAX 235
           L   PL+   D G D++  S TKY  GH DL+ G++      IA +L       G   + 
Sbjct: 193 LNCNPLQ--LDPGCDVVYESATKYLNGHHDLMGGVIISKTAEIAAKLYFVVNSTGAGLSP 250

Query: 236 XXXXXXXXXXXTMDIRVRRQSQNCTELVSYLANN---SEKFSSVVQEIRHASLQTEAFVK 292
                      T+ +R+ +Q +N   L  +L ++       ++   + R   L++    K
Sbjct: 251 MDSWLLVRGLKTLGVRLYQQQRNAMILAHWLEDSCGFKPTETNKTTKTRFVGLRSNPDFK 310

Query: 293 --QQMPGGFGPVFALILKSEDQCRKVV--KNVSFFQHATSLGGVESLIEW-----RAMSD 343
             Q    G G V +    S +  +++V  K +S +    S G V SL+        A  D
Sbjct: 311 LHQSFNSGPGAVLSFETGSFEHSKRLVSSKKLSIWAVTVSFGCVNSLLSMPCKMSHASID 370

Query: 344 PTALKT------LIRVSVGLENIEDLIADLAGSL 371
           P   K       LIR+  G+ENI DL  DL  ++
Sbjct: 371 PELRKERDFPEDLIRLCCGIENIVDLKKDLLAAM 404

>Kwal_47.17221 s47 complement(306099..307490) [1392 bp, 463 aa] {ON}
           YGL184C (STR3) - Cystathionine beta-lyase [contig 211]
           FULL
          Length = 463

 Score = 71.6 bits (174), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 96/401 (23%), Positives = 158/401 (39%), Gaps = 60/401 (14%)

Query: 10  HSDDYLNRVSDVAPPINVSTTFRYDNEHLVPATRETGMHTSDSPMIYSRLGHPNADRLEA 69
           HSD + + V    PPI  STTF+  +              +  P  Y+R G+P    ++ 
Sbjct: 18  HSDQHGSSV----PPIYQSTTFKIGSLE----------DDASQPYDYTRSGNPTRTVVQH 63

Query: 70  VLSQLLD---SHAVVYASGLAAYHAILV-------HFKPKRLFLPHCYHGCKEVARIISR 119
            + +L     S  +  +SG+ A   IL         + P  +     Y G + +   +  
Sbjct: 64  QIGKLYGVDASQVLAVSSGMTALDVILRALVLTNNSYVPTIIAGDDLYGGTQRLLTYLES 123

Query: 120 LNGMEILSLEDIEAKCQEG--------DLVHIEDPINPFGETVDLAQYASRIHSAG--GL 169
            N   +L ++                 D V +E P NP  +  DL +    +  +    +
Sbjct: 124 RNHARVLHVDTTNYDAFTALFNAQPRVDCVLLESPTNPLLKVADLPRITRFVKQSNEKCV 183

Query: 170 MMLDSTLGPPPLRNAWDYGADIIMHSGTKYFGGHSDLLSGIVCVSDEAIAEQLKNDRTYL 229
           + +D+T+    L N   +  D++  S TKY  GH D+++GIV      +A ++       
Sbjct: 184 VAIDNTMMSGMLCNPLHFHCDVVYESATKYLNGHHDIMAGIVVARSAQLAGEIYFMINST 243

Query: 230 GTIPAXXXXXXXXXXXXTMDIRVRRQSQNCTELVSYLANNSEKFSSVVQEIRHASLQT-- 287
           G   +            T+ +R+ +Q  N   L  +L  NS  F S  ++ +  SLQT  
Sbjct: 244 GCGLSPFDSWLLIRGLKTLGVRIYQQQHNAMVLAHWL-ENSCGFVSHGKKGK-GSLQTRF 301

Query: 288 -------EAFVKQQMPGGFGPVFALILKSEDQCRKVV--KNVSFFQHATSLGGVESLIEW 338
                  E  + +    G G V +    S +  R++V  K +  +    S G V SLI  
Sbjct: 302 VGLKSHPEFELHKSFNTGPGAVLSFETGSFEHSRRLVSSKKIKLWAVTVSFGCVNSLISM 361

Query: 339 -----RAMSDPTALKT-------LIRVSVGLENIEDLIADL 367
                 A  DP AL+        L+R+  G+ENI DL  DL
Sbjct: 362 PCKMSHAAIDP-ALRQERDFPEDLVRLCCGIENIVDLQNDL 401

>Skud_7.88 Chr7 complement(160235..161632) [1398 bp, 465 aa] {ON}
           YGL184C (REAL)
          Length = 465

 Score = 71.2 bits (173), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 91/401 (22%), Positives = 159/401 (39%), Gaps = 71/401 (17%)

Query: 22  APPINVSTTFRYDNEHLVPATRETGMHTSDSPMIYSRLGHPNADRLEAVLSQLL---DSH 78
            PP+ +STTF+ D         E   +       YSR G+P    L+  + +L      +
Sbjct: 24  VPPVYLSTTFKVD------LNNEAAQNFD-----YSRSGNPTRSVLQNQIGKLYRVPQEN 72

Query: 79  AVVYASGLAAYHAIL---------------------VHFKPKRL--FLPHCYHGCKEVAR 115
            +  +SG+ A   IL                     ++   +RL  F  H  H       
Sbjct: 73  VLAVSSGMTALDIILRGLVLLNGTDNHTPTIIAGDDLYGGTQRLLNFFKHQTHA------ 126

Query: 116 IISRLNGMEILSLEDIEAKCQEGDLVHIEDPINPFGETVDLAQ---YASRIHSAGGLMML 172
           + + ++  +    + +     + D V +E P NP  + VD+ +   +  RI S   ++++
Sbjct: 127 VTAHVDTSDFEKFKTVFQSVDKVDCVLLESPTNPLCKVVDIPKILRFVKRI-SPETIVIV 185

Query: 173 DST----LGPPPLRNAWDYGADIIMHSGTKYFGGHSDLLSGIVCVSDEAIAEQLKNDRTY 228
           D+T    L   PL+   +   D++  S TKY  GH DL+ G++      IA +L      
Sbjct: 186 DNTMMSGLNCNPLQ--LNPSCDVVYESATKYLNGHHDLMGGVIISKTPEIASKLYFVVNS 243

Query: 229 LGTIPAXXXXXXXXXXXXTMDIRVRRQSQNCTELVSYLANN---SEKFSSVVQEIRHASL 285
            G   +            T+ +R+ +Q +N   L  +L N+       ++   + R   L
Sbjct: 244 TGAGLSPMDSWLLVRGLKTLGVRLHQQQRNAMILAHWLENSCGFKPTETNKATKTRFVGL 303

Query: 286 QTEAFVK--QQMPGGFGPVFALILKSEDQCRKVV--KNVSFFQHATSLGGVESLIEW--- 338
           ++    K  Q    G G V +    S +  +++V  K ++ +    S G V SL+     
Sbjct: 304 RSNPDFKLHQSFNSGPGAVLSFETGSSEHSKRLVSSKKLNIWAVTVSFGCVNSLLSMPCK 363

Query: 339 --RAMSDPTALKT------LIRVSVGLENIEDLIADLAGSL 371
              A  DP   K       L+R+  G+ENI DL  DL  ++
Sbjct: 364 MSHASIDPELRKERDFPEDLVRLCCGIENIVDLKKDLLAAM 404

>NDAI0D02880 Chr4 (669487..670830) [1344 bp, 447 aa] {ON} Anc_4.53
          Length = 447

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 111/444 (25%), Positives = 173/444 (38%), Gaps = 93/444 (20%)

Query: 12  DDYLNRVSDVAPPINVSTTFRY-DNEHLVPATRETGMHTSDSPMIYSRLGHPNADRLEAV 70
           DD  NR   V  PI  +T++ + D+EH    +   G+       +YSR  +P  + LE  
Sbjct: 18  DDNANRPRAV--PIYATTSYVFNDSEH---GSNLFGLKVPG--YVYSRFQNPTQNVLEER 70

Query: 71  LSQLLDS-HAVVYASGLAAYH-AI--LVHFKPKRLFLPHCYHGCKEVARIISRLNGMEIL 126
           ++ L     AV  ASG AA   AI  L H     +     Y G     ++  +  G+E  
Sbjct: 71  MAALEGGVAAVAVASGQAAQTLAICGLAHSGDNIISTSFLYGGTYNQFKVAFKRLGIEAR 130

Query: 127 SL-----EDIEAKCQEG-DLVHIEDPINPFGETVDLAQYASRIHSAGGLMMLDSTLGP-- 178
            +     +D E    +    V++E   NP     D  +     H  G  +++D+T G   
Sbjct: 131 FVTGDNPDDFEKLIDDKTKAVYLESIGNPKYNVPDFEKIVEIAHKHGVPVVVDNTFGAGG 190

Query: 179 ---PPLRNAWDYGADIIMHSGTKYFGGHSDLLSGIVCVSD--------EAIAEQLKNDRT 227
               P++    YGADI+ HS TK+ GGH   ++G++  S         E   +  K    
Sbjct: 191 FFCQPIK----YGADIVTHSATKWIGGHGTTIAGMIVDSGKFPWADYPEKFPQFSKPAEG 246

Query: 228 YLGTI-----------------------PAXX--XXXXXXXXXXTMDIRVRRQSQNCTEL 262
           Y GTI                       PA              T+ +R  R  QN  +L
Sbjct: 247 YHGTIFNEAYGNLAYIVHVRVELLRDLGPAISPFAAFLLIQGIETLSLRGERHGQNALKL 306

Query: 263 VSYLANNSEKFSSVVQEIRHASLQTEAF---VKQQMPGGFGPVFALILK------SEDQC 313
             +L       S  V  + +  L +  +    K+ +  GFG V +  +K       E+  
Sbjct: 307 AQWLEQ-----SPYVSWVSYPGLPSHPYHENAKKYLSNGFGGVLSFGVKDIPGQTKEELA 361

Query: 314 RK--------VVKNVSFFQHATSLGGVESLI------EWRAMSDPTAL-----KTLIRVS 354
            K        VV ++    +  ++G  ++L+          + D   L     K LIRVS
Sbjct: 362 AKPFSASGAQVVDSLKLASNLANVGDSKTLVIAPYFTTHEQLDDDEKLLSGVTKDLIRVS 421

Query: 355 VGLENIEDLIADLAGSLEKINKGE 378
           VG E I+D+IAD   S EK+  G+
Sbjct: 422 VGTEFIDDIIADFQQSFEKVFAGK 445

>NCAS0A05810 Chr1 (1143717..1145060) [1344 bp, 447 aa] {ON} Anc_4.53
          Length = 447

 Score = 69.7 bits (169), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 106/444 (23%), Positives = 173/444 (38%), Gaps = 93/444 (20%)

Query: 12  DDYLNRVSDVAPPINVSTTFRY-DNEHLVPATRETGMHTSDSPMIYSRLGHPNADRLEAV 70
           DD  NR   V  PI  +T++ + D++H     +  G+       +YSR  +P  +  E  
Sbjct: 18  DDNKNRPRAV--PIYATTSYVFNDSKH---GAQLFGLEVPG--YVYSRFQNPTNNVFEER 70

Query: 71  LSQLLDSHAVVYASGLAAYHAI----LVHFKPKRLFLPHCYHGCKEVARIISRLNGMEIL 126
           ++ L    A V  S   A   +    L H     +   + Y G     ++  +  G+E  
Sbjct: 71  IAALEGGAAAVAVSSGQAAQTLAISGLAHVGDNIVSTSYLYGGTYNQFKVAFKRLGVEAR 130

Query: 127 SLE-----DIEAKCQE-GDLVHIEDPINPFGETVDLAQYASRIHSAGGLMMLDSTLGP-- 178
            ++     D E    E    V++E   NP     D     +  H  G  +++D+T G   
Sbjct: 131 FVDGDNPADFEKLFDERTKAVYLESIGNPKYNVPDFEGIVAVAHKHGIPVVVDNTFGAGG 190

Query: 179 ---PPLRNAWDYGADIIMHSGTKYFGGHSDLLSGIVCVSD--------EAIAEQLKNDRT 227
               PL+    +GADI+ HS TK+ GGH   ++G+V  S         E   +  K    
Sbjct: 191 FFCQPLK----FGADIVTHSATKWIGGHGTTVAGVVVDSGKFPWKDYPEKFPQFSKPAEG 246

Query: 228 YLGTI-----------------------PAXX--XXXXXXXXXXTMDIRVRRQSQNCTEL 262
           Y GTI                       P               T+ +R  R + N   L
Sbjct: 247 YHGTIFNETYGNLAYIVHVRVELLRDLGPGMNPFAAFLLLQGVETLSLRCERHASNALAL 306

Query: 263 VSYLANNSEKFSSVVQEIRHASLQTEAF---VKQQMPGGFGPVFALILK-----SEDQCR 314
             +L    EK S  V  + +  L++ +     K+ +  GFG V +  +K     SE++ +
Sbjct: 307 AKWL----EK-SPYVSWVSYPGLESHSHHENAKKYLSNGFGGVLSFGVKDLPNQSEEEVK 361

Query: 315 K---------VVKNVSFFQHATSLGGVESLI------EWRAMSDPTAL-----KTLIRVS 354
           K         VV ++    +  ++G  ++L+        + + D   L     K LIRVS
Sbjct: 362 KNPFAASGAQVVDSLQLASNLANVGDSKTLVIAPYFTTHQQLDDDEKLLSGVTKDLIRVS 421

Query: 355 VGLENIEDLIADLAGSLEKINKGE 378
           VG E I+D+I D   S EK+  G+
Sbjct: 422 VGTEFIDDIIGDFQQSFEKVFAGQ 445

>YGL184C Chr7 complement(154615..156012) [1398 bp, 465 aa] {ON}
           STR3Peroxisomal cystathionine beta-lyase, converts
           cystathionine into homocysteine; may be redox regulated
           by Gto1p
          Length = 465

 Score = 68.6 bits (166), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 88/395 (22%), Positives = 157/395 (39%), Gaps = 59/395 (14%)

Query: 22  APPINVSTTFRYDNEHLVPATRETGMHTSDSPMI-YSRLGHPNADRLEAVLSQLL---DS 77
            PP+ +STTF+ D            ++  D+    YSR G+P    L+  + +L      
Sbjct: 24  VPPVYLSTTFKVD------------LNNEDAQNYDYSRSGNPTRSVLQHQIGKLYRVPQE 71

Query: 78  HAVVYASGLAAYHAILV---------HFKPKRLFLPHCYHGCKEVARIISR--------L 120
           + +  +SG+ A   IL          +  P  +     Y G + +     +        +
Sbjct: 72  NVLAVSSGMTALDVILRGLVLLNGTDNHTPTIIAGDDLYGGTQRLLNFFKQQSHAVSVHV 131

Query: 121 NGMEILSLEDIEAKCQEGDLVHIEDPINPFGETVDLAQYASRIH--SAGGLMMLDST--- 175
           +  +    + +     + D V +E P NP  + VD+ +    +   S    +++D+T   
Sbjct: 132 DTSDFEKFKTVFQSLDKVDCVLLESPTNPLCKVVDIPRILRFVKCISPDTTVVVDNTMMS 191

Query: 176 -LGPPPLRNAWDYGADIIMHSGTKYFGGHSDLLSGIVCVSDEAIAEQLKNDRTYLGTIPA 234
            L   PL+   + G D++  S TKY  GH DL+ G++      IA +L       G   +
Sbjct: 192 GLNCNPLQ--LNPGCDVVYESATKYLNGHHDLMGGVIISKTPEIASKLYFVINSTGAGLS 249

Query: 235 XXXXXXXXXXXXTMDIRVRRQSQNCTELVSYLANN---SEKFSSVVQEIRHASLQTEAFV 291
                       T+ +R+ +Q +N   L  +L N+       ++   + R   L++    
Sbjct: 250 PMDSWLLVRGLKTLGVRLYQQQRNAMILAHWLENSCGFKPTRTNKATKTRFVGLRSNPDF 309

Query: 292 K--QQMPGGFGPVFALILKSEDQCRKVV--KNVSFFQHATSLGGVESLIEW-----RAMS 342
           K  +    G G V +    S +  +++V  K +S +    S G V SL+        A  
Sbjct: 310 KLHKSFNNGPGAVLSFETGSFEHSKRLVSSKKLSIWAVTVSFGCVNSLLSMPCKMSHASI 369

Query: 343 DPTALKT------LIRVSVGLENIEDLIADLAGSL 371
           DP   K       L+R+  G+ENI DL  DL  ++
Sbjct: 370 DPELRKERDFPEDLVRLCCGIENIVDLKKDLLAAM 404

>KAFR0F03070 Chr6 (610571..611908) [1338 bp, 445 aa] {ON} Anc_4.53
           YLR303W
          Length = 445

 Score = 65.9 bits (159), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 98/431 (22%), Positives = 173/431 (40%), Gaps = 86/431 (19%)

Query: 22  APPINVSTTFRYDNEHLVPATRETGMHTSDSPMIYSRLGHPNADRLEA-VLSQLLDSHAV 80
           A PI  +T++ +D+      ++  G+       +YSR  +P ++ LE  + +    + A+
Sbjct: 26  AVPIYATTSYVFDDSKH--GSQLFGLEVPG--YVYSRFQNPTSNVLEERIAALEGGAAAL 81

Query: 81  VYASGLAAYH-AI--LVHFKPKRLFLPHCYHGCKEVARIISRLNGMEILSLE-----DIE 132
             ASG AA   AI  L H     +   + Y G     ++  +  G+E   +E     D E
Sbjct: 82  AVASGQAAQTLAIQGLAHNGDNIVATSYLYGGTYNQFKVAFKRFGIEARFVEGDNQDDFE 141

Query: 133 AKCQE-GDLVHIEDPINPFGETVDLAQYASRIHSAGGLMMLDSTLGP-----PPLRNAWD 186
            +  E    V++E   NP     D  +  +  H  G  +M+D+T G       P++    
Sbjct: 142 KQFDERTKCVYLESIGNPKYNVPDFEKIVAVAHKHGIPVMVDNTFGAGGFFCQPIK---- 197

Query: 187 YGADIIMHSGTKYFGGHSDLLSGIVCVSDE----------------------AIAEQLKN 224
           YG DI+ HS TK+ GGH   L G++  S +                       I  +   
Sbjct: 198 YGVDIVTHSATKWIGGHGTTLGGVIIDSGKFPWKDYPEKFPQFSKPAEGYHGTIYNEAYG 257

Query: 225 DRTY-----------LGTIPAXXXXXXXXXXXXTMDIRVRRQSQNCTELVSYLANNSEKF 273
           +  Y           LG++ +            T+ +R  R  +N  +L  +L       
Sbjct: 258 NLAYIVHVRTELLRDLGSLMSPFAAFLLLQGVETLSLRGERHGENALKLAKWLEQ----- 312

Query: 274 SSVVQEIRHASLQTEAF---VKQQMPGGFGPVFALILK-------SEDQCR----KVVKN 319
           S  V  + +  L + +     K+ +  GFG + +  +K         D  +    +VV N
Sbjct: 313 SPYVSWVSYPGLPSHSHHENAKKYLSNGFGGMLSFGVKDLPNADTETDPFKLSGAQVVDN 372

Query: 320 VSFFQHATSLGGVESLI------EWRAMSDPTAL-----KTLIRVSVGLENIEDLIADLA 368
           +    +  ++G  ++L+        + ++D   L     K LIRVSVG E I+D+I D  
Sbjct: 373 LKIASNLANVGDSKTLVIAPYFTTHQQLNDEEKLASGVTKDLIRVSVGTEFIDDIINDFQ 432

Query: 369 GSLEKINKGEL 379
            S E+  +G++
Sbjct: 433 QSFERTFEGKI 443

>KNAG0I02920 Chr9 (573008..574345) [1338 bp, 445 aa] {ON} Anc_4.53
           YLR303W
          Length = 445

 Score = 65.5 bits (158), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 79/326 (24%), Positives = 126/326 (38%), Gaps = 86/326 (26%)

Query: 131 IEAKCQEGD--------------LVHIEDPINPFGETVDLAQYASRIHSAGGLMMLDSTL 176
           IEA+  EGD               V++E   NP     D  +  +  H  G  +M+D+T 
Sbjct: 127 IEARFVEGDSPEDFEKVFDERTKCVYLESIGNPKYNVPDFEKIVAVAHKHGIPVMVDNTF 186

Query: 177 GP-----PPLRNAWDYGADIIMHSGTKYFGGHSDLLSGIVCVSDE--------------- 216
           G       PL+    YGADI+ HS TK+ GGH   L GI+  S +               
Sbjct: 187 GAGGFFCQPLK----YGADIVTHSATKWIGGHGTTLGGIIVDSGKFPWKDYPEKFPQFSK 242

Query: 217 -------AIAEQLKNDRTY-----------LGTIPAXXXXXXXXXXXXTMDIRVRRQSQN 258
                   I  +   +  Y           LG++ +            T+ +R  R  QN
Sbjct: 243 PAEGYHGTIYNEAYGNLAYIVHVRTELLRDLGSMISPFAAFLLIQGVETLSLRGERHGQN 302

Query: 259 CTELVSYLANNSEKFSSVVQEIRHASLQTEAF---VKQQMPGGFGPVFALILK------- 308
             +L  +L     + S  V  + +  L + +     K+ +  GFG + +  +K       
Sbjct: 303 ALKLAKWL-----EASPYVSWVSYPGLPSHSHHENAKKYLSNGFGGMLSFGVKDLPNAAT 357

Query: 309 SEDQCR----KVVKNVSFFQHATSLGGVESLI------EWRAMSDPTAL-----KTLIRV 353
             D  +    +VV N+    +  ++G  ++L+          ++D   L     K LIRV
Sbjct: 358 ETDPFKLSGAQVVDNLKLASNLANVGDSKTLVIAPFFTTHEQLADEEKLASGVTKDLIRV 417

Query: 354 SVGLENIEDLIADLAGSLEKINKGEL 379
           SVG E I+D+I D   + EK   G+L
Sbjct: 418 SVGTEYIDDIIEDFKQAFEKTFAGKL 443

>TBLA0C04400 Chr3 (1062021..1063358) [1338 bp, 445 aa] {ON} Anc_4.53
           YLR303W
          Length = 445

 Score = 65.5 bits (158), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 107/429 (24%), Positives = 169/429 (39%), Gaps = 86/429 (20%)

Query: 22  APPINVSTTFRYDNEHLVPATRETGMHTSDSPMIYSRLGHPNADRLEA-VLSQLLDSHAV 80
           A PI  +T++ +D+          G+       IYSR+ +P  D LE  + +    + A+
Sbjct: 26  AVPIYATTSYVFDDSKY--GAEIFGLEKPG--FIYSRIMNPTNDVLERRLAALEGGAAAL 81

Query: 81  VYASGLAAYH-AI--LVHFKPKRLFLPHCYHGCKEVARIISRLNGMEILSLE-----DIE 132
             ASG AA   AI  L H     +     Y G     ++  +  G+E   +E     D E
Sbjct: 82  AVASGQAAQTLAITGLAHSGDNIVSTSFLYGGTYNQFKVAFKRLGIEARFVEGDAPEDFE 141

Query: 133 AKCQEG-DLVHIEDPINPFGETVDLAQYASRIHSAGGLMMLDSTLGP-----PPLRNAWD 186
               E    V++E   NP     D  +  +  H  G  +++D+T G       P++    
Sbjct: 142 KLFDEKTKAVYLETIGNPKYNVPDFDKIVAVAHKHGIPVVVDNTFGAGGFFCQPIK---- 197

Query: 187 YGADIIMHSGTKYFGGHSDLLSGIVCVSD--------EAIAEQLKNDRTY---------- 228
           YGADI+ HS TK+ GGH   ++G +  S         E   +  K    Y          
Sbjct: 198 YGADIVTHSATKWIGGHGTTIAGAIIDSGKFPWKEYPEKFPQFSKPSEGYHGMIFNEAMG 257

Query: 229 ---------------LGTIPAXXXXXXXXXXXXTMDIRVRRQSQNCTELVSYLANNSEKF 273
                          LG   +            T+ +R  RQ +N   L  +L    EK 
Sbjct: 258 NLAFIGHVRTELLRDLGPCMSPFASFLLLQGVETLSLRAERQGENTLALAKWL----EK- 312

Query: 274 SSVVQEIRHASLQTEAF---VKQQMPGGFGPVFALILK-------SEDQCR----KVVKN 319
           S+ V  + +  L + +     K+ +  GFG V +  +K        +D  +    + V N
Sbjct: 313 SAYVSWVSYPGLVSHSHHENAKKYLRNGFGGVLSFGVKDLPGAAEEKDPFKAAGAQAVDN 372

Query: 320 VSFFQHATSLGGVESLI------EWRAMSDPTAL-----KTLIRVSVGLENIEDLIADLA 368
           +    +  ++G  ++L+        + +SD   L     K LIRVSVG E I+D+IAD  
Sbjct: 373 LKLASNLANVGDSKTLVIAPYFTTHQQLSDEEKLASGVTKDLIRVSVGTEFIDDIIADFQ 432

Query: 369 GSLEKINKG 377
            S EKI  G
Sbjct: 433 QSFEKIFNG 441

>Kpol_1041.44 s1041 (117344..118678) [1335 bp, 444 aa] {ON}
           (117344..118678) [1335 nt, 445 aa]
          Length = 444

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 100/433 (23%), Positives = 169/433 (39%), Gaps = 92/433 (21%)

Query: 22  APPINVSTTFRY-DNEHLVPATRETGMHTSDSPMIYSRLGHPNADRLEAVLSQLLDSHAV 80
           A PI  +T++ + D++H     +  G+ T     IYSR+ +P  D  E  ++ L    A 
Sbjct: 26  AVPIYATTSYVFNDSKH---GAQLFGLETPG--YIYSRIMNPTVDVFEKRIAALEGGIAA 80

Query: 81  VYASGLAAYHAI----LVHFKPKRLFLPHCYHGCKEVARIISRLNGMEILSLEDIEAKC- 135
           +  S   A   +    L H     +   + Y G     ++  +  G+ +  +E  + K  
Sbjct: 81  LAVSSGQAAQTLAITGLAHAGDNIVSTSYLYGGTYNQFKVAFKRLGINVKFVEGDDPKDF 140

Query: 136 -----QEGDLVHIEDPINPFGETVDLAQYASRIHSAGGLMMLDSTLGP-----PPLRNAW 185
                ++   V++E   NP     D  +     H  G  +++D+T G       P++   
Sbjct: 141 EKLFDEKTKAVYLETIGNPKYNVPDFEKITEVAHKHGIPVVVDNTFGAGGYFCQPIK--- 197

Query: 186 DYGADIIMHSGTKYFGGHSDLLSGIVCVSD--------EAIAEQLKNDRTYLGTI----- 232
            YG DI+ HS TK+ GGH   ++G +  S         E   +  K    Y G +     
Sbjct: 198 -YGCDIVTHSATKWIGGHGTTVAGAIIDSGKFPWKDYPERFPQFSKPSEGYHGLVFNDAF 256

Query: 233 -PA-------------------XXXXXXXXXXXXTMDIRVRRQSQNCTELVSYLANNSEK 272
            PA                               T+ +R  R  +N  +L  +L    EK
Sbjct: 257 GPAAFIGHVRTELLRDLGPCLDAFSAFLLLQGVETLSLRGERHGENTLKLAKWL----EK 312

Query: 273 FSSVVQEIRHASLQTEAF---VKQQMPGGFGPVFALILK-------SEDQCR----KVVK 318
            S  V  + +  L + +     K+ +  GFG V +  +K        +D  +    +VV 
Sbjct: 313 -SPYVSWVSYPGLPSHSHHENAKKYLSNGFGGVLSFGVKDLPNASDEKDPFKASGAQVVD 371

Query: 319 NVSFFQHATSLGGVESLI-------------EWRAMSDPTALKTLIRVSVGLENIEDLIA 365
           N+    +  ++G  ++L+             E +  S  T  K LIRVSVG E I+D+IA
Sbjct: 372 NLKLALNLANVGDSKTLVIAPYFTTHQQLNEEEKLASGVT--KDLIRVSVGTEYIDDIIA 429

Query: 366 DLAGSLEKINKGE 378
           D   S EK+  G+
Sbjct: 430 DFQQSFEKVFAGQ 442

>SAKL0H23892g Chr8 (2059083..2060411) [1329 bp, 442 aa] {ON} highly
           similar to uniprot|P06106 Saccharomyces cerevisiae
           YLR303W MET17 O-acetyl homoserine-O-acetyl serine
           sulfhydrylase required for sulfur amino acid synthesis
          Length = 442

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 106/431 (24%), Positives = 174/431 (40%), Gaps = 88/431 (20%)

Query: 22  APPINVSTTFRY-DNEHLVPATRETGMHTSDSPMIYSRLGHPNADRLEA-VLSQLLDSHA 79
           A PI  +T++ + D++H     +  G+ T     IYSR+ +P  D LE  + +    + A
Sbjct: 25  AVPIYATTSYVFNDSKH---GAQLFGLETPG--YIYSRIMNPTNDVLEQRLAALEGGAAA 79

Query: 80  VVYASGLAAYHAI---LVHFKPKRLFLPHCYHGCKEVARIISRLNGMEILSL-----EDI 131
           +  ASG AA       L H     +     Y G     ++  +  G+E   +     ED 
Sbjct: 80  LAVASGQAAQTVAITGLAHAGDNIVSTSFLYGGTYNQFKVAFKRLGIEARFVDGDKPEDF 139

Query: 132 EAKCQEG-DLVHIEDPINPFGETVDLAQYASRIHSAGGLMMLDSTLGP-----PPLRNAW 185
           E +  E    +++E   NP     D  +  +  H  G  +++D+T G       P++   
Sbjct: 140 EKQFDEKTKALYLESIGNPKYNVPDFEKIVAIAHKHGIPVVVDNTFGAGGFFCQPIK--- 196

Query: 186 DYGADIIMHSGTKYFGGHSDLLSGIVCVSD--------EAIAEQLKNDRTYLGTI----- 232
            +GADI+ HS TK+ GGH   ++G +  S         E   +  K    Y G +     
Sbjct: 197 -WGADIVTHSATKWIGGHGTTIAGAIIDSGKFPWKDYPEKFPQFSKPSEGYHGLVFNDAF 255

Query: 233 ------------------PAXX--XXXXXXXXXXTMDIRVRRQSQNCTELVSYLANNSEK 272
                             PA              T+ +R  R + N  +L  +L    EK
Sbjct: 256 GPLAFIGHARTELLRDLGPALSPFSSFLLLQGLETLSLRGERHAYNALKLAQWL----EK 311

Query: 273 FSSVVQEIRHASLQTEAF---VKQQMPGGFGPVFALILK-----SED------QCRKVVK 318
            S  V  + +  L++       K+ +  GFG V +  +K     SE+         +VV 
Sbjct: 312 -SPYVSWVSYPGLESHTHHENAKKYLQNGFGGVLSFGVKPLPNASEESDPFKASGAQVVD 370

Query: 319 NVSFFQHATSLGGVESLI------EWRAMSDPTALKT-----LIRVSVGLENIEDLIADL 367
           N+    +  ++G  ++L+        + +S    L +     LIRVSVG E I+D+IAD 
Sbjct: 371 NLKLASNLANVGDSKTLVIAPYFTTHQQLSHEEKLASGVTDDLIRVSVGTEFIDDIIADF 430

Query: 368 AGSLEKINKGE 378
             S EKI KG+
Sbjct: 431 EQSFEKIFKGQ 441

>Suva_7.79 Chr7 complement(150082..151479) [1398 bp, 465 aa] {ON}
           YGL184C (REAL)
          Length = 465

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 87/400 (21%), Positives = 154/400 (38%), Gaps = 69/400 (17%)

Query: 22  APPINVSTTFRYDNEHLVPATRETGMHTSDSPMIYSRLGHPNADRLEAVLSQLL---DSH 78
            PP+ +STTF+ D  +      +           YSR G+P    L+  + +L      +
Sbjct: 24  VPPVYLSTTFKVDLNNEAAQDYD-----------YSRSGNPTRSVLQNQIGKLYRVPQEN 72

Query: 79  AVVYASGLAAYHAIL---------------------VHFKPKRL--FLPHCYHGCKEVAR 115
            +  +SG+ A   IL                     ++   +RL  F  H  H       
Sbjct: 73  VLAVSSGMTALDIILRGLVLLNGTEDHTPTIIAGDDLYGGTQRLLNFFKHQTHA------ 126

Query: 116 IISRLNGMEILSLEDIEAKCQEGDLVHIEDPINPFGETVDLAQYASRIH--SAGGLMMLD 173
           +   ++       + +     + D V +E P NP  + VD+ +    +   S    +++D
Sbjct: 127 VTVHVDTSNFDRFKTVFQSLDKVDCVLLESPTNPLCKVVDIPKILRYVKCVSPDTKVIVD 186

Query: 174 ST----LGPPPLRNAWDYGADIIMHSGTKYFGGHSDLLSGIVCVSDEAIAEQLKNDRTYL 229
           +T    L   PL+   +   D++  S TKY  GH DL+ G++      IA +L       
Sbjct: 187 NTMMSGLNCNPLQ--LNPSCDVVYESATKYLNGHHDLMGGVIISKTAEIASKLYFVVNST 244

Query: 230 GTIPAXXXXXXXXXXXXTMDIRVRRQSQNCTELVSYLANN---SEKFSSVVQEIRHASLQ 286
           G   +            T+ +R+ +Q +N   L  +L ++       ++   + R   L+
Sbjct: 245 GAGLSPMDSWLLVRGLKTLGVRLHQQQRNAMILAHWLEDSCGFKPTATNKATKTRFVGLR 304

Query: 287 TEAFVK--QQMPGGFGPVFALILKSEDQCRKVV--KNVSFFQHATSLGGVESLIEW---- 338
           +    K  Q    G G V +    S +  +++V  K ++ +    S G V SL+      
Sbjct: 305 SNPDFKLHQSFNNGPGAVLSFETGSFEHSKRLVSSKKLNIWAVTVSFGCVNSLLSMPCKM 364

Query: 339 -RAMSDPTALKT------LIRVSVGLENIEDLIADLAGSL 371
             A  DP   K       L+R+  G+ENI DL  DL  ++
Sbjct: 365 SHASIDPEVRKERDFPEDLVRLCCGIENIVDLKKDLLAAM 404

>YFR055W Chr6 (264204..265226) [1023 bp, 340 aa] {ON}
           IRC7Beta-lyase involved in the production of thiols;
           null mutant displays increased levels of spontaneous
           Rad52p foci; expression induced by nitrogen limitation
           in a GLN3, GAT1-dependent manner and by copper levels in
           a Mac1-dependent manner
          Length = 340

 Score = 62.8 bits (151), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 49/199 (24%), Positives = 90/199 (45%), Gaps = 15/199 (7%)

Query: 140 LVHIEDPINPFGETVDLAQYASRIHSAGGLMMLDSTLGPPPLRNAWDYGADIIMHSGTKY 199
           ++ +E P +   E  D+    S     G   +LD+T   P   +A  +G DI + +GTKY
Sbjct: 150 VIFLESPGSGTMEVQDIPALVSVAKKHGIKTILDNTWATPLFFDAHAHGIDISVEAGTKY 209

Query: 200 FGGHSDLLSGIVCVSDEAIAEQLKNDRTYLGTIPAXXXXXXXXXXXXTMDIRVRRQSQNC 259
            GGHSDLL G+   ++E     L++    +  +P             T+ +R++   +  
Sbjct: 210 LGGHSDLLIGLASANEECWP-LLRSTYDAMAMLPGAEDCQLALRGMRTLHLRLKEVERKA 268

Query: 260 TELVSYLANNSEKFSSVVQEIRHASLQT----EAFVKQQMPGGFGPVFALILK---SEDQ 312
            +L ++L N  E     V+++ H + +     E +V+     G   +F+++LK   +   
Sbjct: 269 LDLAAWLGNRDE-----VEKVLHPAFEDCPGHEYWVRDYK--GSSGLFSIVLKNGFTRAG 321

Query: 313 CRKVVKNVSFFQHATSLGG 331
             K+V+ +   Q   S GG
Sbjct: 322 LEKMVEGMKVLQLGFSWGG 340

>Ecym_8365 Chr8 complement(732418..733752) [1335 bp, 444 aa] {ON}
           similar to Ashbya gossypii ADL031W
          Length = 444

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 87/393 (22%), Positives = 149/393 (37%), Gaps = 78/393 (19%)

Query: 55  IYSRLGHPNADRLEAVLSQLLDSHA-VVYASGLAAYH---AILVHFKPKRLFLPHCYHGC 110
           +YSR+G+P  D LE  L+ L      V  ASG AA       L       +   H Y G 
Sbjct: 54  LYSRMGNPTVDVLEKRLAALEGGRGCVAVASGQAAQAMALGALAQVGDNIVTSSHLYGGT 113

Query: 111 KEVARIISRLNGMEILSLEDIEAKCQE------GDLVHIEDPINPFGETVDLAQYASRIH 164
               ++  +  G+E+   E  EA+  E         +++E   NP     D  +     H
Sbjct: 114 YNQLKVAFKRLGVEVRFSEGGEAEDYEQLFDDKTKALYVESIGNPKYTVPDFEKITEVAH 173

Query: 165 SAGGLMMLDSTLGPPPLR-NAWDYGADIIMHSGTKYFGGHSDLLSGIVCVSD-------- 215
             G  +++D+T G         ++GADII HS TK+  GH   ++G +  S         
Sbjct: 174 KHGIPVVVDNTFGAAGFFCKPIEFGADIITHSATKWINGHGTAIAGAIVDSGNFPWTQYP 233

Query: 216 ----------EAIAEQLKNDR-------TY--------LGTIPAXXXXXXXXXXXXTMDI 250
                     E+    + ND         Y        LG+  +            T+ +
Sbjct: 234 DKFPQFSQPAESYHGMVYNDNFGPLAFIAYVRLELLRDLGSTMSPFTAFLSLQGLETLSL 293

Query: 251 RVRRQSQNCTELVSYLANNSEKFSSVVQEIRHASLQTEAF---VKQQMPGGFGPVFALIL 307
           R  R ++N  +L  +L +     S  V  + +  L +       K+ +  G G + +  +
Sbjct: 294 RCERHARNSIDLARHLED-----SPYVAWVSYPGLDSHPSRNNAKKYLTNGAGGMLSFGI 348

Query: 308 KSEDQCR---------------KVVKNVSFFQHATSLGGVESLI------EWRAMSDPTA 346
           K  D+                 K V ++    +  ++G  ++L+        + ++D   
Sbjct: 349 KPFDKTNGEEEASEVDTSVIAAKFVDSLKLASNLANVGDSKTLVIAPYFTTHQQLTDEEK 408

Query: 347 LKT-----LIRVSVGLENIEDLIADLAGSLEKI 374
           LK      +IRVSVG E I+D+IAD   + + +
Sbjct: 409 LKAGADKDVIRVSVGTEYIDDIIADFEQAFKTV 441

>ADL031W Chr4 (645776..647179) [1404 bp, 467 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR303W (MET17)
          Length = 467

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 98/437 (22%), Positives = 172/437 (39%), Gaps = 96/437 (21%)

Query: 16  NRVSDVAPPINVSTTFRY-DNEHLVPATRETGMHTSDSPMIYSRLGHPNADRLEA-VLSQ 73
           N  S  A PI  +T++ + D++H     +  G+       IYSR+ +P  D LE  + + 
Sbjct: 20  NANSPRAVPIYATTSYVFNDSKH---GAQLFGLEAPG--FIYSRIMNPTNDVLEKRIAAL 74

Query: 74  LLDSHAVVYASGLAAYHAI---LVHFKPKRLFLPHCYHGCKEVARIISRLNGMEIL---- 126
              + A+  ASG AA       L H     +   + Y G     ++  +  G+E      
Sbjct: 75  EGGAAALAVASGQAAQLVAIGGLAHAGDNIVSTSYLYGGSYNQFKVAFKRLGIECRFVEG 134

Query: 127 -SLEDIEAKC-QEGDLVHIEDPINPFGETVDLAQYASRIHSAGGLMMLDSTLGP-----P 179
            + ED EA+   +   V +E   NP     D  +  +  H  G  +++D+T G       
Sbjct: 135 DNAEDFEARFDSKTKAVFLESIGNPKYNVPDFERIVAVAHRHGIPVVVDNTFGAGGYFCQ 194

Query: 180 PLRNAWDYGADIIMHSGTKYFGGHSDLLSGIVC--------------------------- 212
           P++    +GADI+ HS TK+ GGH   + G+V                            
Sbjct: 195 PIK----FGADIVTHSATKWIGGHGTAIGGLVVDSGKFPWKDYPAKFPQFSEPSEGYHGL 250

Query: 213 VSDEAIA----------EQLKNDRTYLGTIPAXXXXXXXXXXXXTMDIRVRRQSQNCTEL 262
           V +EA+           E L++    LG   +            T+ +R  R  QN   L
Sbjct: 251 VLNEALGPLAFVGHARIELLRD----LGPALSPFAAFLFLQGLETLSLRAERHGQNALAL 306

Query: 263 VSYLANNSEKFSSVVQEIRHASLQTEAFVK---QQMPGGFGPVFALILKS---------- 309
             YL       S+ V  + +  L++  ++    + +  G+G V +  +K           
Sbjct: 307 AKYLET-----SAYVSWVSYPGLESHDYLSNATRYLQNGYGGVLSFGVKPLPDTDEEADP 361

Query: 310 -EDQCRKVVKNVSFFQHATSLGGVESLI------EWRAMSDPTAL-----KTLIRVSVGL 357
            +    + V N+ F  +  ++G  ++L+        + +S+   L     + LIRVSVG 
Sbjct: 362 FKAAGAQFVDNLKFASNLANVGDSKTLVIAPYFTTHQQLSESEKLASGVTRDLIRVSVGT 421

Query: 358 ENIEDLIADLAGSLEKI 374
           E ++D+IAD   +   +
Sbjct: 422 EYLQDIIADFEQAFSTV 438

>KLLA0D04037g Chr4 (336499..337833) [1335 bp, 444 aa] {ON} highly
           similar to uniprot|P06106 Saccharomyces cerevisiae
           YLR303W MET17 O-acetyl homoserine-O-acetyl serine
           sulfhydrylase required for sulfur amino acid synthesis
          Length = 444

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 99/431 (22%), Positives = 166/431 (38%), Gaps = 88/431 (20%)

Query: 22  APPINVSTTFRY-DNEHLVPATRETGMHTSDSPMIYSRLGHPNADRLEAVLSQLLDSHAV 80
           A PI  +T++ + D++H     +  G+ T     IYSR+ +P  D LE  L+ L    A 
Sbjct: 25  AVPIYATTSYVFNDSKH---GAQLFGLETPG--YIYSRIMNPTLDVLEKRLAALEGGIAA 79

Query: 81  VYASGLAAYHAI----LVHFKPKRLFLPHCYHGCKEVARIISRLNGMEILSL-----EDI 131
           +  S   A   +    L H     +     Y G     ++  +  G+E   +     ED 
Sbjct: 80  LATSSGQAAQTLAVTGLAHTGDNIVSTSFLYGGTYNQFKVAFKRLGIEARFVDGDKPEDF 139

Query: 132 EAKCQEG-DLVHIEDPINPFGETVDLAQYASRIHSAGGLMMLDSTLGP-----PPLRNAW 185
           E    E    +++E   NP     D  +  +  H  G  +++D+T G       P++   
Sbjct: 140 EKLFDEKTKALYLESIGNPKYNVPDFEKIVAVAHKHGIPVVVDNTFGAGGFFCQPIK--- 196

Query: 186 DYGADIIMHSGTKY-----------------------------FGGHSDLLSGIVCVSDE 216
            YGADI+ HS TK+                             F   S+   G++     
Sbjct: 197 -YGADIVTHSATKWIGGHGVTVGGVIIDSGKFPWKDYPEKFPQFSQPSEGYHGLIFNDAF 255

Query: 217 AIAEQLKNDRTY----LGTIPAXXXXXXXXXXXXTMDIRVRRQSQNCTELVSYLANNSEK 272
             A  + + RT     LG + +            T+ +R  R   N  +L  YL +    
Sbjct: 256 GPAAFIGHVRTELLRDLGPVLSPFAGFLLLQGLETLSLRGERHGSNALKLAQYLES---- 311

Query: 273 FSSVVQEIRHASLQTEAF---VKQQMPGGFGPVFALILK-----SED------QCRKVVK 318
            S  V  + +  L + +     K+ +  GFG V +  +K     SE+         +VV 
Sbjct: 312 -SPYVSWVSYPGLPSHSHHENAKKYLENGFGGVLSFGVKDLPNASEESDPFKASGAQVVD 370

Query: 319 NVSFFQHATSLGGVESLI------EWRAMSDPTAL-----KTLIRVSVGLENIEDLIADL 367
           N+    +  ++G  ++L+        + ++D   L     K LIRVSVG E I+D+IAD 
Sbjct: 371 NLKLASNLANVGDSKTLVIAPYFTTHQQLTDEEKLASGVTKDLIRVSVGTEFIDDIIADF 430

Query: 368 AGSLEKINKGE 378
             S   +  G+
Sbjct: 431 EASFATVFNGQ 441

>KLTH0D03652g Chr4 complement(358612..359946) [1335 bp, 444 aa] {ON}
           highly similar to uniprot|P06106 Saccharomyces
           cerevisiae YLR303W MET17 O-acetyl homoserine-O-acetyl
           serine sulfhydrylase required for sulfur amino acid
           synthesis
          Length = 444

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 99/397 (24%), Positives = 158/397 (39%), Gaps = 82/397 (20%)

Query: 55  IYSRLGHPNADRLEAVLSQLLDS-HAVVYASGLAAYH-AI--LVHFKPKRLFLPHCYHGC 110
           +YSR+ +P  D  E  ++ L     A+  ASG AA   AI  L H     +     Y G 
Sbjct: 55  MYSRIVNPTVDVFERRIAALEGGVAALAVASGQAAQALAISGLAHAGDNIVSTSFLYGGT 114

Query: 111 KEVARIISRLNGMEILSLE-----DIE-AKCQEGDLVHIEDPINPFGETVDLAQYASRIH 164
               ++  R  G+E   +E     D E A   +   V++E   NP     D  +  +  H
Sbjct: 115 YNQFKVAFRRLGIETRFIEGDKPEDFEKAFDDKTKAVYLETIGNPKYNVPDFEKIVAVAH 174

Query: 165 SAGGLMMLDSTLGP-----PPLRNAWDYGADIIMHSGTKYFGGHSDLLSGIVCVSD---- 215
             G  +++D+T G       P++    YGADI+ HS TK+ GGH   + G++  S     
Sbjct: 175 KHGIPVVVDNTFGAGGYFAQPIK----YGADIVTHSATKWIGGHGTTIGGVIVDSGKFPW 230

Query: 216 ----EAIAEQLKNDRTYLGTI-----------------------PAXX--XXXXXXXXXX 246
               E   +  K    Y G +                       PA              
Sbjct: 231 KEYPEKFPQFSKPSEGYHGLVINDALGPLAYIGHVRIELLRDLGPALNPFAAFQLLQGVE 290

Query: 247 TMDIRVRRQSQNCTELVSYLANNSEKFSSVVQEIRHASLQTEAF---VKQQMPGGFGPVF 303
           T+ +R  R + N  +L  YL    EK S  V  + +  L + +     K+ +  GFG V 
Sbjct: 291 TLSLRCERHATNALKLAQYL----EK-SPYVSWVSYPGLSSHSHHENAKKYLQNGFGGVL 345

Query: 304 ALILKS-------EDQCR----KVVKNVSFFQHATSLGGVESLI------EWRAMSDPTA 346
           +  +K        ED  +    +VV ++    +  ++G  ++L+        + ++D   
Sbjct: 346 SFGVKDLPNAHEIEDPFKASGAQVVDSLKIASNLANVGDSKTLVIAPYFTTHQQLTDEEK 405

Query: 347 L-----KTLIRVSVGLENIEDLIADLAGSLEKINKGE 378
           L     K LIRVSVG E I+D+I D   + EK+  G+
Sbjct: 406 LASGVTKDLIRVSVGTEFIDDIIGDFEQAFEKVFNGQ 442

>Smik_12.383 Chr12 (670676..672010) [1335 bp, 444 aa] {ON} YLR303W
           (REAL)
          Length = 444

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 97/435 (22%), Positives = 162/435 (37%), Gaps = 96/435 (22%)

Query: 22  APPINVSTTFRYDNEHLVPATRETGMHTSDSPMIYSRLGHPNADRLEAVLSQLLDSHAVV 81
           A PI  +T++ ++N      ++  G+       +YSR  +P ++ LE  ++ L    A +
Sbjct: 26  AVPIYATTSYVFENSKH--GSQLFGLEVPG--YVYSRFQNPTSNVLEERIAALEGGAAAL 81

Query: 82  YASGLAAYHAI----LVHFKPKRLFLPHCYHGCKEVARIISRLNGMEILSLE-----DIE 132
             S   A   +    L H     +   + Y G     +I  +  G+E   +E     D E
Sbjct: 82  AVSSGQAAQTLAIQGLAHTGDNIVSTSYLYGGTYNQFKISFKRFGIEARFVEGDNPEDFE 141

Query: 133 AKCQE-GDLVHIEDPINPFGETVDLAQYASRIHSAGGLMMLDSTLGP-----PPLRNAWD 186
               E    V++E   NP     D  +  +  H  G  +++D+T G       P++    
Sbjct: 142 KVFDERTKAVYLETIGNPKYNVPDFEKIVAIAHKHGIPVVVDNTFGAGGYFCQPIK---- 197

Query: 187 YGADIIMHSGTKYF----------------------------------GGHSDL------ 206
           YGADI+ HS TK+                                   G H  +      
Sbjct: 198 YGADIVTHSATKWIGGHGTTIGGIIVDSGKFPWKDYPEKFPQFSQPAEGYHGTIYNEAYG 257

Query: 207 -LSGIVCVSDEAIAEQLKNDRTYLGTIPAXXXXXXXXXXXXTMDIRVRRQSQNCTELVSY 265
            L+ IV V  E + +        LG +              T+ +R  R  +N  +L  +
Sbjct: 258 NLAYIVHVRTELLRD--------LGPLMNPFASFLLLQGVETLSLRAERHGENALKLAKW 309

Query: 266 LANNSEKFSSVVQEIRHASLQTEAFVKQQMPGGFGPVFALILKSEDQCRK---------- 315
           L  +   + S V     AS       K+ +  GFG V +  +K      K          
Sbjct: 310 LEQSP--YVSWVSYPGLASHSHHENAKKYLSNGFGGVLSFGVKDLPNADKETDPFKLSGA 367

Query: 316 -VVKNVSFFQHATSLGGVESLI------EWRAMSDPTAL-----KTLIRVSVGLENIEDL 363
            VV N+    +  ++G  ++L+        + ++D   L     K LIRVSVG+E I+D+
Sbjct: 368 QVVDNLKLASNLANVGDAKTLVIAPYFTTHKQLNDKEKLASGVTKDLIRVSVGIEFIDDI 427

Query: 364 IADLAGSLEKINKGE 378
           IAD   S E +  G+
Sbjct: 428 IADFQQSFETVFAGQ 442

>ZYRO0G22198g Chr7 complement(1827527..1828864) [1338 bp, 445 aa]
           {ON} highly similar to uniprot|P06106 Saccharomyces
           cerevisiae YLR303W MET17 O-acetyl homoserine-O-acetyl
           serine sulfhydrylase required for sulfur amino acid
           synthesis
          Length = 445

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 102/431 (23%), Positives = 173/431 (40%), Gaps = 95/431 (22%)

Query: 22  APPINVSTTFRYDNEHLVPATRETGMHTSDSPMIYSRLGHPNADRLEAVLSQLLDS-HAV 80
           A PI  +T++ +D+      ++  G+ T     IYSR+ +P AD  E  ++ L     A+
Sbjct: 26  AVPIYSTTSYVFDDSKH--GSQLFGLETPG--YIYSRIMNPTADVFERRIAALEGGVGAL 81

Query: 81  VYASGLAAYH-AI--LVHFKPKRLFLPHCYHGCKEVARIISRLNGMEILSLED-----IE 132
             +SGLAA   AI  L H     +   + Y G     +I  +  G+E   +E      +E
Sbjct: 82  AVSSGLAAQTLAITGLAHAGDNIVSTSYLYGGTYNQFKIAFKRFGIESRFIEGDDPSGLE 141

Query: 133 AKCQE-GDLVHIEDPINPFGETVDLAQYASRIHSAGGLMMLDSTLGP-----PPLRNAWD 186
           A+  E    V++E   NP     D  +  +  H  G  +++D+T G       P++    
Sbjct: 142 AQIDERTKAVYLETIGNPKYNVPDFEKIVAIAHKHGVPVVVDNTFGAGGYYCQPIK---- 197

Query: 187 YGADIIMHSGTKY-----------------------------FGGHSDLLSGIV---CVS 214
           +GAD+++HS TK+                             F   S+   G+V    + 
Sbjct: 198 HGADVVVHSATKWIGGHGTTIGGVIVDSGNFPWKEYPKKFPQFSEPSEGYHGLVFNEALG 257

Query: 215 DEAI-----AEQLKNDRTYLGTIPAXXXXXXXXXXXXTMDIRVRRQSQNCTELVSYLANN 269
           ++A      AE L++    LG   +            T+ +R  R + N  +L  +L   
Sbjct: 258 NQAFIGHVRAELLRD----LGPSLSPFAAFLLLQGLETLSLRAERHASNALKLAQWL--- 310

Query: 270 SEKFSSVVQEIRHASLQT---EAFVKQQMPGGFGPVFALILK--------SEDQCR---- 314
            EK S  V  + +  L      A  K+ +  GFG V +   K         E+  +    
Sbjct: 311 -EK-SPYVSWVSYPGLPNHSHHANAKKYLTNGFGGVLSFGAKDLPDNPEEKENPFKAAGA 368

Query: 315 KVVKNVSFFQHATSLGGVESLIEWRAMSDPTAL-----------KTLIRVSVGLENIEDL 363
           ++  N+    +  ++G  ++L+     +    L           K LIRVSVG E I+D+
Sbjct: 369 QISDNLELASNLANVGDCKTLVIAPYFTTHLQLNHEEKLAAGVSKDLIRVSVGTEFIDDI 428

Query: 364 IADLAGSLEKI 374
           IAD   S +K+
Sbjct: 429 IADFEQSFKKV 439

>CAGL0D06402g Chr4 (602973..604301) [1329 bp, 442 aa] {ON} highly
           similar to uniprot|P06106 Saccharomyces cerevisiae
           YLR303w MET25 O-acetylhomoserine sulfhydrylase
          Length = 442

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 105/427 (24%), Positives = 162/427 (37%), Gaps = 88/427 (20%)

Query: 22  APPINVSTTFRY-DNEHLVPATRETGMHTSDSPMIYSRLGHPNADRLEA-VLSQLLDSHA 79
           A PI  +T+F + D++H     +  G+       IYSR  +P  + LE  + +    + A
Sbjct: 26  AVPIYSTTSFVFNDSQH---GAQLFGLEVPG--YIYSRFQNPTNNVLEERIAALEGGAAA 80

Query: 80  VVYASGLAAYH---AILVHFKPKRLFLPHCYHGCKEVARIISRLNGMEILSLE-----DI 131
           +  +SG AA     A L H     +     Y G     ++  +  G+E   +E     D 
Sbjct: 81  LAVSSGQAAQTLAVAGLAHNGDNIVSTSFLYGGTYNQFKVAFKRLGIEARFVEGDKPEDF 140

Query: 132 EAKCQE-GDLVHIEDPINPFGETVDLAQYASRIHSAGGLMMLDSTLGP-----PPLRNAW 185
           E    E    V++E   NP     D     +  H  G  +++D+T G       P++   
Sbjct: 141 EKLFDERTKAVYLESIGNPKYNVPDFENIVAVAHKHGIPVVVDNTFGAGGFFCQPIK--- 197

Query: 186 DYGADIIMHSGTKYFGGHSDLL------SGIVCVSD--EAIAEQLKNDRTYLGTI----- 232
            YGADI+ HS TK+ GGH   +      SG     D  E   +  K    Y GT+     
Sbjct: 198 -YGADIVTHSATKWIGGHGTTIGGIIVDSGKFPWKDYPEKFPQFSKPAEGYHGTVYNETY 256

Query: 233 ------------------PAXXXXXXX--XXXXXTMDIRVRRQSQNCTELVSYLANNSEK 272
                             P               T+ +R  R  QN   L  +L  N   
Sbjct: 257 GNLAYIVHVRTELLRDLGPGMSPFAAFLLLQGVETLSLRGERHGQNALALAKWLEKNPH- 315

Query: 273 FSSVVQEIRHASLQTEAF---VKQQMPGGFGPVFALILKSEDQCRK-----------VVK 318
               V  + +  L + +     K+ +  GFG V +  +K      K           VV 
Sbjct: 316 ----VAWVSYPGLPSHSHHENAKKYLSNGFGGVLSFGVKDLPNADKETDPFKLAGAQVVD 371

Query: 319 NVSFFQHATSLGGVESLI------EWRAMSDPTAL-----KTLIRVSVGLENIEDLIADL 367
           N+    +  ++G  ++L+        + +SDP  L     K LIRVSVG E I+D+IAD 
Sbjct: 372 NLKIASNLANVGDSKTLVIAPYFTTHQQLSDPEKLASGVTKDLIRVSVGTEFIDDIIADF 431

Query: 368 AGSLEKI 374
             S  K+
Sbjct: 432 EQSFAKV 438

>YLR303W Chr12 (732542..733876) [1335 bp, 444 aa] {ON}
           MET17Methionine and cysteine synthase (O-acetyl
           homoserine-O-acetyl serine sulfhydrylase), required for
           sulfur amino acid synthesis
          Length = 444

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 98/443 (22%), Positives = 162/443 (36%), Gaps = 112/443 (25%)

Query: 22  APPINVSTTFRYDNEHLVPATRETGMHTSDSPMIYSRLGHPNADRLEAVLSQLLDSHAVV 81
           A PI  +T++ ++N      ++  G+       +YSR  +P ++ LE  ++ L    A +
Sbjct: 26  AVPIYATTSYVFENSKH--GSQLFGLEVPG--YVYSRFQNPTSNVLEERIAALEGGAAAL 81

Query: 82  YASGLAAYHAI----LVHFKPKRLFLPHCYHGCKEVARIISRLNGMEILSLEDIEAKCQE 137
             S   A   +    L H     +   + Y G     +I  +  G        IEA+  E
Sbjct: 82  AVSSGQAAQTLAIQGLAHTGDNIVSTSYLYGGTYNQFKISFKRFG--------IEARFVE 133

Query: 138 GD--------------LVHIEDPINPFGETVDLAQYASRIHSAGGLMMLDSTLGP----- 178
           GD               V++E   NP     D  +  +  H  G  +++D+T G      
Sbjct: 134 GDNPEEFEKVFDERTKAVYLETIGNPKYNVPDFEKIVAIAHKHGIPVVVDNTFGAGGYFC 193

Query: 179 PPLRNAWDYGADIIMHSGTKYF----------------------------------GGHS 204
            P++    YGADI+ HS TK+                                   G H 
Sbjct: 194 QPIK----YGADIVTHSATKWIGGHGTTIGGIIVDSGKFPWKDYPEKFPQFSQPAEGYHG 249

Query: 205 DL-------LSGIVCVSDEAIAEQLKNDRTYLGTIPAXXXXXXXXXXXXTMDIRVRRQSQ 257
            +       L+ IV V  E + +        LG +              T+ +R  R  +
Sbjct: 250 TIYNEAYGNLAYIVHVRTELLRD--------LGPLMNPFASFLLLQGVETLSLRAERHGE 301

Query: 258 NCTELVSYLANNSEKFSSVVQEIRHASLQTEAFVKQQMPGGFGPVFALILKSEDQCRK-- 315
           N  +L  +L  +   + S V     AS       K+ +  GFG V +  +K      K  
Sbjct: 302 NALKLAKWLEQSP--YVSWVSYPGLASHSHHENAKKYLSNGFGGVLSFGVKDLPNADKET 359

Query: 316 ---------VVKNVSFFQHATSLGGVESLI------EWRAMSDPTAL-----KTLIRVSV 355
                    VV N+    +  ++G  ++L+        + ++D   L     K LIRVSV
Sbjct: 360 DPFKLSGAQVVDNLKLASNLANVGDAKTLVIAPYFTTHKQLNDKEKLASGVTKDLIRVSV 419

Query: 356 GLENIEDLIADLAGSLEKINKGE 378
           G+E I+D+IAD   S E +  G+
Sbjct: 420 GIEFIDDIIADFQQSFETVFAGQ 442

>Suva_10.397 Chr10 (693647..694981) [1335 bp, 444 aa] {ON} YLR303W
           (REAL)
          Length = 444

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 96/435 (22%), Positives = 162/435 (37%), Gaps = 96/435 (22%)

Query: 22  APPINVSTTFRYDNEHLVPATRETGMHTSDSPMIYSRLGHPNADRLEAVLSQLLDSHAVV 81
           A PI  +T++ ++N      ++  G+       +YSR  +P ++ LE  ++ L    A +
Sbjct: 26  AVPIYATTSYCFENSKH--GSQLFGLEVPG--YVYSRFQNPTSNVLEERIAALEGGAAAL 81

Query: 82  YASGLAAYHAI----LVHFKPKRLFLPHCYHGCKEVARIISRLNGMEILSLE-----DIE 132
             S   A   +    L H     +   + Y G     +I  +  G+E   +E     D E
Sbjct: 82  AVSSGQAAQTLAIQGLAHTGDNIVSTSYLYGGTYNQFKISFKRFGIEARFVEGDNPEDFE 141

Query: 133 AKCQE-GDLVHIEDPINPFGETVDLAQYASRIHSAGGLMMLDSTLGP-----PPLRNAWD 186
               E    V++E   NP     D  +  +  H  G  +++D+T G       P++    
Sbjct: 142 KVFDERTKAVYLETIGNPKYNVPDFEKIVAIAHKHGIPVVVDNTFGAGGYFCQPIK---- 197

Query: 187 YGADIIMHSGTKYF----------------------------------GGHSDL------ 206
           YGADI+ HS TK+                                   G H  +      
Sbjct: 198 YGADIVTHSATKWIGGHGTTIGGIIVDSGKFPWKDYPEKFPQFSQPAEGYHGTIYNEAYG 257

Query: 207 -LSGIVCVSDEAIAEQLKNDRTYLGTIPAXXXXXXXXXXXXTMDIRVRRQSQNCTELVSY 265
            L+ IV V  E + +        LG +              T+ +R  R  +N  +L  +
Sbjct: 258 NLAYIVHVRTELLRD--------LGPLMNPFASFLLLQGVETLSLRAERHGENALKLAKW 309

Query: 266 LANNSEKFSSVVQEIRHASLQTEAFVKQQMPGGFGPVFALILKSEDQCRK---------- 315
           L  +   + S V     AS       K+ +  GFG V +  +K      K          
Sbjct: 310 LEQSP--YVSWVSYPGLASHSHHENAKKYLSNGFGGVLSFGVKDLPNADKETDPFKLSGA 367

Query: 316 -VVKNVSFFQHATSLGGVESLI------EWRAMSDPTAL-----KTLIRVSVGLENIEDL 363
            VV ++    +  ++G  ++L+        + ++D   L     K LIRVSVG+E I+D+
Sbjct: 368 QVVDSLKLASNLANVGDAKTLVIAPYFTTHKQLNDTEKLASGVTKDLIRVSVGIEFIDDI 427

Query: 364 IADLAGSLEKINKGE 378
           IAD   S E +  G+
Sbjct: 428 IADFQQSFETVFAGQ 442

>NCAS0A06270 Chr1 complement(1239445..1241424) [1980 bp, 659 aa]
           {ON} Anc_4.354
          Length = 659

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 60/257 (23%), Positives = 104/257 (40%), Gaps = 29/257 (11%)

Query: 127 SLEDIEAKCQEGD---LVHIEDPINPFGETVDLAQYASRIHSAGGLMMLDSTLGPPPLRN 183
           SL+D++     G+    V IE P NP  +  DL +        G  +++D T+G     +
Sbjct: 390 SLQDLQTILHSGEQILAVFIEAPSNPLLQMCDLIELQKLSEIYGFFIVVDETIGGFVNLD 449

Query: 184 AWDYGADIIMHSGTKYFGGHSDLLSGIVCVSDEA----IAEQLKNDRTYLGTIPAXXXXX 239
              + ADI+  S TK F G S++++G + ++ ++     A+Q  N     G   +     
Sbjct: 450 GL-FHADIVCSSLTKVFNGDSNVIAGSMVLNPKSKIYEFAQQFLNGPD--GVTDSIWCED 506

Query: 240 XXXXXXXTMDIRVRRQSQNCTELVSYLANNSEK--FSSVVQEIRHASLQTEAF------V 291
                  + D   +    N T    YL +N  K     + + I + S  +E        +
Sbjct: 507 LIYLEKNSRDFVAKTLRINYT--TEYLLDNVFKPHVGKLFKRIYYPSQNSEEIKQNYEAI 564

Query: 292 KQQMPGGFGPVFALILKSEDQCRKVVKNVSFFQHATSLGGVESLIEWRAMSDPTALK--- 348
           K +  GG+G VF++     DQ +    N+   +  T      ++  +  +     L+   
Sbjct: 565 KCKKDGGYGGVFSVTFFQLDQAKVFFNNLKLTKQITLGNNSTTVCPYTMLKHKDELERVK 624

Query: 349 ------TLIRVSVGLEN 359
                  LIRV VGLEN
Sbjct: 625 EYGLEDNLIRVCVGLEN 641

>Skud_12.384 Chr12 (673748..675082) [1335 bp, 444 aa] {ON} YLR303W
           (REAL)
          Length = 444

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 96/436 (22%), Positives = 161/436 (36%), Gaps = 98/436 (22%)

Query: 22  APPINVSTTFRYDNEHLVPATRETGMHTSDSPMIYSRLGHPNADRLEAVLSQLLDSHAVV 81
           A PI  +T++ ++N      ++  G+       +YSR  +P ++ LE  ++ L    A +
Sbjct: 26  AVPIYATTSYVFENSKH--GSQLFGLEVPG--YVYSRFQNPTSNVLEERIAALEGGAAAL 81

Query: 82  YASGLAAYHAI----LVHFKPKRLFLPHCYHGCKEVARIISRLNGMEILSLE-----DIE 132
             S   A   +    L H     +   + Y G     +I  +  G+E   +E     D E
Sbjct: 82  AVSSGQAAQTLAIQGLAHTGDNIVSTSYLYGGTYNQFKISFKRFGIEARFVEGDNPEDFE 141

Query: 133 AKCQE-GDLVHIEDPINPFGETVDLAQYASRIHSAGGLMMLDSTLGP-----PPLRNAWD 186
               E    V++E   NP     D  +  +  H  G  +++D+T G       P++    
Sbjct: 142 KVFDERTKAVYLETIGNPKYNVPDFEKIVAIAHKHGIPVVVDNTFGAGGYFCQPIK---- 197

Query: 187 YGADIIMHS------------------------------------------GTKYFGGHS 204
           YGADI+ HS                                          GT Y   + 
Sbjct: 198 YGADIVTHSATKWIGGHGTTIGGIIVDSGKFPWKDYPEKFPQFSQPAEGYHGTIYNEAYG 257

Query: 205 DLLSGIVCVSDEAIAEQLKNDRTYLGTIPAXXXXXXXXXXXXTMDIRVRRQSQNCTELVS 264
           +L + IV V  E + +        LG +              T+ +R  R  +N  +L  
Sbjct: 258 NL-AYIVHVRTELLRD--------LGPLMNPFASFLLLQGVETLSLRAERHGENALKLAK 308

Query: 265 YLANNSEKFSSVVQEIRHASLQTEAFVKQQMPGGFGPVFALILKSEDQCRK--------- 315
           +L  +   + S V     AS       K+ +  GFG V +  +K      K         
Sbjct: 309 WLEESP--YVSWVSYPGLASHSHHENAKKYLSNGFGGVLSFGVKDLPNADKETDPFKLSG 366

Query: 316 --VVKNVSFFQHATSLGGVESLI------EWRAMSDPTAL-----KTLIRVSVGLENIED 362
             VV N+    +  ++G  ++L+        + ++D   L     K LIRVSVG+E I+D
Sbjct: 367 AQVVDNLKLASNLANVGDAKTLVIAPYFTTHKQLNDKEKLASGVTKDLIRVSVGIEFIDD 426

Query: 363 LIADLAGSLEKINKGE 378
           +IAD   S E +  G+
Sbjct: 427 IIADFQQSFETVFAGQ 442

>Ecym_5169 Chr5 complement(353237..355282) [2046 bp, 681 aa] {ON}
           similar to Ashbya gossypii AER164C
          Length = 681

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 67/279 (24%), Positives = 115/279 (41%), Gaps = 44/279 (15%)

Query: 116 IISRLNGMEILSLEDIEAKCQEGDLVH---------IEDPINPFGETVDLAQYASRIHSA 166
           I+   N    L + D EA  Q   ++H         IE P NP  +  DL +      + 
Sbjct: 393 ILRDFNHTHFLGMGDSEAMEQLKAILHGGEPILAVFIETPSNPLLKMGDLLELRKLADAY 452

Query: 167 GGLMMLDSTLGPPPLRNAWDYGADIIMHSGTKYFGGHSDLLSGIVCVSDEAIAEQLKNDR 226
              +++D T+G     +   Y ADI+  S TK F G S++++G + ++  +   +L   R
Sbjct: 453 DFYVIIDDTIGGFINVDVLQY-ADIVCSSLTKIFSGDSNVMAGSLVLNPSSRLYKLA--R 509

Query: 227 TYLGTIPAXXXXXXXXXXXXTMDIRVRRQSQNCTELVSYLANNSEKF---------SSVV 277
            +  +                  I + R S++C      +  N+E+           ++ 
Sbjct: 510 RFFAS------DDYEDLLWCEDSIYLERNSRDCVSRSMKINENAERLLKGTLLPLEGTLF 563

Query: 278 QEIRHASL---QTEA---FVKQQMPGGFGPVFALILKSEDQCRKVVKNVSFFQHATSLGG 331
           ++I + SL   +T+A    VK Q  GG+G +F+L    +D+C K   N        SLG 
Sbjct: 564 KKIYYPSLTSSETKANYDAVKCQPNGGYGGLFSLTF-FDDECAKAFFNSLDLCKGPSLGT 622

Query: 332 VESLI----------EWRAMSDPTALKTLIRVSVGLENI 360
             +L           E   ++     K L+RVS+GLE+ 
Sbjct: 623 NFTLACPYTILAHYGEMDVVAKYGLEKNLVRVSIGLEDF 661

>Kwal_26.7437 s26 complement(365889..367223) [1335 bp, 444 aa] {ON}
           YLR303W (MET17) - O-Acetylhomoserine-O-Acetylserine
           Sulfhydralase [contig 50] FULL
          Length = 444

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 75/312 (24%), Positives = 125/312 (40%), Gaps = 65/312 (20%)

Query: 127 SLEDIE-AKCQEGDLVHIEDPINPFGETVDLAQYASRIHSAGGLMMLDSTLGPPPL-RNA 184
           S ED E A   +   V++E   NP     D  +  +  H  G  +++D+T G        
Sbjct: 136 SPEDFEKAFDDKTKAVYLESIGNPKYNVPDFEKIVAVAHKHGIPVVVDNTFGAGGFFAQP 195

Query: 185 WDYGADIIMHSGTKYFGGHSDLLSGIVCVSD--------EAIAEQLKNDRTYLGTI---- 232
           + +GADII HS TK+ GGH   + G++  S         E   +  +    Y G I    
Sbjct: 196 FKFGADIITHSATKWIGGHGTTIGGVIVDSGKFPWKDYPEKFPQFSQPSEGYHGLIFNDA 255

Query: 233 -------------------PAXXXXXXXXXXX--XTMDIRVRRQSQNCTELVSYLANNSE 271
                              PA              T+ +R  R + N  +L  YL +   
Sbjct: 256 LGPLAYIAHVRVELLRDLGPALNPFAAFQLLQGIETLSLRCERHASNALKLAQYLES--- 312

Query: 272 KFSSVVQEIRHASLQTEAF---VKQQMPGGFGPVFALILK-----SED------QCRKVV 317
             S  V  + +  L + +     K+ +  GFG V ++ +K     SE+         +VV
Sbjct: 313 --SPYVSWVSYPGLPSHSHHENAKKYLQNGFGGVLSIGVKDLPNASEETDPFAASGAQVV 370

Query: 318 KNVSFFQHATSLGGVESLI------EWRAMSDPTAL-----KTLIRVSVGLENIEDLIAD 366
            ++    +  ++G  ++L+        + +SD   L     K LIR+SVG E I+D+I D
Sbjct: 371 DSLKLASNLANVGDSKTLVIAPYFTTHQQLSDEEKLASGVTKDLIRISVGTEFIDDIIGD 430

Query: 367 LAGSLEKINKGE 378
              + EK+ +G+
Sbjct: 431 FEQAFEKVFQGQ 442

>TDEL0E05620 Chr5 complement(1043585..1044925) [1341 bp, 446 aa]
           {ON} Anc_4.53 YLR303W
          Length = 446

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 106/441 (24%), Positives = 172/441 (39%), Gaps = 96/441 (21%)

Query: 12  DDYLNRVSDVAPPINVSTTFRY-DNEHLVPATRETGMHTSDSPMIYSRLGHPNADRLEAV 70
           DD  NR   V  PI  +T++ + D++H    ++  G+ T     IYSR+ +P  D LE  
Sbjct: 18  DDNANRPRAV--PIYATTSYVFNDSKH---GSQLFGLETPG--YIYSRIMNPTVDVLEKR 70

Query: 71  LSQLLDSHAVVYASGLAAYHAI----LVHFKPKRLFLPHCYHGCKEVARIISRLNGMEIL 126
           ++ L    A +  +   A  A+    L H     +     Y G     ++  +  G+E  
Sbjct: 71  IAALEGGAAALAVASGQASQALAISGLAHTGDNIVATSFLYGGTYNQFKVAFKRLGIETR 130

Query: 127 SLE-----DIEAKCQE-GDLVHIEDPINPFGETVDLAQYASRIHSAGGLMMLDSTLGP-- 178
            +E     D E    E    V++E   NP     D  +     H  G  +++D+T G   
Sbjct: 131 FVEGDNPEDFEKVFDERTKAVYLETIGNPKYNVPDFDRIVEVAHKHGIPVVVDNTFGAGG 190

Query: 179 ---PPLRNAWDYGADIIMHSGTKYFGGHSDLL------SGIVCVSD------------EA 217
               P++    YGADI+ HS TK+ GGH   +      SG     D            E 
Sbjct: 191 FFAQPIK----YGADIVTHSATKWIGGHGTTIGGIIVDSGKFPWKDYPEKFPQFSIPSEG 246

Query: 218 IAEQLKNDR----TYLGTI---------PAXXXXXXXXXXXXTMDIRVR--RQSQNCTEL 262
               + ND      ++G +         PA               + +R  R  +N  +L
Sbjct: 247 YHGMIFNDAFGPLAFIGHVRTELLRDLGPALNPFAAFQLLQGVETLSLRAERHGENALKL 306

Query: 263 VSYLANNSEKFSSVVQEIRHASLQTEAF---VKQQMPGGFGPVFALILK-----SEDQCR 314
            ++L       S  V  + +  L + +     K+ +  GFG V +   K     +E + +
Sbjct: 307 AAWLEQ-----SPYVSWVSYPGLPSHSHHENAKKYLTNGFGGVLSFGAKDLPNNAEAEAK 361

Query: 315 --------KVVKNVSFFQHATSLGGVESLI-------------EWRAMSDPTALKTLIRV 353
                   KVV N+    +  ++G  ++L+             E +A S  T  K LIRV
Sbjct: 362 NPFAAAGAKVVDNLKLASNLANVGDCKTLVIAPYFTTHLQLTHEEKASSGVT--KDLIRV 419

Query: 354 SVGLENIEDLIADLAGSLEKI 374
           SVG E I+D+I D   S E++
Sbjct: 420 SVGTEFIDDIINDFQQSFEQV 440

>KLTH0G00418g Chr7 complement(23130..24836) [1707 bp, 568 aa] {ON}
           similar to uniprot|Q12198 Saccharomyces cerevisiae
           YLL058W Hypothetical ORF
          Length = 568

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 55/254 (21%), Positives = 108/254 (42%), Gaps = 23/254 (9%)

Query: 141 VHIEDPINPFGETVDLAQYASRIHSAGGLMMLDSTLGPPPLRNAWDYGADIIMHSGTKYF 200
           V +E P NP     DL Q  +  +  G  +++D T+G   + +   Y ADI+  S TK F
Sbjct: 320 VFLETPSNPMLNMPDLKQLRNMANEYGFFIVVDDTIGGLNV-DVLPY-ADIVCTSLTKLF 377

Query: 201 GGHSDLLSGIVCVSDEAIAEQLKNDRTYLGTIPAXXXXXXXXXXXXT---MDIRVRRQSQ 257
            G S+++ G + ++ ++            G                     + R  R ++
Sbjct: 378 SGSSNVMGGSIILNPKSALYSCALQYFRGGEFEELLWLEDAIILEANSRDFEERTTRTNE 437

Query: 258 NCTELVSYLANNSEKFSSVVQEIRHASLQTEAFVK-----QQMPGGFGPVFALILKSEDQ 312
           N  +L+  +    E    + +++ + ++ ++   K     +   GG+G +F+L   +E+ 
Sbjct: 438 NTMKLIQEVLLPEE--GKIFKKVYYPTVSSKETFKNFESVRTNGGGYGSLFSLSFFNEED 495

Query: 313 CRKVVKNVSFFQHATSLGGVESL----------IEWRAMSDPTALKTLIRVSVGLENIED 362
            +K   +++ F+   S G   +L           E   +S   A  +L+RVSVGLEN + 
Sbjct: 496 AKKFYNSLTVFK-GPSNGTNFTLACPYVHLAHHFELEEVSTFGAHSSLVRVSVGLENTQW 554

Query: 363 LIADLAGSLEKINK 376
           L+   +  +  + K
Sbjct: 555 LLNAFSSVINLLRK 568

>CAGL0M00550g Chr13 (66078..67787) [1710 bp, 569 aa] {ON} similar to
           uniprot|P47164 Saccharomyces cerevisiae YJR130c STR2
          Length = 569

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 56/242 (23%), Positives = 106/242 (43%), Gaps = 23/242 (9%)

Query: 141 VHIEDPINPFGETVDLAQYASRIHSAGGLMMLDSTLGPPPLRNAWDYGADIIMHSGTKYF 200
           V +E P NP  +  D+++        G  +++D T+      +   Y  DI+  S TK F
Sbjct: 318 VFLEAPSNPLLKMCDMSKLKQLSQQYGFFIVVDETVSGFVNIDILSY-CDIVCSSLTKIF 376

Query: 201 GGHSDLLSGIVCVSDEA----IAEQLKNDRTYLGTIPAXXXXXXXXXXXXTMDIRVRRQS 256
            G S++++G + V+  +     A    ND      +                  R ++ +
Sbjct: 377 SGDSNVIAGSLVVNPASKLHDFAIDFLNDPKRNEDLLWCEDSVYLERNSRDFIDRAQKIN 436

Query: 257 QNCTELVSYLANNSEKFSSVVQEIRHASLQT-EAFVK----QQMPGGFGPVFALILKSED 311
           +   +LVS +    E    ++++I + SL + E+ +     +   GG+G + +++ K ED
Sbjct: 437 KIAEDLVSTVLLEEE--GQLLEKIYYPSLTSPESKLNYDSVKCNNGGYGGLISIVFKRED 494

Query: 312 QCRKVVKNVSFFQHATSLGGVESLI----------EWRAMSDPTALKTLIRVSVGLENIE 361
           Q +    N+S      SLG   +L+          E   ++    +K L+R+SVGLE++E
Sbjct: 495 QAKVFYDNLSL-NKGPSLGTNFTLVCPYAILAHYAELDEVAKYGVVKNLVRISVGLESLE 553

Query: 362 DL 363
            L
Sbjct: 554 TL 555

>TDEL0E05710 Chr5 complement(1062353..1064023) [1671 bp, 556 aa]
           {ON} 
          Length = 556

 Score = 43.1 bits (100), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 61/253 (24%), Positives = 109/253 (43%), Gaps = 28/253 (11%)

Query: 143 IEDPINPFGETVDLAQYASRIHSAGGLMMLDSTLGPPPLRNAWDYGADIIMHSGTKYFGG 202
           +E P NP     DL       +  G  +++D T+G   + +   Y ADI+  S TK F G
Sbjct: 304 VETPSNPLLNMPDLTGLRKLANEYGFFIVIDDTIGGLNV-DILPY-ADIVCTSLTKLFNG 361

Query: 203 HSDLLSGIVCVSDEAIAEQLKNDRTYLGT-----IPAXXXXXXXXXXXXTMDIRVRRQSQ 257
            S+++ G + ++ ++      + R ++ +     +                + R  R ++
Sbjct: 362 SSNVMGGSLILNPKS--SLYSSARAFVESDGFEDLLWCEDAKVLEINSRDFEDRTVRANK 419

Query: 258 NCTELVSYLANNSEKFSSVVQEIRHASLQTEAFVK-----QQMPGGFGPVFALILKSEDQ 312
           N   L+S L   +E    V ++I + ++ +E   K     +   GG+G +F++   SE+ 
Sbjct: 420 NTERLLSELILVNE--GKVFKKIYYPTVSSEETFKNYEAVRNKLGGYGCMFSMAFYSEED 477

Query: 313 CR------KVVK---NVSFFQHATSLGGVESLIEWRAMSDPTALKTLIRVSVGLENIE-- 361
            +      KV K   N + F  A     +    E   +S   A   LIRVSVGLE+ +  
Sbjct: 478 SKAFYDSLKVFKGPSNGTNFTLACPYVQLAHRFELEEVSKFGADPNLIRVSVGLEDSQWL 537

Query: 362 -DLIADLAGSLEK 373
            D+ +D    LE+
Sbjct: 538 LDVFSDAINMLER 550

>KLTH0D17930g Chr4 (1486259..1488217) [1959 bp, 652 aa] {ON} similar
           to uniprot|P47164 Saccharomyces cerevisiae YJR130C STR2
           Cystathionine gamma-synthase converts cysteine into
           cystathionine
          Length = 652

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 67/278 (24%), Positives = 115/278 (41%), Gaps = 37/278 (13%)

Query: 116 IISRLNGMEILSLEDIEAKCQEGDLVH---------IEDPINPFGETVDLAQYASRIHSA 166
           I+ + N    L   D ++  Q  D++H         +E P NP  +  DL +     ++ 
Sbjct: 363 ILRKFNHTHFLGDGDQKSMDQLKDILHSGEQILAVFMEAPSNPLLKMGDLVELRELANAY 422

Query: 167 GGLMMLDSTLGPPPLRNAWDYGADIIMHSGTKYFGGHSDLLSGIVCVSDEA----IAEQL 222
           G  +++D T G     +   + ADI+  S TK F G S++++G V ++  +     A+Q 
Sbjct: 423 GFYIVVDETAGGFVNIDVLPH-ADIVCSSLTKIFSGDSNVMAGSVVLNPRSPLYPFAQQF 481

Query: 223 KNDRTY--LGTIPAXXXXXXXXXXXXTMDIRVRRQSQNCTELVSYLANNSEKFSSVVQEI 280
            +  ++  L                 T  + V + +Q   E V  L    + F    ++I
Sbjct: 482 FSSDSFEDLLWCEDAIYLERNSRDFATRTLTVNKNTQRLLEDV-LLPQEGKLF----KKI 536

Query: 281 RHASLQTEAFVKQQ-----MPGGFGPVFALILKSEDQCRKVVKNVSFFQHATSLGGVESL 335
              SL +E   +         GG+G +F+L    E+Q R V  +V       SLG   +L
Sbjct: 537 FFPSLTSEETKRNYDVVLCPQGGYGGLFSLTFYREEQAR-VFFDVLELCKGPSLGTNFTL 595

Query: 336 ----------IEWRAMSDPTALKTLIRVSVGLENIEDL 363
                      E   ++     ++L+RVSVGLE+ E L
Sbjct: 596 ACPYAILAHYAELEEVAKYGVERSLVRVSVGLESAESL 633

>Smik_10.423 Chr10 complement(654265..656184) [1920 bp, 639 aa] {ON}
           YJR130C (REAL)
          Length = 639

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 57/257 (22%), Positives = 102/257 (39%), Gaps = 32/257 (12%)

Query: 141 VHIEDPINPFGETVDLAQYASRIHSAGGLMMLDSTLGPPPLRNAWDYGADIIMHSGTKYF 200
           V IE P NP  +  DL +           +++D T+G     +   Y ADI+  S TK F
Sbjct: 387 VFIEAPSNPLLKMGDLQELKRLSDLYSFYIVVDETVGGFVNIDVLPY-ADIVCSSLTKIF 445

Query: 201 GGHSDLLSGIVCVSDEAIAEQLKNDRTYLGTIPAXXXXXXXXXXXXTMDIRVRRQSQNCT 260
            G S++++G + ++ +    +    R ++ T                  + + R S++  
Sbjct: 446 SGDSNVIAGSLVLNPKGKIYEFA--RKFMKTEDGYEDCLWCEDA-----LCLERNSRDFV 498

Query: 261 ELVSYLANNSE---------KFSSVVQEIRHASLQTEAF------VKQQMPGGFGPVFAL 305
           E    +  N+          +   + ++I + SL +E        V     GG+G +F+L
Sbjct: 499 ERTIKVNTNTNILLTKVLLPQVGKLFKKIYYPSLTSEETKRNYDSVISTKDGGYGGLFSL 558

Query: 306 ILKSEDQCRKVVKNVSF---------FQHATSLGGVESLIEWRAMSDPTALKTLIRVSVG 356
              S ++ +K   N+           F  A     +    E   ++     K L+RVSVG
Sbjct: 559 TFFSIEEAKKFFNNLELCKGPSLGTNFTLACPYAIIAHYQELDEIAQYGVEKNLVRVSVG 618

Query: 357 LENIEDLIADLAGSLEK 373
           LEN + L      ++EK
Sbjct: 619 LENSDVLCKVFQRAIEK 635

>AER164C Chr5 complement(944867..946804) [1938 bp, 645 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR130C
           (STR2) and YML082W
          Length = 645

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 62/295 (21%), Positives = 118/295 (40%), Gaps = 50/295 (16%)

Query: 116 IISRLNGMEILSLEDIEAKCQEGDLVH---------IEDPINPFGETVDLAQYASRIHSA 166
           I+   N    L   D +A  Q  D++H         IE P NP  +  DL          
Sbjct: 357 ILRVFNHTHFLGSGDHKAMAQLEDILHSGEPILAVFIETPSNPLLKMGDLQALRRLADIY 416

Query: 167 GGLMMLDSTLGPPPLRNAWDYGADIIMHSGTKYFGGHSDLLSGIVCVSDEA----IAEQL 222
           G  +++D TLG     +   + AD++  S TK F G S++++G + V+  +     A+  
Sbjct: 417 GFYLVVDDTLGGFVNIDVLPH-ADLVCSSLTKIFSGDSNVMAGSLVVNPASRLYDFAQGF 475

Query: 223 KNDRTYLGTIPAXXXXXXXXXXXXTMDIRVRRQSQNCTELVSYLANNSEKF--------- 273
            ++ +Y   +                 I + R S++C      +  N+E           
Sbjct: 476 FHNGSYEDLLWCEDA------------IYLERNSRDCASRSLRVNKNTELLLEKVLLPHQ 523

Query: 274 SSVVQEIRHASLQTEAF------VKQQMPGGFGPVFALILKSEDQCRKVVKNVSF----- 322
            S+ ++I + +L +E        V+ +  GG+G +F+L    E++ +     +       
Sbjct: 524 GSLFKKIFYPTLTSEETKRNYDAVRCKPDGGYGGLFSLTFHEENRAKVFFDTLELCKGPS 583

Query: 323 ----FQHATSLGGVESLIEWRAMSDPTALKTLIRVSVGLENIEDLIADLAGSLEK 373
               F  A     +    E   +++    ++L+RVSVGLE+ + L      +++K
Sbjct: 584 LGTNFTLACPYTVLAHYAEMDVVAEYGLERSLVRVSVGLEDFDHLRKVFQRAIDK 638

>Skud_10.353 Chr10 complement(623771..625693) [1923 bp, 640 aa] {ON}
           YJR130C (REAL)
          Length = 640

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 58/262 (22%), Positives = 104/262 (39%), Gaps = 42/262 (16%)

Query: 141 VHIEDPINPFGETVDLAQYASRIHSAGGLMMLDSTLGPPPLRNAWDYGADIIMHSGTKYF 200
           V IE P NP  +  DL +           +++D T+G     +   Y ADII  S TK F
Sbjct: 388 VFIEAPSNPLLKMGDLQELKRLSDLYSFYIVVDETVGGFVNIDVLPY-ADIICSSLTKIF 446

Query: 201 GGHSDLLSGIVCVSD-----EAIAEQLKNDRTYLGTIPAXXXXXXXXXXXXTMDIRVRRQ 255
            G S++++G + ++      E   + +K++  Y   +                 + + R 
Sbjct: 447 SGDSNVIAGSLVLNPRGKIYEFAKKFMKSENGYEDCLWCEDA------------LCLERN 494

Query: 256 SQNCTELVSYLANNSE---------KFSSVVQEIRHASLQTEAF------VKQQMPGGFG 300
           S++  E    +  N++         +   + ++I + SL +E        V     GG+G
Sbjct: 495 SRDFVERTIKVNTNTDILLTKVLLPQVGKLFKKIYYPSLTSEETKRNYDSVMATRDGGYG 554

Query: 301 PVFALILKSEDQCRKVVKNVSF---------FQHATSLGGVESLIEWRAMSDPTALKTLI 351
            +F+L     ++ +K   N+           F  A     +    E   ++     K L+
Sbjct: 555 GLFSLTFFDIEKAKKFFNNLELCKGPSLGTNFTLACPYAIIAHYQELDEIAQYGVEKNLV 614

Query: 352 RVSVGLENIEDLIADLAGSLEK 373
           RVSVGLEN + L      ++EK
Sbjct: 615 RVSVGLENSDVLCRVFQRAIEK 636

>Kwal_14.791 s14 complement(49074..50789) [1716 bp, 571 aa] {ON}
           YLL058W - Hypothetical ORF [contig 245] FULL
          Length = 571

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 55/250 (22%), Positives = 107/250 (42%), Gaps = 23/250 (9%)

Query: 141 VHIEDPINPFGETVDLAQYASRIHSAGGLMMLDSTLGPPPLRNAWDYGADIIMHSGTKYF 200
           V +E P NP     DL +        G  +++D T+G   + +   Y ADI+  S TK F
Sbjct: 317 VFVETPSNPLLNVPDLDKLRKLADEYGFFIVIDDTIGGLNV-DILPY-ADIVCTSLTKLF 374

Query: 201 GGHSDLLSGIVCVSDEA----IAEQLKNDRTYLGTIPAXXXXXXXXXXXXTMDIRVRRQS 256
            G S+++ G V ++ ++     A++      +   + +              + R  R +
Sbjct: 375 SGTSNVMGGSVLLNPDSSLYPYAQEYFQSCEFEDLLWSEDAVVLEANSRD-FEARTLRTN 433

Query: 257 QNCTELVSYLANNSEKFSSVVQEIRHASLQTEAFVK-----QQMPGGFGPVFALILKSED 311
           +N   L++ +    E    +++++ + ++ +E   K     +   GG+G +F++   +E+
Sbjct: 434 ENTVNLLTKVLLPEE--GKLIKKVYYPTVSSEETFKNYERVRNRQGGYGCLFSIAFHNEE 491

Query: 312 QCR------KVVK---NVSFFQHATSLGGVESLIEWRAMSDPTALKTLIRVSVGLENIED 362
             +      KV K   N + F  A     +    E   +++  A   L+RVSVGLE  + 
Sbjct: 492 DAKCFYDSLKVFKGPSNGTNFTLACPYVHLAHHFELVEVAELGADPNLVRVSVGLEEFQG 551

Query: 363 LIADLAGSLE 372
           L      +LE
Sbjct: 552 LREVFLNALE 561

>Kpol_1028.80 s1028 (179685..181754) [2070 bp, 689 aa] {ON}
           (179685..181754) [2070 nt, 690 aa]
          Length = 689

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 44/86 (51%), Gaps = 4/86 (4%)

Query: 127 SLEDIEAKCQEGD---LVHIEDPINPFGETVDLAQYASRIHSAGGLMMLDSTLGPPPLRN 183
           SL+D+E     G+    V +E P NP  +  DLA      +  G  +++D T+G     +
Sbjct: 411 SLKDLECTLHSGEQILAVFVETPSNPLLKMPDLAHLRRLANLYGFYIIIDETMGGFVNID 470

Query: 184 AWDYGADIIMHSGTKYFGGHSDLLSG 209
              Y ADI+  S TK F G S++++G
Sbjct: 471 VLPY-ADIVCSSLTKIFSGSSNVIAG 495

>KNAG0M00330 Chr13 (48427..50322) [1896 bp, 631 aa] {ON} Anc_4.354
           YJR130C
          Length = 631

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 57/257 (22%), Positives = 111/257 (43%), Gaps = 22/257 (8%)

Query: 121 NGMEILS-LEDIEAKCQEGDLVHIEDPINPFGETVDLAQYASRIHSAGGLMMLDSTLGPP 179
           NG + LS L++I    ++   V  E P N   +  +L +        G  +++D ++G  
Sbjct: 373 NGTDGLSKLKEILHSGEQILAVITETPTNGLLDVTNLVELKQLSELFGFYIVVDESVGGF 432

Query: 180 PLRNAWDYGADIIMHSGTKYFGGHSDLLSGIVCVSDEAIAEQLKNDRTYLGTIPAXXXXX 239
              +A  Y  DI+  S  K F G  D++SG + V+ ++   +L +   +  T  A     
Sbjct: 433 VNVDALVY-CDIVCSSLVKMFSGTEDVVSGSMVVNPQS---KLYD---FAQTFMASEHEP 485

Query: 240 XXXXXXXTMDIRVRRQSQNCTELVSYLANNSEKF---------SSVVQEIRHASLQTEA- 289
                   + I++ + S++       +   +++           ++  E+ H S+   A 
Sbjct: 486 SSVLWCEDI-IQLEQNSRDFVSKSKRINTATKRLLRDVILPQRGTIFTEVHHPSITDRAQ 544

Query: 290 --FVKQQMPGGFGPVFALILKSEDQCRKVVKNVSFFQHATSLGGVESLIEWRAMSDPTAL 347
              +K +  GG+G VFA+   + ++ R     ++  +     G       W+ ++    +
Sbjct: 545 YNLIKGKQDGGYGGVFAVQFSTLERARSFYDRLNVCKGPGLGGDYTVACPWQLLNQYDEV 604

Query: 348 -KTLIRVSVGLENIEDL 363
            KTLIRVSVGLE+ + L
Sbjct: 605 DKTLIRVSVGLEDYDVL 621

>TDEL0D00610 Chr4 (109396..111354) [1959 bp, 652 aa] {ON} Anc_4.354
           YJR130C
          Length = 652

 Score = 39.3 bits (90), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 60/269 (22%), Positives = 111/269 (41%), Gaps = 45/269 (16%)

Query: 127 SLEDIEAKCQEGD---LVHIEDPINPFGETVDLAQYASRIHSAGGLMMLDSTLGPPPLRN 183
           ++ED++   Q G+    V +E P NP  +  DL +     +  G  +++D T G     +
Sbjct: 380 AMEDLKKILQSGEQILAVFMEAPSNPLLKMGDLLELRQLANLYGFFIVVDETAGGFVNID 439

Query: 184 AWDYGADIIMHSGTKYFGGHSDLLSGIVCVSDEA----IAEQ-LKNDRTYLGTIPAXXXX 238
              + AD++  S TK F G S+L++G + ++ +      A+Q L   + Y  T+      
Sbjct: 440 VLPH-ADVVCSSLTKIFSGDSNLIAGSLVLNPQGKLYDFAQQWLLAQKEYEDTLWCEDA- 497

Query: 239 XXXXXXXXTMDIRVRRQSQNCTELVSYLANNSEKF---------SSVVQEIRHASLQTEA 289
                      + + R S++  +    + +N+E             + ++I + SL +  
Sbjct: 498 -----------LALERNSRDFVQRTIQVNHNTEYLLNKVLIPLEGKLFKKIYYPSLTSPE 546

Query: 290 F------VKQQMPGGFGPVFALILKSEDQCRKVVKNVSF---------FQHATSLGGVES 334
                  VK  +  G+G +F+L   +  Q R    ++           F  A     +  
Sbjct: 547 TKRHYDAVKCSIDAGYGGLFSLTFFNLAQARVFFDSLQLCKGPSLGTNFTLACPYAILAH 606

Query: 335 LIEWRAMSDPTALKTLIRVSVGLENIEDL 363
             E   ++     K+L+RVSVGLEN E L
Sbjct: 607 YQELDEVARYGVEKSLVRVSVGLENRESL 635

>Suva_13.68 Chr13 (103103..105169) [2067 bp, 688 aa] {ON} YML082W
           (REAL)
          Length = 688

 Score = 38.5 bits (88), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 53/242 (21%), Positives = 103/242 (42%), Gaps = 28/242 (11%)

Query: 141 VHIEDPINPFGETVDLAQYASRIHSAGGLMMLDSTLGPPPLRNAWDYGADIIMHSGTKYF 200
           V IE P NP  +  +L +        G  +++D T+G     +   + AD++  S TK F
Sbjct: 434 VFIETPSNPLLKMGNLVELKRLSELFGFFIIIDETVGGIVNIDGLPF-ADLVCSSLTKTF 492

Query: 201 GGHSDLLSGIVCVSDEA-IAE------QLKNDRTYLGTIPAXXXXXXXXXXXXTMDIRVR 253
            G S+++ G + ++ ++ + E      QL+++   L                    IR+ 
Sbjct: 493 SGDSNVIGGSMVLNPQSRVYEFATRFMQLEDEYEDLLWCEDAIYLERNSRDFIARTIRI- 551

Query: 254 RQSQNCTELVSYLANNSEKFSSVVQEIRHASLQTEA------FVKQQMPGGFGPVFALIL 307
             + N   L+  +       +++ ++I + +L ++        V+ +  GG+G +F+L  
Sbjct: 552 --NYNTEYLLDKIIKPHVGENALFKKIYYPNLTSKETLTNYDMVRCKKEGGYGGLFSLTF 609

Query: 308 KSEDQCRKVVKNVSFFQHATSLGGVESLI---------EWRAMSDPTAL-KTLIRVSVGL 357
             ED       N+       SLG   +L+            AM++   + + L+R+SVGL
Sbjct: 610 HDEDHAEAFYDNLQ-LNKGPSLGTNFTLVFPYTLMTYYHEMAMAEKFGVERNLLRISVGL 668

Query: 358 EN 359
           EN
Sbjct: 669 EN 670

>Kwal_26.7197 s26 (258929..259192) [264 bp, 87 aa] {OFF} YAL012W
           (CYS3) - cystathionine gamma-lyase [contig 47] FULL
          Length = 87

 Score = 35.4 bits (80), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 35/66 (53%), Gaps = 11/66 (16%)

Query: 322 FFQHATSLGGVESLIEWRAMSDPTAL-----------KTLIRVSVGLENIEDLIADLAGS 370
            F  A SLGG+ESL+E  A+     +             LIR+SVG+E+ +DL+ D+  +
Sbjct: 22  LFTLAESLGGIESLLEVPAVMTHGGIPKDQREASGVYDDLIRLSVGIEDTDDLLDDIKNA 81

Query: 371 LEKINK 376
           L   +K
Sbjct: 82  LTLASK 87

>YLL058W Chr12 (23569..25296) [1728 bp, 575 aa] {ON} Putative
           protein of unknown function with similarity to Str2p,
           which is a cystathionine gamma-synthase important in
           sulfur metabolism; YLL058W is not an essential gene
          Length = 575

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 65/274 (23%), Positives = 118/274 (43%), Gaps = 26/274 (9%)

Query: 121 NGMEILSLED-IEAKCQEGDLVHIEDPINPFGETVDLAQYASRIHSAGGLMMLDSTLGPP 179
           N  +++ L+  +E   Q    V +E P NP     DL +  S     G  +++D T+G  
Sbjct: 300 NSRDVVELQKFLETSKQRILAVFVETPSNPLLNMPDLKKLRSLADQYGFFIVIDDTIGGL 359

Query: 180 PLRNAWDYGADIIMHSGTKYFGGHSDLLSGIVCVSDEA----IAEQLKNDRTYLGTIPAX 235
            + +   Y ADI+  S TK F G S+++ G V ++ ++     A +      +   +   
Sbjct: 360 NV-DILPY-ADIVSTSLTKLFNGASNVMGGSVVLNPKSSLYPYAREYFRSANFEDLLWCE 417

Query: 236 XXXXXXXXXXXTMDIRVRRQSQNCTELVSYLANNSEKFSSVVQEIRHASLQT-EAF---- 290
                        D R  R + N   L++ L    E    + ++I + ++ + E F    
Sbjct: 418 DAIVLERNSRDFED-RTLRANANTGILLNDLLLPEE--GKICKKIYYPTVTSKETFENYE 474

Query: 291 -VKQQMPGGFGPVFALILKSEDQCR------KVVK---NVSFFQHATSLGGVESLIEWRA 340
            V+ +  GG+G +F++   +E   +      KV K   N + F  A     +    E   
Sbjct: 475 SVRNER-GGYGCLFSVAFFNEGDAKAFYDSLKVFKGPSNGTNFTLACPYVHLAHHSELEE 533

Query: 341 MSDPTALKTLIRVSVGLENIEDLIADLAGSLEKI 374
           +S   A   +IRVSVGLE+I+ L+   + +L+ +
Sbjct: 534 VSKFGADPNIIRVSVGLEDIQWLLKVFSSALDVV 567

>Kwal_26.7194 s26 (258018..258476) [459 bp, 152 aa] {ON} YAL012W
           (CYS3) - cystathionine gamma-lyase [contig 47] FULL
          Length = 152

 Score = 34.7 bits (78), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 33/134 (24%), Positives = 62/134 (46%), Gaps = 22/134 (16%)

Query: 5   ATNAIHSDDYLNRVSDVAPPINVSTTFRYDNEHLVPATRETGMHTSDSPM---IYSRLGH 61
           AT A+H+  + +    V  PI++STTF+               H+   P+    YSR  +
Sbjct: 9   ATKAVHAGTHTDVHGSVIEPISLSTTFK--------------QHSPAQPVGEYEYSRSQN 54

Query: 62  PNADRLEAVLSQLLDS-HAVVYASGLAAYHAILVHFKPK---RLFLPHCYHGCKEVARII 117
           PN   LE  ++ L ++ HA+ ++SG +A  A+++   P+    + +   Y G       +
Sbjct: 55  PNRKNLEDAVAALENAKHALAFSSG-SATTAVVLQSLPQGSHAVSIGDVYGGTHRYFSKV 113

Query: 118 SRLNGMEILSLEDI 131
           +  +G+E     D+
Sbjct: 114 AAAHGVETTFTNDL 127

>TPHA0L00330 Chr12 (43495..45648) [2154 bp, 717 aa] {ON} Anc_4.354
           YJR130C
          Length = 717

 Score = 35.4 bits (80), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 45/86 (52%), Gaps = 4/86 (4%)

Query: 127 SLEDIEAKCQEGD---LVHIEDPINPFGETVDLAQYASRIHSAGGLMMLDSTLGPPPLRN 183
           S++++E     G+    V IE P NP  +  DL    +  +  G  +++D TLG     +
Sbjct: 439 SMKELEQTLHSGEQILAVFIEIPSNPLLKVADLKYLRNLANIYGFYIVIDETLGGFVNID 498

Query: 184 AWDYGADIIMHSGTKYFGGHSDLLSG 209
              + ADI+  S ++ FGG S++++G
Sbjct: 499 VLPF-ADIVCSSLSQSFGGDSNVMAG 523

>NDAI0D03260 Chr4 complement(774579..776669) [2091 bp, 696 aa] {ON}
           Anc_4.354
          Length = 696

 Score = 34.7 bits (78), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 43/93 (46%), Gaps = 11/93 (11%)

Query: 291 VKQQMPGGFGPVFALILKSEDQCRKVVKNVSFFQHATSLGGVESLI----------EWRA 340
           +K +  GG+G VF++     ++ +    N+       SLG   + +          E   
Sbjct: 601 IKCKTYGGYGGVFSITFHDIEKAKLFFNNLKL-SKTISLGSNYTTVCPYTVLKHGDELEK 659

Query: 341 MSDPTALKTLIRVSVGLENIEDLIADLAGSLEK 373
           +S+    +TLIRV VGLEN   L  + + ++EK
Sbjct: 660 VSEYGLDETLIRVCVGLENKTSLKENFSRAIEK 692

>ZYRO0B08338g Chr2 complement(649933..651855) [1923 bp, 640 aa] {ON}
           similar to uniprot|P47164 Saccharomyces cerevisiae
           YJR130C STR2 Cystathionine gamma-synthase converts
           cysteine into cystathionine
          Length = 640

 Score = 34.7 bits (78), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 55/275 (20%), Positives = 109/275 (39%), Gaps = 34/275 (12%)

Query: 127 SLEDIEAKCQEGDLV---HIEDPINPFGETVDLAQYASRIHSAGGLMMLDSTLGPPPLRN 183
           ++E+++     G+ +    +E P NP  +  DL +     +S G  +++D T G     +
Sbjct: 373 AMEELKKILHSGEQILALFMEAPSNPLLKMGDLIELRELANSFGFYIVVDDTAGGFVNID 432

Query: 184 AWDYGADIIMHSGTKYFGGHSDLLSGIVCVSD--------EAIAEQLKNDRTYLGTIPAX 235
              + ADI+  S TK F G S++++G + ++         E   EQ   D  +       
Sbjct: 433 VLPF-ADIVCSSLTKIFSGDSNVIAGSIVLNPQSKLYSFAETFMEQQYEDCLWC------ 485

Query: 236 XXXXXXXXXXXTMDIRVRRQSQNCTELVSYLANNSEKFSSVVQEIRHASLQTEAFVK--- 292
                          R  + +QN   L++ +    E    + ++I + SL ++   K   
Sbjct: 486 EDALYLERNSRDFVARTLKVNQNTERLLNKVLLPQE--GKLFKKIYYPSLTSKETKKNYD 543

Query: 293 --QQMPGGFGPVFALILKSEDQCRKVVKNVSF---------FQHATSLGGVESLIEWRAM 341
             +   GG+G +F+L   + D  +     +           F  A     +    E   +
Sbjct: 544 AVRGHQGGYGGLFSLTFYNLDSAKTFFNTLQLCKGPSLGTNFTLACPYAIIAHYQELDRV 603

Query: 342 SDPTALKTLIRVSVGLENIEDLIADLAGSLEKINK 376
           +       L+RVSVGLE  ++L      ++++ +K
Sbjct: 604 AKYGVESNLVRVSVGLEREDELCKVFQTAIDEASK 638

>KLLA0B04378g Chr2 (390701..392767) [2067 bp, 688 aa] {ON} similar
           to uniprot|P47164 Saccharomyces cerevisiae YJR130C STR2
           Cystathionine gamma-synthase converts cysteine into
           cystathionine
          Length = 688

 Score = 34.7 bits (78), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 27/108 (25%), Positives = 50/108 (46%), Gaps = 10/108 (9%)

Query: 116 IISRLNGMEILSLEDIEAKCQEGDLVH---------IEDPINPFGETVDLAQYASRIHSA 166
           I+ + N    L   D +A  +  +++H         IE P NP  +  DL +        
Sbjct: 397 ILRKFNHTHFLGQGDSQAMNELKEILHGGEQILAVFIESPSNPLLKMGDLVELKRLSDLY 456

Query: 167 GGLMMLDSTLGPPPLRNAWDYGADIIMHSGTKYFGGHSDLLSGIVCVS 214
           G  +++D T+G     +   Y AD++  S TK F G S++++G + ++
Sbjct: 457 GFYIVIDETVGGFLNIDVLPY-ADVVCSSLTKIFSGDSNVMAGSIVLN 503

>Smik_13.55 Chr13 (99421..101520) [2100 bp, 699 aa] {ON} YJR130C
           (REAL)
          Length = 699

 Score = 34.3 bits (77), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 54/244 (22%), Positives = 102/244 (41%), Gaps = 32/244 (13%)

Query: 141 VHIEDPINPFGETVDLAQYASRIHSAGGLMMLDSTLGPPPLRNAWDYGADIIMHSGTKYF 200
           V IE P NP  +  +L +        G  +++D T+G     +   + ADI+  S TK F
Sbjct: 445 VFIETPSNPLLKMGNLLELKRLSELFGFFIIIDETVGGIVNIDGLPF-ADIVCGSLTKTF 503

Query: 201 GGHSDLLSGIVCVSDEA-IAE------QLKNDRTYLGTIPAXXXXXXXXXXXXTMDIRVR 253
            G S+++ G + ++ ++ + E      QL+++   L                    IR+ 
Sbjct: 504 SGDSNVIGGSMVLNPQSRVYEFATRFMQLEDEYEDLLWCEDAIYLERNSRDFIARTIRIN 563

Query: 254 RQSQNCTE--LVSYLANNSEKFSSVVQEIRHASLQTEA------FVKQQMPGGFGPVFAL 305
             ++   +  L +++  N      + ++I + SL ++        V+ +  GG+G +F+L
Sbjct: 564 YSTEYLLDKILKAHVGEN-----GLFKKIYYPSLTSKETLINYDMVRCKKEGGYGGLFSL 618

Query: 306 ILKSEDQCRKVVKNVSFFQHATSLGGVESL-IEWRAMSDPTAL---------KTLIRVSV 355
               ED       N+       SLG   +L   +  M+    L         + L+R+SV
Sbjct: 619 TFHDEDHAAAFYNNLQ-LNKGPSLGTNFTLAFPYTLMTYYHELTMAEKFGVERNLLRISV 677

Query: 356 GLEN 359
           GLE+
Sbjct: 678 GLES 681

>Suva_10.8 Chr10 (9213..10931) [1719 bp, 572 aa] {ON} YLL058W (REAL)
          Length = 572

 Score = 33.9 bits (76), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 56/253 (22%), Positives = 105/253 (41%), Gaps = 25/253 (9%)

Query: 141 VHIEDPINPFGETVDLAQYASRIHSAGGLMMLDSTLGPPPLRNAWDYGADIIMHSGTKYF 200
           V +E P NP     DL +      + G  +++D T+G   + +   Y ADI+  S TK F
Sbjct: 318 VFVETPSNPLLNMPDLKELRRLADAYGFFIVVDDTIGGLNV-DVLPY-ADIVCTSLTKLF 375

Query: 201 GGHSDLLSGIVCVSDE-----AIAEQLKNDRTYLGTIPAXXXXXXXXXXXXTMDIRVRRQ 255
            G S+ + G + ++ +     +  E  K+       +                  R  R 
Sbjct: 376 NGSSNAMGGSIILNPKSSLYSSACEYFKSAE--FEDLLWCEDAVVLEANSRDFQDRTLRA 433

Query: 256 SQNCTELVSYLANNSEKFSSVVQEIRHASLQT-EAFVK----QQMPGGFGPVFALILKSE 310
           + N  +L++ +    E    + ++I + ++ + E F      +   GG+G +F++   +E
Sbjct: 434 NINTEKLLNEVLLPEE--GKICKKIYYPTVSSKETFNNYESVRNKHGGYGCLFSMAFYNE 491

Query: 311 DQCR------KVVK---NVSFFQHATSLGGVESLIEWRAMSDPTALKTLIRVSVGLENIE 361
              +      KV K   N + F  A     +    E   +S   A   LIRVSVGLE+ +
Sbjct: 492 GDAKTFYDTLKVFKGPSNGTNFTLACPYVHLAHHSELEEVSKFGADPNLIRVSVGLEDTQ 551

Query: 362 DLIADLAGSLEKI 374
            L+   + +++ +
Sbjct: 552 TLLDVFSSAIDVV 564

>Skud_12.10 Chr12 (10565..12280) [1716 bp, 571 aa] {ON} YLL058W
           (REAL)
          Length = 571

 Score = 33.5 bits (75), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 53/249 (21%), Positives = 98/249 (39%), Gaps = 17/249 (6%)

Query: 141 VHIEDPINPFGETVDLAQYASRIHSAGGLMMLDSTLGPPPLRNAWDYGADIIMHSGTKYF 200
           V +E P NP     +L +      + G  +++D T+G   + +   Y ADI+  S TK F
Sbjct: 317 VFVETPSNPLLNMPNLKELRRLADAYGFFIVIDDTIGGLNV-DILPY-ADIVCTSLTKLF 374

Query: 201 GGHSDLLSGIVCVSDEAIAEQLKNDRTYLGTIP-AXXXXXXXXXXXXTMDIRVRRQSQNC 259
            G S+++ G V ++ ++   Q   +    G                 + D   R    N 
Sbjct: 375 NGASNVMGGSVVLNPKSALYQRAREYFKSGEFEDLLWGEDAVVLERNSRDFEDRTLRANT 434

Query: 260 TELVSYLANNSEKFSSVVQEIRHASLQTEAFVK-----QQMPGGFGPVFALILKSEDQCR 314
                       +     ++I + ++ ++  +      +   GG+G +F++   SE    
Sbjct: 435 NTEKLLKELLLPEQGKTCKKIYYPTVNSKETINNYESVRNERGGYGCLFSVAFHSEGDAE 494

Query: 315 ------KVVK---NVSFFQHATSLGGVESLIEWRAMSDPTALKTLIRVSVGLENIEDLIA 365
                 KV K   N + F  A     +    E   +S   A  ++IRVSVGLE  + L+ 
Sbjct: 495 AFYDSLKVFKGPSNGTNFTLACPYVHLAHHSELEEVSKFGADSSIIRVSVGLEETQLLLD 554

Query: 366 DLAGSLEKI 374
             + +L+ +
Sbjct: 555 VFSSALDVV 563

>CAGL0H04169g Chr8 (394311..396407) [2097 bp, 698 aa] {ON} similar
           to uniprot|Q04533 Saccharomyces cerevisiae YML082w
          Length = 698

 Score = 33.5 bits (75), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 36/77 (46%), Gaps = 1/77 (1%)

Query: 298 GFGPVFALILKSEDQCRKVVKNVSFFQHATSLGGVESLIEWRAMSDPTALKTLIRVSVGL 357
           G+G + A+  + E+Q  K   ++      T + G   +    A  +    + L+RV VGL
Sbjct: 623 GYGGIIAIEFEKENQLAKFYDSIEHIYKGTPVLGGNDITTVAAFREHNG-RHLLRVCVGL 681

Query: 358 ENIEDLIADLAGSLEKI 374
           ENI+ L      +L KI
Sbjct: 682 ENIKILTKVFQSALSKI 698

>YML082W Chr13 (101862..103811) [1950 bp, 649 aa] {ON} Putative
           protein predicted to have carbon-sulfur lyase activity;
           transcriptionally regulated by Upc2p via an upstream
           sterol response element; green fluorescent protein
           (GFP)-fusion protein localizes to the nucleus and the
           cytoplasm; YML082W is not an essential gene
          Length = 649

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 53/244 (21%), Positives = 101/244 (41%), Gaps = 32/244 (13%)

Query: 141 VHIEDPINPFGETVDLAQYASRIHSAGGLMMLDSTLGPPPLRNAWDYGADIIMHSGTKYF 200
           V IE P NP  +  +L +        G  +++D T+G     +   + ADI+  S TK F
Sbjct: 395 VFIETPSNPLLKMGNLLELKRLSELFGFFIIIDETVGGIVNIDGLPF-ADIVCSSLTKTF 453

Query: 201 GGHSDLLSGIVCVSDEA-IAE------QLKNDRTYLGTIPAXXXXXXXXXXXXTMDIRVR 253
            G S+++ G + ++ ++ + E      QL+++   L                    IR+ 
Sbjct: 454 SGDSNVIGGSMVLNPQSRVYEFASRFMQLEDEYEDLLWCEDAIYLERNSRDFIARTIRIN 513

Query: 254 RQSQNCTE--LVSYLANNSEKFSSVVQEIRHASLQTEA------FVKQQMPGGFGPVFAL 305
             ++   +  L  ++  N      + ++I + +L ++        V+ +  GG+G +F+L
Sbjct: 514 YSTEYLLDKILKPHVGEN-----KLFKKIYYPNLTSKETLTNYDMVRCKKEGGYGGLFSL 568

Query: 306 ILKSEDQCRKVVKNVSFFQHATSLGGVESL-IEWRAMSDPTAL---------KTLIRVSV 355
               ED       N+       SLG   +L   +  M+    L         + L+R+SV
Sbjct: 569 TFHDEDHAAAFYDNLK-LNKGPSLGTNFTLAFPYTLMTYYHELDMAEKFGVERNLLRISV 627

Query: 356 GLEN 359
           GLE+
Sbjct: 628 GLES 631

>SAKL0G18172g Chr7 complement(1572652..1574673) [2022 bp, 673 aa]
           {ON} similar to uniprot|P47164 Saccharomyces cerevisiae
           YJR130C STR2 Cystathionine gamma-synthase converts
           cysteine into cystathionine
          Length = 673

 Score = 32.0 bits (71), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 58/285 (20%), Positives = 109/285 (38%), Gaps = 50/285 (17%)

Query: 116 IISRLNGMEILSLEDIEAKCQEGDLVH---------IEDPINPFGETVDLAQYASRIHSA 166
           I+S+ N    L + D  A     +++H         +E P NP  +  DL +        
Sbjct: 385 ILSKFNHTHFLGMGDSTAMDTLKEILHSGEQILAVFMETPSNPLLKMGDLLELKRLADIY 444

Query: 167 GGLMMLDSTLGPPPLRNAWDYGADIIMHSGTKYFGGHSDLLSGIVCVSDEA----IAEQL 222
           G  +++D T G     +   + AD++  S TK F G S++++G + ++  +     A++ 
Sbjct: 445 GFYVVVDETAGGFVNIDVLPH-ADLVCSSLTKIFSGDSNVMAGSLVLNPNSRLHEFAQEF 503

Query: 223 KNDRTYLGTIPAXXXXXXXXXXXXTMDIRVRRQSQNCTELVSYLANNSEKFSSVV----- 277
             +  Y   +                 I + R S++       + +N+E   + V     
Sbjct: 504 FRNGEYEDCLWCEDA------------IYLERNSRDFVTRTLKVNSNAEMLLNDVLIPEE 551

Query: 278 ----QEIRHASLQTEA------FVKQQMPGGFGPVFALILKSEDQCRKVVKNVSF----- 322
                +I +  L +E        V+ +  GG+G +F+L     +Q +K    +       
Sbjct: 552 GHLFSKIYYPRLTSEETKQNYDTVRCKPNGGYGGLFSLTFYEIEQAKKFFNALELCKGPS 611

Query: 323 ----FQHATSLGGVESLIEWRAMSDPTALKTLIRVSVGLENIEDL 363
               F  A     +    E   ++       L+RVSVGLE+ E L
Sbjct: 612 LGTNFTLACPYAVLAHYAELEKVAQYGVEANLVRVSVGLEDAEHL 656

>KLLA0B00825g Chr2 (64284..65468) [1185 bp, 394 aa] {ON} similar to
           uniprot|Q04062 Saccharomyces cerevisiae YDR427W
          Length = 394

 Score = 31.2 bits (69), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 24/37 (64%)

Query: 120 LNGMEILSLEDIEAKCQEGDLVHIEDPINPFGETVDL 156
           +NG  +L +E    K ++GDLV + D ++  G+T+D+
Sbjct: 121 VNGNLLLDIEIARVKLEKGDLVEVRDILDAIGKTLDV 157

>SAKL0H15378g Chr8 complement(1328983..1340172) [11190 bp, 3729 aa]
            {ON} similar to uniprot|Q750B4 Ashbya gossypii AGR043W
            AGR043Wp and weakly similar to YDR150W uniprot|Q00402
            Saccharomyces cerevisiae YDR150W NUM1 Protein required
            for nuclear migration localizes to the mother cell cortex
            and the bud tip may mediate interactions of dynein and
            cytoplasmic microtubules with the cell cortex
          Length = 3729

 Score = 31.2 bits (69), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 45/190 (23%), Positives = 76/190 (40%), Gaps = 35/190 (18%)

Query: 9    IHSDDYLNRVSDVAPPINVSTTFRYDNEHLVPATRETGMHTSDSPMIYSRLGHPNADRLE 68
            + ++ Y N + +V   INV+++    N   V A++E   H          +   NA + E
Sbjct: 2655 VPAEKYNNLLEEVKNKINVTSS---PNSSKVLASKEYFEHV---------IRQENAQQKE 2702

Query: 69   AVLSQLLDSHAVVYASGLAAYHAILVHFKPKRLFLPHCYHGCKEVARIISRLNGMEILSL 128
             +LS +     V  +  L  Y  +L + K   L     Y+G KE          + +L +
Sbjct: 2703 KLLSSVKSLGFVTLS--LDEYKTLLENQKNHVLTKTDVYNGAKEFE--------LTVLPI 2752

Query: 129  EDIEA---KCQEGDLVHIEDPINPFGETVDLAQYASRIHSAGGLMMLDSTLGPPPLRNAW 185
            ++  A   K    D +  ED          L+ YASR++     +  D    P P+R A 
Sbjct: 2753 DEYRALLKKKNYRDSIAYED----------LSDYASRLNLKLVPVNTDPVGSPTPIRRAA 2802

Query: 186  DYGADIIMHS 195
              G  +I H+
Sbjct: 2803 STGQQLIFHN 2812

>Skud_13.59 Chr13 (101194..103143) [1950 bp, 649 aa] {ON} YML082W
           (REAL)
          Length = 649

 Score = 30.8 bits (68), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 39/77 (50%), Gaps = 1/77 (1%)

Query: 141 VHIEDPINPFGETVDLAQYASRIHSAGGLMMLDSTLGPPPLRNAWDYGADIIMHSGTKYF 200
           V IE P NP  +  +L +        G  +++D T+G     +   + ADI+  S TK F
Sbjct: 395 VFIETPSNPLLKMGNLLELKRLSELFGFFIIIDETVGGIVNIDGLPF-ADIVCSSLTKTF 453

Query: 201 GGHSDLLSGIVCVSDEA 217
            G S+++ G + ++ ++
Sbjct: 454 SGDSNVIGGSMVLNPQS 470

>Skud_7.432 Chr7 complement(715852..717393) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 30.4 bits (67), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 26/58 (44%)

Query: 3   FSATNAIHSDDYLNRVSDVAPPINVSTTFRYDNEHLVPATRETGMHTSDSPMIYSRLG 60
           FSA N   S   L  +  + P   V    R D+E+L+  T E   H +  PM YS  G
Sbjct: 453 FSAPNYCDSQGNLGGIIHIVPGRGVLQAGRNDDENLIIETFEAVEHPNIKPMAYSNGG 510

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.134    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 37,226,160
Number of extensions: 1465326
Number of successful extensions: 3781
Number of sequences better than 10.0: 120
Number of HSP's gapped: 3701
Number of HSP's successfully gapped: 142
Length of query: 380
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 269
Effective length of database: 40,753,473
Effective search space: 10962684237
Effective search space used: 10962684237
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 66 (30.0 bits)