Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_55.214595.426ON1148114861080.0
KLTH0F16236g5.426ON1460114458900.0
SAKL0G02354g5.426ON1458114454600.0
AER252C5.426ON1459114453320.0
Ecym_55255.426ON1459114452810.0
KLLA0E21253g5.426ON1457114452700.0
NDAI0C016205.426ON1460114552420.0
NCAS0H020405.426ON1460114552300.0
TDEL0E019905.426ON1460114552140.0
KAFR0D050305.426ON1462114652050.0
ZYRO0F09856g5.426ON1458114452030.0
TBLA0A037205.426ON1458114451930.0
Kpol_1016.95.426ON1460114551910.0
Skud_15.2795.426ON1460114551830.0
YOR116C (RPO31)5.426ON1460114551750.0
Smik_15.2945.426ON1460114551650.0
Suva_8.1695.426ON1460114551600.0
TPHA0H017605.426ON1459114550740.0
CAGL0L11660g5.426ON1459114650730.0
KNAG0B042405.426ON1455114550640.0
Suva_4.1047.314ON1733117715970.0
KLLA0F05071g7.314ON1720119115930.0
NCAS0A139007.314ON1716118115900.0
TPHA0A030707.314ON1719117915800.0
KLTH0H02046g7.314ON1740119115770.0
Kwal_56.244897.314ON1728119015720.0
SAKL0F10472g7.314ON1730117815570.0
TDEL0C023207.314ON1727117415450.0
KAFR0B010607.314ON168593314581e-177
ZYRO0F05918g7.314ON174493014611e-177
NDAI0A021307.314ON172992614531e-176
KNAG0C039707.314ON172193014521e-176
YDL140C (RPO21)7.314ON173392714501e-175
Smik_4.957.314ON171992714471e-175
TBLA0F021707.314ON172693314451e-175
Ecym_80657.314ON174393414451e-175
CAGL0I03828g7.314ON171593114421e-174
Skud_4.1147.314ON172692714391e-174
ADR086C7.314ON174593414371e-173
Kpol_162.1singletonON131184113801e-169
KLTH0D01628g7.51ON165495311211e-130
Kwal_26.69797.51ON165495011211e-130
ZYRO0D04532g7.51ON166795211181e-129
TDEL0H040007.51ON166595611161e-129
CAGL0E05500g7.51ON164395911131e-129
Smik_15.5197.51ON166594811121e-128
YOR341W (RPA190)7.51ON166495811091e-128
Skud_15.5067.51ON166595511061e-128
KAFR0K005407.51ON166295811061e-127
TPHA0H028007.51ON164895311031e-127
KLLA0F23243g7.51ON165394511011e-127
NDAI0H012007.51ON166995210991e-127
Suva_8.3917.51ON166595810971e-126
KNAG0D049707.51ON167194110951e-126
NCAS0F007307.51ON167488210921e-126
Kpol_1040.37.51ON165695710871e-125
TBLA0E019307.51ON165996210631e-122
SAKL0B10736g7.51ON165094710511e-120
ADR374C7.51ON164094410471e-120
Kpol_1019.277.314ON3642891931e-14
TBLA0B023403.101ON73680970.010
NCAS0A142007.362ON24774800.68
YOR236W (DFR1)8.657ON211105751.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_55.21459
         (1148 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_55.21459 s55 (846902..850348) [3447 bp, 1148 aa] {ON} YOR11...  2357   0.0  
KLTH0F16236g Chr6 (1316542..1320924) [4383 bp, 1460 aa] {ON} hig...  2273   0.0  
SAKL0G02354g Chr7 complement(193623..197999) [4377 bp, 1458 aa] ...  2107   0.0  
AER252C Chr5 complement(1101343..1105722) [4380 bp, 1459 aa] {ON...  2058   0.0  
Ecym_5525 Chr5 complement(1063773..1068152) [4380 bp, 1459 aa] {...  2038   0.0  
KLLA0E21253g Chr5 (1896457..1900830) [4374 bp, 1457 aa] {ON} hig...  2034   0.0  
NDAI0C01620 Chr3 (346478..350860) [4383 bp, 1460 aa] {ON} Anc_5....  2023   0.0  
NCAS0H02040 Chr8 complement(393711..398093) [4383 bp, 1460 aa] {...  2019   0.0  
TDEL0E01990 Chr5 (373218..377600) [4383 bp, 1460 aa] {ON} Anc_5....  2013   0.0  
KAFR0D05030 Chr4 complement(988159..992547) [4389 bp, 1462 aa] {...  2009   0.0  
ZYRO0F09856g Chr6 complement(798821..803197) [4377 bp, 1458 aa] ...  2008   0.0  
TBLA0A03720 Chr1 complement(929751..934127) [4377 bp, 1458 aa] {...  2004   0.0  
Kpol_1016.9 s1016 (19972..24354) [4383 bp, 1460 aa] {ON} (19972....  2004   0.0  
Skud_15.279 Chr15 complement(496216..500598) [4383 bp, 1460 aa] ...  2001   0.0  
YOR116C Chr15 complement(539763..544145) [4383 bp, 1460 aa] {ON}...  1998   0.0  
Smik_15.294 Chr15 complement(500962..505344) [4383 bp, 1460 aa] ...  1994   0.0  
Suva_8.169 Chr8 complement(297556..301938) [4383 bp, 1460 aa] {O...  1992   0.0  
TPHA0H01760 Chr8 complement(402254..406633) [4380 bp, 1459 aa] {...  1959   0.0  
CAGL0L11660g Chr12 (1245685..1250064) [4380 bp, 1459 aa] {ON} hi...  1958   0.0  
KNAG0B04240 Chr2 (806212..810579) [4368 bp, 1455 aa] {ON} Anc_5....  1955   0.0  
Suva_4.104 Chr4 complement(193257..193711,193754..193782,194161....   619   0.0  
KLLA0F05071g Chr6 complement(496371..501533) [5163 bp, 1720 aa] ...   618   0.0  
NCAS0A13900 Chr1 (2728572..2733722) [5151 bp, 1716 aa] {ON} Anc_...   617   0.0  
TPHA0A03070 Chr1 complement(671766..676925) [5160 bp, 1719 aa] {...   613   0.0  
KLTH0H02046g Chr8 complement(182788..188010) [5223 bp, 1740 aa] ...   612   0.0  
Kwal_56.24489 s56 (1018237..1023423) [5187 bp, 1728 aa] {ON} YDL...   610   0.0  
SAKL0F10472g Chr6 (808869..814061) [5193 bp, 1730 aa] {ON} highl...   604   0.0  
TDEL0C02320 Chr3 complement(403851..409034) [5184 bp, 1727 aa] {...   599   0.0  
KAFR0B01060 Chr2 complement(197351..202408) [5058 bp, 1685 aa] {...   566   e-177
ZYRO0F05918g Chr6 (487056..492290) [5235 bp, 1744 aa] {ON} highl...   567   e-177
NDAI0A02130 Chr1 complement(477808..482997) [5190 bp, 1729 aa] {...   564   e-176
KNAG0C03970 Chr3 complement(778936..784101) [5166 bp, 1721 aa] {...   563   e-176
YDL140C Chr4 complement(205360..210561) [5202 bp, 1733 aa] {ON} ...   563   e-175
Smik_4.95 Chr4 complement(182198..187357) [5160 bp, 1719 aa] {ON...   561   e-175
TBLA0F02170 Chr6 (535350..540530) [5181 bp, 1726 aa] {ON} Anc_7....   561   e-175
Ecym_8065 Chr8 (139544..144775) [5232 bp, 1743 aa] {ON} similar ...   561   e-175
CAGL0I03828g Chr9 complement(328922..334069) [5148 bp, 1715 aa] ...   560   e-174
Skud_4.114 Chr4 complement(201053..206233) [5181 bp, 1726 aa] {O...   558   e-174
ADR086C Chr4 complement(860406..865643) [5238 bp, 1745 aa] {ON} ...   558   e-173
Kpol_162.1 s162 complement(211..4146) [3936 bp, 1311 aa] {ON} co...   536   e-169
KLTH0D01628g Chr4 complement(157597..162561) [4965 bp, 1654 aa] ...   436   e-130
Kwal_26.6979 s26 complement(150350..155314) [4965 bp, 1654 aa] {...   436   e-130
ZYRO0D04532g Chr4 (374177..379180) [5004 bp, 1667 aa] {ON} highl...   435   e-129
TDEL0H04000 Chr8 (680730..685727) [4998 bp, 1665 aa] {ON} Anc_7....   434   e-129
CAGL0E05500g Chr5 (539213..544144) [4932 bp, 1643 aa] {ON} highl...   433   e-129
Smik_15.519 Chr15 (910592..915589) [4998 bp, 1665 aa] {ON} YOR34...   432   e-128
YOR341W Chr15 (960987..965981) [4995 bp, 1664 aa] {ON}  RPA190RN...   431   e-128
Skud_15.506 Chr15 (901437..906434) [4998 bp, 1665 aa] {ON} YOR34...   430   e-128
KAFR0K00540 Chr11 complement(114196..119184) [4989 bp, 1662 aa] ...   430   e-127
TPHA0H02800 Chr8 (659254..664200) [4947 bp, 1648 aa] {ON} Anc_7....   429   e-127
KLLA0F23243g Chr6 (2165407..2170368) [4962 bp, 1653 aa] {ON} hig...   428   e-127
NDAI0H01200 Chr8 complement(280165..285174) [5010 bp, 1669 aa] {...   427   e-127
Suva_8.391 Chr8 (702691..707688) [4998 bp, 1665 aa] {ON} YOR341W...   427   e-126
KNAG0D04970 Chr4 (905179..910194) [5016 bp, 1671 aa] {ON} Anc_7....   426   e-126
NCAS0F00730 Chr6 complement(143500..148524) [5025 bp, 1674 aa] {...   425   e-126
Kpol_1040.3 s1040 complement(6642..11612) [4971 bp, 1656 aa] {ON...   423   e-125
TBLA0E01930 Chr5 (468692..473671) [4980 bp, 1659 aa] {ON} Anc_7....   414   e-122
SAKL0B10736g Chr2 (925889..930841) [4953 bp, 1650 aa] {ON} highl...   409   e-120
ADR374C Chr4 complement(1372609..1377531) [4923 bp, 1640 aa] {ON...   407   e-120
Kpol_1019.27 s1019 complement(51067..52161) [1095 bp, 364 aa] {O...    79   1e-14
TBLA0B02340 Chr2 complement(545918..548128) [2211 bp, 736 aa] {O...    42   0.010
NCAS0A14200 Chr1 complement(2795611..2796354) [744 bp, 247 aa] {...    35   0.68 
YOR236W Chr15 (780906..781541) [636 bp, 211 aa] {ON}  DFR1Dihydr...    33   1.8  

>Kwal_55.21459 s55 (846902..850348) [3447 bp, 1148 aa] {ON} YOR116C
            (RPO31) - RNA polymerase III large subunit [contig 130]
            FULL
          Length = 1148

 Score = 2357 bits (6108), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1134/1148 (98%), Positives = 1134/1148 (98%)

Query: 1    MKEVVVDIAPKRIKGLEFSALSASDIVGQSKVEISTRDLFDLENGRKPKSGGALDTRMGV 60
            MKEVVVDIAPKRIKGLEFSALSASDIVGQSKVEISTRDLFDLENGRKPKSGGALDTRMGV
Sbjct: 1    MKEVVVDIAPKRIKGLEFSALSASDIVGQSKVEISTRDLFDLENGRKPKSGGALDTRMGV 60

Query: 61   SSSQAECSTCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKSCAALLLSEEDK 120
            SSSQAECSTCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKSCAALLLSEEDK
Sbjct: 61   SSSQAECSTCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKSCAALLLSEEDK 120

Query: 121  RQFLSELRRPGIDNLRRMGILKKVVDQCKKQRRCLRCGSLNXXXXXXXXXXXXXXLKILH 180
            RQFLSELRRPGIDNLRRMGILKKVVDQCKKQRRCLRCGSLN              LKILH
Sbjct: 121  RQFLSELRRPGIDNLRRMGILKKVVDQCKKQRRCLRCGSLNGVVKKAAAGSGSASLKILH 180

Query: 181  DTFRWVGKKSAPEKDKWVGDWKTVLSHNPELERYVKKCMDDLNPLKTLNLFKQVSPEDCE 240
            DTFRWVGKKSAPEKDKWVGDWKTVLSHNPELERYVKKCMDDLNPLKTLNLFKQVSPEDCE
Sbjct: 181  DTFRWVGKKSAPEKDKWVGDWKTVLSHNPELERYVKKCMDDLNPLKTLNLFKQVSPEDCE 240

Query: 241  LMGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LMGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LMGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGGKTKPIRGFCQRLKGKQ 360
            AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGGKTKPIRGFCQRLKGKQ
Sbjct: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGGKTKPIRGFCQRLKGKQ 360

Query: 361  GRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKAKLQQLVI 420
            GRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKAKLQQLVI
Sbjct: 361  GRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKAKLQQLVI 420

Query: 421  NGPNEHPGANYLLKKDEEARRNLRYGDRIKLAKNLQYGDLVERHLEDGDVVLFNRQPSLH 480
            NGPNEHPGANYLLKKDEEARRNLRYGDRIKLAKNLQYGDLVERHLEDGDVVLFNRQPSLH
Sbjct: 421  NGPNEHPGANYLLKKDEEARRNLRYGDRIKLAKNLQYGDLVERHLEDGDVVLFNRQPSLH 480

Query: 481  RLSILSHFAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL 540
            RLSILSHFAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL
Sbjct: 481  RLSILSHFAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL 540

Query: 541  LTPKSGEPIIAATQDFITGSYLISHKDSFYSRAEFVQLLSMMSDGNMQFDIPPPAIMKPY 600
            LTPKSGEPIIAATQDFITGSYLISHKDSFYSRAEFVQLLSMMSDGNMQFDIPPPAIMKPY
Sbjct: 541  LTPKSGEPIIAATQDFITGSYLISHKDSFYSRAEFVQLLSMMSDGNMQFDIPPPAIMKPY 600

Query: 601  YMWTGKQVFSLLIRPNKKSSVVINLDAKNKVYIPPKHKHLPNEMSINDGFVVIRGSQILS 660
            YMWTGKQVFSLLIRPNKKSSVVINLDAKNKVYIPPKHKHLPNEMSINDGFVVIRGSQILS
Sbjct: 601  YMWTGKQVFSLLIRPNKKSSVVINLDAKNKVYIPPKHKHLPNEMSINDGFVVIRGSQILS 660

Query: 661  GVMDKSVLGDGKKHSVFYTILRDFGPKEAAYAMNRMAKLCARYLGNRGFSIGINDVTPGF 720
            GVMDKSVLGDGKKHSVFYTILRDFGPKEAAYAMNRMAKLCARYLGNRGFSIGINDVTPGF
Sbjct: 661  GVMDKSVLGDGKKHSVFYTILRDFGPKEAAYAMNRMAKLCARYLGNRGFSIGINDVTPGF 720

Query: 721  ELKNKKEVMVEDAYAKCDDLIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVC 780
            ELKNKKEVMVEDAYAKCDDLIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVC
Sbjct: 721  ELKNKKEVMVEDAYAKCDDLIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVC 780

Query: 781  IKELDNLNSCLIMANCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSKT 840
            IKELDNLNSCLIMANCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSKT
Sbjct: 781  IKELDNLNSCLIMANCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSKT 840

Query: 841  PQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD 900
            PQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD
Sbjct: 841  PQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD 900

Query: 901  NTIRTSSNGIVQFTYGGDGLDPIDMEGNAQPVNFTRSWDHANNITFNHSDKPLLPYQIMQ 960
            NTIRTSSNGIVQFTYGGDGLDPIDMEGNAQPVNFTRSWDHANNITFNHSDKPLLPYQIMQ
Sbjct: 901  NTIRTSSNGIVQFTYGGDGLDPIDMEGNAQPVNFTRSWDHANNITFNHSDKPLLPYQIMQ 960

Query: 961  QTNSILQPLEEKLVRYDNLGRTLDPSLQDRAEFIDQDDAERNFYKSLREYLHTKASHLAK 1020
            QTNSILQPLEEKLVRYDNLGRTLDPSLQDRAEFIDQDDAERNFYKSLREYLHTKASHLAK
Sbjct: 961  QTNSILQPLEEKLVRYDNLGRTLDPSLQDRAEFIDQDDAERNFYKSLREYLHTKASHLAK 1020

Query: 1021 IRSHKGLKQFLDEPAPELQSMDLDEGSPSALLASVDQLCKISSKLVAKFLEIAIFKYHKA 1080
            IRSHKGLKQFLDEPAPELQSMDLDEGSPSALLASVDQLCKISSKLVAKFLEIAIFKYHKA
Sbjct: 1021 IRSHKGLKQFLDEPAPELQSMDLDEGSPSALLASVDQLCKISSKLVAKFLEIAIFKYHKA 1080

Query: 1081 KVEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII 1140
            KVEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII
Sbjct: 1081 KVEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII 1140

Query: 1141 NAVLGQYE 1148
            NAVLGQYE
Sbjct: 1141 NAVLGQYE 1148

>KLTH0F16236g Chr6 (1316542..1320924) [4383 bp, 1460 aa] {ON} highly
            similar to uniprot|P04051 Saccharomyces cerevisiae
            YOR116C
          Length = 1460

 Score = 2273 bits (5890), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1078/1144 (94%), Positives = 1111/1144 (97%)

Query: 1    MKEVVVDIAPKRIKGLEFSALSASDIVGQSKVEISTRDLFDLENGRKPKSGGALDTRMGV 60
            MKEVVVDIAPKRIKGLEFSALSASDIV QSKVEISTRDLFDLENGRKPKSGGALDTRMGV
Sbjct: 1    MKEVVVDIAPKRIKGLEFSALSASDIVAQSKVEISTRDLFDLENGRKPKSGGALDTRMGV 60

Query: 61   SSSQAECSTCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKSCAALLLSEEDK 120
            SSSQAECSTCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICK+CAALLLSEEDK
Sbjct: 61   SSSQAECSTCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKTCAALLLSEEDK 120

Query: 121  RQFLSELRRPGIDNLRRMGILKKVVDQCKKQRRCLRCGSLNXXXXXXXXXXXXXXLKILH 180
             QFLSELRRPGIDNLRRMGILKKVVDQCKKQRRCLRCGSLN              LKILH
Sbjct: 121  HQFLSELRRPGIDNLRRMGILKKVVDQCKKQRRCLRCGSLNGVVKKAAAGSGSASLKILH 180

Query: 181  DTFRWVGKKSAPEKDKWVGDWKTVLSHNPELERYVKKCMDDLNPLKTLNLFKQVSPEDCE 240
            DTFRWVGKKSAPEKDKWVGDWKTVL+HNPELERYVKKCMDDLNPLKTLNLFKQV+PEDCE
Sbjct: 181  DTFRWVGKKSAPEKDKWVGDWKTVLAHNPELERYVKKCMDDLNPLKTLNLFKQVAPEDCE 240

Query: 241  LMGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            L+GIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGGKTKPIRGFCQRLKGKQ 360
            AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGGKTKPIRGFCQRLKGKQ
Sbjct: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGGKTKPIRGFCQRLKGKQ 360

Query: 361  GRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKAKLQQLVI 420
            GRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNK KLQQLVI
Sbjct: 361  GRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKQKLQQLVI 420

Query: 421  NGPNEHPGANYLLKKDEEARRNLRYGDRIKLAKNLQYGDLVERHLEDGDVVLFNRQPSLH 480
            NGPNEHPGANYLLKKDEEARRNLRYGDR+KLA+NLQYGD+VERHLEDGDVVLFNRQPSLH
Sbjct: 421  NGPNEHPGANYLLKKDEEARRNLRYGDRMKLARNLQYGDVVERHLEDGDVVLFNRQPSLH 480

Query: 481  RLSILSHFAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL 540
            RLSILSH+AKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL
Sbjct: 481  RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL 540

Query: 541  LTPKSGEPIIAATQDFITGSYLISHKDSFYSRAEFVQLLSMMSDGNMQFDIPPPAIMKPY 600
            LTPKSGEPIIAATQDFITGSYLISHKDSF+SRAEFVQLLSMMSDGN+QFDIPPP+IMKPY
Sbjct: 541  LTPKSGEPIIAATQDFITGSYLISHKDSFFSRAEFVQLLSMMSDGNLQFDIPPPSIMKPY 600

Query: 601  YMWTGKQVFSLLIRPNKKSSVVINLDAKNKVYIPPKHKHLPNEMSINDGFVVIRGSQILS 660
            YMWTGKQVFSLLIRPNK+S VVINLDAKNKVYIPPK K LPNEMSINDG+VVIRGS+ILS
Sbjct: 601  YMWTGKQVFSLLIRPNKESPVVINLDAKNKVYIPPKDKSLPNEMSINDGYVVIRGSKILS 660

Query: 661  GVMDKSVLGDGKKHSVFYTILRDFGPKEAAYAMNRMAKLCARYLGNRGFSIGINDVTPGF 720
            GVMDKSVLGDGKKHSVFYTILRDFGP+EAA+AMNRMAKLCAR+LGNRGFSIGINDVTPGF
Sbjct: 661  GVMDKSVLGDGKKHSVFYTILRDFGPQEAAFAMNRMAKLCARFLGNRGFSIGINDVTPGF 720

Query: 721  ELKNKKEVMVEDAYAKCDDLIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVC 780
            ELKNKKE+MVEDAYAKCD LID FNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVC
Sbjct: 721  ELKNKKEIMVEDAYAKCDALIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVC 780

Query: 781  IKELDNLNSCLIMANCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSKT 840
            IKELDNLNSCLIMANCGSKGS LNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSKT
Sbjct: 781  IKELDNLNSCLIMANCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSKT 840

Query: 841  PQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD 900
            PQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD
Sbjct: 841  PQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD 900

Query: 901  NTIRTSSNGIVQFTYGGDGLDPIDMEGNAQPVNFTRSWDHANNITFNHSDKPLLPYQIMQ 960
            NTIRTSSNGIVQFTYGGDGLDPIDMEGNAQPVNF+RSW+HANN+TFNH DKPLLPYQIMQ
Sbjct: 901  NTIRTSSNGIVQFTYGGDGLDPIDMEGNAQPVNFSRSWEHANNVTFNHVDKPLLPYQIMQ 960

Query: 961  QTNSILQPLEEKLVRYDNLGRTLDPSLQDRAEFIDQDDAERNFYKSLREYLHTKASHLAK 1020
            QTN +L+PLEEKLVRYDNLG  LDPSLQDR E+IDQDDAERNFYKSLR+Y++ KASHLA 
Sbjct: 961  QTNGVLKPLEEKLVRYDNLGNELDPSLQDRVEYIDQDDAERNFYKSLRDYMYEKASHLAN 1020

Query: 1021 IRSHKGLKQFLDEPAPELQSMDLDEGSPSALLASVDQLCKISSKLVAKFLEIAIFKYHKA 1080
            IR+HKGLK+FLDEPA ELQ+MDLDEG+P++ LASVDQLCKISSKLV KFLEIAIFKYHKA
Sbjct: 1021 IRAHKGLKEFLDEPAAELQAMDLDEGAPASALASVDQLCKISSKLVLKFLEIAIFKYHKA 1080

Query: 1081 KVEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII 1140
            KVEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII
Sbjct: 1081 KVEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII 1140

Query: 1141 NAVL 1144
            NAVL
Sbjct: 1141 NAVL 1144

>SAKL0G02354g Chr7 complement(193623..197999) [4377 bp, 1458 aa] {ON}
            highly similar to uniprot|P04051 Saccharomyces cerevisiae
            YOR116C
          Length = 1458

 Score = 2107 bits (5460), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 995/1144 (86%), Positives = 1066/1144 (93%), Gaps = 1/1144 (0%)

Query: 1    MKEVVVDIAPKRIKGLEFSALSASDIVGQSKVEISTRDLFDLENGRKPKSGGALDTRMGV 60
            MKEVVVDIAPK+IKGLEFSALSASDIV QS+VEISTRDLFDLENGR PK GGALDT+MGV
Sbjct: 1    MKEVVVDIAPKKIKGLEFSALSASDIVAQSEVEISTRDLFDLENGRTPKVGGALDTKMGV 60

Query: 61   SSSQAECSTCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKSCAALLLSEEDK 120
            SSS AECSTCHGNLASCHGHFGHIKL+LPVFHVGYFKATIQ+LQ +CK+CA++LLS++DK
Sbjct: 61   SSSHAECSTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGVCKNCASILLSDDDK 120

Query: 121  RQFLSELRRPGIDNLRRMGILKKVVDQCKKQRRCLRCGSLNXXXXXXXXXXXXXXLKILH 180
            RQFL+ELRRPG+DNLRRMG LKK++DQCKKQRRCL CG LN              LKI+H
Sbjct: 121  RQFLAELRRPGVDNLRRMGTLKKILDQCKKQRRCLHCGMLNGVVKKAAAGSGSASLKIIH 180

Query: 181  DTFRWVGKKSAPEKDKWVGDWKTVLSHNPELERYVKKCMDDLNPLKTLNLFKQVSPEDCE 240
            DTFRWVGKKSAPEK+KWVGDWK VL HNPELERY+K+CMDDLNPLKTLNLFKQV PEDCE
Sbjct: 181  DTFRWVGKKSAPEKEKWVGDWKQVLEHNPELERYMKRCMDDLNPLKTLNLFKQVKPEDCE 240

Query: 241  LMGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            L+GIDS VKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSAVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGGKTKPIRGFCQRLKGKQ 360
            AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPG S GGKTKPIRGFCQRLKGKQ
Sbjct: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGAS-GGKTKPIRGFCQRLKGKQ 359

Query: 361  GRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKAKLQQLVI 420
            GRFRGNLSGKRVDFSGRTV+SPDPNLSIDEVAVPDRVAKVLTYPE VTRYNK KLQQLVI
Sbjct: 360  GRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNKHKLQQLVI 419

Query: 421  NGPNEHPGANYLLKKDEEARRNLRYGDRIKLAKNLQYGDLVERHLEDGDVVLFNRQPSLH 480
            NGPN HPGANYLLKK+++ARRNLRYGDR+KLAKNLQYGD+VERH+EDGDVVLFNRQPSLH
Sbjct: 420  NGPNIHPGANYLLKKNDDARRNLRYGDRMKLAKNLQYGDVVERHIEDGDVVLFNRQPSLH 479

Query: 481  RLSILSHFAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL 540
            RLSILSH+AKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL
Sbjct: 480  RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL 539

Query: 541  LTPKSGEPIIAATQDFITGSYLISHKDSFYSRAEFVQLLSMMSDGNMQFDIPPPAIMKPY 600
            LTPKSGEPIIAATQDFITGSYLISHKDSF+ RA   QLLSMMSDGNMQFD+PPPA+MKP+
Sbjct: 540  LTPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMMSDGNMQFDLPPPAVMKPH 599

Query: 601  YMWTGKQVFSLLIRPNKKSSVVINLDAKNKVYIPPKHKHLPNEMSINDGFVVIRGSQILS 660
            Y+WTGKQVFSLLIRPNKKS V+IN+DAKNKV++PPKHK LPNEMS+NDGFVVIRGS+ILS
Sbjct: 600  YLWTGKQVFSLLIRPNKKSPVIINVDAKNKVFMPPKHKGLPNEMSVNDGFVVIRGSEILS 659

Query: 661  GVMDKSVLGDGKKHSVFYTILRDFGPKEAAYAMNRMAKLCARYLGNRGFSIGINDVTPGF 720
            GVMDKSVLGDGKKHSVFYTILRD+GP+EAA AMNRMAKLCARYLGNRGFSIGI+DVTPG 
Sbjct: 660  GVMDKSVLGDGKKHSVFYTILRDYGPQEAASAMNRMAKLCARYLGNRGFSIGISDVTPGA 719

Query: 721  ELKNKKEVMVEDAYAKCDDLIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVC 780
            +LK KKE  VE+AYAKCD+LIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVC
Sbjct: 720  DLKQKKEDKVEEAYAKCDELIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVC 779

Query: 781  IKELDNLNSCLIMANCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSKT 840
            I+ELDNLN+ LIMA CGSKGS LNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSKT
Sbjct: 780  IRELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKT 839

Query: 841  PQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD 900
            PQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD
Sbjct: 840  PQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD 899

Query: 901  NTIRTSSNGIVQFTYGGDGLDPIDMEGNAQPVNFTRSWDHANNITFNHSDKPLLPYQIMQ 960
            NT+RTSSNGIVQFTYGGDGLDP+DMEGNAQPVNF RSWDHANNITF H D  LLPYQI++
Sbjct: 900  NTVRTSSNGIVQFTYGGDGLDPLDMEGNAQPVNFNRSWDHANNITFTHKDFGLLPYQIIE 959

Query: 961  QTNSILQPLEEKLVRYDNLGRTLDPSLQDRAEFIDQDDAERNFYKSLREYLHTKASHLAK 1020
             TNSIL+PLE+KLVR+DNLG  L+   +++ E+IDQ DAERNFY+SLR+Y+  KA+HLAK
Sbjct: 960  NTNSILKPLEQKLVRFDNLGNKLNKEDEEKIEYIDQHDAERNFYQSLRDYMTEKATHLAK 1019

Query: 1021 IRSHKGLKQFLDEPAPELQSMDLDEGSPSALLASVDQLCKISSKLVAKFLEIAIFKYHKA 1080
            IR  KGLK  LDEPAPEL+ ++LDE  P  +L +V+QLCKIS  LV  FL IAI KYH+A
Sbjct: 1020 IRKAKGLKTLLDEPAPELKILNLDEQYPEYILTAVNQLCKISKNLVETFLGIAISKYHRA 1079

Query: 1081 KVEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII 1140
            KVEPGTAVGA+GA SIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII
Sbjct: 1080 KVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII 1139

Query: 1141 NAVL 1144
            NAVL
Sbjct: 1140 NAVL 1143

>AER252C Chr5 complement(1101343..1105722) [4380 bp, 1459 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YOR116C
            (RPO31)
          Length = 1459

 Score = 2058 bits (5332), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 975/1144 (85%), Positives = 1047/1144 (91%)

Query: 1    MKEVVVDIAPKRIKGLEFSALSASDIVGQSKVEISTRDLFDLENGRKPKSGGALDTRMGV 60
            MKEVVVDI PKRI GLEFSALSASDIV QS+VEI TRDLFDLE+GR PK GGALD+RMGV
Sbjct: 1    MKEVVVDILPKRISGLEFSALSASDIVAQSEVEIFTRDLFDLEDGRAPKKGGALDSRMGV 60

Query: 61   SSSQAECSTCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKSCAALLLSEEDK 120
            SSSQAECSTCHG LASCHGHFGHIKL+LPVFHVGYFKATIQ+LQSICK+CA LLL+EEDK
Sbjct: 61   SSSQAECSTCHGTLASCHGHFGHIKLALPVFHVGYFKATIQILQSICKNCAKLLLNEEDK 120

Query: 121  RQFLSELRRPGIDNLRRMGILKKVVDQCKKQRRCLRCGSLNXXXXXXXXXXXXXXLKILH 180
            RQFLSELRRPGIDNLRRM  LKKV+DQCKKQRRCL CG LN              LKI+H
Sbjct: 121  RQFLSELRRPGIDNLRRMATLKKVLDQCKKQRRCLHCGMLNGVVKKAAAGSGSAALKIIH 180

Query: 181  DTFRWVGKKSAPEKDKWVGDWKTVLSHNPELERYVKKCMDDLNPLKTLNLFKQVSPEDCE 240
            DTFRWVGKKSAPEKDKW+GDW  VL H+PELERY+K+ M++LNPLKTLNLFKQ+SP+DCE
Sbjct: 181  DTFRWVGKKSAPEKDKWIGDWNQVLQHSPELERYMKRTMENLNPLKTLNLFKQISPQDCE 240

Query: 241  LMGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            L+GIDSTVK+GRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSTVKAGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGGKTKPIRGFCQRLKGKQ 360
            AGLEKGISINNMMEQWDYLQ+AVAMYINSDSVNPA+MPGG+ GGKTKPIRGFCQRLKGKQ
Sbjct: 301  AGLEKGISINNMMEQWDYLQMAVAMYINSDSVNPALMPGGNGGGKTKPIRGFCQRLKGKQ 360

Query: 361  GRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKAKLQQLVI 420
            GRFRGNLSGKRVDFSGRTV+SPDPNLSIDEVAVPDRVAKVLT+PE VTRYNK KLQQL++
Sbjct: 361  GRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNKHKLQQLIV 420

Query: 421  NGPNEHPGANYLLKKDEEARRNLRYGDRIKLAKNLQYGDLVERHLEDGDVVLFNRQPSLH 480
            NG N HPGANYLLKK+EEARRNLRYGDRIKLAKNLQ GD+VERHLEDGDVVLFNRQPSLH
Sbjct: 421  NGANVHPGANYLLKKNEEARRNLRYGDRIKLAKNLQIGDVVERHLEDGDVVLFNRQPSLH 480

Query: 481  RLSILSHFAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL 540
            RLSILSH+AKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL
Sbjct: 481  RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL 540

Query: 541  LTPKSGEPIIAATQDFITGSYLISHKDSFYSRAEFVQLLSMMSDGNMQFDIPPPAIMKPY 600
            LTPKSGEPIIAATQDFITGSYLISHKDSF+ RA FVQ+LSMMSDGN+QFDIPPPAIM+P+
Sbjct: 541  LTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFVQMLSMMSDGNLQFDIPPPAIMRPH 600

Query: 601  YMWTGKQVFSLLIRPNKKSSVVINLDAKNKVYIPPKHKHLPNEMSINDGFVVIRGSQILS 660
            Y+WTGKQ+FSLLI+PNKKS V+INLDAKNKVYI PK+K  PNEMS NDG+VVIRGS ILS
Sbjct: 601  YLWTGKQLFSLLIKPNKKSPVIINLDAKNKVYIAPKNKAYPNEMSANDGYVVIRGSNILS 660

Query: 661  GVMDKSVLGDGKKHSVFYTILRDFGPKEAAYAMNRMAKLCARYLGNRGFSIGINDVTPGF 720
            GVMDKSVLGDGKKHSVFYTILRDFGP+EA  AMNRMAKLCARYLGNRGFSIGI+DVTPG 
Sbjct: 661  GVMDKSVLGDGKKHSVFYTILRDFGPQEATQAMNRMAKLCARYLGNRGFSIGISDVTPGV 720

Query: 721  ELKNKKEVMVEDAYAKCDDLIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVC 780
            ELK  KE MVE AYAKCD+LID + +GKLETQPGCNEEQTLEAKIGGLLSKVREEVG+VC
Sbjct: 721  ELKATKEEMVEIAYAKCDELIDLYKRGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDVC 780

Query: 781  IKELDNLNSCLIMANCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSKT 840
            I+ELDNLN+ LIMA CGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSKT
Sbjct: 781  IRELDNLNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKT 840

Query: 841  PQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD 900
            PQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD
Sbjct: 841  PQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD 900

Query: 901  NTIRTSSNGIVQFTYGGDGLDPIDMEGNAQPVNFTRSWDHANNITFNHSDKPLLPYQIMQ 960
            NT+RTSSNGIVQFTYGGDGLDP++MEGNA+PVNF RSWDHANNIT+NH DK +LPYQI++
Sbjct: 901  NTVRTSSNGIVQFTYGGDGLDPLNMEGNAKPVNFNRSWDHANNITYNHDDKGMLPYQILE 960

Query: 961  QTNSILQPLEEKLVRYDNLGRTLDPSLQDRAEFIDQDDAERNFYKSLREYLHTKASHLAK 1020
            +TN+IL PLE++L RYDN+G  L P L++   +IDQ DAER FY+SLR Y+  KA  LA 
Sbjct: 961  ETNAILHPLEQQLSRYDNVGNPLAPGLENEELYIDQHDAEREFYQSLRTYMSEKARKLAD 1020

Query: 1021 IRSHKGLKQFLDEPAPELQSMDLDEGSPSALLASVDQLCKISSKLVAKFLEIAIFKYHKA 1080
            I   +GLK+    PA ELQ MDLD   P   + SV+QLCKISSKLV  FL+IAI KY KA
Sbjct: 1021 ITKSRGLKELYHAPALELQLMDLDASCPEVDVKSVNQLCKISSKLVRTFLDIAISKYRKA 1080

Query: 1081 KVEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII 1140
            KVEPGTAVGA+GAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII
Sbjct: 1081 KVEPGTAVGAIGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII 1140

Query: 1141 NAVL 1144
            NA L
Sbjct: 1141 NATL 1144

>Ecym_5525 Chr5 complement(1063773..1068152) [4380 bp, 1459 aa] {ON}
            similar to Ashbya gossypii AER252C
          Length = 1459

 Score = 2038 bits (5281), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 970/1144 (84%), Positives = 1051/1144 (91%)

Query: 1    MKEVVVDIAPKRIKGLEFSALSASDIVGQSKVEISTRDLFDLENGRKPKSGGALDTRMGV 60
            MKEVVVD+APK+IKGL FSALSASDIV QS+VEI TRDLFDLENGR PK GGALD++MGV
Sbjct: 1    MKEVVVDVAPKKIKGLHFSALSASDIVAQSEVEIFTRDLFDLENGRAPKQGGALDSKMGV 60

Query: 61   SSSQAECSTCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKSCAALLLSEEDK 120
            SSSQAECSTCHGNLASCHGHFGHIKL+LPVFH+GYFKATIQ+LQSICK+CAA+LLSEE+K
Sbjct: 61   SSSQAECSTCHGNLASCHGHFGHIKLALPVFHIGYFKATIQILQSICKNCAAILLSEEEK 120

Query: 121  RQFLSELRRPGIDNLRRMGILKKVVDQCKKQRRCLRCGSLNXXXXXXXXXXXXXXLKILH 180
            RQFL+ELRRPGIDNLRRM  L+KV+DQCKKQRRCL CG+LN              LKI+H
Sbjct: 121  RQFLAELRRPGIDNLRRMATLRKVLDQCKKQRRCLHCGALNGVVKKAATGSGSAALKIIH 180

Query: 181  DTFRWVGKKSAPEKDKWVGDWKTVLSHNPELERYVKKCMDDLNPLKTLNLFKQVSPEDCE 240
            DTFRWVGKKSAPEK+KW+GDW  VL HNPELERY+K+ MD+LNPLKTLNLFKQV  +DCE
Sbjct: 181  DTFRWVGKKSAPEKEKWIGDWNQVLQHNPELERYMKRSMDNLNPLKTLNLFKQVRAQDCE 240

Query: 241  LMGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            L+GIDSTVK+GRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSTVKAGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGGKTKPIRGFCQRLKGKQ 360
            AGLEKGISINNMMEQWDYLQ+AVAMYINSDSVNPA+MPGG+ GGKTKPIRGFCQRLKGKQ
Sbjct: 301  AGLEKGISINNMMEQWDYLQMAVAMYINSDSVNPALMPGGTGGGKTKPIRGFCQRLKGKQ 360

Query: 361  GRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKAKLQQLVI 420
            GRFRGNLSGKRVDFSGRTV+SPDPNLSIDEVAVPDRVAKVLTYPE VTRYNK KLQQL+I
Sbjct: 361  GRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPERVTRYNKHKLQQLII 420

Query: 421  NGPNEHPGANYLLKKDEEARRNLRYGDRIKLAKNLQYGDLVERHLEDGDVVLFNRQPSLH 480
            NGPN HPGANY+LKK+E+ARRNLRYGDRIKLAKN+Q GD+VERH+EDGDVVLFNRQPSLH
Sbjct: 421  NGPNVHPGANYMLKKNEDARRNLRYGDRIKLAKNIQIGDVVERHIEDGDVVLFNRQPSLH 480

Query: 481  RLSILSHFAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL 540
            RLSILSH+AKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL
Sbjct: 481  RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL 540

Query: 541  LTPKSGEPIIAATQDFITGSYLISHKDSFYSRAEFVQLLSMMSDGNMQFDIPPPAIMKPY 600
            LTPKSGEPII+ATQDFITGSYLISHKDSF+ RA F QLLSMM+D NMQFD+PPPAI+KP 
Sbjct: 541  LTPKSGEPIISATQDFITGSYLISHKDSFFDRATFTQLLSMMADANMQFDLPPPAIIKPC 600

Query: 601  YMWTGKQVFSLLIRPNKKSSVVINLDAKNKVYIPPKHKHLPNEMSINDGFVVIRGSQILS 660
            Y+WTGKQVFSLLIRPNKKS V+INLDAKNKVY+PPK+K  PNEMS NDG+V+IRGS+IL 
Sbjct: 601  YLWTGKQVFSLLIRPNKKSPVIINLDAKNKVYLPPKNKSFPNEMSSNDGYVIIRGSEILC 660

Query: 661  GVMDKSVLGDGKKHSVFYTILRDFGPKEAAYAMNRMAKLCARYLGNRGFSIGINDVTPGF 720
            GVMDKSVLGDGKKHSVFYTILRDFGP EAA AMNRMAKLCARYLGNRGFSIGINDVTPG 
Sbjct: 661  GVMDKSVLGDGKKHSVFYTILRDFGPYEAAKAMNRMAKLCARYLGNRGFSIGINDVTPGK 720

Query: 721  ELKNKKEVMVEDAYAKCDDLIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVC 780
            ELK KKE MVE AYAKCD+LID F +G+LETQPGCNEEQTLEAKIGGLLSKVREEVGEVC
Sbjct: 721  ELKAKKEEMVEIAYAKCDELIDLFKRGELETQPGCNEEQTLEAKIGGLLSKVREEVGEVC 780

Query: 781  IKELDNLNSCLIMANCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSKT 840
            I+ELDNLN+ LIMA CGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSKT
Sbjct: 781  IRELDNLNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFAKNSKT 840

Query: 841  PQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD 900
            PQSKGFVR+SFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD
Sbjct: 841  PQSKGFVRSSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD 900

Query: 901  NTIRTSSNGIVQFTYGGDGLDPIDMEGNAQPVNFTRSWDHANNITFNHSDKPLLPYQIMQ 960
            NT+RTSSNG+VQFTYGGDGLDP++MEGNAQPVNF RSWDHANNITFN+ +  LLPYQIM+
Sbjct: 901  NTVRTSSNGVVQFTYGGDGLDPLNMEGNAQPVNFNRSWDHANNITFNNEEPGLLPYQIME 960

Query: 961  QTNSILQPLEEKLVRYDNLGRTLDPSLQDRAEFIDQDDAERNFYKSLREYLHTKASHLAK 1020
             +NSIL PLE +L+R DN+G  +   L    E+IDQ+DAER+FY+SLR Y+  KA  LA+
Sbjct: 961  TSNSILVPLERQLLRLDNVGNAISADLGSNDEYIDQNDAERDFYQSLRTYMTAKAHRLAQ 1020

Query: 1021 IRSHKGLKQFLDEPAPELQSMDLDEGSPSALLASVDQLCKISSKLVAKFLEIAIFKYHKA 1080
            IR  KGLK  L+EPA EL+ MDLD  + +A L S++QLCKIS  LV  FL IAI KYHKA
Sbjct: 1021 IRKSKGLKSLLEEPAQELKYMDLDASASTADLNSINQLCKISYNLVTTFLNIAISKYHKA 1080

Query: 1081 KVEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII 1140
            KVEPGTAVGA+GAHSIGEPGTQMTLKTFHFAGVASMN+TLGVPRIKEIINASKVISTPII
Sbjct: 1081 KVEPGTAVGAIGAHSIGEPGTQMTLKTFHFAGVASMNITLGVPRIKEIINASKVISTPII 1140

Query: 1141 NAVL 1144
            NA+L
Sbjct: 1141 NALL 1144

>KLLA0E21253g Chr5 (1896457..1900830) [4374 bp, 1457 aa] {ON} highly
            similar to uniprot|P04051 Saccharomyces cerevisiae
            YOR116C
          Length = 1457

 Score = 2034 bits (5270), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 960/1144 (83%), Positives = 1041/1144 (90%), Gaps = 1/1144 (0%)

Query: 1    MKEVVVDIAPKRIKGLEFSALSASDIVGQSKVEISTRDLFDLENGRKPKSGGALDTRMGV 60
            MKE V+DIAPK+IKG+ FSALSA+DIV QS+VEISTRDLFDL+NGR  K GGALD RMGV
Sbjct: 1    MKETVIDIAPKKIKGISFSALSAADIVSQSEVEISTRDLFDLDNGRSAKEGGALDPRMGV 60

Query: 61   SSSQAECSTCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKSCAALLLSEEDK 120
            SSSQAEC+TCHGNLASCHGHFGHIKL+LPVFHVGYFKATIQ+LQS+CK C ALLLSEEDK
Sbjct: 61   SSSQAECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQSVCKGCGALLLSEEDK 120

Query: 121  RQFLSELRRPGIDNLRRMGILKKVVDQCKKQRRCLRCGSLNXXXXXXXXXXXXXXLKILH 180
            R+FL+ELRRPG+DNLRRM ILKK++DQCKKQRRC  CG LN              LKI+H
Sbjct: 121  RKFLTELRRPGMDNLRRMNILKKILDQCKKQRRCFECGELNGVVKKAAAGSGSAALKIIH 180

Query: 181  DTFRWVGKKSAPEKDKWVGDWKTVLSHNPELERYVKKCMDDLNPLKTLNLFKQVSPEDCE 240
            DTFRWVGKKSAPEK++W+GDWK VL +NPELERYVK+CMDDLNPLK LNLFKQ+ P DCE
Sbjct: 181  DTFRWVGKKSAPEKEQWIGDWKQVLENNPELERYVKRCMDDLNPLKVLNLFKQIKPNDCE 240

Query: 241  LMGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            L+GIDST KSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSTSKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGGKTKPIRGFCQRLKGKQ 360
            AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNP+M+PG S+G K+KPIRGFCQRLKGKQ
Sbjct: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPSMLPG-SSGTKSKPIRGFCQRLKGKQ 359

Query: 361  GRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKAKLQQLVI 420
            GRFRGNLSGKRVDFSGRTV+SPDPNLSIDEVAVPDRVAK+LTYPE VTRYNK KLQQLVI
Sbjct: 360  GRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKILTYPEKVTRYNKHKLQQLVI 419

Query: 421  NGPNEHPGANYLLKKDEEARRNLRYGDRIKLAKNLQYGDLVERHLEDGDVVLFNRQPSLH 480
            NGP  HPGANYLLKK+E+ARRNLRYGDR+KLAK LQYGD+VERH+EDGDVVLFNRQPSLH
Sbjct: 420  NGPKVHPGANYLLKKNEDARRNLRYGDRVKLAKQLQYGDVVERHIEDGDVVLFNRQPSLH 479

Query: 481  RLSILSHFAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL 540
            RLSILSH+AKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL
Sbjct: 480  RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL 539

Query: 541  LTPKSGEPIIAATQDFITGSYLISHKDSFYSRAEFVQLLSMMSDGNMQFDIPPPAIMKPY 600
            LTPKSGEPIIAATQDFITGSYLISHKDSF+ RA+  QLLSMMSD N+QFDIPPP+IMKP+
Sbjct: 540  LTPKSGEPIIAATQDFITGSYLISHKDSFFDRAQLTQLLSMMSDSNLQFDIPPPSIMKPH 599

Query: 601  YMWTGKQVFSLLIRPNKKSSVVINLDAKNKVYIPPKHKHLPNEMSINDGFVVIRGSQILS 660
            Y+WTGKQVFSLLI+P++KS VVINLDAKNKVY+PP  K  PNEMS NDGFV+IRGS ILS
Sbjct: 600  YLWTGKQVFSLLIKPSRKSPVVINLDAKNKVYLPPPKKEYPNEMSQNDGFVLIRGSNILS 659

Query: 661  GVMDKSVLGDGKKHSVFYTILRDFGPKEAAYAMNRMAKLCARYLGNRGFSIGINDVTPGF 720
            GVMDKSVLGDGKKHSVFYTILRD+GP EAA AMNRMAKLCARYLGNRGFSIGINDVTPG 
Sbjct: 660  GVMDKSVLGDGKKHSVFYTILRDYGPNEAAQAMNRMAKLCARYLGNRGFSIGINDVTPGS 719

Query: 721  ELKNKKEVMVEDAYAKCDDLIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVC 780
            +LK KKE MVE AYAKCD+LID FNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVC
Sbjct: 720  DLKQKKEQMVESAYAKCDELIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVC 779

Query: 781  IKELDNLNSCLIMANCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSKT 840
            I+ELDNLN+ LIMA CGSKGS LNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSKT
Sbjct: 780  IRELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKT 839

Query: 841  PQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD 900
            PQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD
Sbjct: 840  PQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD 899

Query: 901  NTIRTSSNGIVQFTYGGDGLDPIDMEGNAQPVNFTRSWDHANNITFNHSDKPLLPYQIMQ 960
            NT+RTSSNGIVQFTYGGDGLDP+DMEGNAQPVNF RSW HANN+T N +   LLPYQI+ 
Sbjct: 900  NTVRTSSNGIVQFTYGGDGLDPLDMEGNAQPVNFNRSWTHANNLTLNDNSPGLLPYQIIA 959

Query: 961  QTNSILQPLEEKLVRYDNLGRTLDPSLQDRAEFIDQDDAERNFYKSLREYLHTKASHLAK 1020
            +TN ILQPLE KL RYDN+G+ L    + + E+IDQ DAER+FY+SLRE++  KA  LA 
Sbjct: 960  ETNVILQPLENKLKRYDNIGQELRKEDEHKDEYIDQFDAERSFYQSLREFMTEKALTLAS 1019

Query: 1021 IRSHKGLKQFLDEPAPELQSMDLDEGSPSALLASVDQLCKISSKLVAKFLEIAIFKYHKA 1080
            +R  +GLK+ +DEPA EL+  + DE  P+++  +++QLCKIS  LV KFL IAI KYH+A
Sbjct: 1020 LRGERGLKELVDEPAEELREFNWDENVPASITIALNQLCKISKILVQKFLSIAISKYHRA 1079

Query: 1081 KVEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII 1140
            +VEPGTAVGA+GA SIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII
Sbjct: 1080 RVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII 1139

Query: 1141 NAVL 1144
            NAVL
Sbjct: 1140 NAVL 1143

>NDAI0C01620 Chr3 (346478..350860) [4383 bp, 1460 aa] {ON} Anc_5.426
          Length = 1460

 Score = 2023 bits (5242), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 955/1145 (83%), Positives = 1041/1145 (90%), Gaps = 1/1145 (0%)

Query: 1    MKEVVVDIAPKRIKGLEFSALSASDIVGQSKVEISTRDLFDLENGRKPKSGGALDTRMGV 60
            MKEVVV   PKRI GLEFSALSA+DIV QS+VEIS+RDLFDLE GR+PK+GGALD RMGV
Sbjct: 1    MKEVVVSENPKRISGLEFSALSAADIVAQSEVEISSRDLFDLEKGREPKTGGALDKRMGV 60

Query: 61   SSSQAECSTCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKSCAALLLSEEDK 120
            SSS  EC TCHGNLASCHGHFGHIKL+LPVFHVGYFKATIQ+LQ ICK+C+A+LLS++D+
Sbjct: 61   SSSSLECETCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKTCSAILLSDKDR 120

Query: 121  RQFLSELRRPGIDNLRRMGILKKVVDQCKKQRRCLRCGSLNXXXXXXXXXXXXXXLKILH 180
            RQFL+ELRRPG+DNLRRMGILKKV+DQCKKQRRCL+CG+LN              LKI+H
Sbjct: 121  RQFLNELRRPGVDNLRRMGILKKVLDQCKKQRRCLQCGALNGVVKKAAAGAGSASLKIIH 180

Query: 181  DTFRWVGKKSAPEKDKWVGDWKTVLSHNPELERYVKKCMDDLNPLKTLNLFKQVSPEDCE 240
            D FRWVGKKSAPEKDKWVGDWK VLSH+PELER+VK+C DDLNPLKTLNLFKQ+ PEDCE
Sbjct: 181  DNFRWVGKKSAPEKDKWVGDWKEVLSHHPELERFVKRCSDDLNPLKTLNLFKQIKPEDCE 240

Query: 241  LMGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            L+G++STVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGVNSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGG-KTKPIRGFCQRLKGK 359
            AGLEKGISINNMME WDYLQL VAMYINSDSVNPAM+PG S+GG K KPIRGFCQRLKGK
Sbjct: 301  AGLEKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGASSGGGKVKPIRGFCQRLKGK 360

Query: 360  QGRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKAKLQQLV 419
            QGRFRGNLSGKRVDFSGRTV+SPDPNLSIDEVAVPDRVAKVLT+PE VTRYN+ KLQQL+
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNRQKLQQLI 420

Query: 420  INGPNEHPGANYLLKKDEEARRNLRYGDRIKLAKNLQYGDLVERHLEDGDVVLFNRQPSL 479
            INGPN HPGANYLLK +E+ARRNLRYGDR+KLAKNLQ+GD+VERHLEDGDVVLFNRQPSL
Sbjct: 421  INGPNVHPGANYLLKNNEDARRNLRYGDRVKLAKNLQFGDVVERHLEDGDVVLFNRQPSL 480

Query: 480  HRLSILSHFAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 539
            HRLSILSH+AKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 540  LLTPKSGEPIIAATQDFITGSYLISHKDSFYSRAEFVQLLSMMSDGNMQFDIPPPAIMKP 599
            LLTPKSGEPIIAATQDFITGSYLISHKDSF+ RA   QLLSMM D N+QFDIPPPAIMKP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMMCDANLQFDIPPPAIMKP 600

Query: 600  YYMWTGKQVFSLLIRPNKKSSVVINLDAKNKVYIPPKHKHLPNEMSINDGFVVIRGSQIL 659
            +Y+WTGKQ+FSLLI+PNK S VVINLDAKNKVYIPPK K  PNEMS NDG+V+IRGSQIL
Sbjct: 601  HYLWTGKQLFSLLIKPNKDSPVVINLDAKNKVYIPPKTKAYPNEMSRNDGYVIIRGSQIL 660

Query: 660  SGVMDKSVLGDGKKHSVFYTILRDFGPKEAAYAMNRMAKLCARYLGNRGFSIGINDVTPG 719
            SGVMDKSVLGDGKKHSVFYTILRD+GP+EAA AMNRMAKLCAR+LGNRGFSIGI+DVTP 
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAATAMNRMAKLCARFLGNRGFSIGISDVTPA 720

Query: 720  FELKNKKEVMVEDAYAKCDDLIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 779
             +LK KKE +VE AYAKCD+LIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVG+V
Sbjct: 721  DDLKQKKEELVEIAYAKCDELIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780

Query: 780  CIKELDNLNSCLIMANCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSK 839
            CI ELDNLN+ LIMA CGSKGS LNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSK
Sbjct: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSK 840

Query: 840  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 899
            TPQSKGFVRNSFFSGL+PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 900  DNTIRTSSNGIVQFTYGGDGLDPIDMEGNAQPVNFTRSWDHANNITFNHSDKPLLPYQIM 959
            DNT+RTSSNGIVQFTYGGDGLDP++MEGNA+PVNF RSWDHA NITF+     LLPYQIM
Sbjct: 901  DNTVRTSSNGIVQFTYGGDGLDPMEMEGNAKPVNFNRSWDHATNITFSPDQHGLLPYQIM 960

Query: 960  QQTNSILQPLEEKLVRYDNLGRTLDPSLQDRAEFIDQDDAERNFYKSLREYLHTKASHLA 1019
            + TN+IL+PLE++L+RYDNLG  +      +AE++DQ DAER+FYKSLR+Y+  KA  L 
Sbjct: 961  ETTNAILKPLEDRLIRYDNLGEIVPNEDSTKAEYVDQFDAERDFYKSLRDYMDEKAKVLG 1020

Query: 1020 KIRSHKGLKQFLDEPAPELQSMDLDEGSPSALLASVDQLCKISSKLVAKFLEIAIFKYHK 1079
             +R  +G+   +DEPA EL+ M+ DE  P  +  SVDQL KI+  LV KFLEIA++KY K
Sbjct: 1021 SVRKSRGMLPMVDEPAEELKKMNPDEQVPETIRYSVDQLYKITEDLVKKFLEIALYKYRK 1080

Query: 1080 AKVEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1139
            A+VEPGTAVGA+GA SIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI
Sbjct: 1081 ARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140

Query: 1140 INAVL 1144
            INAVL
Sbjct: 1141 INAVL 1145

>NCAS0H02040 Chr8 complement(393711..398093) [4383 bp, 1460 aa] {ON}
            Anc_5.426
          Length = 1460

 Score = 2019 bits (5230), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 953/1145 (83%), Positives = 1047/1145 (91%), Gaps = 1/1145 (0%)

Query: 1    MKEVVVDIAPKRIKGLEFSALSASDIVGQSKVEISTRDLFDLENGRKPKSGGALDTRMGV 60
            MKEVVV   PKRI GLEFSALSA+DIV QS++E+S+RDLFDLE GR+PK GGALD +MGV
Sbjct: 1    MKEVVVSENPKRISGLEFSALSAADIVAQSEIEVSSRDLFDLEKGREPKIGGALDRKMGV 60

Query: 61   SSSQAECSTCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKSCAALLLSEEDK 120
            SSS  EC TCHGNLASCHGHFGHIKL+LPVFHVGYFKATIQ+LQ +CK+C+A+LL+++DK
Sbjct: 61   SSSSLECETCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGVCKTCSAILLNDQDK 120

Query: 121  RQFLSELRRPGIDNLRRMGILKKVVDQCKKQRRCLRCGSLNXXXXXXXXXXXXXXLKILH 180
            RQFL+ELRRPG+DNLRRMGILKKV+DQCKKQRRCL+CG+LN              LKI+H
Sbjct: 121  RQFLTELRRPGVDNLRRMGILKKVLDQCKKQRRCLQCGALNGVVKKAAAGAGPASLKIIH 180

Query: 181  DTFRWVGKKSAPEKDKWVGDWKTVLSHNPELERYVKKCMDDLNPLKTLNLFKQVSPEDCE 240
            DTFRWVGKKSAPEKDKWVGDWK VLSH+PELER++K+C DDLNPLKTLNLFKQ+ PEDCE
Sbjct: 181  DTFRWVGKKSAPEKDKWVGDWKEVLSHHPELERFMKRCSDDLNPLKTLNLFKQIKPEDCE 240

Query: 241  LMGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            L+GIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGG-KTKPIRGFCQRLKGK 359
            AGLEKGISINNMME WDYLQL VAMYINSDSVNPAM+PG S+GG K KPIRGFCQRLKGK
Sbjct: 301  AGLEKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGASSGGGKVKPIRGFCQRLKGK 360

Query: 360  QGRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKAKLQQLV 419
            QGRFRGNLSGKRVDFSGRTV+SPDPNLSIDEVAVPDRVAKVLT+PE VTRYNK KLQQL+
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNKQKLQQLI 420

Query: 420  INGPNEHPGANYLLKKDEEARRNLRYGDRIKLAKNLQYGDLVERHLEDGDVVLFNRQPSL 479
            INGPN HPGANYLLKK+E+ARRNLRYGDRIKLAKNLQ+GD+VERHLEDGDVVLFNRQPSL
Sbjct: 421  INGPNVHPGANYLLKKNEDARRNLRYGDRIKLAKNLQHGDVVERHLEDGDVVLFNRQPSL 480

Query: 480  HRLSILSHFAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 539
            HRLSILSHFAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHFAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 540  LLTPKSGEPIIAATQDFITGSYLISHKDSFYSRAEFVQLLSMMSDGNMQFDIPPPAIMKP 599
            LLTPKSGEPIIAATQDFITGSYLISHKDSF+ RA   QLLSMMS+G ++FDIPPPAIMKP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMMSNGTLRFDIPPPAIMKP 600

Query: 600  YYMWTGKQVFSLLIRPNKKSSVVINLDAKNKVYIPPKHKHLPNEMSINDGFVVIRGSQIL 659
            YYMWTGKQVFSLLIRPNK+S VVINLDAKNKV++PPK+K  PNEMS NDG+VVIRGS IL
Sbjct: 601  YYMWTGKQVFSLLIRPNKESPVVINLDAKNKVFMPPKYKDYPNEMSRNDGYVVIRGSNIL 660

Query: 660  SGVMDKSVLGDGKKHSVFYTILRDFGPKEAAYAMNRMAKLCARYLGNRGFSIGINDVTPG 719
            SGVMDKSVLGDGKKHSVFYTILRD+GP+EAA AMNRM+KLCARYLGNRGFSIGI+DVTP 
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMSKLCARYLGNRGFSIGISDVTPA 720

Query: 720  FELKNKKEVMVEDAYAKCDDLIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 779
             +LK KKE +VE AYAKCD+LIDQF+KGKLETQPGCNEEQTLEAKIGGLLSKVREEVG+V
Sbjct: 721  DDLKQKKEELVEIAYAKCDELIDQFHKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780

Query: 780  CIKELDNLNSCLIMANCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSK 839
            CI ELDNLN+ LIMA CGSKGS LNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSK
Sbjct: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSK 840

Query: 840  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 899
            TPQSKGFVRNSFFSGL+PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 900  DNTIRTSSNGIVQFTYGGDGLDPIDMEGNAQPVNFTRSWDHANNITFNHSDKPLLPYQIM 959
            DNT+RTSSNGIVQFTYGGDGLDP++MEGNA+PVNF RSWDHA NITF++ +K LLPY+IM
Sbjct: 901  DNTVRTSSNGIVQFTYGGDGLDPMEMEGNAKPVNFNRSWDHAINITFSNLEKGLLPYEIM 960

Query: 960  QQTNSILQPLEEKLVRYDNLGRTLDPSLQDRAEFIDQDDAERNFYKSLREYLHTKASHLA 1019
            ++TN IL+PLEE+L+RYDN+G  +     ++AE++DQ DAER+FY+SLR+Y+  KA  LA
Sbjct: 961  EKTNEILKPLEERLIRYDNVGELVPKKDNEKAEYVDQFDAERDFYRSLRDYIQEKADILA 1020

Query: 1020 KIRSHKGLKQFLDEPAPELQSMDLDEGSPSALLASVDQLCKISSKLVAKFLEIAIFKYHK 1079
            ++R  +G+ +   EP  EL+ +D DE    ++  SVDQL KI+ K V  FLEIA++KY K
Sbjct: 1021 RVRKSRGMLEMSSEPGEELRKLDPDERITESIKHSVDQLYKITEKSVQTFLEIALYKYRK 1080

Query: 1080 AKVEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1139
            A+VEPGTAVGA+GA SIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI
Sbjct: 1081 ARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140

Query: 1140 INAVL 1144
            INAVL
Sbjct: 1141 INAVL 1145

>TDEL0E01990 Chr5 (373218..377600) [4383 bp, 1460 aa] {ON} Anc_5.426
            YOR116C
          Length = 1460

 Score = 2013 bits (5214), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 948/1145 (82%), Positives = 1036/1145 (90%), Gaps = 1/1145 (0%)

Query: 1    MKEVVVDIAPKRIKGLEFSALSASDIVGQSKVEISTRDLFDLENGRKPKSGGALDTRMGV 60
            MKEVVV   PKRI GLEFSALSA+DIV QS+VEISTRDLFDLENGR P++GGALD +MGV
Sbjct: 1    MKEVVVSATPKRISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPRAGGALDPKMGV 60

Query: 61   SSSQAECSTCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKSCAALLLSEEDK 120
            SSS  EC+TCHGNLASCHGHFGHIKL+LPVFHVGYFKATIQ+LQ ICK+C+A+LL + D+
Sbjct: 61   SSSSLECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKNCSAVLLDDHDR 120

Query: 121  RQFLSELRRPGIDNLRRMGILKKVVDQCKKQRRCLRCGSLNXXXXXXXXXXXXXXLKILH 180
            R FLSELRRPG+DNLRRMGIL KV+DQCKKQRRCL+CG+LN              LKI+H
Sbjct: 121  RHFLSELRRPGVDNLRRMGILSKVLDQCKKQRRCLQCGALNGVVKKAAAGSGSASLKIIH 180

Query: 181  DTFRWVGKKSAPEKDKWVGDWKTVLSHNPELERYVKKCMDDLNPLKTLNLFKQVSPEDCE 240
            DTFRW GKKS PEKDKWVGDW  VLSHNPELERYVK+CMDDLNPLKTLNLFKQ+ PEDCE
Sbjct: 181  DTFRWAGKKSVPEKDKWVGDWDEVLSHNPELERYVKRCMDDLNPLKTLNLFKQLKPEDCE 240

Query: 241  LMGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            L+GIDS+ KSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSSNKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGG-KTKPIRGFCQRLKGK 359
            +GLEKGISINNMME WDYLQL+VAMYINSDSVNPAMMPG S+GG K KPIRGFCQRLKGK
Sbjct: 301  SGLEKGISINNMMEHWDYLQLSVAMYINSDSVNPAMMPGASSGGGKVKPIRGFCQRLKGK 360

Query: 360  QGRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKAKLQQLV 419
            QGRFRGNLSGKRVDFSGRTV+SPDPNLSIDEVAVPDRVAKVLTYPE VTRYN+ KLQQL+
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRQKLQQLL 420

Query: 420  INGPNEHPGANYLLKKDEEARRNLRYGDRIKLAKNLQYGDLVERHLEDGDVVLFNRQPSL 479
            INGPN HPGANYLLKKDE+ARRNLRYGDR+KLAKNL+ GD+VERHLEDGDVVLFNRQPSL
Sbjct: 421  INGPNVHPGANYLLKKDEDARRNLRYGDRVKLAKNLRVGDVVERHLEDGDVVLFNRQPSL 480

Query: 480  HRLSILSHFAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 539
            HRLSILSH+AKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 540  LLTPKSGEPIIAATQDFITGSYLISHKDSFYSRAEFVQLLSMMSDGNMQFDIPPPAIMKP 599
            LLTPKSGEPIIAATQDFITGSYLISHKDSF+ R    QLLSMMSDGN+QFDIP PAIMKP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRGSLTQLLSMMSDGNLQFDIPAPAIMKP 600

Query: 600  YYMWTGKQVFSLLIRPNKKSSVVINLDAKNKVYIPPKHKHLPNEMSINDGFVVIRGSQIL 659
             Y+WTGKQVFSLLI+PNKKS VVINLDAKNKV+IPPK K LP+EMS NDG+V+IRGS+IL
Sbjct: 601  CYLWTGKQVFSLLIKPNKKSPVVINLDAKNKVFIPPKSKSLPSEMSQNDGYVIIRGSEIL 660

Query: 660  SGVMDKSVLGDGKKHSVFYTILRDFGPKEAAYAMNRMAKLCARYLGNRGFSIGINDVTPG 719
            SGVMDKSVLGDGKKHSVFYTILRD+GP+EAA AMNRMAKLCARYLGNRGFSIGI+DVTP 
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARYLGNRGFSIGISDVTPA 720

Query: 720  FELKNKKEVMVEDAYAKCDDLIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 779
             +LK KKE MVE AYAKCD+LID +NKGKLETQPGCNEEQTLEAKIGGLLSKVREEVG+V
Sbjct: 721  DDLKKKKEDMVEFAYAKCDELIDSYNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780

Query: 780  CIKELDNLNSCLIMANCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSK 839
            CI ELDNLN+ LIMA CGSKGS LNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSK
Sbjct: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840

Query: 840  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 899
            TPQSKGFVRNSFFSGL+PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 900  DNTIRTSSNGIVQFTYGGDGLDPIDMEGNAQPVNFTRSWDHANNITFNHSDKPLLPYQIM 959
            DNT+RTSSNGIVQFTYGGDGLDP++MEGNAQPVNF RSW+HA N+TFN++++ L PYQI 
Sbjct: 901  DNTVRTSSNGIVQFTYGGDGLDPMEMEGNAQPVNFVRSWNHAFNVTFNNTERGLFPYQIE 960

Query: 960  QQTNSILQPLEEKLVRYDNLGRTLDPSLQDRAEFIDQDDAERNFYKSLREYLHTKASHLA 1019
            ++T+ IL PL  +L+RYDN+G+ +        E+IDQ+DAERNFY SL+ ++  KA  LA
Sbjct: 961  EETDKILAPLMNRLIRYDNVGKLVPKEKDALIEYIDQNDAERNFYLSLKSFMRGKAELLA 1020

Query: 1020 KIRSHKGLKQFLDEPAPELQSMDLDEGSPSALLASVDQLCKISSKLVAKFLEIAIFKYHK 1079
             +R  +G+K+ LDEP PE +++D DE  P  +  SVDQLC+I+   V +FL+IAI KY +
Sbjct: 1021 SVRKQRGMKELLDEPGPEFKNIDFDEDVPENIRHSVDQLCRITGDSVREFLKIAISKYRR 1080

Query: 1080 AKVEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1139
            A+VEPGTAVGA+GA SIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI
Sbjct: 1081 ARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140

Query: 1140 INAVL 1144
            INAVL
Sbjct: 1141 INAVL 1145

>KAFR0D05030 Chr4 complement(988159..992547) [4389 bp, 1462 aa] {ON}
            Anc_5.426 YOR116C
          Length = 1462

 Score = 2009 bits (5205), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 950/1146 (82%), Positives = 1037/1146 (90%), Gaps = 2/1146 (0%)

Query: 1    MKEVVVDIAPKRIKGLEFSALSASDIVGQSKVEISTRDLFDLENGRKPKSGGALDTRMGV 60
            MKEVV+  APK+I G+EFSALSASDIV QS+VEIS+RDLFDLE  RK K  GALD RMGV
Sbjct: 1    MKEVVISEAPKKISGIEFSALSASDIVAQSEVEISSRDLFDLEQNRKQKENGALDPRMGV 60

Query: 61   SSSQAECSTCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKSCAALLLSEEDK 120
            SSS   C TCHGNLASCHGHFGHIKL+LPVFHVGYFKATIQ+LQ+ICK+C+++LLS+EDK
Sbjct: 61   SSSSLTCETCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQAICKNCSSVLLSDEDK 120

Query: 121  RQFLSELRRPG-IDNLRRMGILKKVVDQCKKQRRCLRCGSLNXXXXXXXXXXXXXXLKIL 179
            +++L ELR  G IDNL++MGILKKV+DQCKKQRRCL CG+LN              LKI+
Sbjct: 121  KKYLHELRTSGRIDNLKKMGILKKVMDQCKKQRRCLHCGALNGVVKKAAAGSGTASLKII 180

Query: 180  HDTFRWVGKKSAPEKDKWVGDWKTVLSHNPELERYVKKCMDDLNPLKTLNLFKQVSPEDC 239
            HDTFRWVGKKS PEKD W+GDW  VLSH+PELER+VK+C DDLNPLKTLNLFKQV PEDC
Sbjct: 181  HDTFRWVGKKSTPEKDNWIGDWNEVLSHHPELERFVKRCTDDLNPLKTLNLFKQVRPEDC 240

Query: 240  ELMGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLI 299
            EL+GIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLT+KLTEIVWTSSLI
Sbjct: 241  ELLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTIKLTEIVWTSSLI 300

Query: 300  KAGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGG-KTKPIRGFCQRLKG 358
            KAGLEKGISINNMME WDYLQL VAMYIN+DSVNPAM+PG S+GG K KPIRGFCQRLKG
Sbjct: 301  KAGLEKGISINNMMEHWDYLQLTVAMYINADSVNPAMLPGASSGGGKVKPIRGFCQRLKG 360

Query: 359  KQGRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKAKLQQL 418
            KQGRFRGNLSGKRVDFSGRTV+SPDPNLSIDEVAVPDRVAKVLTYPE VTRYN+ KLQ+L
Sbjct: 361  KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRKKLQEL 420

Query: 419  VINGPNEHPGANYLLKKDEEARRNLRYGDRIKLAKNLQYGDLVERHLEDGDVVLFNRQPS 478
            V+NGPN HPGANYLLKK+EEARRNLRYGDR+KLAKNLQYGD+VERHLEDGDVVLFNRQPS
Sbjct: 421  VMNGPNIHPGANYLLKKNEEARRNLRYGDRLKLAKNLQYGDIVERHLEDGDVVLFNRQPS 480

Query: 479  LHRLSILSHFAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN 538
            LHRLSILSH+AKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN
Sbjct: 481  LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN 540

Query: 539  NLLTPKSGEPIIAATQDFITGSYLISHKDSFYSRAEFVQLLSMMSDGNMQFDIPPPAIMK 598
            NLLTPKSGEPIIAATQDFITGSYLISHKDSF+ RA F QLLSMMSDGN+QFDIPPPAIMK
Sbjct: 541  NLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFTQLLSMMSDGNLQFDIPPPAIMK 600

Query: 599  PYYMWTGKQVFSLLIRPNKKSSVVINLDAKNKVYIPPKHKHLPNEMSINDGFVVIRGSQI 658
            PYY+WTGKQ+FSLLI+PN KS VVINLDAKNKVYIPPK K LPNEMS NDGFV+IRGS I
Sbjct: 601  PYYLWTGKQLFSLLIKPNHKSPVVINLDAKNKVYIPPKSKSLPNEMSRNDGFVIIRGSNI 660

Query: 659  LSGVMDKSVLGDGKKHSVFYTILRDFGPKEAAYAMNRMAKLCARYLGNRGFSIGINDVTP 718
            LSGVMDKSVLGDGKKHSVFYTILRD+GP+EAA AMNRM+KLCAR+LGNRGFSIGI+DVTP
Sbjct: 661  LSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMSKLCARFLGNRGFSIGISDVTP 720

Query: 719  GFELKNKKEVMVEDAYAKCDDLIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGE 778
              +LK KKE +VE AYAKCDDLID +NKGKLETQPGCNEE+TLEAKIGGLLSKVREEVG+
Sbjct: 721  ADDLKIKKEELVEIAYAKCDDLIDSYNKGKLETQPGCNEEETLEAKIGGLLSKVREEVGD 780

Query: 779  VCIKELDNLNSCLIMANCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNS 838
            VCI ELDNLN+ LIMA CGSKGS LNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNS
Sbjct: 781  VCINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNS 840

Query: 839  KTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ 898
            KTPQSKGFVRNSFFSGL+PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ
Sbjct: 841  KTPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ 900

Query: 899  YDNTIRTSSNGIVQFTYGGDGLDPIDMEGNAQPVNFTRSWDHANNITFNHSDKPLLPYQI 958
            YDNT+RTSSNGIVQFTYGGDGLDP++MEG+AQPVNF RSWDHA NITFN++++ LLPYQ+
Sbjct: 901  YDNTVRTSSNGIVQFTYGGDGLDPMEMEGSAQPVNFNRSWDHALNITFNNNERGLLPYQV 960

Query: 959  MQQTNSILQPLEEKLVRYDNLGRTLDPSLQDRAEFIDQDDAERNFYKSLREYLHTKASHL 1018
            M++TN +L PLEE+LVRYDNLG  +     D+ E+ DQ DAER+FYK+LR Y+ +K+ HL
Sbjct: 961  MKKTNEVLNPLEERLVRYDNLGNEVMKEDLDKLEYADQFDAERDFYKTLRSYIQSKSDHL 1020

Query: 1019 AKIRSHKGLKQFLDEPAPELQSMDLDEGSPSALLASVDQLCKISSKLVAKFLEIAIFKYH 1078
            A +R  +GL + L EP  ELQS+  DE +     +SVDQLCKI+ K V KFLEIA+ KY 
Sbjct: 1021 AHVRKSRGLLELLSEPGEELQSLHPDERATDVSRSSVDQLCKITEKAVLKFLEIALSKYR 1080

Query: 1079 KAKVEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP 1138
            KA+VEPGTAVGA+GA SIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASK ISTP
Sbjct: 1081 KARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKTISTP 1140

Query: 1139 IINAVL 1144
            IINAVL
Sbjct: 1141 IINAVL 1146

>ZYRO0F09856g Chr6 complement(798821..803197) [4377 bp, 1458 aa] {ON}
            highly similar to uniprot|P04051 Saccharomyces cerevisiae
            YOR116C
          Length = 1458

 Score = 2008 bits (5203), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 951/1144 (83%), Positives = 1038/1144 (90%), Gaps = 1/1144 (0%)

Query: 1    MKEVVVDIAPKRIKGLEFSALSASDIVGQSKVEISTRDLFDLENGRKPKSGGALDTRMGV 60
            MKEVV   APK+I GLEFSALSA+DIV QS+VEISTRDLFDLENGR PK+GGALD +MGV
Sbjct: 1    MKEVVSSEAPKKISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPKTGGALDPKMGV 60

Query: 61   SSSQAECSTCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKSCAALLLSEEDK 120
            SSS  EC TCHGNLASCHGHFGHIKL+LPVFH+GYFKATIQ+LQ ICK C+++LL + DK
Sbjct: 61   SSSSMECQTCHGNLASCHGHFGHIKLALPVFHIGYFKATIQILQGICKECSSILLEDTDK 120

Query: 121  RQFLSELRRPGIDNLRRMGILKKVVDQCKKQRRCLRCGSLNXXXXXXXXXXXXXXLKILH 180
            + FLSELRRPG+DNLRRMGILKKV+DQCKKQRRCL+CG+LN              LKI+H
Sbjct: 121  KHFLSELRRPGVDNLRRMGILKKVLDQCKKQRRCLQCGALNGVVKKAAAGGGSASLKIIH 180

Query: 181  DTFRWVGKKSAPEKDKWVGDWKTVLSHNPELERYVKKCMDDLNPLKTLNLFKQVSPEDCE 240
            DTFRW GKKS PEK+KW+GDW +VL+H+PELERYVK+CMDDLNPLKTLNLFKQV PEDCE
Sbjct: 181  DTFRWAGKKSVPEKEKWIGDWDSVLAHSPELERYVKRCMDDLNPLKTLNLFKQVKPEDCE 240

Query: 241  LMGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            L+GIDST+KSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTE+VWTSSLIK
Sbjct: 241  LLGIDSTIKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEVVWTSSLIK 300

Query: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGGKTKPIRGFCQRLKGKQ 360
            AGLEKGISINNMME WDYLQLAVAMYINSDSVNPA++ GG TGGK KPIRGFCQRLKGKQ
Sbjct: 301  AGLEKGISINNMMEHWDYLQLAVAMYINSDSVNPAILSGG-TGGKVKPIRGFCQRLKGKQ 359

Query: 361  GRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKAKLQQLVI 420
            GRFRGNLSGKRVDFSGRTV+SPDPNLS+DEVAVPDRVAKVLTYPE VTRYNK KLQQLV+
Sbjct: 360  GRFRGNLSGKRVDFSGRTVISPDPNLSVDEVAVPDRVAKVLTYPERVTRYNKGKLQQLVV 419

Query: 421  NGPNEHPGANYLLKKDEEARRNLRYGDRIKLAKNLQYGDLVERHLEDGDVVLFNRQPSLH 480
            NGPNE+PGANYLLKKDE+ARRNLR+GDR+KLAKNL+ GDLVERHLEDGDVVLFNRQPSLH
Sbjct: 420  NGPNEYPGANYLLKKDEDARRNLRFGDRVKLAKNLRIGDLVERHLEDGDVVLFNRQPSLH 479

Query: 481  RLSILSHFAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL 540
            RLSILSH+AKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQ+EEARAEAINLMGVK+NL
Sbjct: 480  RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQSEEARAEAINLMGVKSNL 539

Query: 541  LTPKSGEPIIAATQDFITGSYLISHKDSFYSRAEFVQLLSMMSDGNMQFDIPPPAIMKPY 600
            LTPKSGEPIIAATQDFITGSYLISHKDSF+ + +  QLLSMMSDG +QFDIPPP I KP 
Sbjct: 540  LTPKSGEPIIAATQDFITGSYLISHKDSFFDKYDMTQLLSMMSDGALQFDIPPPTIWKPC 599

Query: 601  YMWTGKQVFSLLIRPNKKSSVVINLDAKNKVYIPPKHKHLPNEMSINDGFVVIRGSQILS 660
            Y+WTGKQ+FSLLIRPNKKS VV+NLDAKNKVYIPPK K LPNEMS NDGFV+IRGSQILS
Sbjct: 600  YLWTGKQIFSLLIRPNKKSPVVLNLDAKNKVYIPPKSKSLPNEMSQNDGFVLIRGSQILS 659

Query: 661  GVMDKSVLGDGKKHSVFYTILRDFGPKEAAYAMNRMAKLCARYLGNRGFSIGINDVTPGF 720
            GVMDKSVLGDGKKHSVFYTILRD+G +EAA AMNRMAKLCARY+GNRGFSIGI+DVTP  
Sbjct: 660  GVMDKSVLGDGKKHSVFYTILRDYGSQEAAEAMNRMAKLCARYVGNRGFSIGISDVTPAE 719

Query: 721  ELKNKKEVMVEDAYAKCDDLIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVC 780
            ELK KKE MVE AYAKCD+LID F+KGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVC
Sbjct: 720  ELKEKKEEMVESAYAKCDELIDLFSKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVC 779

Query: 781  IKELDNLNSCLIMANCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSKT 840
            I ELDN+N+ LIMA CGSKGS LNVSQMVAVVGQQIISG+RVPDGFQDRSLPHF KNSKT
Sbjct: 780  INELDNMNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGSRVPDGFQDRSLPHFPKNSKT 839

Query: 841  PQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD 900
            PQSKGFVRNSFFSGL+PPEFL+HAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSC YD
Sbjct: 840  PQSKGFVRNSFFSGLTPPEFLYHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCLYD 899

Query: 901  NTIRTSSNGIVQFTYGGDGLDPIDMEGNAQPVNFTRSWDHANNITFNHSDKPLLPYQIMQ 960
            NT+RTSSNGIVQFTYGGDGLDP++MEGNAQPVNF R+WDHA N+TFN+ D+ LLPYQIMQ
Sbjct: 900  NTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPVNFNRTWDHATNVTFNNMDRGLLPYQIMQ 959

Query: 961  QTNSILQPLEEKLVRYDNLGRTLDPSLQDRAEFIDQDDAERNFYKSLREYLHTKASHLAK 1020
             T  ILQPLE +LVRYDNLG  +    +DR E+IDQ+DAER FY SLR+++  KA  LAK
Sbjct: 960  VTEEILQPLENRLVRYDNLGNEITKENRDRIEYIDQNDAERGFYHSLRDFIWAKAQLLAK 1019

Query: 1021 IRSHKGLKQFLDEPAPELQSMDLDEGSPSALLASVDQLCKISSKLVAKFLEIAIFKYHKA 1080
             R  K +K+ +DEPA ELQS+DLDE  P  +  SVDQ+ +I+ K+V +FL +AI KY +A
Sbjct: 1020 FRGSKDMKELMDEPALELQSVDLDENVPEDIRHSVDQVYRITDKMVREFLRVAILKYRRA 1079

Query: 1081 KVEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII 1140
            KVEPGTAVGA+GA SIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII
Sbjct: 1080 KVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII 1139

Query: 1141 NAVL 1144
            NAVL
Sbjct: 1140 NAVL 1143

>TBLA0A03720 Chr1 complement(929751..934127) [4377 bp, 1458 aa] {ON}
            Anc_5.426 YOR116C
          Length = 1458

 Score = 2004 bits (5193), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 944/1144 (82%), Positives = 1028/1144 (89%)

Query: 1    MKEVVVDIAPKRIKGLEFSALSASDIVGQSKVEISTRDLFDLENGRKPKSGGALDTRMGV 60
            MKEVV    PK+I GLEFSALSA+DIV QS+V I+TRDL+DLE+GR PK  GALD RMGV
Sbjct: 1    MKEVVTSEIPKKISGLEFSALSAADIVAQSEVAITTRDLYDLEHGRAPKKSGALDQRMGV 60

Query: 61   SSSQAECSTCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKSCAALLLSEEDK 120
            SSS  EC TCHGNLASCHGHFGHIKL+LPVFHVGYFKATIQ+LQ+ICKSCAA+LLS+EDK
Sbjct: 61   SSSNLECETCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQAICKSCAAVLLSDEDK 120

Query: 121  RQFLSELRRPGIDNLRRMGILKKVVDQCKKQRRCLRCGSLNXXXXXXXXXXXXXXLKILH 180
            R FLSELRRPGIDNL+RMGILKK++DQCKKQRRCL CG LN              LKI+H
Sbjct: 121  RNFLSELRRPGIDNLKRMGILKKILDQCKKQRRCLHCGGLNGVVKKAAAGGGSASLKIIH 180

Query: 181  DTFRWVGKKSAPEKDKWVGDWKTVLSHNPELERYVKKCMDDLNPLKTLNLFKQVSPEDCE 240
            DTFRWVGKK  PEKD WVGDW+ VLSHNPELER+VK+ MDDLNPLKTLNLFKQ+ PEDCE
Sbjct: 181  DTFRWVGKKQTPEKDSWVGDWQEVLSHNPELERFVKRAMDDLNPLKTLNLFKQIKPEDCE 240

Query: 241  LMGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            L+GIDST KSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTE+VWTSSLIK
Sbjct: 241  LLGIDSTSKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEVVWTSSLIK 300

Query: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGGKTKPIRGFCQRLKGKQ 360
            AGLEKGISINNMME WDYLQL+VAMYINSDSVNP +MPG STG K KPIRGFCQRLKGKQ
Sbjct: 301  AGLEKGISINNMMEHWDYLQLSVAMYINSDSVNPLLMPGASTGNKVKPIRGFCQRLKGKQ 360

Query: 361  GRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKAKLQQLVI 420
            GRFRGNLSGKRVDFSGRTV+SPDPNLSIDEVAVPDRVAKVLT+PE VTRYNK KLQ LV+
Sbjct: 361  GRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPERVTRYNKRKLQALVL 420

Query: 421  NGPNEHPGANYLLKKDEEARRNLRYGDRIKLAKNLQYGDLVERHLEDGDVVLFNRQPSLH 480
            NGPN HPGANYLLKKDEEARRNLRYGD++KLAKNLQ GD+VERHLEDGDVVLFNRQPSLH
Sbjct: 421  NGPNVHPGANYLLKKDEEARRNLRYGDKVKLAKNLQIGDVVERHLEDGDVVLFNRQPSLH 480

Query: 481  RLSILSHFAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL 540
            RLSILSH+AKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL
Sbjct: 481  RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL 540

Query: 541  LTPKSGEPIIAATQDFITGSYLISHKDSFYSRAEFVQLLSMMSDGNMQFDIPPPAIMKPY 600
            LTPKSGEPIIAATQDFITGSYLISHKDSF+ RA F QLLSMM DGN+QFDIPPPAIMKP 
Sbjct: 541  LTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFTQLLSMMCDGNLQFDIPPPAIMKPC 600

Query: 601  YMWTGKQVFSLLIRPNKKSSVVINLDAKNKVYIPPKHKHLPNEMSINDGFVVIRGSQILS 660
            Y+WTGKQ+FSLLI+PN  S VVIN+DAKNKV+ PPK K LP+EMS NDGFVVIRGSQILS
Sbjct: 601  YLWTGKQLFSLLIKPNSNSPVVINVDAKNKVFKPPKDKSLPSEMSPNDGFVVIRGSQILS 660

Query: 661  GVMDKSVLGDGKKHSVFYTILRDFGPKEAAYAMNRMAKLCARYLGNRGFSIGINDVTPGF 720
            GVMDKSVLGDGKKHSVFYTILRD+GP+EAA AMNRMAKLCAR+LGNRGFSIGINDVTP  
Sbjct: 661  GVMDKSVLGDGKKHSVFYTILRDYGPQEAATAMNRMAKLCARFLGNRGFSIGINDVTPDD 720

Query: 721  ELKNKKEVMVEDAYAKCDDLIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVC 780
            +LKN KE +VE AYAKCD+LI  +N+GKLETQPGCNEEQTLEAKI G+LSKVREEVG++C
Sbjct: 721  KLKNLKENLVEIAYAKCDELIGLYNQGKLETQPGCNEEQTLEAKISGILSKVREEVGDIC 780

Query: 781  IKELDNLNSCLIMANCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSKT 840
            I ELDN N+ LIMA CGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSKT
Sbjct: 781  INELDNWNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSKT 840

Query: 841  PQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD 900
            PQSKGFVRNSF+SGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD
Sbjct: 841  PQSKGFVRNSFYSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD 900

Query: 901  NTIRTSSNGIVQFTYGGDGLDPIDMEGNAQPVNFTRSWDHANNITFNHSDKPLLPYQIMQ 960
            NT+RTSSNGIVQFTYGGDGLDP DMEGNAQPVNF RSWDHA NI F+++DK + PYQI++
Sbjct: 901  NTVRTSSNGIVQFTYGGDGLDPFDMEGNAQPVNFNRSWDHAYNIKFDNNDKTIYPYQILE 960

Query: 961  QTNSILQPLEEKLVRYDNLGRTLDPSLQDRAEFIDQDDAERNFYKSLREYLHTKASHLAK 1020
             TN IL PLEEKL+RYDN+G+ + P    + EF+DQ DAERNFY SLR+Y+  KA+ LA 
Sbjct: 961  ITNDILHPLEEKLIRYDNIGKVVTPENSGKDEFVDQLDAERNFYNSLRDYMTKKANELAD 1020

Query: 1021 IRSHKGLKQFLDEPAPELQSMDLDEGSPSALLASVDQLCKISSKLVAKFLEIAIFKYHKA 1080
            +R  +G+K+ L  P  E + MDLDE +P ++  SV+Q+C+I+   V +FL+IAI KY +A
Sbjct: 1021 VRKSRGMKELLSAPGDEFKLMDLDEQTPDSIRHSVEQICRITENTVREFLKIAITKYRRA 1080

Query: 1081 KVEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII 1140
            +VEPGTAVGA+GA SIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII
Sbjct: 1081 RVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII 1140

Query: 1141 NAVL 1144
            NAVL
Sbjct: 1141 NAVL 1144

>Kpol_1016.9 s1016 (19972..24354) [4383 bp, 1460 aa] {ON}
            (19972..24354) [4383 nt, 1461 aa]
          Length = 1460

 Score = 2004 bits (5191), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 946/1145 (82%), Positives = 1032/1145 (90%), Gaps = 1/1145 (0%)

Query: 1    MKEVVVDIAPKRIKGLEFSALSASDIVGQSKVEISTRDLFDLENGRKPKSGGALDTRMGV 60
            MKEVVV   PK+I GLEFSALSASDIV QS+VE+STRDLFDLENGR PK GGALD +MGV
Sbjct: 1    MKEVVVSETPKKISGLEFSALSASDIVAQSEVEVSTRDLFDLENGRAPKIGGALDPKMGV 60

Query: 61   SSSQAECSTCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKSCAALLLSEEDK 120
            SSS  EC+TCHGNLASCHGHFGHIKL+LPVFHVGYFKATIQ+LQ ICK+C+++LL++ D+
Sbjct: 61   SSSSMECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKNCSSILLNDTDR 120

Query: 121  RQFLSELRRPGIDNLRRMGILKKVVDQCKKQRRCLRCGSLNXXXXXXXXXXXXXXLKILH 180
            R FL ELRRPGIDNL+RM I+KK++DQCKKQRRCL CG+LN              LKI+H
Sbjct: 121  RDFLHELRRPGIDNLKRMAIIKKILDQCKKQRRCLTCGALNGVVKRAAAGSGSASLKIIH 180

Query: 181  DTFRWVGKKSAPEKDKWVGDWKTVLSHNPELERYVKKCMDDLNPLKTLNLFKQVSPEDCE 240
            DTFRWVGKKS+PEKD+WVGDW+ VL++NPELER+ K+ MDDLNPLKTLNLFKQ+ PEDCE
Sbjct: 181  DTFRWVGKKSSPEKDEWVGDWEKVLANNPELERFAKRSMDDLNPLKTLNLFKQIRPEDCE 240

Query: 241  LMGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            L+GIDSTVK+GRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSTVKAGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGG-KTKPIRGFCQRLKGK 359
            AGLEKGISINNMME WDYLQL+VAMYINSDSVNP+MMPG S+GG K KPIRGFCQRLKGK
Sbjct: 301  AGLEKGISINNMMEHWDYLQLSVAMYINSDSVNPSMMPGASSGGAKAKPIRGFCQRLKGK 360

Query: 360  QGRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKAKLQQLV 419
            QGRFRGNLSGKRVDFSGRTV+SPDPNLSIDEVAVPDRVAKVLTYPE VTRYN+ KLQ LV
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNREKLQALV 420

Query: 420  INGPNEHPGANYLLKKDEEARRNLRYGDRIKLAKNLQYGDLVERHLEDGDVVLFNRQPSL 479
            INGPN HPGANY+LK +EEARRNLRYGDR+K+AK L+ GD+VERHLEDGD+VLFNRQPSL
Sbjct: 421  INGPNVHPGANYILKANEEARRNLRYGDRLKIAKQLRVGDIVERHLEDGDIVLFNRQPSL 480

Query: 480  HRLSILSHFAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 539
            HRLSILSHFAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEA+NLMGVKNN
Sbjct: 481  HRLSILSHFAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAMNLMGVKNN 540

Query: 540  LLTPKSGEPIIAATQDFITGSYLISHKDSFYSRAEFVQLLSMMSDGNMQFDIPPPAIMKP 599
            LLTPKSGEPIIAATQDFITGSYLISHKD+F  RA F QLLSMMSD N+QFDIPPP I+KP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDTFLDRATFTQLLSMMSDSNLQFDIPPPTIIKP 600

Query: 600  YYMWTGKQVFSLLIRPNKKSSVVINLDAKNKVYIPPKHKHLPNEMSINDGFVVIRGSQIL 659
            Y +WTGKQ+FSLLI+PNK S VVINLDAKNKV+IPPK K LPNEMS NDGFVVIRGSQIL
Sbjct: 601  YCLWTGKQLFSLLIKPNKDSPVVINLDAKNKVFIPPKSKSLPNEMSQNDGFVVIRGSQIL 660

Query: 660  SGVMDKSVLGDGKKHSVFYTILRDFGPKEAAYAMNRMAKLCARYLGNRGFSIGINDVTPG 719
            SGVMDKSVLGDGKKHSVFYTILRD+GP+EAA AMNRMAKLCARYLGNRGFSIGI+DVTP 
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARYLGNRGFSIGISDVTPD 720

Query: 720  FELKNKKEVMVEDAYAKCDDLIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 779
              LK KKE +VE AYAKCD+LID F KGKLETQPGCNEEQTLEAKIGGLLSKVREEVG++
Sbjct: 721  NALKQKKEELVEIAYAKCDELIDLFTKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDI 780

Query: 780  CIKELDNLNSCLIMANCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSK 839
            CI ELDNLN+ LIMA CGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSK
Sbjct: 781  CINELDNLNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFRKNSK 840

Query: 840  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 899
            TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 900  DNTIRTSSNGIVQFTYGGDGLDPIDMEGNAQPVNFTRSWDHANNITFNHSDKPLLPYQIM 959
            DNT+RTSSNGIVQFTYGGDGLDP++MEGNAQPVNF RSWDHA NITF++S + LLPY I+
Sbjct: 901  DNTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPVNFKRSWDHAINITFDNSAQGLLPYAII 960

Query: 960  QQTNSILQPLEEKLVRYDNLGRTLDPSLQDRAEFIDQDDAERNFYKSLREYLHTKASHLA 1019
             +TN IL P EE+L+RYDN+G  +  + Q + EF+DQ D+ERNFY SLR+Y+  KAS LA
Sbjct: 961  NKTNDILAPFEERLIRYDNIGTLVKANDQAKDEFVDQLDSERNFYCSLRKYMQEKASILA 1020

Query: 1020 KIRSHKGLKQFLDEPAPELQSMDLDEGSPSALLASVDQLCKISSKLVAKFLEIAIFKYHK 1079
             IR  KGLK+   EP  E + MDLDEG  S    +V++LCKI+ K V KFLEIA+ KY +
Sbjct: 1021 SIRKDKGLKELSSEPGNEFKEMDLDEGESSEARFAVEKLCKITEKTVEKFLEIAMSKYRR 1080

Query: 1080 AKVEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1139
            A+VEPGTAVGA+GA SIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI
Sbjct: 1081 ARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140

Query: 1140 INAVL 1144
            INAVL
Sbjct: 1141 INAVL 1145

>Skud_15.279 Chr15 complement(496216..500598) [4383 bp, 1460 aa] {ON}
            YOR116C (REAL)
          Length = 1460

 Score = 2001 bits (5183), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 944/1145 (82%), Positives = 1030/1145 (89%), Gaps = 1/1145 (0%)

Query: 1    MKEVVVDIAPKRIKGLEFSALSASDIVGQSKVEISTRDLFDLENGRKPKSGGALDTRMGV 60
            MKEVVV   PKRIKGLEFSALSA+DIV QS+VE+STRDLFDLE  R PK+ GALD +MGV
Sbjct: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGV 60

Query: 61   SSSQAECSTCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKSCAALLLSEEDK 120
            SSS  EC+TCHGNLASCHGHFGH+KL+LPVFH+GYFKATIQ+LQ ICK+C+A+LLSE DK
Sbjct: 61   SSSTLECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAVLLSETDK 120

Query: 121  RQFLSELRRPGIDNLRRMGILKKVVDQCKKQRRCLRCGSLNXXXXXXXXXXXXXXLKILH 180
            R FL ELRRPG+DNLRRMGILKK++DQCKKQRRCL CG+LN              LKI+H
Sbjct: 121  RHFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCGALNGVVKKAAAGAGSAALKIIH 180

Query: 181  DTFRWVGKKSAPEKDKWVGDWKTVLSHNPELERYVKKCMDDLNPLKTLNLFKQVSPEDCE 240
            DTFRWVGKKSAPEKD WVG+WK VL+HNPELERYVK+CMDDLNPLKTLNLFKQ+   DCE
Sbjct: 181  DTFRWVGKKSAPEKDIWVGEWKEVLTHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240

Query: 241  LMGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            L+GID+T+ SGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDATIPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGG-KTKPIRGFCQRLKGK 359
            AGL+KGISINNMME WDYLQL VAMYINSDSVNPAM+PG S GG K KPIRGFCQRLKGK
Sbjct: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360

Query: 360  QGRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKAKLQQLV 419
            QGRFRGNLSGKRVDFSGRTV+SPDPNLSIDEVAVPDRVAKVLTYPE VTRYN+ KLQ+L+
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRLKLQELI 420

Query: 420  INGPNEHPGANYLLKKDEEARRNLRYGDRIKLAKNLQYGDLVERHLEDGDVVLFNRQPSL 479
            +NGPN HPGANYLLK++E+ARRNLRYGDR+KLAKNLQ GD+VERHLEDGDVVLFNRQPSL
Sbjct: 421  VNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 480

Query: 480  HRLSILSHFAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 539
            HRLSILSH+AKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 540  LLTPKSGEPIIAATQDFITGSYLISHKDSFYSRAEFVQLLSMMSDGNMQFDIPPPAIMKP 599
            LLTPKSGEPIIAATQDFITGSYLISHKDSFY RA   QLLSMMSDG  QFD+PPPAIMKP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMSDGIEQFDVPPPAIMKP 600

Query: 600  YYMWTGKQVFSLLIRPNKKSSVVINLDAKNKVYIPPKHKHLPNEMSINDGFVVIRGSQIL 659
            YY+WTGKQVFSLLI+PN  S VVINLDAKNKV++PPK K LP+EMS NDGFV+IRGSQIL
Sbjct: 601  YYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPSEMSQNDGFVIIRGSQIL 660

Query: 660  SGVMDKSVLGDGKKHSVFYTILRDFGPKEAAYAMNRMAKLCARYLGNRGFSIGINDVTPG 719
            SGVMDKSVLGDGKKHSVFYTILRD+GP+EAA AMNRMAKLCAR+LGNRGFSIGINDVTP 
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720

Query: 720  FELKNKKEVMVEDAYAKCDDLIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 779
             +LK KKE +VE AY KCD+LI  FNKG+LETQPGCNEEQTLEAKIGG LSKVREEVG+V
Sbjct: 721  DDLKQKKEELVEIAYRKCDELITLFNKGELETQPGCNEEQTLEAKIGGFLSKVREEVGDV 780

Query: 780  CIKELDNLNSCLIMANCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSK 839
            CI ELDN N+ LIMA CGSKGS LNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSK
Sbjct: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840

Query: 840  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 899
            TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 900  DNTIRTSSNGIVQFTYGGDGLDPIDMEGNAQPVNFTRSWDHANNITFNHSDKPLLPYQIM 959
            DNT+RTS+NGIVQFTYGGDGLDP++MEGNAQPVNF RSWDHA NITFN+ D+ LLPY IM
Sbjct: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNEDEGLLPYAIM 960

Query: 960  QQTNSILQPLEEKLVRYDNLGRTLDPSLQDRAEFIDQDDAERNFYKSLREYLHTKASHLA 1019
            +  N IL+PLEE+LVRYDN G  +    +DRAE++DQ DAER+FY+SLREY++ KA+ LA
Sbjct: 961  KTANEILRPLEERLVRYDNRGSLVKEEDKDRAEYVDQYDAERDFYRSLREYINLKATALA 1020

Query: 1020 KIRSHKGLKQFLDEPAPELQSMDLDEGSPSALLASVDQLCKISSKLVAKFLEIAIFKYHK 1079
             +R  +G+ + L+ P  EL+ +DLDE  P  +  SV QL +IS K V KFLEIA+FKY K
Sbjct: 1021 NLRKSRGMFEQLEPPEKELEGIDLDEAVPDNVRTSVSQLYRISEKSVRKFLEIALFKYRK 1080

Query: 1080 AKVEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1139
            A++EPGTA+GA+GA SIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASK ISTPI
Sbjct: 1081 ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKSISTPI 1140

Query: 1140 INAVL 1144
            INAVL
Sbjct: 1141 INAVL 1145

>YOR116C Chr15 complement(539763..544145) [4383 bp, 1460 aa] {ON}
            RPO31RNA polymerase III largest subunit C160, part of
            core enzyme; similar to bacterial beta-prime subunit and
            to RPA190 and RPO21
          Length = 1460

 Score = 1998 bits (5175), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 949/1145 (82%), Positives = 1028/1145 (89%), Gaps = 1/1145 (0%)

Query: 1    MKEVVVDIAPKRIKGLEFSALSASDIVGQSKVEISTRDLFDLENGRKPKSGGALDTRMGV 60
            MKEVVV   PKRIKGLEFSALSA+DIV QS+VE+STRDLFDLE  R PK+ GALD +MGV
Sbjct: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGV 60

Query: 61   SSSQAECSTCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKSCAALLLSEEDK 120
            SSS  EC+TCHGNLASCHGHFGH+KL+LPVFH+GYFKATIQ+LQ ICK+C+A+LLSE DK
Sbjct: 61   SSSSLECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDK 120

Query: 121  RQFLSELRRPGIDNLRRMGILKKVVDQCKKQRRCLRCGSLNXXXXXXXXXXXXXXLKILH 180
            RQFL ELRRPG+DNLRRMGILKK++DQCKKQRRCL CG+LN              LKI+H
Sbjct: 121  RQFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCGALNGVVKKAAAGAGSAALKIIH 180

Query: 181  DTFRWVGKKSAPEKDKWVGDWKTVLSHNPELERYVKKCMDDLNPLKTLNLFKQVSPEDCE 240
            DTFRWVGKKSAPEKD WVG+WK VL+HNPELERYVK+CMDDLNPLKTLNLFKQ+   DCE
Sbjct: 181  DTFRWVGKKSAPEKDIWVGEWKEVLAHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240

Query: 241  LMGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            L+GID+TV SGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGG-KTKPIRGFCQRLKGK 359
            AGL+KGISINNMME WDYLQL VAMYINSDSVNPAM+PG S GG K KPIRGFCQRLKGK
Sbjct: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360

Query: 360  QGRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKAKLQQLV 419
            QGRFRGNLSGKRVDFSGRTV+SPDPNLSIDEVAVPDRVAKVLTYPE VTRYN+ KLQ+L+
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELI 420

Query: 420  INGPNEHPGANYLLKKDEEARRNLRYGDRIKLAKNLQYGDLVERHLEDGDVVLFNRQPSL 479
            +NGPN HPGANYLLK++E+ARRNLRYGDR+KLAKNLQ GD+VERHLEDGDVVLFNRQPSL
Sbjct: 421  VNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 480

Query: 480  HRLSILSHFAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 539
            HRLSILSH+AKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 540  LLTPKSGEPIIAATQDFITGSYLISHKDSFYSRAEFVQLLSMMSDGNMQFDIPPPAIMKP 599
            LLTPKSGEPIIAATQDFITGSYLISHKDSFY RA   QLLSMMSDG   FDIPPPAIMKP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMSDGIEHFDIPPPAIMKP 600

Query: 600  YYMWTGKQVFSLLIRPNKKSSVVINLDAKNKVYIPPKHKHLPNEMSINDGFVVIRGSQIL 659
            YY+WTGKQVFSLLI+PN  S VVINLDAKNKV++PPK K LPNEMS NDGFV+IRGSQIL
Sbjct: 601  YYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPNEMSQNDGFVIIRGSQIL 660

Query: 660  SGVMDKSVLGDGKKHSVFYTILRDFGPKEAAYAMNRMAKLCARYLGNRGFSIGINDVTPG 719
            SGVMDKSVLGDGKKHSVFYTILRD+GP+EAA AMNRMAKLCAR+LGNRGFSIGINDVTP 
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720

Query: 720  FELKNKKEVMVEDAYAKCDDLIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 779
             +LK KKE +VE AY KCD+LI  FNKG+LETQPGCNEEQTLEAKIGGLLSKVREEVG+V
Sbjct: 721  DDLKQKKEELVEIAYHKCDELITLFNKGELETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780

Query: 780  CIKELDNLNSCLIMANCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSK 839
            CI ELDN N+ LIMA CGSKGS LNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSK
Sbjct: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840

Query: 840  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 899
            TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 900  DNTIRTSSNGIVQFTYGGDGLDPIDMEGNAQPVNFTRSWDHANNITFNHSDKPLLPYQIM 959
            DNT+RTS+NGIVQFTYGGDGLDP++MEGNAQPVNF RSWDHA NITFN+ DK LLPY IM
Sbjct: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNQDKGLLPYAIM 960

Query: 960  QQTNSILQPLEEKLVRYDNLGRTLDPSLQDRAEFIDQDDAERNFYKSLREYLHTKASHLA 1019
            +  N IL PLEE+LVRYDN G  +     ++AE++DQ DAER+FY SLREY++ KA+ LA
Sbjct: 961  ETANEILGPLEERLVRYDNSGCLVKREDLNKAEYVDQYDAERDFYHSLREYINGKATALA 1020

Query: 1020 KIRSHKGLKQFLDEPAPELQSMDLDEGSPSALLASVDQLCKISSKLVAKFLEIAIFKYHK 1079
             +R  +G+   L+ PA ELQ +D DE  P  +  SV QL +IS K V KFLEIA+FKY K
Sbjct: 1021 NLRKSRGMLGLLEPPAKELQGIDPDETVPDNVKTSVSQLYRISEKSVRKFLEIALFKYRK 1080

Query: 1080 AKVEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1139
            A++EPGTA+GA+GA SIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI
Sbjct: 1081 ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140

Query: 1140 INAVL 1144
            INAVL
Sbjct: 1141 INAVL 1145

>Smik_15.294 Chr15 complement(500962..505344) [4383 bp, 1460 aa] {ON}
            YOR116C (REAL)
          Length = 1460

 Score = 1994 bits (5165), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 943/1145 (82%), Positives = 1031/1145 (90%), Gaps = 1/1145 (0%)

Query: 1    MKEVVVDIAPKRIKGLEFSALSASDIVGQSKVEISTRDLFDLENGRKPKSGGALDTRMGV 60
            MKEVVV   PKRIKGLEFSALSA+DIV QS+VE+STRDLFDLE  R PK+ GALD +MGV
Sbjct: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGV 60

Query: 61   SSSQAECSTCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKSCAALLLSEEDK 120
            SSS  EC+TCHGNLASCHGHFGH+KL+LPVFH+GYFKATIQ+LQ ICK+C+A+LLSE DK
Sbjct: 61   SSSSLECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDK 120

Query: 121  RQFLSELRRPGIDNLRRMGILKKVVDQCKKQRRCLRCGSLNXXXXXXXXXXXXXXLKILH 180
            R FL ELRRPG+DNLRRMGILKK++DQCKKQRRCL CG+LN              LKI+H
Sbjct: 121  RHFLQELRRPGVDNLRRMGILKKILDQCKKQRRCLHCGALNGVVKKAAAGAGSAALKIIH 180

Query: 181  DTFRWVGKKSAPEKDKWVGDWKTVLSHNPELERYVKKCMDDLNPLKTLNLFKQVSPEDCE 240
            DTFRWVGKKSAPEKD WVG+WK VL+HNPELERYVK+CMDDLNPLKTLNLFKQ+   DCE
Sbjct: 181  DTFRWVGKKSAPEKDIWVGEWKEVLTHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240

Query: 241  LMGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            L+GID+TV SGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGG-KTKPIRGFCQRLKGK 359
            AGL+KGISINNMME WDYLQL VAMYINSDSVNPAM+PG S GG K KPIRGFCQRLKGK
Sbjct: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360

Query: 360  QGRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKAKLQQLV 419
            QGRFRGNLSGKRVDFSGRTV+SPDPNLSIDEVAVPDRVAKVLTYPE VTRYN+ KLQ+L+
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELI 420

Query: 420  INGPNEHPGANYLLKKDEEARRNLRYGDRIKLAKNLQYGDLVERHLEDGDVVLFNRQPSL 479
            +NGPN HPGANYLLK++E+ARRNLRYGDR+KLAKNLQ GD+VERHLEDGDVVLFNRQPSL
Sbjct: 421  VNGPNVHPGANYLLKRNEDARRNLRYGDRLKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 480

Query: 480  HRLSILSHFAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 539
            HRLSILSH+AKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 540  LLTPKSGEPIIAATQDFITGSYLISHKDSFYSRAEFVQLLSMMSDGNMQFDIPPPAIMKP 599
            LLTPKSGEPIIAATQDFITGSYLISHKDSFY RA   QLLSMMSDG  QFDIPPPAIMKP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMSDGIEQFDIPPPAIMKP 600

Query: 600  YYMWTGKQVFSLLIRPNKKSSVVINLDAKNKVYIPPKHKHLPNEMSINDGFVVIRGSQIL 659
            YY+WTGKQVFSLLI+PN  S VVINLDAKNKV++PPK K LPNEMS NDGFV+IRGS+IL
Sbjct: 601  YYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPNEMSQNDGFVIIRGSKIL 660

Query: 660  SGVMDKSVLGDGKKHSVFYTILRDFGPKEAAYAMNRMAKLCARYLGNRGFSIGINDVTPG 719
            SGVMDKSVLGDGKKHSVFYTILRD+GP+EAA AMNRMAKLCAR+LGNRGFSIGINDVTP 
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720

Query: 720  FELKNKKEVMVEDAYAKCDDLIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 779
             +LK KKE +VE AY+KCD+LI  FNKG+LETQPGCNEEQTLEAKIGGLLSKVREEVG+V
Sbjct: 721  DDLKQKKEELVEIAYSKCDELITLFNKGELETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780

Query: 780  CIKELDNLNSCLIMANCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSK 839
            CI ELDN N+ LIMA CGSKGS LNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSK
Sbjct: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840

Query: 840  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 899
            TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 900  DNTIRTSSNGIVQFTYGGDGLDPIDMEGNAQPVNFTRSWDHANNITFNHSDKPLLPYQIM 959
            DNT+RTS+NGIVQFTYGGDGLDP++MEGNAQPVNF RSWDHA NITFN+ D+ LLPY IM
Sbjct: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNQDEGLLPYAIM 960

Query: 960  QQTNSILQPLEEKLVRYDNLGRTLDPSLQDRAEFIDQDDAERNFYKSLREYLHTKASHLA 1019
            Q TN IL+PLEE+LVRYDN G  +     ++AE++DQ DAER+FY+SL+EY++ KA+ LA
Sbjct: 961  QTTNEILRPLEERLVRYDNSGCLVKEENLNKAEYVDQYDAERDFYRSLKEYINLKATALA 1020

Query: 1020 KIRSHKGLKQFLDEPAPELQSMDLDEGSPSALLASVDQLCKISSKLVAKFLEIAIFKYHK 1079
             +R  +G+ + L+ P  E + +D D+  P  +  SV QL +IS K V KFLEIA++KY K
Sbjct: 1021 NLRKSRGMLELLEPPTKESEKVDPDKLVPDNVKTSVSQLYRISEKSVRKFLEIALYKYRK 1080

Query: 1080 AKVEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1139
            A++EPGTA+GA+GA SIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI
Sbjct: 1081 ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140

Query: 1140 INAVL 1144
            INAVL
Sbjct: 1141 INAVL 1145

>Suva_8.169 Chr8 complement(297556..301938) [4383 bp, 1460 aa] {ON}
            YOR116C (REAL)
          Length = 1460

 Score = 1992 bits (5160), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 941/1145 (82%), Positives = 1030/1145 (89%), Gaps = 1/1145 (0%)

Query: 1    MKEVVVDIAPKRIKGLEFSALSASDIVGQSKVEISTRDLFDLENGRKPKSGGALDTRMGV 60
            MKEVVV   PKRIKGLEFSALSA+DIV QS+VE+STRDLFDLE  R P++ GALD +MGV
Sbjct: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPRANGALDPKMGV 60

Query: 61   SSSQAECSTCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKSCAALLLSEEDK 120
            SSS  EC+TCHGNLASCHGHFGH+KL+LPVFH+GYFKATIQ+LQ ICK+C+A+LLSE DK
Sbjct: 61   SSSSLECTTCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDK 120

Query: 121  RQFLSELRRPGIDNLRRMGILKKVVDQCKKQRRCLRCGSLNXXXXXXXXXXXXXXLKILH 180
            R+FL ELRRPG+DNLRRMGILKK++DQCKKQRRCL CG+LN              LKI+H
Sbjct: 121  RKFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCGALNGVVKKAAAGAGSAALKIIH 180

Query: 181  DTFRWVGKKSAPEKDKWVGDWKTVLSHNPELERYVKKCMDDLNPLKTLNLFKQVSPEDCE 240
            DTFRWVGKKSAPEKD WVG+WK VL+HNPELERYVK+CMDDLNPLKTLNLFKQ+   DCE
Sbjct: 181  DTFRWVGKKSAPEKDIWVGEWKEVLTHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240

Query: 241  LMGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            L+GID+TV SGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGG-KTKPIRGFCQRLKGK 359
            AGL+KGISINNMME WDYLQL VAMYINSDSVNPAM+PG S GG K KPIRGFCQRLKGK
Sbjct: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360

Query: 360  QGRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKAKLQQLV 419
            QGRFRGNLSGKRVDFSGRTV+SPDPNLSIDEVAVPDRVAKVLTYPE VTRYN+ KLQ+LV
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELV 420

Query: 420  INGPNEHPGANYLLKKDEEARRNLRYGDRIKLAKNLQYGDLVERHLEDGDVVLFNRQPSL 479
            +NGPN HPGANYLLKK+E+ARRNLRYGDR+KLAK+LQ GD++ERHLEDGDVVLFNRQPSL
Sbjct: 421  VNGPNVHPGANYLLKKNEDARRNLRYGDRMKLAKSLQIGDVIERHLEDGDVVLFNRQPSL 480

Query: 480  HRLSILSHFAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 539
            HRLSILSH+AKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 540  LLTPKSGEPIIAATQDFITGSYLISHKDSFYSRAEFVQLLSMMSDGNMQFDIPPPAIMKP 599
            LLTPKSGEPIIAATQDFITGSYLISHKDSFY RA   QLL MMSDG  QFD+PPPAIMKP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLCMMSDGVEQFDVPPPAIMKP 600

Query: 600  YYMWTGKQVFSLLIRPNKKSSVVINLDAKNKVYIPPKHKHLPNEMSINDGFVVIRGSQIL 659
            YY+WTGKQVFSLLI+P+ KS VVINLDAKNKV++PPK K LP+EMS NDGFVVIRGSQIL
Sbjct: 601  YYLWTGKQVFSLLIKPSHKSPVVINLDAKNKVFVPPKSKSLPSEMSQNDGFVVIRGSQIL 660

Query: 660  SGVMDKSVLGDGKKHSVFYTILRDFGPKEAAYAMNRMAKLCARYLGNRGFSIGINDVTPG 719
            SGVMDKSVLGDGKKHSVFYTILRD+GP+EAA AMNRMAKLCAR+LGNRGFSIGINDVTP 
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720

Query: 720  FELKNKKEVMVEDAYAKCDDLIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 779
             +LK KKE +VE AY KCD+LI  FNKG+LETQPGCNEEQTLEAKIGG LSKVREEVG+V
Sbjct: 721  DDLKQKKEELVEIAYRKCDELITSFNKGELETQPGCNEEQTLEAKIGGFLSKVREEVGDV 780

Query: 780  CIKELDNLNSCLIMANCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSK 839
            CI ELDN N+ LIMA CGSKGS LNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSK
Sbjct: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840

Query: 840  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 899
            TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 900  DNTIRTSSNGIVQFTYGGDGLDPIDMEGNAQPVNFTRSWDHANNITFNHSDKPLLPYQIM 959
            DNT+RTS+NGIVQFTYGGDGLDP++MEGNAQPVNF RSWDHA NITF++ D+ LLPY IM
Sbjct: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFDNQDEGLLPYAIM 960

Query: 960  QQTNSILQPLEEKLVRYDNLGRTLDPSLQDRAEFIDQDDAERNFYKSLREYLHTKASHLA 1019
            +  N IL PLE++LVRYDN G  +    +D+AE +DQ DAER+FY+SLREY++ KA+ LA
Sbjct: 961  ETANKILVPLEDRLVRYDNRGFLVKDEDKDKAEHVDQYDAERDFYRSLREYINLKATTLA 1020

Query: 1020 KIRSHKGLKQFLDEPAPELQSMDLDEGSPSALLASVDQLCKISSKLVAKFLEIAIFKYHK 1079
             +R  +G+ + ++ P  ELQ MD DE  P+ +  SV QL +IS + V KFLEIA+FKY K
Sbjct: 1021 NLRKSRGMLELVNAPPKELQGMDPDEAVPTNVRTSVSQLYRISEQSVKKFLEIALFKYRK 1080

Query: 1080 AKVEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1139
            A++EPGTA+GA+GA SIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI
Sbjct: 1081 ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140

Query: 1140 INAVL 1144
            INAVL
Sbjct: 1141 INAVL 1145

>TPHA0H01760 Chr8 complement(402254..406633) [4380 bp, 1459 aa] {ON}
            Anc_5.426 YOR116C
          Length = 1459

 Score = 1959 bits (5074), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 930/1145 (81%), Positives = 1018/1145 (88%), Gaps = 1/1145 (0%)

Query: 1    MKEVVVDIAPKRIKGLEFSALSASDIVGQSKVEISTRDLFDLENGRKPKSGGALDTRMGV 60
            MKEVV+   PKRI GLEFSALS SDI+ QS+VEISTRDLFDLENGR P  GGALD +MGV
Sbjct: 1    MKEVVISETPKRISGLEFSALSTSDIIAQSEVEISTRDLFDLENGRAPIEGGALDPKMGV 60

Query: 61   SSSQAECSTCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKSCAALLLSEEDK 120
            SSS  ECSTCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQ+LQ +CKSC+A+LL++ DK
Sbjct: 61   SSSTLECSTCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQILQGVCKSCSAILLNDTDK 120

Query: 121  RQFLSELRRPGIDNLRRMGILKKVVDQCKKQRRCLRCGSLNXXXXXXXXXXXXXXLKILH 180
            R FL ELR+P IDNL+RM ILKK++DQCKKQRRCL CG LN              LKI+H
Sbjct: 121  RHFLHELRKPDIDNLKRMSILKKILDQCKKQRRCLECGDLNGVVKRAATGSGSASLKIIH 180

Query: 181  DTFRWVGKKSAPEKDKWVGDWKTVLSHNPELERYVKKCMDDLNPLKTLNLFKQVSPEDCE 240
            DTFRWVGKK+ PEKDKW+GDW  VL++NPELE+++K+C DDLNPLKTLNLFKQ+  EDCE
Sbjct: 181  DTFRWVGKKNVPEKDKWIGDWNQVLTNNPELEKFIKRCTDDLNPLKTLNLFKQIKNEDCE 240

Query: 241  LMGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            L+GIDSTV SGRPETYIWRYLPAPPVCIRPSVMMQDS ASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSTVASGRPETYIWRYLPAPPVCIRPSVMMQDSSASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGGKTKPIRGFCQRLKGKQ 360
            AGLEKGISINNMME WDYLQL+VAMYINSDSVN  +MPG + G K KPIRGFCQRLKGKQ
Sbjct: 301  AGLEKGISINNMMEHWDYLQLSVAMYINSDSVNLLVMPGSNGGTKAKPIRGFCQRLKGKQ 360

Query: 361  GRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKAKLQQLVI 420
            GRFRGNLSGKRVDFSGRTV+SPDPNLSIDEVAVP+ VAKVLTYPE VTRYNK KLQ+LV+
Sbjct: 361  GRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPELVAKVLTYPEKVTRYNKTKLQKLVM 420

Query: 421  NGPNEHPGANYLLKKDEEARRNLRYGDRIKLAKNLQYGDLVERHLEDGDVVLFNRQPSLH 480
            NGPN HPGANYLLK +EEARRNLRYG+R KLAK L+ GD+VERHLEDGD+VLFNRQPSLH
Sbjct: 421  NGPNVHPGANYLLKSNEEARRNLRYGNRDKLAKQLRIGDIVERHLEDGDIVLFNRQPSLH 480

Query: 481  RLSILSHFAKIRPWRTFRLNECVCTPYNADFDGDEMNLHV-PQTEEARAEAINLMGVKNN 539
            RLSILSHFAKIRPWRTFRLNECVCTPYNADFDGDEMNL    QTEEARAEAINLMGVKNN
Sbjct: 481  RLSILSHFAKIRPWRTFRLNECVCTPYNADFDGDEMNLLCYQQTEEARAEAINLMGVKNN 540

Query: 540  LLTPKSGEPIIAATQDFITGSYLISHKDSFYSRAEFVQLLSMMSDGNMQFDIPPPAIMKP 599
            LLTPKSGEPIIAATQDFITGSYLISHKDSF+ RA   QLLSMMSD N++FDIPPPAI KP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMMSDANLKFDIPPPAIFKP 600

Query: 600  YYMWTGKQVFSLLIRPNKKSSVVINLDAKNKVYIPPKHKHLPNEMSINDGFVVIRGSQIL 659
              +WTGKQ+FSLLI+PNK+S VVINLDAKNKVYIPP++K  P+EMS NDG+V+IRGS+IL
Sbjct: 601  QCLWTGKQIFSLLIKPNKESPVVINLDAKNKVYIPPQNKSWPSEMSPNDGYVIIRGSEIL 660

Query: 660  SGVMDKSVLGDGKKHSVFYTILRDFGPKEAAYAMNRMAKLCARYLGNRGFSIGINDVTPG 719
            SGVMDKSVLGDGKKHSVFYTILRD+GP+E+A AMNRMAKLCARYLGNRGFSIGI+DVTPG
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQESANAMNRMAKLCARYLGNRGFSIGISDVTPG 720

Query: 720  FELKNKKEVMVEDAYAKCDDLIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 779
             ELK KKE +VE AY KCD+LI Q+NKG+LETQPGCNEEQTLEAKIGGLLSKVREEVG+V
Sbjct: 721  EELKLKKEDLVEIAYKKCDELIIQYNKGELETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780

Query: 780  CIKELDNLNSCLIMANCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSK 839
            CI ELDNLN+ LIMA CGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSK
Sbjct: 781  CINELDNLNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFEKNSK 840

Query: 840  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 899
            TPQSKGFVRNSFF+GL+PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFTGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 900  DNTIRTSSNGIVQFTYGGDGLDPIDMEGNAQPVNFTRSWDHANNITFNHSDKPLLPYQIM 959
            DNTIRTSSNGIVQFTYGGDGLDP+DMEGNA+PVNF R+WDHA+NITF+ + K LLPYQI+
Sbjct: 901  DNTIRTSSNGIVQFTYGGDGLDPLDMEGNAKPVNFKRTWDHASNITFDFNAKGLLPYQII 960

Query: 960  QQTNSILQPLEEKLVRYDNLGRTLDPSLQDRAEFIDQDDAERNFYKSLREYLHTKASHLA 1019
            +QTN ILQPLE  LVRY+N+G+ L      + E++DQ DA+R+FY S+REY+  KA  LA
Sbjct: 961  KQTNLILQPLENALVRYNNVGKPLSKKDYHKDEYVDQLDAKRDFYASIREYMVEKAEQLA 1020

Query: 1020 KIRSHKGLKQFLDEPAPELQSMDLDEGSPSALLASVDQLCKISSKLVAKFLEIAIFKYHK 1079
            KIR  + LK+ + EPA ELQ +D DE  PS +   VD+LCKIS   V KFLEIAI KYH+
Sbjct: 1021 KIRKARSLKELISEPAEELQHIDFDENIPSNVREVVDKLCKISEANVKKFLEIAISKYHR 1080

Query: 1080 AKVEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1139
            AKVEPGTAVGA+GA SIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASK ISTPI
Sbjct: 1081 AKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKTISTPI 1140

Query: 1140 INAVL 1144
            I AVL
Sbjct: 1141 IKAVL 1145

>CAGL0L11660g Chr12 (1245685..1250064) [4380 bp, 1459 aa] {ON} highly
            similar to uniprot|P04051 Saccharomyces cerevisiae
            YOR116c RPO31 DNA-directed RNA polymerase III
          Length = 1459

 Score = 1958 bits (5073), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 937/1146 (81%), Positives = 1024/1146 (89%), Gaps = 4/1146 (0%)

Query: 1    MKEVVVDIAPKRIKGLEFSALSASDIVGQSKVEISTRDLFDLENGRKPKSGGALDTRMGV 60
            MKEVV+   PKRI GLEFSALS +DIV QS++EIS+RDLFDLEN R PK GGALD RMGV
Sbjct: 1    MKEVVIGETPKRISGLEFSALSPADIVAQSELEISSRDLFDLENNRSPKEGGALDPRMGV 60

Query: 61   SSSQAECSTCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKSCAALLLSEEDK 120
            S+S  EC+TCHGNLASCHGHFGHIKL+LPVFHVGYFKATIQ+LQ ICK+C+A+LLSE+DK
Sbjct: 61   SASSMECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKTCSAILLSEQDK 120

Query: 121  RQFLSELRRPGIDNLRRMGILKKVVDQCKKQRRCLRCGSLNXXXXXXXXXXXXXXLKILH 180
            R FLSELRRPG+DNLRRM +LKKV+DQCKKQRRCL CG+LN              LKI+H
Sbjct: 121  RHFLSELRRPGVDNLRRMALLKKVLDQCKKQRRCLHCGALNGVVKKAAAGAGTASLKIIH 180

Query: 181  DTFRWVGKKSAPEKDKWVGDWKTVLSHNPELERYVKKCMDDLNPLKTLNLFKQVSPEDCE 240
            DTFRWVGKKS PEKDKW+GDWK VLSHNPELERYVK+  DDLNPLKTLNLFKQ++ EDCE
Sbjct: 181  DTFRWVGKKSTPEKDKWIGDWKEVLSHNPELERYVKRATDDLNPLKTLNLFKQIASEDCE 240

Query: 241  LMGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            L+GID+T K+GRPETYIWRY+PAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDATNKAGRPETYIWRYIPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGG-KTKPIRGFCQRLKGK 359
            AG+EKGISINNMME WDYLQ+ VAMYINSDS+NPAM+PG STGG K KPIRGFCQRLKGK
Sbjct: 301  AGIEKGISINNMMEHWDYLQMTVAMYINSDSINPAMLPGSSTGGGKVKPIRGFCQRLKGK 360

Query: 360  QGRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKAKLQQLV 419
            QGRFRGNLSGKRVDFSGRTV+SPDPNLSIDEVAVP  VAKVLT+PE VTRYN  KL+QLV
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNIKKLRQLV 420

Query: 420  INGPNEHPGANYLLKKDEEARRNLRYGDRIKLAKNLQYGDLVERHLEDGDVVLFNRQPSL 479
             NGPN HPGANYLLKK+EEARRNLRYGDR KLA NLQYGD+VERHLEDGDVVLFNRQPSL
Sbjct: 421  QNGPNVHPGANYLLKKNEEARRNLRYGDRQKLANNLQYGDVVERHLEDGDVVLFNRQPSL 480

Query: 480  HRLSILSHFAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 539
            HRLSILSH+AKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 540  LLTPKSGEPIIAATQDFITGSYLISHKDSFYSRAEFVQLLSMMSDGNMQFDIPPPAIMKP 599
            LLTPKSGEPIIAATQDFITGSYLISHKDSF+ +A   QLLSMMSDG++QFDIPPPAIMKP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDKASLTQLLSMMSDGSLQFDIPPPAIMKP 600

Query: 600  YYMWTGKQVFSLLIRPNKKSSVVINLDAKNKVYIPPKHKHLPNEMSINDGFVVIRGSQIL 659
             Y+WTGKQVFSLLI+PNK S V INLDAKNKVYIPPK KH PNEMS NDGFV++RGSQIL
Sbjct: 601  CYLWTGKQVFSLLIKPNKNSPVKINLDAKNKVYIPPKQKHYPNEMSQNDGFVIVRGSQIL 660

Query: 660  SGVMDKSVLGDGKKHSVFYTILRDFGPKEAAYAMNRMAKLCARYLGNRGFSIGINDVTPG 719
            SGVMDKSVLGDGKKHSVFYTILRDFGP+EAA AMNRMAKLCARYLGNRGFSIGI+DVTP 
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDFGPQEAASAMNRMAKLCARYLGNRGFSIGISDVTPA 720

Query: 720  FELKNKKEVMVEDAYAKCDDLIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 779
             +LK KKE +VE AYAKCD+LID +NKGKLETQPGCNEEQTLEAKIGGLLSKVREEVG+V
Sbjct: 721  DDLKQKKEDLVEIAYAKCDELIDLYNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780

Query: 780  CIKELDNLNSCLIMANCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSK 839
            CI ELDNLN+ LIMA CGSKGS LNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSK
Sbjct: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840

Query: 840  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 899
            TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 900  DNTIRTSSNGIVQFTYGGDGLDPIDMEGNAQPVNFTRSWDHANNITFNHSDKPLLPYQIM 959
            DNT+RTSSNGIVQFTYGGDGLDP++MEGNAQPVNF RSWDHA NITFN++D+ LLPY+I 
Sbjct: 901  DNTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNTDRGLLPYEIK 960

Query: 960  QQTNSILQPLEEKLVRYDNLGRTLDPSLQDRAEFIDQDDAERNFYKSLREYLHTKASHLA 1019
            +  ++IL+PLE++L+RYD LGR +        +++DQ D+ER FY SLRE++  KA  LA
Sbjct: 961  KTVDNILKPLEKRLIRYDTLGRPVSAEDDKLDDYVDQHDSERLFYASLREFMTDKAKKLA 1020

Query: 1020 KIRSHKGLKQFLDEPAPELQSMDLDEGSPSALLA-SVDQLCKISSKLVAKFLEIAIFKYH 1078
            K+R  +GL + + +   EL+  D +     A++  S+ QL +I+   V KFLEIAI KYH
Sbjct: 1021 KLRKSRGLPKLIKK--SELEGYDPENEHIDAIVQHSITQLYRITEDAVQKFLEIAISKYH 1078

Query: 1079 KAKVEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP 1138
            +AKVEPGTAVGA+GA SIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP
Sbjct: 1079 RAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP 1138

Query: 1139 IINAVL 1144
            IINAVL
Sbjct: 1139 IINAVL 1144

>KNAG0B04240 Chr2 (806212..810579) [4368 bp, 1455 aa] {ON} Anc_5.426
            YOR116C
          Length = 1455

 Score = 1955 bits (5064), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 928/1145 (81%), Positives = 1017/1145 (88%), Gaps = 6/1145 (0%)

Query: 1    MKEVVVDIAPKRIKGLEFSALSASDIVGQSKVEISTRDLFDLENGRKPKSGGALDTRMGV 60
            MKEVVV    K+I G+EFSAL+A+DIV QS+VEI+TRDLFDLE GR+ K+GGALD RMGV
Sbjct: 1    MKEVVVGETQKKISGIEFSALNAADIVAQSEVEITTRDLFDLEKGREQKTGGALDRRMGV 60

Query: 61   SSSQAECSTCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKSCAALLLSEEDK 120
            SSS  EC TCHGNLASCHGHFGHIKL+LPVFHVGYFK+TIQ+LQ ICK C+A+LLS++D+
Sbjct: 61   SSSSQECMTCHGNLASCHGHFGHIKLALPVFHVGYFKSTIQILQCICKDCSAVLLSDKDR 120

Query: 121  RQFLSELRRPGIDNLRRMGILKKVVDQCKKQRRCLRCGSLNXXXXXXXXXXXXXXLKILH 180
            R FL ELRRPGIDNLR+M ILKKV+DQCKKQRRCL+CG LN              LKI+H
Sbjct: 121  RDFLKELRRPGIDNLRKMSILKKVIDQCKKQRRCLKCGGLNGVVKKAAAGAGTASLKIIH 180

Query: 181  DTFRWVGKKSAPEKDKWVGDWKTVLSHNPELERYVKKCMDDLNPLKTLNLFKQVSPEDCE 240
            DTFRWVGKK  PEKD+W+G+W  +L+H+PELER+VK+C DDLNPLKTL LFKQ+  EDCE
Sbjct: 181  DTFRWVGKKMVPEKDRWIGEWNEILTHHPELERFVKRCSDDLNPLKTLTLFKQLKSEDCE 240

Query: 241  LMGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            L+GI+STV+SGRPETYIWRYLPAPPVCIRPSV MQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGINSTVRSGRPETYIWRYLPAPPVCIRPSVTMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGG-KTKPIRGFCQRLKGK 359
            AGL KGISINNMME WDYLQL VAMYINSDSVNPAM+PG S+GG K KPIRGFCQRLKGK
Sbjct: 301  AGLAKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGASSGGGKVKPIRGFCQRLKGK 360

Query: 360  QGRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKAKLQQLV 419
            QGRFRGNLSGKRVDFSGRTV+SPDPNLSIDEVAVP  VAKVLT+PE VTRYNK KLQQL+
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNKRKLQQLI 420

Query: 420  INGPNEHPGANYLLKKDEEARRNLRYGDRIKLAKNLQYGDLVERHLEDGDVVLFNRQPSL 479
            INGP  HPGANYLLKK+EEARRNLRYGD++KLAKNLQYGD+VERHLEDGDVVLFNRQPSL
Sbjct: 421  INGPTVHPGANYLLKKNEEARRNLRYGDKLKLAKNLQYGDVVERHLEDGDVVLFNRQPSL 480

Query: 480  HRLSILSHFAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 539
            HRLSILSH+AKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 540  LLTPKSGEPIIAATQDFITGSYLISHKDSFYSRAEFVQLLSMMSDGNMQFDIPPPAIMKP 599
            LLTPKSGEPIIAATQDFITGSYLISHKDSF+      QLLSMMSD  +QFDIPPPAIMKP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDLGSLTQLLSMMSDAKLQFDIPPPAIMKP 600

Query: 600  YYMWTGKQVFSLLIRPNKKSSVVINLDAKNKVYIPPKHKHLPNEMSINDGFVVIRGSQIL 659
            YY+WTGKQVFSLLIRPNKKS VVINLDAKNKVYIPPK K  PNEMSINDGFV+IRGS+IL
Sbjct: 601  YYLWTGKQVFSLLIRPNKKSPVVINLDAKNKVYIPPKDKSFPNEMSINDGFVIIRGSEIL 660

Query: 660  SGVMDKSVLGDGKKHSVFYTILRDFGPKEAAYAMNRMAKLCARYLGNRGFSIGINDVTPG 719
            SGVMDKSVLGDGKKHSVFYTILRD+GP+EAA  MNRMAKLCARYLGNRGFSIGI+DVTP 
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANTMNRMAKLCARYLGNRGFSIGISDVTPS 720

Query: 720  FELKNKKEVMVEDAYAKCDDLIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 779
             +L++KKE MV  AYAKCD+LID F  GKLETQPGCNEEQTLEAKIGGLLSKVREEVG+V
Sbjct: 721  SDLRDKKEEMVRFAYAKCDELIDMFKNGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780

Query: 780  CIKELDNLNSCLIMANCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSK 839
            CI ELDNLN+ LIMA CGSKGS LNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSK
Sbjct: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSK 840

Query: 840  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 899
            TPQSKGFVRNSFFSGL+PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 900  DNTIRTSSNGIVQFTYGGDGLDPIDMEGNAQPVNFTRSWDHANNITFNHSDKPLLPYQIM 959
            D+T+RTS+NGIVQFTYGGDGLDP+DMEGNA+PVNF RSWDHA NITFN ++  LLPY+I+
Sbjct: 901  DDTVRTSANGIVQFTYGGDGLDPLDMEGNAKPVNFIRSWDHACNITFNKNETGLLPYEIV 960

Query: 960  QQTNSILQPLEEKLVRYDNLGRTLDPSLQDRAEFIDQDDAERNFYKSLREYLHTKASHLA 1019
            ++T+++L+PLEEKL+RYDNLG  +   L D   + D+ DAER FYKSLR Y+  KA+ LA
Sbjct: 961  RETDNVLKPLEEKLIRYDNLGAVVPKELIDDERYADRHDAERAFYKSLRMYMQEKAARLA 1020

Query: 1020 KIRSHKGLKQFLDEPAPELQSMDLDEGSPSALLASVDQLCKISSKLVAKFLEIAIFKYHK 1079
            +IR+ +GL +          SM++     S L ASVDQ+ KI+ K V  FL IA+ KYH+
Sbjct: 1021 QIRNTRGLLEMTQNGGD--TSMEV---VSSELQASVDQVYKITKKNVNAFLTIALHKYHR 1075

Query: 1080 AKVEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1139
            AKVEPGTAVGA+GA SIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI
Sbjct: 1076 AKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1135

Query: 1140 INAVL 1144
            INAVL
Sbjct: 1136 INAVL 1140

>Suva_4.104 Chr4
            complement(193257..193711,193754..193782,194161..198878)
            [5202 bp, 1733 aa] {ON} YDL140C (REAL)
          Length = 1733

 Score =  619 bits (1597), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 423/1177 (35%), Positives = 615/1177 (52%), Gaps = 106/1177 (9%)

Query: 9    APKR-IKGLEFSALSASDIVGQSKVEISTRDLFDLENGRKPKSGGALDTRMGVSSSQAEC 67
            AP R +K ++F   S  ++   S  +I   +  D E   + K GG  D R+G      +C
Sbjct: 9    APLRTVKEVQFGLFSPEEVRAISVAKIRFPETMD-ETQTRAKIGGLNDPRLGSIDRNLKC 67

Query: 68   STCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKSCAALLLSEEDKRQFLSEL 127
             TC   +  C GHFGHI L+ PVFHVG+     +V + +C  C  LLL E +      EL
Sbjct: 68   QTCQEGMNECPGHFGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHN------EL 121

Query: 128  RRPGI---DNLRRMGILKKVVDQCKKQRRC-LRCGSLNXXXXXXXXXX-XXXXLKILHDT 182
             R  +   D  +R G +  +   CK +  C     S N                 +  D 
Sbjct: 122  MRQALAIKDTKKRFGAIWTL---CKTKMVCETDVPSENDPTQLVSRGGCGNTQPTVRKDG 178

Query: 183  FRWVGKKSAPEKDKWVGDWKTVLSHNPELERYVKKCMDDLNPLKTLNLFKQVSPEDCELM 242
             + VG   + +KD+  GD     +  PEL          L+  + LN+FK +S +D   +
Sbjct: 179  LKLVG---SWKKDRATGD-----ADEPELRV--------LSTEEILNIFKHISAKDSSSL 222

Query: 243  GIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKAG 302
            G +      RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  ++  
Sbjct: 223  GFNEVFS--RPEWMILTCLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETL 279

Query: 303  LEKGISINNMMEQWDYLQLAVAMYINSDSVNP--AMMPGGSTGGKTKPIRGFCQRLKGKQ 360
               G   + + E    LQ  VA Y+++D      A+   G      +P++    RLKGK+
Sbjct: 280  EHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSG------RPVKSIRARLKGKE 333

Query: 361  GRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKAKLQQLVI 420
            GR RGNL GKRVDFS RTV+S DPNL +D+V VP  +AK LTYPE+VT YN  +L QLV 
Sbjct: 334  GRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVR 393

Query: 421  NGPNEHPGANYLLKKDEEARRNLRYGDRIKLAKNLQYGDLVERHLEDGDVVLFNRQPSLH 480
            NGPNEHPGA Y+++ D   R +LRY  R    + LQYG  VERH+ D D VLFNRQPSLH
Sbjct: 394  NGPNEHPGAKYVIR-DSGDRIDLRYSKRAGDIQ-LQYGWKVERHIMDNDPVLFNRQPSLH 451

Query: 481  RLSILSHFAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL 540
            ++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   +
Sbjct: 452  KMSMMAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQI 511

Query: 541  LTPKSGEPIIAATQDFITGSYLISHKDSFYSRAEFVQLLSMMSDGNMQFDIPPPAIMKPY 600
            ++P+S +P +   QD + G   ++ +D+F    + + +L  + D +    IP PAI+KP 
Sbjct: 512  VSPQSNKPCMGIVQDTLCGIRKLTLRDTFIELDQVLNMLYWVPDWDGV--IPTPAIIKPK 569

Query: 601  YMWTGKQVFSLLIRPNKKSSVVINLDAKNKVYIPPKHKHLPNEMSINDGFVVIRGSQILS 660
             +W+GKQV S+ I PN    + +    +    + PK          ++G ++I G QI+ 
Sbjct: 570  PLWSGKQVLSVAI-PN---GIHLQRFDEGTTLLSPK----------DNGMLIIDG-QIVF 614

Query: 661  GVMDKSVLGDGKKHSVFYTILRDFGPKEAAYAMNRMAKLCARYLGNRGFSIGIND-VTPG 719
            GV++K  +G      + + + R+ GP+  A     + K+   +L + GFS GI D +  G
Sbjct: 615  GVVEKKTVGSSNG-GLIHVVTREKGPQVCAKLFGNIQKVVNFWLLHNGFSTGIGDTIADG 673

Query: 720  FELKNKKEVMVEDAYAKCDDLIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 779
              ++   E  + DA  K  D+  +     L  + G    ++ E  +   L++ R++ G +
Sbjct: 674  PTMREITET-IADAKKKVFDVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDKAGRL 732

Query: 780  CIKELDNLNSCLIMANCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSK 839
                L +LN+   M   GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+  
Sbjct: 733  AEVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAYGFVDRTLPHFSKDDY 792

Query: 840  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 899
            +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   Y
Sbjct: 793  SPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHY 852

Query: 900  DNTIRTSSNGIVQFTYGGDGLDPIDMEGNAQPV--NFTRSWDHANNITFNHSDKPLLPYQ 957
            DNT R S   ++QF YG DG+D   +E  +         +++    I   + D  L P  
Sbjct: 853  DNTTRNSLGNVIQFIYGEDGMDASHIEKQSLDTIGGSDAAFEKRYRIDLLNPDHILDP-S 911

Query: 958  IMQQTNSILQPLEEKLVRYDNLGRTLDPSLQDRAEFIDQD--------------DAERNF 1003
            +++  + IL  L+ +++  +   + +      R  F+D +              +A++ F
Sbjct: 912  LLESGSEILGDLKLQVLLDEEYKQLVKDRSFLRHIFVDGEANWPLPVNIRRIIQNAQQTF 971

Query: 1004 YKSLREYLHTKAS----------------HLAKIRSHKGLKQFLDEPAPELQSMDLDEGS 1047
            +       HTK S                +L  +R    + Q   + A  L    L    
Sbjct: 972  HID-----HTKPSDLTIKDIVIGVKDLQENLLVLRGKNEIIQNAQQDAVTLFCCLLRSRL 1026

Query: 1048 PSALLASVDQLCKISSKLVAKFLEIAIFKYHKAKVEPGTAVGAVGAHSIGEPGTQMTLKT 1107
             S  +    +L K + + V   +E    +   + V PG  VG + A SIGEP TQMTL T
Sbjct: 1027 ASRRVIQEYKLTKQAFEWVLSNIEAQFLR---SVVHPGEMVGVLAAQSIGEPATQMTLNT 1083

Query: 1108 FHFAGVASMNVTLGVPRIKEIINASKVISTPIINAVL 1144
            FHFAGVAS  VT GVPR+KEI+N +K + TP +   L
Sbjct: 1084 FHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYL 1120

>KLLA0F05071g Chr6 complement(496371..501533) [5163 bp, 1720 aa] {ON}
            highly similar to uniprot|P04050 Saccharomyces cerevisiae
            YDL140C
          Length = 1720

 Score =  618 bits (1593), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 429/1191 (36%), Positives = 616/1191 (51%), Gaps = 134/1191 (11%)

Query: 9    APKR-IKGLEFSALSASDIVGQSKVEISTRDLFDLENGRKPKSGGALDTRMGVSSSQAEC 67
            AP R IK ++F   S  ++ G S  +I   +  D E+  K K GG  D R+G      +C
Sbjct: 9    APLRTIKEVQFGLFSPEEVRGISVAKIEFPETMD-ESQMKAKIGGLNDPRLGSIDRNYKC 67

Query: 68   STCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKSCAALLLSE--EDKRQFLS 125
             TC   +A C GHFGHI+L+ PVFH+G+     +V +S+C  C  LLL E  E  RQ + 
Sbjct: 68   QTCGEGMAECPGHFGHIELAKPVFHIGFLSKIKKVCESVCMHCGKLLLDEYNEQMRQAI- 126

Query: 126  ELRRPGIDNLRRMGILKKVVDQCKKQRRCLR----------------CGSLNXXXXXXXX 169
            +++ P     RR      V   CK +  C                  CG +         
Sbjct: 127  KIKDPK----RR---FNAVWTLCKAKMVCETEVPSPDDPTVFLSRGGCGHIQP------- 172

Query: 170  XXXXXXLKILHDTFRWVGKKSAPEKDKWVGDWKTVLSHNPELERYVKKCMDDLNPLKTLN 229
                    I  D    VG         W  D     S  PE     K+    ++  + LN
Sbjct: 173  -------SIRKDGLSLVGT--------WKKDKNADDSDQPE-----KRI---ISAEEILN 209

Query: 230  LFKQVSPEDCELMGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKL 289
            +FK +SPED   +G +      RPE  I   LP PP  +RPS+   +S    EDDLT KL
Sbjct: 210  VFKHISPEDGWRLGFNEDFS--RPEWMILTVLPVPPPPVRPSISFNES-QRGEDDLTYKL 266

Query: 290  TEIVWTSSLIKAGLEKGISINNMMEQWDYLQLAVAMYINSDSVNP--AMMPGGSTGGKTK 347
             +I+  +  ++     G   + + E    LQ  VA Y+++D      A+   G      +
Sbjct: 267  GDILKANINVQKLEINGSPQHVIQESESLLQFHVATYMDNDIAGQPQAVQKSG------R 320

Query: 348  PIRGFCQRLKGKQGRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMV 407
            PI+    RLKGK+GR RGNL GKRVDFS RTV+S DPNL +D+V VP  +AK LTYPE+V
Sbjct: 321  PIKSIRARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLDLDQVGVPKSIAKTLTYPEVV 380

Query: 408  TRYNKAKLQQLVINGPNEHPGANYLLKKDEEARRNLRYGDRIKLAKNLQYGDLVERHLED 467
            T YN  +L QLV NGPNEHPGA Y++++  + R +LRY  R    + LQYG  VERH+ D
Sbjct: 381  TPYNIDRLTQLVRNGPNEHPGAKYVIRESGD-RIDLRYSKRAGDIQ-LQYGWKVERHITD 438

Query: 468  GDVVLFNRQPSLHRLSILSHFAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEAR 527
             D VLFNRQPSLH++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE R
Sbjct: 439  NDPVLFNRQPSLHKMSMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETR 498

Query: 528  AEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYSRAEFVQLLSMMSDGNM 587
            AE   L  V   +++P+S +P +   QD + G   ++ +D+F    + + +L  + D + 
Sbjct: 499  AELSQLCAVPLQIVSPQSNKPCMGIVQDTLCGIRKMTLRDTFIELDQVLNMLYWIPDWDG 558

Query: 588  QFDIPPPAIMKPYYMWTGKQVFSLLIRPNKKSSVVINLDAKNKVYIPPKHKHLPNEMSIN 647
               IP PAI+KP  +W+GKQV S+ I PN    + +        ++ PK          +
Sbjct: 559  I--IPTPAILKPVPLWSGKQVLSMAI-PN---GIHLQRFDDGTTFLSPK----------D 602

Query: 648  DGFVVIRGSQILSGVMDKSVLGDGKKHSVFYTILRDFGPKEAAYAMNRMAKLCARYLGNR 707
            +G ++I G +I+ GV+DK  +G      + + + R+ GP+  A   + + K+   +L + 
Sbjct: 603  NGMLIIDG-KIIFGVVDKKTVG-SSSGGLIHVVTREKGPEICARLFSNIQKVVNYWLLHN 660

Query: 708  GFSIGINDVTPGFELKNKKEVMVEDAYAKCDDLIDQFNKGKLETQPGCNEEQTLEAKIGG 767
            GFSIGI D     +   +    +  A  K +D+  +     L  + G    ++ E  +  
Sbjct: 661  GFSIGIGDTIADEKTMREITEAIAVAKKKVEDVTKEAQANLLTAKHGMTLRESFEDNVVR 720

Query: 768  LLSKVREEVGEVCIKELDNLNSCLIMANCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQ 827
             L++ R++ G      L +LN+   M + GSKGS +N++QM A VGQQ + G R+  GF 
Sbjct: 721  YLNEARDKAGRSAEVNLKDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFA 780

Query: 828  DRSLPHFLKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRR 887
            DR+LPHF K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RR
Sbjct: 781  DRTLPHFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRR 840

Query: 888  LMKSLEDLSCQYDNTIRTSSNGIVQFTYGGDGLDPIDMEGNAQPVNFTRSWDHA----NN 943
            L+K+LED+   YD T R S   ++QF YG DG+D   +E   Q ++     D A      
Sbjct: 841  LVKALEDIMVHYDGTTRNSLGNVIQFIYGEDGMDAAHIE--KQSIDTIPGSDSAFERRYR 898

Query: 944  ITFNHSDKPLLPYQIMQQTNSILQPLEEKLVRYDNLGRTLDPSLQDRAEFIDQD------ 997
            I   + +  L P  +++  + I+   + +L+  D   + +D     R  F+D +      
Sbjct: 899  IDLLNEEYALDP-SLLESGSEIIGDSKLQLLLNDEYKQLVDDRQILRRVFVDGEHNWPLP 957

Query: 998  -DAERNFYKSLREYL--HTKASHLAKIRSHKGLKQFLDEPAPELQSMDLDEGSPSALLAS 1054
             + +R    S + +    TK + L       G+++        LQ   L     S +L  
Sbjct: 958  VNIKRIIQNSQQTFRIDQTKPTDLTIEDVISGVRK--------LQEKLLVVRGKSDILKE 1009

Query: 1055 VDQ------LCKISSKLVAK------FLEIAIFKYHKAKVE---------PGTAVGAVGA 1093
              Q       C + S+L  +       L    F +    +E         PG  VG + A
Sbjct: 1010 AQQNAITLFCCLLRSRLATRRVIEEYRLNRQTFDWVLNNIEAQFLRSIVHPGEMVGVLAA 1069

Query: 1094 HSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPIINAVL 1144
             SIGEP TQMTL TFHFAGVAS  VT GVPR+KEI+N +K + TP +   L
Sbjct: 1070 QSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYL 1120

>NCAS0A13900 Chr1 (2728572..2733722) [5151 bp, 1716 aa] {ON} Anc_7.314
          Length = 1716

 Score =  617 bits (1590), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/1181 (36%), Positives = 612/1181 (51%), Gaps = 114/1181 (9%)

Query: 9    APKR-IKGLEFSALSASDIVGQSKVEISTRDLFDLENGRKPKSGGALDTRMGVSSSQAEC 67
            AP R +K ++F   S  ++ G S  +I   +  D E   + K GG  D R+G      +C
Sbjct: 9    APLRTVKEVQFGLFSPEEVRGISVAKIRFPETMD-ETQTRAKIGGLNDPRLGSIDRNLKC 67

Query: 68   STCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKSCAALLLSE--EDKRQFLS 125
             TC   +  C GHFGHI L+ PVFHVG+     +V +S+C  C  LLL E  E  RQ ++
Sbjct: 68   QTCQEGMNECPGHFGHIDLAKPVFHVGFIAKIKKVCESVCMHCGKLLLDEHNEQMRQAMA 127

Query: 126  ELRRPGIDNLRRMGILKKVVDQCKKQRRCLRCGSLNXXXXXXXXXXXXXXLKILHDTFRW 185
                   D+ +R      V   CK +  C                        L      
Sbjct: 128  IK-----DSKKR---FNAVWTLCKTKMIC------------ETDVPSDDDPTTLISRGGC 167

Query: 186  VGKKSAPEKD--KWVGDWKTV--LSHNPELERYVKKCMDDLNPLKTLNLFKQVSPEDCEL 241
               + +  KD  K VG WK     S   E E+ V      L+  + LN+FK +SPED   
Sbjct: 168  GNAQPSIRKDGLKLVGSWKKEKNTSDGDEPEQRV------LSTEEILNIFKHISPEDSTR 221

Query: 242  MGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKA 301
            MG        RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  ++ 
Sbjct: 222  MGFSEEF--ARPEWMILCVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLET 278

Query: 302  GLEKGISINNMMEQWDYLQLAVAMYINSDSVNP--AMMPGGSTGGKTKPIRGFCQRLKGK 359
                G   + + E    LQ  VA Y+++D      A+   G      +P++    RLKGK
Sbjct: 279  LEHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSG------RPVKSIRARLKGK 332

Query: 360  QGRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKAKLQQLV 419
            +GR RGNL GKRVDFS RTV+S DPNL +D+V VP  +A+ LTYPE+VT YN  +L QLV
Sbjct: 333  EGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIARTLTYPEVVTPYNIDRLTQLV 392

Query: 420  INGPNEHPGANYLLKKDEEARRNLRYGDRIKLAKNLQYGDLVERHLEDGDVVLFNRQPSL 479
             NGPNEHPGA Y+++ D   R +LRY  R    + LQYG  VERH+ D D VLFNRQPSL
Sbjct: 393  RNGPNEHPGAKYVIR-DNGDRIDLRYSKRAGDIQ-LQYGWKVERHIMDDDPVLFNRQPSL 450

Query: 480  HRLSILSHFAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 539
            H++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   
Sbjct: 451  HKMSMMAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQ 510

Query: 540  LLTPKSGEPIIAATQDFITGSYLISHKDSFYSRAEFVQLLSMMS-----DGNMQFDIPPP 594
            +++ +S +P +   QD + G   ++ +D+F    EF Q+L+M+      DG     IP P
Sbjct: 511  IVSAQSNKPCMGIVQDTLCGIRKLTLRDTFI---EFDQVLNMLYWVPDWDGV----IPTP 563

Query: 595  AIMKPYYMWTGKQVFSLLIRPNKKSSVVINLDAKNKVYIPPKHKHLPNEMSINDGFVVIR 654
            A++KP  +WTGKQV S  I       + +    +    + PK          ++G +VI 
Sbjct: 564  AVLKPKPLWTGKQVLSAAI----PKGIHLQRFDEGTTLLSPK----------DNGMLVID 609

Query: 655  GSQILSGVMDKSVLGDGKKHSVFYTILRDFGPKEAAYAMNRMAKLCARYLGNRGFSIGIN 714
            G QI+ GV+DK  +G      + + + R+ GP   A     + K+   +L + GFS GI 
Sbjct: 610  G-QIIFGVVDKKTVG-SSSGGLIHVVTREKGPTICARLFGNIQKIVNFWLLHNGFSTGIG 667

Query: 715  D-VTPGFELKNKKEVMVEDAYAKCDDLIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVR 773
            D +  G  +K   E + E A  K +D+  +     L  + G    ++ E  +   L++ R
Sbjct: 668  DTIADGQTIKEITETIAE-AKKKVEDVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEAR 726

Query: 774  EEVGEVCIKELDNLNSCLIMANCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPH 833
            ++ G +    L++LN+   M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPH
Sbjct: 727  DKAGRLAEVNLNDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIGFGFVDRTLPH 786

Query: 834  FLKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLE 893
            F K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LE
Sbjct: 787  FSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALE 846

Query: 894  DLSCQYDNTIRTSSNGIVQFTYGGDGLDPIDMEGN------AQPVNFTRSWDHANNITFN 947
            D+   YD T R S   ++QF YG DG+D   +E           V F R +   + +   
Sbjct: 847  DIMVHYDGTTRNSLGNVIQFIYGEDGIDAAHIEKQTLDTIGGSDVAFERRY-RIDLLNPE 905

Query: 948  HSDKPLLPYQIMQQTNSILQPLEEKLVRYDNLGRTLDPSLQDRAEFIDQDDAE------R 1001
            HS  P L    ++  + I   L+ + +  +   + ++     R  F+D +         R
Sbjct: 906  HSLDPTL----LESGSEIAGDLKLQALLDEEYKQLVEDRRFLREIFVDGESNWPLPVNIR 961

Query: 1002 NFYKSLREYL---HTKASHLAKIRSHKGLKQFLDEPAPELQSMDLDEGSPSALLASVDQL 1058
               ++ ++     H+K S L       G+K+  +         ++ E + S  +      
Sbjct: 962  RIIQNAQQTFRIDHSKPSDLTIRDIVFGIKELQEHLLVLRGKSEIIEKAQSDAITLF--C 1019

Query: 1059 CKISSKLVAKF------LEIAIFKYHKAKVE---------PGTAVGAVGAHSIGEPGTQM 1103
            C + S+L  +       L    F++    VE         PG  VG + A SIGEP TQM
Sbjct: 1020 CLVRSRLATRRILQEYKLTKQAFQWVLNNVESQFLRSVVHPGEMVGVLAAQSIGEPATQM 1079

Query: 1104 TLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPIINAVL 1144
            TL TFHFAGVAS  VT GVPR+KEI+N +K + TP +   L
Sbjct: 1080 TLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYL 1120

>TPHA0A03070 Chr1 complement(671766..676925) [5160 bp, 1719 aa] {ON}
            Anc_7.314 YDL140C
          Length = 1719

 Score =  613 bits (1580), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 421/1179 (35%), Positives = 621/1179 (52%), Gaps = 122/1179 (10%)

Query: 9    APKR-IKGLEFSALSASDIVGQSKVEISTRDLFDLENGRKPKSGGALDTRMGVSSSQAEC 67
            AP R +K ++F   S  ++   S  +I   +  D E   + K GG  D R+G      +C
Sbjct: 9    APLRTVKEVQFGLFSPEEVRSISVAKIKFPETMD-ETQTRAKIGGLNDPRLGSIDRNLKC 67

Query: 68   STCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKSCAALLLSE--EDKRQFLS 125
             TC   +  C GHFGHI L+ PVFH+G+     +V + IC  C  LLL E  E  RQ +S
Sbjct: 68   QTCQEGMNECPGHFGHIDLAKPVFHIGFISKIKKVCECICMHCGKLLLDENNEQMRQVMS 127

Query: 126  ELRRPGIDNLRRMGILKKVVDQCKKQRRCLRCGSLNXXXXXXXXXXXXXXLKILHDTFRW 185
                   D+ +R   +  +   CK +  C                     +    D  + 
Sbjct: 128  IK-----DSKKRFNAIWTL---CKTKTVC------------------ETDVPSEDDPTQL 161

Query: 186  VGK------KSAPEKD--KWVGDWKTVLSHNP--ELERYVKKCMDDLNPLKTLNLFKQVS 235
            + +      +    KD  K VG WK   + N   E E+ V      LN  + LN+FK +S
Sbjct: 162  ISRGGCGNAQPTIRKDGLKLVGSWKKDKATNDGDEPEQRV------LNTEEILNIFKHIS 215

Query: 236  PEDCELMGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWT 295
              D   +G +   +  RP+  I   LP PP  +RPS+   +S    EDDLT KL +I+  
Sbjct: 216  VHDSNTLGFNE--QFARPDWMILTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKA 272

Query: 296  SSLIKAGLEKGISINNMMEQWDYLQLAVAMYINSDSVNP--AMMPGGSTGGKTKPIRGFC 353
            +  ++     G   + + E    LQ  +A Y+++D      A+   G      +P++   
Sbjct: 273  NISLETLEHNGAPHHAIEEAESLLQFHIATYMDNDIAGQPQALQKSG------RPVKSIR 326

Query: 354  QRLKGKQGRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKA 413
             RLKGK+GR RGNL GKRVDFS RTV+S DPNL +D+V VP  +AK LTYPE+VT YN  
Sbjct: 327  ARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNID 386

Query: 414  KLQQLVINGPNEHPGANYLLKKDEEARRNLRYGDRIKLAKNLQYGDLVERHLEDGDVVLF 473
            +L QLV NGPNEHPGA Y+++ D   R +LRY  R    + LQYG  VERH+ D D VLF
Sbjct: 387  RLTQLVRNGPNEHPGAKYVIR-DNGDRIDLRYSKRAGDIQ-LQYGWKVERHIMDNDPVLF 444

Query: 474  NRQPSLHRLSILSHFAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINL 533
            NRQPSLH++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L
Sbjct: 445  NRQPSLHKMSMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQL 504

Query: 534  MGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYSRAEFVQLLSMMSDGNMQFDIPP 593
              V   +++P+S +P +   QD + G   ++ +D F    + + +L  + D +    IP 
Sbjct: 505  CSVPLQIVSPQSNKPCMGIVQDTLCGIRKLTLRDCFIELDQLLNMLYWVPDWDGI--IPT 562

Query: 594  PAIMKPYYMWTGKQVFSLLIRPNKKSSVVINLDAKNKVYIPPKHKHLPNEMSINDGFVVI 653
            PAI+KP  +W+GKQ+ S+ I       + +    +    + PK          ++G ++I
Sbjct: 563  PAIIKPVPLWSGKQILSIAI----PKGIHLQRFDEGTTMLSPK----------DNGMLII 608

Query: 654  RGSQILSGVMDKSVLGDGKKHSVFYTILRDFGPKEAAYAMNRMAKLCARYLGNRGFSIGI 713
             G QI+ GV+DK  +G      + + + R+ GP+  A     + K+   +  + GFS GI
Sbjct: 609  DG-QIIFGVVDKKTVG-SSNGGLIHVVTREKGPQICAKMFGNIQKVVNFWFLHNGFSTGI 666

Query: 714  ND-VTPGFELKNKKEVMVEDAYAKCDDLIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKV 772
             D +  G  +K   E  + DA  K +++  +     L  + G    ++ E  +   L++ 
Sbjct: 667  GDTIADGGTMKEITET-IADAKRKVEEVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEA 725

Query: 773  REEVGEVCIKELDNLNSCLIMANCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLP 832
            R++ G +    L++LN+   M + GSKGS +N++QM A VGQQ + G R+  GF DR+LP
Sbjct: 726  RDKAGRLAEVNLNDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLP 785

Query: 833  HFLKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSL 892
            HF K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+L
Sbjct: 786  HFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKAL 845

Query: 893  EDLSCQYDNTIRTSSNGIVQFTYGGDGLDPIDMEGNAQPVNFTRSWDHA-------NNIT 945
            ED+   YD+T R S   ++QF YG DG+D   +E   Q ++     D A       + ++
Sbjct: 846  EDIMVHYDSTTRNSLGNVIQFVYGEDGIDAGHIE--KQSIDTIGGSDAAFEKRYRIDLMS 903

Query: 946  FNHSDKPLLPYQIMQQTNSI-LQPLEEKLVRYDNLGRTLDPSLQDRAEFIDQDDAERNFY 1004
             NH+  P L    ++ T  + LQ + +    Y  L   +D     R  FI   D E N++
Sbjct: 904  PNHALDPSLLESGLEITGDVKLQSILD--TEYKQL---VDDRRFLRNVFI---DGEPNWH 955

Query: 1005 --KSLREYL----------HTKASHL---------AKIRSH----KGLKQFLDEPAPELQ 1039
               ++R  +          HTK S L         A+++ +    +G  + ++E   +  
Sbjct: 956  LPVNIRRIIQNAQQTFRIDHTKPSDLTINEVIRDVARLQENLLVLRGKGKIIEEAQNDAI 1015

Query: 1040 SMDLDEGSPSALLASVDQLCKISSKLVAKFLEIAIFKYHKAKVEPGTAVGAVGAHSIGEP 1099
            ++          +  V Q  +++ +     L     ++ ++ V PG  VG + A SIGEP
Sbjct: 1016 TLFCCLVRSRLAVRRVLQEYRLTKQAFQWVLNNIESQFLRSIVHPGEMVGVLAAQSIGEP 1075

Query: 1100 GTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP 1138
             TQMTL TFHFAGVAS  VT GVPR+KEI+N +K + TP
Sbjct: 1076 ATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTP 1114

>KLTH0H02046g Chr8 complement(182788..188010) [5223 bp, 1740 aa] {ON}
            highly similar to uniprot|P04050 Saccharomyces cerevisiae
            YDL140C
          Length = 1740

 Score =  612 bits (1577), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/1191 (35%), Positives = 618/1191 (51%), Gaps = 118/1191 (9%)

Query: 1    MKEVVVDIAPKR-IKGLEFSALSASDIVGQSKVEISTRDLFDLENGRKPKSGGALDTRMG 59
            M E     AP R +K ++F   S  ++   S  +I   +  D E   + K GG  D R+G
Sbjct: 1    MVEFPYSSAPLRTVKEVQFGIFSPEEVRAISVAKIEFPETMD-ETQMRAKVGGLNDPRLG 59

Query: 60   VSSSQAECSTCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKSCAALLLSEED 119
                  +C TC   +  C GHFGHI+L+ PVFH+GY     +V + +C  C  LLL E  
Sbjct: 60   SIDRNYKCQTCGEGMNDCPGHFGHIELAKPVFHIGYISKIKKVCECVCMHCGKLLLDEH- 118

Query: 120  KRQFLSELRRPGI---DNLRRMGILKKVVDQCKKQRRCLRCGSLNXXXXXXXXXXXXXXL 176
                 SEL R  I   D  RR      V   CK +  C                     +
Sbjct: 119  -----SELMRQAIKIKDPKRR---FNAVWSLCKAKMVC------------------ETEV 152

Query: 177  KILHDTFRWVGK------KSAPEKD--KWVGDWKTVLSHNP--ELERYVKKCMDDLNPLK 226
               +D  ++V +      + +  KD    VG WK     +   + ER V      ++  +
Sbjct: 153  PSDNDPAQYVSRGGCGNTQPSVRKDGLSLVGTWKKDKGADDADQPERRV------ISADE 206

Query: 227  TLNLFKQVSPEDCELMGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLT 286
             LN+FK +SPED   +G +      RPE  I   LP PP  +RPS+   ++    EDDLT
Sbjct: 207  VLNVFKHISPEDSVRLGFNEDF--ARPEWMILTVLPVPPPPVRPSISFNET-QRGEDDLT 263

Query: 287  VKLTEIVWTSSLIKAGLEKGISINNMMEQWDYLQLAVAMYINSDSVNP--AMMPGGSTGG 344
             KL +I+  +  ++     G   + + E    LQ  VA Y+++D      A+   G    
Sbjct: 264  YKLGDILKANINVQRLEINGSPQHVIQESEALLQFHVATYMDNDIAGQPQALQKSG---- 319

Query: 345  KTKPIRGFCQRLKGKQGRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYP 404
              +PI+    RLKGK+GR RGNL GKRVDFS RTV+S DPNL +D+V VP  +A+ LTYP
Sbjct: 320  --RPIKSIRARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLDLDQVGVPKSIARTLTYP 377

Query: 405  EMVTRYNKAKLQQLVINGPNEHPGANYLLKKDEEARRNLRYGDRIKLAKNLQYGDLVERH 464
            E+VT YN  +L QLV NGPNEHPGA Y+++ D   R +LRY  R    + LQYG  VERH
Sbjct: 378  EVVTPYNIDRLTQLVRNGPNEHPGAKYIIR-DNGDRIDLRYSKRAGDIQ-LQYGWKVERH 435

Query: 465  LEDGDVVLFNRQPSLHRLSILSHFAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTE 524
            + D D VLFNRQPSLH++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+E
Sbjct: 436  IIDEDPVLFNRQPSLHKMSMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSE 495

Query: 525  EARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYSRAEFVQLLSMMSD 584
            E RAE   L  V   +++ +S +P +   QD + G   ++ +D+F    + + +L  + D
Sbjct: 496  ETRAELSQLCAVPQQIVSAQSNKPCMGIVQDTLCGVRKMTLRDTFIELDQVLNMLYWIPD 555

Query: 585  GNMQFDIPPPAIMKPYYMWTGKQVFSLLIRPNKKSSVVINLDAKNKVYIPPKHKHLPNEM 644
             +    IP P I+KP  +W+GKQ+ S+ I     S + +    +    + PK        
Sbjct: 556  WDGV--IPTPIILKPKPLWSGKQILSIAI----PSGIHLQRFDEGTTLLSPK-------- 601

Query: 645  SINDGFVVIRGSQILSGVMDKSVLGDGKKHSVFYTILRDFGPKEAAYAMNRMAKLCARYL 704
              ++G ++I G QI+ GV+DK  +G      + + + R+ GPK  A   + + K+   +L
Sbjct: 602  --DNGMLIIDG-QIIFGVVDKKTVG-SSSGGLIHVVTREKGPKICARLFSNLQKVVNFWL 657

Query: 705  GNRGFSIGINDVTPGFELKNKKEVM--VEDAYAKCDDLIDQFNKGKLETQPGCNEEQTLE 762
             + GFSIGI D     + K+ +E+   +  A  K +++  +     L  + G    ++ E
Sbjct: 658  LHNGFSIGIGDTIA--DEKSMREITEAIIVAKRKVEEVTKEAQANLLTAKHGMTLRESFE 715

Query: 763  AKIGGLLSKVREEVGEVCIKELDNLNSCLIMANCGSKGSNLNVSQMVAVVGQQIISGNRV 822
              +   L++ R++ G      L +LN+   M + GSKGS +N++QM A VGQQ + G R+
Sbjct: 716  DSVVRYLNEARDKAGRSAEVNLKDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRI 775

Query: 823  PDGFQDRSLPHFLKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETG 882
              GF DR+LPHF K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETG
Sbjct: 776  AFGFADRTLPHFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETG 835

Query: 883  YMSRRLMKSLEDLSCQYDNTIRTSSNGIVQFTYGGDGLDPIDMEGNAQPVNFTRSWDHAN 942
            Y+ RRL+K+LED+   YD T R S   ++QF YG DG+D   +E   Q ++   S D A 
Sbjct: 836  YIQRRLVKALEDIMVHYDGTTRNSLGNVIQFIYGEDGMDAAHIE--KQTIDTIASSDAAF 893

Query: 943  NITF-------NHSDKPLLPYQIMQQTNSILQPLEEKLVRYDNLGRTLDPSLQDRAEFID 995
               F        H+  P L    ++  + I+  L+ + +  +   + ++     R  F+D
Sbjct: 894  ERRFRIDLLNPRHALDPSL----LESGSEIIGDLKLQALLDEEFKQLVEDREFLRKIFVD 949

Query: 996  QD--------------DAERNFY--------KSLREYLHTKASHLAKIRSHKGLKQFLDE 1033
             +              +A++ F          ++R+ ++       K+   +G  + L E
Sbjct: 950  GEQNWPLPVNIRRIIQNAQQTFRIDQTKPTDLTIRDVVYGVKELQEKLLVLRGKSKILQE 1009

Query: 1034 PAPELQSMDLDEGSPSALLASVDQLCKISSKLVAKFLEIAIFKYHKAKVEPGTAVGAVGA 1093
                  ++             V Q  +++ +     L     ++ ++ V PG  VG + A
Sbjct: 1010 AQQNAVTLFCCLLRSRLATRRVIQEYRLNKQTFEWVLSNVESQFLRSIVHPGEMVGVLAA 1069

Query: 1094 HSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPIINAVL 1144
             SIGEP TQMTL TFHFAGVAS  VT GVPR+KEI+N +K + TP +   L
Sbjct: 1070 QSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYL 1120

>Kwal_56.24489 s56 (1018237..1023423) [5187 bp, 1728 aa] {ON} YDL140C
            (RPO21) - RNA polymerase II large subunit [contig 161]
            FULL
          Length = 1728

 Score =  610 bits (1572), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 424/1190 (35%), Positives = 625/1190 (52%), Gaps = 112/1190 (9%)

Query: 1    MKEVVVDIAPKR-IKGLEFSALSASDIVGQSKVEISTRDLFDLENGRKPKSGGALDTRMG 59
            M E     AP R +K ++F   S  ++   S  +I   +  D E   + K GG  D R+G
Sbjct: 1    MVEFPYSSAPLRTVKEVQFGMFSPEEVRAISVAKIEFPETMD-ETQMRAKVGGLNDPRLG 59

Query: 60   VSSSQAECSTCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKSCAALLLSEED 119
                  +C TC   +  C GHFGHI+L+ PVFH+GY     +V + +C  C  LLL E  
Sbjct: 60   SIDRNFKCQTCGEGMNDCPGHFGHIELAKPVFHIGYISKIKKVCECVCMHCGKLLLDEH- 118

Query: 120  KRQFLSELRRPGI---DNLRRMGILKKVVDQCKKQRRCLRCGSLNXXXXXXXXXXXXXXL 176
                 SEL +  I   D  RR      V   CK +  C                     +
Sbjct: 119  -----SELMKQAIKIKDPKRR---FNAVWSLCKVKMVC------------------ETEV 152

Query: 177  KILHDTFRWVGK------KSAPEKD--KWVGDWKTVLSHNP--ELERYVKKCMDDLNPLK 226
               +D  ++V +      + +  KD    VG WK     +   + ER +      ++  +
Sbjct: 153  PSDNDPSQYVSRGGCGNTQPSVRKDGLSLVGTWKKDKGADDADQPERRI------ISADE 206

Query: 227  TLNLFKQVSPEDCELMGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLT 286
             LN+FK +SPED   +G +      RPE  I   LP PP  +RPS+   ++    EDDLT
Sbjct: 207  VLNVFKHISPEDSVRLGFNEDF--ARPEWMILTVLPVPPPPVRPSISFNET-QRGEDDLT 263

Query: 287  VKLTEIVWTSSLIKAGLEKGISINNMMEQWDYLQLAVAMYINSDSVNP--AMMPGGSTGG 344
             KL +I+  +  ++     G   + + E    LQ  VA Y+++D      A+   G    
Sbjct: 264  YKLGDILKANINVQRLEINGSPQHVIQESEALLQFHVATYMDNDIAGQPQALQKSG---- 319

Query: 345  KTKPIRGFCQRLKGKQGRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYP 404
              +PI+    RLKGK+GR RGNL GKRVDFS RTV+S DPNL +D+V VP  +A+ LTYP
Sbjct: 320  --RPIKSIRARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLDLDQVGVPKSIARTLTYP 377

Query: 405  EMVTRYNKAKLQQLVINGPNEHPGANYLLKKDEEARRNLRYGDRIKLAKNLQYGDLVERH 464
            E+VT YN  +L QLV NGPNEHPGA Y+++ D   R +LRY  R    + LQYG  VERH
Sbjct: 378  EVVTPYNIDRLTQLVRNGPNEHPGAKYVIR-DNGDRIDLRYSKRAGDIQ-LQYGWKVERH 435

Query: 465  LEDGDVVLFNRQPSLHRLSILSHFAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTE 524
            + D D VLFNRQPSLH++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+E
Sbjct: 436  IIDEDPVLFNRQPSLHKMSMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSE 495

Query: 525  EARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYSRAEFVQLLSMMSD 584
            E RAE   L  V   +++ +S +P +   QD + G   ++ +D+F    + + +L  + D
Sbjct: 496  ETRAELSQLCAVPQQIVSAQSNKPCMGIVQDTLCGVRKMTLRDTFIELEQVLNMLYWIPD 555

Query: 585  GNMQFDIPPPAIMKPYYMWTGKQVFSLLIRPNKKSSVVINLDAKNKVYIPPKHKHLPNEM 644
             +    IP P I+KP  +W+GKQ+ S+ I     + + +    +    + PK        
Sbjct: 556  WDGV--IPTPIILKPKPLWSGKQILSIAI----PTGIHLQRFDEGTTLLSPK-------- 601

Query: 645  SINDGFVVIRGSQILSGVMDKSVLGDGKKHSVFYTILRDFGPKEAAYAMNRMAKLCARYL 704
              ++G ++I G QI+ GV+DK  +G      + + + R+ GPK  A   + + K+   +L
Sbjct: 602  --DNGMLIIDG-QIIFGVVDKKTVG-SSSGGLIHVVTREKGPKICARLFSNLQKVVNYWL 657

Query: 705  GNRGFSIGINDVTPGFELKNKKEVM--VEDAYAKCDDLIDQFNKGKLETQPGCNEEQTLE 762
             + GFSIGI D     + K+ +E+   +  A  K +++  +     L  + G    ++ E
Sbjct: 658  LHNGFSIGIGDTIA--DEKSMREITDAIVVAKRKVEEVTKEAQANLLTAKHGMTLRESFE 715

Query: 763  AKIGGLLSKVREEVGEVCIKELDNLNSCLIMANCGSKGSNLNVSQMVAVVGQQIISGNRV 822
              +   L++ R++ G      L +LN+   M + GSKGS +N++QM A VGQQ + G R+
Sbjct: 716  DNVVRYLNEARDKAGRSAEVNLKDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRI 775

Query: 823  PDGFQDRSLPHFLKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETG 882
              GF DR+LPHF K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETG
Sbjct: 776  AFGFADRTLPHFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETG 835

Query: 883  YMSRRLMKSLEDLSCQYDNTIRTSSNGIVQFTYGGDGLDPIDMEGNAQPVNFTRSWDHAN 942
            Y+ RRL+K+LED+   YD T R S   ++QF YG DG+D   +E   Q ++     D A 
Sbjct: 836  YIQRRLVKALEDIMVHYDGTTRNSLGNVIQFIYGEDGMDAAHIE--KQAIDTIACSDAAF 893

Query: 943  NITFN---HSDKPLLPYQIMQQTNSILQPLEEKLVRYDNLGRTLDPSLQDRAEFIDQDDA 999
               F     + K  L   +++  + I+  L+ + +  +   +  +     R  F+D +  
Sbjct: 894  ERRFKIDLLNPKHALDPSLLESGSEIIGDLKLQALLDEEFKQLSEDRQFLRKIFVDGEQN 953

Query: 1000 E------RNFYKSLREYL---HTKASHLAKIRSHKGLKQFLDEPAPEL--QSMDLDEGSP 1048
                   R   ++ ++     HTK + L+      G+K+ L E    L  +S  L E   
Sbjct: 954  WPLPVNIRRIIQNAQQTFRIDHTKPTDLSIRDVIYGVKE-LQEKLLVLRGKSKILQEAQV 1012

Query: 1049 SAL----------LAS--VDQLCKISSKLVAKFLEIAIFKYHKAKVEPGTAVGAVGAHSI 1096
            +A+          LAS  V Q  +++ +     L     ++ ++ V PG  VG + A SI
Sbjct: 1013 NAVTLFCCLLRSRLASRRVIQEYRLNKQTFEWVLSNVEAQFLRSLVHPGEMVGVLAAQSI 1072

Query: 1097 GEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPIINAVLGQ 1146
            GEP TQMTL TFHFAGVAS  VT GVPR+KEI+N +K + TP +   L +
Sbjct: 1073 GEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLDE 1122

>SAKL0F10472g Chr6 (808869..814061) [5193 bp, 1730 aa] {ON} highly
            similar to uniprot|P04050 Saccharomyces cerevisiae
            YDL140C
          Length = 1730

 Score =  604 bits (1557), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 416/1178 (35%), Positives = 614/1178 (52%), Gaps = 100/1178 (8%)

Query: 9    APKR-IKGLEFSALSASDIVGQSKVEISTRDLFDLENGRKPKSGGALDTRMGVSSSQAEC 67
            AP R IK ++F   S  ++   S  +I   +  D E   + K GG  D R+G      +C
Sbjct: 9    APLRTIKEVQFGLFSPEEVRAISVAKIEFPETMD-ETQMRAKVGGLNDPRLGSIDRNYKC 67

Query: 68   STCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKSCAALLLSEEDKRQFLSEL 127
             TC   +  C GHFGHI+L+ PVFH+G+     +V + +C  C  LLL E +++   +  
Sbjct: 68   QTCGEGMNDCPGHFGHIELAKPVFHIGFLSRIKKVCECVCMHCGKLLLDEHNEQMKQAIK 127

Query: 128  RRPGIDNLRRMGILKKVVDQCKKQ--------RRCLRCGSLNXXXXXXXXXXXXXXLKIL 179
             +        +  L KV   C+ +        +   R G  N                I 
Sbjct: 128  IKDPKRRFNAVWTLSKVKMICETEVPSEDDPTKYISRGGCGNTQP------------SIR 175

Query: 180  HDTFRWVGKKSAPEKDKWVGDWKTVLSHNPELERYVKKCMDDLNPLKTLNLFKQVSPEDC 239
             D    VG         W  D     +  PE     K+    ++  + LN+FK + PED 
Sbjct: 176  KDGLSLVGT--------WKKDKNADDADQPE-----KRI---ISAEEVLNVFKHICPEDS 219

Query: 240  ELMGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLI 299
              +G +      RPE  +   LP PP  +RPS+   ++    EDDLT KL +I+  +  +
Sbjct: 220  WRLGFNEDF--ARPEWMLLTVLPVPPPPVRPSISFNET-QRGEDDLTYKLGDILKANINV 276

Query: 300  KAGLEKGISINNMMEQWDYLQLAVAMYINSDSVNP--AMMPGGSTGGKTKPIRGFCQRLK 357
            +     G   + + E    LQ  VA Y+++D      A+   G      +PI+    RLK
Sbjct: 277  QRLEINGSPQHVIQESEALLQFHVATYMDNDIAGQPQALQKSG------RPIKSIRARLK 330

Query: 358  GKQGRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKAKLQQ 417
            GK+GR RGNL GKRVDFS RTV+S DPNL +D+V VP  +AK LTYPE+VT YN  +L Q
Sbjct: 331  GKEGRIRGNLMGKRVDFSARTVISGDPNLDLDQVGVPKSIAKTLTYPEVVTPYNIDRLTQ 390

Query: 418  LVINGPNEHPGANYLLKKDEEARRNLRYGDRIKLAKNLQYGDLVERHLEDGDVVLFNRQP 477
            LV NGPNEHPGA Y+++ D   R +LRY  R    + LQYG  VERH+ D D VLFNRQP
Sbjct: 391  LVRNGPNEHPGAKYVIR-DNGDRIDLRYSKRAGDIQ-LQYGWKVERHIIDNDPVLFNRQP 448

Query: 478  SLHRLSILSHFAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVK 537
            SLH++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V 
Sbjct: 449  SLHKMSMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVP 508

Query: 538  NNLLTPKSGEPIIAATQDFITGSYLISHKDSFYSRAEFVQLLSMMSDGNMQFDIPPPAIM 597
              +++P+S +P +   QD + G   ++ +D+F    + + +L  + D +    IP P I+
Sbjct: 509  LQIVSPQSNKPCMGIVQDTLCGVRKMTLRDTFIELDQVLNMLYWVPDWDGV--IPTPTIL 566

Query: 598  KPYYMWTGKQVFSLLIRPNKKSSVVINLDAKNKVYIPPKHKHLPNEMSINDGFVVIRGSQ 657
            KP  +W+GKQ+ S+ I       + +    +    + PK          ++G +++ G Q
Sbjct: 567  KPKPLWSGKQILSMAI----PKGIHLQRFDEGTTLLSPK----------DNGMLIVDG-Q 611

Query: 658  ILSGVMDKSVLGDGKKHSVFYTILRDFGPKEAAYAMNRMAKLCARYLGNRGFSIGINDVT 717
            I+ GV+DK  +G      + + + R+ GP+  A   + + K+   +L + GFSIGI D  
Sbjct: 612  IIFGVVDKKTVG-SSNGGLIHIVTREKGPQICARLFSNIQKVVNYWLLHNGFSIGIGDTI 670

Query: 718  PGFELKNKKEVMVEDAYAK--CDDLIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREE 775
               + K  +E+    A AK   +++  +     L  + G    ++ E  +   L++ R++
Sbjct: 671  A--DQKTMREITEAIAVAKKKVENVTKEAQANLLTAKHGMTLRESFEDNVVRYLNEARDK 728

Query: 776  VGEVCIKELDNLNSCLIMANCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFL 835
             G      L +LN+   M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF 
Sbjct: 729  AGRSAEVNLKDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFADRTLPHFS 788

Query: 836  KNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDL 895
            K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+
Sbjct: 789  KDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDI 848

Query: 896  SCQYDNTIRTSSNGIVQFTYGGDGLDPIDMEGNA--QPVNFTRSWDHANNITFNHSDKPL 953
               YD T R S   I+QF YG DG+D   +E  +        R+++    I   + D  L
Sbjct: 849  MVHYDGTTRNSLGNIIQFIYGEDGMDAAHIEKQSIDTIAGSDRAFERRYRIDLLNPDNAL 908

Query: 954  LPYQIMQQTNSILQPLEEKLVRYDNLGRTLDPSLQDRAEFIDQDDAE------RNFYKSL 1007
             P  +++  + ++  L+ +    +   + ++     R  F+D +         R   ++ 
Sbjct: 909  DP-SLLESGSEMMGDLKLQASLDEEYRQLVEDRRFLRKIFVDGEQNWPLPVNIRRIIQNA 967

Query: 1008 REYL---HTKASHLAKIRSHKGLKQFLDEPAPEL--QSMDLDEGSPSAL----------L 1052
            ++     HTK + L       G+K  L E    L  +S  L E   +A+          L
Sbjct: 968  QQTFRIDHTKPTDLTIHDVIYGVKD-LQEKLLVLRGKSEMLQEAQTNAVTLFCCLLRSRL 1026

Query: 1053 AS--VDQLCKISSKLVAKFLEIAIFKYHKAKVEPGTAVGAVGAHSIGEPGTQMTLKTFHF 1110
            AS  V +  K++ +     L     ++ ++ V PG  VG + A SIGEP TQMTL TFHF
Sbjct: 1027 ASRRVIEEYKLTKQTFQWVLNNVEAQFLRSIVHPGEMVGVLAAQSIGEPATQMTLNTFHF 1086

Query: 1111 AGVASMNVTLGVPRIKEIINASKVISTPIINAVLGQYE 1148
            AGVAS  VT GVPR+KEI+N +K + TP +   L   E
Sbjct: 1087 AGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLESEE 1124

>TDEL0C02320 Chr3 complement(403851..409034) [5184 bp, 1727 aa] {ON}
            Anc_7.314 YDL140C
          Length = 1727

 Score =  599 bits (1545), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/1174 (34%), Positives = 608/1174 (51%), Gaps = 100/1174 (8%)

Query: 9    APKR-IKGLEFSALSASDIVGQSKVEISTRDLFDLENGRKPKSGGALDTRMGVSSSQAEC 67
            AP R +K ++F   S  ++   S  +I   +  D E   + K GG  D R+G      +C
Sbjct: 9    APLRTVKEVQFGLFSPEEVRAISVAKIRFPETMD-ETQTRAKIGGLNDPRLGSIDRNLKC 67

Query: 68   STCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKSCAALLLSEEDKRQFLSEL 127
             TC   +  C GHFGHI L+ PVFH+G+     +V + +C  C  LLL + ++     ++
Sbjct: 68   QTCQEGMNECPGHFGHIDLAKPVFHIGFITKIKKVCECVCMHCGKLLLDDHNE-----QM 122

Query: 128  RRPGI--DNLRRMGILKKVVDQCKKQRRCLRCGSLNXXXXXXXXXXXXXXLKILHDTFRW 185
            R+     D+ +R   +  +   CK +   + C S                      T R 
Sbjct: 123  RQACKIKDSKKRFNAIWTL---CKTK---MICESDVPSEEDPTKLISRGGCGNAQPTVRK 176

Query: 186  VGKKSAPEKDKWVGDWKTVL-SHNPELERYVKKCMDDLNPLKTLNLFKQVSPEDCELMGI 244
             G K        VG WK    + +PE        M+++     LN+FK +S ED   +G 
Sbjct: 177  DGLK-------LVGSWKKEKNTGDPEEPEQRILTMEEI-----LNIFKHISKEDSNRLGF 224

Query: 245  DSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKAGLE 304
            +   +  RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  ++    
Sbjct: 225  NE--EFARPEWMILTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETLEH 281

Query: 305  KGISINNMMEQWDYLQLAVAMYINSDSVNP--AMMPGGSTGGKTKPIRGFCQRLKGKQGR 362
             G   + + E    LQ  VA Y+++D      A+   G      +P++    RLKGK+GR
Sbjct: 282  NGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSG------RPVKSIRARLKGKEGR 335

Query: 363  FRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKAKLQQLVING 422
             RGNL GKRVDFS RTV+S DPNL +D+V VP  +AK LTYPE+VT YN  +L  LV NG
Sbjct: 336  IRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTFLVRNG 395

Query: 423  PNEHPGANYLLKKDEEARRNLRYGDRIKLAKNLQYGDLVERHLEDGDVVLFNRQPSLHRL 482
            PNEHPGA Y+++ D   R +LRY  R    + LQYG  VERH+ D D VLFNRQPSLH++
Sbjct: 396  PNEHPGAKYVIR-DNGDRIDLRYSKRAGDIQ-LQYGWKVERHIMDNDPVLFNRQPSLHKM 453

Query: 483  SILSHFAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLLT 542
            S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   +++
Sbjct: 454  SMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVS 513

Query: 543  PKSGEPIIAATQDFITGSYLISHKDSFYSRAEFVQLLSMMSDGNMQFDIPPPAIMKPYYM 602
            P+S +P +   QD + G   ++ +D+F    + + +L  + D +    IP PAI+KP  +
Sbjct: 514  PQSNKPCMGIVQDTLCGIRKLTLRDNFIELDQVLNMLYWVPDWDGV--IPTPAIIKPKPL 571

Query: 603  WTGKQVFSLLIRPNKKSSVVINLDAKNKVYIPPKHKHLPNEMSINDGFVVIRGSQILSGV 662
            WTGKQ+ S+ I       + +    +    + PK          ++G ++I G +I+ GV
Sbjct: 572  WTGKQILSIAI----PKGIHLQRFDEGTTLLSPK----------DNGMLIIDG-KIIFGV 616

Query: 663  MDKSVLGDGKKHSVFYTILRDFGPKEAAYAMNRMAKLCARYLGNRGFSIGINDVTPGFEL 722
            +DK  +G      + + + R+ GP+  A     + K+   +  + GFS GI D     + 
Sbjct: 617  VDKKTVGSSSG-GLIHVVTREKGPQICARLFGNIQKVVNYWFLHNGFSTGIGDTIADGQT 675

Query: 723  KNKKEVMVEDAYAKCDDLIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVCIK 782
              +    + DA  K +D+  +     L  + G    ++ E  +   L++ R++ G +   
Sbjct: 676  MREITETIADAKKKVEDVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDKAGRLAEV 735

Query: 783  ELDNLNSCLIMANCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSKTPQ 842
             L +LN+   M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+  +P+
Sbjct: 736  NLKDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDYSPE 795

Query: 843  SKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNT 902
            SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   YD+T
Sbjct: 796  SKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDST 855

Query: 903  IRTSSNGIVQFTYGGDGLDPIDMEGNAQPV--NFTRSWDHANNITFNHSDKPLLPYQIMQ 960
             R S   ++QF YG DG+D   +E  A         +++    I   + D  L P  +++
Sbjct: 856  TRNSLGNVIQFVYGEDGMDASHIEKQAIDTIGGSDSAFEKRYRIDLLNPDHLLDP-SLLE 914

Query: 961  QTNSILQPLEEKLVRYDNLGRTLDPSLQDRAEFIDQD--------------DAERNFYKS 1006
              + I+  L+ +++  +   + ++     R+ F+D +              +A++ F   
Sbjct: 915  SGSEIVGDLKLQVLLDEEYKQLVEDRFFLRSVFVDGEPNWPLPVNIRRIVQNAQQTFRID 974

Query: 1007 LREYLHTKASHLAKIRSHKGLKQFLD----------------EPAPELQSMDLDEGSPSA 1050
                 HTK S L+    +  +K   D                + A  L    +     + 
Sbjct: 975  -----HTKPSDLSIRDVYFAVKNLQDKLLVLRGNSEIIKNAQQDAVSLFCCLMRSRLATR 1029

Query: 1051 LLASVDQLCKISSKLVAKFLEIAIFKYHKAKVEPGTAVGAVGAHSIGEPGTQMTLKTFHF 1110
             +    +L K + + V   +EI   ++ ++ V PG  VG + A SIGEP TQMTL TFHF
Sbjct: 1030 RVIEEYRLTKQAFEWVLNNIEI---QFLRSIVHPGEMVGVLAAQSIGEPATQMTLNTFHF 1086

Query: 1111 AGVASMNVTLGVPRIKEIINASKVISTPIINAVL 1144
            AGVAS  VT GVPR+      +K I + I +  L
Sbjct: 1087 AGVASKKVTSGVPRLXXXXEKAKFIRSAIEHTTL 1120

>KAFR0B01060 Chr2 complement(197351..202408) [5058 bp, 1685 aa] {ON}
           Anc_7.314 YDL140C
          Length = 1685

 Score =  566 bits (1458), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 356/933 (38%), Positives = 507/933 (54%), Gaps = 77/933 (8%)

Query: 9   APKR-IKGLEFSALSASDIVGQSKVEISTRDLFDLENGRKPKSGGALDTRMGVSSSQAEC 67
           AP R +K ++F   S  ++   S  ++   +  D E   + K GG  D R+G      +C
Sbjct: 9   APLRTVKEVQFGLFSPEEVRAISVAKVRFPETMD-ETQTRAKIGGLNDPRLGSIDRNLKC 67

Query: 68  STCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKSCAALLLSE--EDKRQFLS 125
            TC   +  C GHFGHI L+ PVFHVG+     +V +S+C  C  LLL E  E  RQ L 
Sbjct: 68  QTCQEGMNECPGHFGHIDLAKPVFHVGFISKIKKVCESVCMHCGKLLLDEHNEQMRQVL- 126

Query: 126 ELRRPGIDNLRRMGILKKVVDQCKKQRRCLRCGSLNXXXXXXXXXXXXXXLKILHDTFRW 185
           +++ P     +R      V   CK +  C                     +   +D  + 
Sbjct: 127 KIKDPK----KR---FNAVWSLCKTKMIC------------------ETDVPSENDPTQL 161

Query: 186 VGK------KSAPEKD--KWVGDWKT--VLSHNPELERYVKKCMDDLNPLKTLNLFKQVS 235
           + +      +    KD  K VG WK     S   E E+ V      L   + LN+FK +S
Sbjct: 162 ISRGGCGNAQPTVRKDGLKLVGSWKKDKATSDGEEPEQRV------LGVEEILNIFKHIS 215

Query: 236 PEDCELMGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWT 295
           PED   +G D   +  RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  
Sbjct: 216 PEDSTKLGFDE--EFARPEWMILTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKA 272

Query: 296 SSLIKAGLEKGISINNMMEQWDYLQLAVAMYINSDSVNP--AMMPGGSTGGKTKPIRGFC 353
           +  ++     G   + + E    LQ  VA Y+++D      A+   G      +P++   
Sbjct: 273 NISLETLEHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSG------RPVKSIR 326

Query: 354 QRLKGKQGRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKA 413
            RLKGK+GR RGNL GKRVDFS RTV+S DPNL +D+V VP  +A+ LTYPE+VT YN  
Sbjct: 327 ARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIARTLTYPEVVTPYNID 386

Query: 414 KLQQLVINGPNEHPGANYLLKKDEEARRNLRYGDRIKLAKNLQYGDLVERHLEDGDVVLF 473
           +L QLV NGPNEHPGA Y+++ D   R +LRY  R    + LQYG  VERH+ D D VLF
Sbjct: 387 RLTQLVRNGPNEHPGAKYVIR-DNGDRIDLRYSKRAGDIQ-LQYGWKVERHIMDDDPVLF 444

Query: 474 NRQPSLHRLSILSHFAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINL 533
           NRQPSLH++S++SH  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L
Sbjct: 445 NRQPSLHKMSMMSHRVKVVPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQL 504

Query: 534 MGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYSRAEFVQLLSMMSDGNMQFDIPP 593
             V   +++P+S +P +   QD + G  +++ KD+F      + +L  + D +    IP 
Sbjct: 505 CAVPLQIVSPQSNKPCMGIVQDTLCGIRILTLKDTFLEFDHVLNMLYWVPDWDGI--IPT 562

Query: 594 PAIMKPYYMWTGKQVFSLLIRPNKKSSVVINLDAKNKVYIPPKHKHLPNEMSINDGFVVI 653
           PAI+KP  +WTGKQ+ S  I       + +    +    + PK          ++G ++I
Sbjct: 563 PAILKPKPLWTGKQILSAAI----PKGIHLQRFDEGTTLLSPK----------DNGMLII 608

Query: 654 RGSQILSGVMDKSVLGDGKKHSVFYTILRDFGPKEAAYAMNRMAKLCARYLGNRGFSIGI 713
            G QI+ GV+DK  +G      + + + R+ GP+  +     + K+   +L + GFS GI
Sbjct: 609 DG-QIIFGVVDKKTVGSSSG-GLIHVVTREKGPQVCSRLFGNIQKVVNFWLLHNGFSTGI 666

Query: 714 NDVTPGFELKNKKEVMVEDAYAKCDDLIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVR 773
            D     E   +    + +A  K +++  +     L  + G    ++ E  +   L++ R
Sbjct: 667 GDTIANGETIKEITETIAEAKKKVEEVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEAR 726

Query: 774 EEVGEVCIKELDNLNSCLIMANCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPH 833
           ++ G +    L++ N    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPH
Sbjct: 727 DKAGRLAEVNLNDTNYVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIGYGFVDRTLPH 786

Query: 834 FLKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLE 893
           F K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LE
Sbjct: 787 FSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALE 846

Query: 894 DLSCQYDNTIRTSSNGIVQFTYGGDGLDPIDME 926
           D+   YD T R S   I+QF YG DG+D   +E
Sbjct: 847 DIMVHYDGTTRNSLGNIIQFIYGEDGIDASHIE 879

 Score = 84.0 bits (206), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 39/69 (56%), Positives = 49/69 (71%)

Query: 1076 KYHKAKVEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVI 1135
            ++ ++ V PG  VG + A SIGEP TQMTL TFHFAGVAS  VT GVPR+KEI+N +K +
Sbjct: 1052 QFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNM 1111

Query: 1136 STPIINAVL 1144
             TP +   L
Sbjct: 1112 KTPSLTVYL 1120

>ZYRO0F05918g Chr6 (487056..492290) [5235 bp, 1744 aa] {ON} highly
           similar to uniprot|P04050 Saccharomyces cerevisiae
           YDL140C
          Length = 1744

 Score =  567 bits (1461), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 359/930 (38%), Positives = 509/930 (54%), Gaps = 65/930 (6%)

Query: 9   APKR-IKGLEFSALSASDIVGQSKVEISTRDLFDLENGRKPKSGGALDTRMGVSSSQAEC 67
           AP R +K ++F   S  +I   S  +I   +  D E   + K GG  D R+G      +C
Sbjct: 9   APLRTVKEVQFGLFSPEEICAISVAKIKFPETMD-ETQTRAKIGGLNDPRLGSIDRSLKC 67

Query: 68  STCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKSCAALLLSEEDKRQFLSEL 127
            TC   +  C GHFGHI+L+ PVFH+G+     +V + +C  C  LLL E +      E 
Sbjct: 68  QTCQEGMNECPGHFGHIELAKPVFHIGFISKIKKVCECVCMHCGKLLLDEHN------EQ 121

Query: 128 RRPGI---DNLRRMGILKKVVDQCKKQRRCLR--CGSLNXXXXXXXXXXXXXXLKILHDT 182
            R  I   D+ +R      V   CK +  C        +                I  D 
Sbjct: 122 MRQAIKIKDSKKR---FNAVWSLCKAKMICDTDVPSDEDPTQLISRGGCGNAQPTIRRDG 178

Query: 183 FRWVGKKSAPEKDKWVGDWKTVLSHNPELERYVKKCMDDLNPLKTLNLFKQVSPEDCELM 242
            + VG   + +KDK  GD       N E E+ V      LN  + LN+FK +SPED   +
Sbjct: 179 LKLVG---SWKKDKNSGD-------NEEPEQRV------LNMEEILNIFKHISPEDSWKL 222

Query: 243 GIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKAG 302
           G +   +  RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  ++  
Sbjct: 223 GFNE--EFARPEWMILTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETL 279

Query: 303 LEKGISINNMMEQWDYLQLAVAMYINSDSVNP--AMMPGGSTGGKTKPIRGFCQRLKGKQ 360
              G   + + E    LQ  VA Y+++D      A+   G      +P++    RLKGK+
Sbjct: 280 EHNGAPHHTIEEAESLLQFHVATYMDNDIAGQPQALQKSG------RPVKSIRARLKGKE 333

Query: 361 GRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKAKLQQLVI 420
           GR RGNL GKRVDFS RTV+S DPNL +D+V VP  +AK LTYPE+VT YN  +L  LV 
Sbjct: 334 GRIRGNLMGKRVDFSARTVISGDPNLDLDQVGVPKSIAKTLTYPEVVTPYNIDRLTMLVR 393

Query: 421 NGPNEHPGANYLLKKDEEARRNLRYGDRIKLAKNLQYGDLVERHLEDGDVVLFNRQPSLH 480
           NGPNEHPGA Y+++ D   R +LRY  R    + LQYG  VERH+ D D VLFNRQPSLH
Sbjct: 394 NGPNEHPGAKYVIR-DNGDRIDLRYSKRAGDIQ-LQYGWKVERHVIDNDPVLFNRQPSLH 451

Query: 481 RLSILSHFAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL 540
           ++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   +
Sbjct: 452 KMSMMAHKVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPQQI 511

Query: 541 LTPKSGEPIIAATQDFITGSYLISHKDSFYSRAEFVQLLSMMSDGNMQFDIPPPAIMKPY 600
           ++P+S +P +   QD + G   ++ +D+F    + + +L  + D +    IP PAI+KP 
Sbjct: 512 VSPQSNKPCMGVVQDTLCGIRKLTLRDNFIELGQVLNMLYWVPDWDGV--IPTPAILKPK 569

Query: 601 YMWTGKQVFSLLIRPNKKSSVVINLDAKNKVYIPPKHKHLPNEMSINDGFVVIRGSQILS 660
            +WTGKQ+ S+ I       + +    +    + PK          ++G +VI G QI+ 
Sbjct: 570 PLWTGKQLLSVAI----PKGIHLQRFDEGTTLLSPK----------DNGMLVIDG-QIIF 614

Query: 661 GVMDKSVLGDGKKHSVFYTILRDFGPKEAAYAMNRMAKLCARYLGNRGFSIGIND-VTPG 719
           GV+DK  +G      + + + R+ GP+  A   + + K+   +  + GFS GI D +  G
Sbjct: 615 GVVDKKTVG-SSSGGLIHVVTREKGPQVCATLFSNIQKVVNYWFLHCGFSTGIGDTIADG 673

Query: 720 FELKNKKEVMVEDAYAKCDDLIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 779
             ++   E + E A  K +D+  +     L  + G    ++ E  +   L++ R++ G +
Sbjct: 674 QTMRQITEAIAE-AKVKVEDVTKEAQANLLTAKHGMTLRESFEDNVVRYLNEARDKAGRL 732

Query: 780 CIKELDNLNSCLIMANCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSK 839
               L++ N    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+  
Sbjct: 733 AEVNLNDTNFVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDY 792

Query: 840 TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 899
           +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   Y
Sbjct: 793 SPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHY 852

Query: 900 DNTIRTSSNGIVQFTYGGDGLDPIDMEGNA 929
           D T R S   I+QF YG DG+D   +E  A
Sbjct: 853 DGTTRNSLGNIIQFIYGEDGMDAAHIEKQA 882

 Score = 85.5 bits (210), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 44/88 (50%), Positives = 59/88 (67%), Gaps = 3/88 (3%)

Query: 1057 QLCKISSKLVAKFLEIAIFKYHKAKVEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASM 1116
            +L K + + V   +E+   ++ ++ V PG  VG + A SIGEP TQMTL TFHFAGVAS 
Sbjct: 1036 RLTKQAFEWVLNNIEV---QFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASK 1092

Query: 1117 NVTLGVPRIKEIINASKVISTPIINAVL 1144
             VT GVPR+KEI+N +K + TP + A L
Sbjct: 1093 KVTSGVPRLKEILNVAKNMKTPSLTAYL 1120

>NDAI0A02130 Chr1 complement(477808..482997) [5190 bp, 1729 aa] {ON}
           Anc_7.314
          Length = 1729

 Score =  564 bits (1453), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 357/926 (38%), Positives = 507/926 (54%), Gaps = 63/926 (6%)

Query: 9   APKR-IKGLEFSALSASDIVGQSKVEISTRDLFDLENGRKPKSGGALDTRMGVSSSQAEC 67
           AP R +K ++F   S  ++   S  +I   +  D E   + K GG  D R+G      +C
Sbjct: 9   APLRTVKEVQFGLFSPEEVRAISVAKIRFPETMD-ETQTRAKIGGLNDPRLGSIDRNLKC 67

Query: 68  STCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKSCAALLLSE--EDKRQFLS 125
            TC   +  C GHFGHI L+ PV HVG+     +V +S+C  C  LLL E  E  RQ ++
Sbjct: 68  QTCQEGMNECPGHFGHIDLAKPVLHVGFIAKIKKVCESVCMHCGKLLLDEHNEQMRQAIA 127

Query: 126 ELRRPGIDNLRRMGILKKVVDQCKKQRRCLRCGSLNXXXXXXXXXXXXXXLKILHDTFRW 185
                  D+ +R      V + CK +   + C +                      T R 
Sbjct: 128 IK-----DSKKR---FNAVWNLCKTK---MICDTDVPSDDDPTQLISRGGCGNAQPTVRK 176

Query: 186 VGKKSAPEKDKWVGDWKTVLSHNP--ELERYVKKCMDDLNPLKTLNLFKQVSPEDCELMG 243
            G K        VG WK   + N   E E+ V      L+  + LN+FK +SPED   +G
Sbjct: 177 DGLK-------LVGSWKKEKNTNDGDEPEQRV------LSTEEILNIFKHISPEDSTRLG 223

Query: 244 IDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKAGL 303
            +      RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  ++   
Sbjct: 224 FNEEF--ARPEWMILNVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETLE 280

Query: 304 EKGISINNMMEQWDYLQLAVAMYINSDSVNP--AMMPGGSTGGKTKPIRGFCQRLKGKQG 361
             G   + + E    LQ  VA Y+++D      A+   G      +P++    RLKGK+G
Sbjct: 281 HNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSG------RPVKSIRARLKGKEG 334

Query: 362 RFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKAKLQQLVIN 421
           R RGNL GKRVDFS RTV+S DPNL +D+V VP  +A+ LTYPE+VT YN  +L QLV N
Sbjct: 335 RIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIARTLTYPEVVTPYNIDRLTQLVRN 394

Query: 422 GPNEHPGANYLLKKDEEARRNLRYGDRIKLAKNLQYGDLVERHLEDGDVVLFNRQPSLHR 481
           GPNEHPGA Y+++ D   R +LRY  R    + LQYG  VERH+ D D VLFNRQPSLH+
Sbjct: 395 GPNEHPGAKYVIR-DNGDRIDLRYSKRAGDIQ-LQYGWKVERHITDNDPVLFNRQPSLHK 452

Query: 482 LSILSHFAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLL 541
           +S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   ++
Sbjct: 453 MSMMAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIV 512

Query: 542 TPKSGEPIIAATQDFITGSYLISHKDSFYSRAEFVQLLSMMSDGNMQFDIPPPAIMKPYY 601
           + +S +P +   QD + G   ++ +D+F    E + +L  + D +    IP PAI+KP  
Sbjct: 513 SAQSNKPCMGIVQDTLCGIRKLTLRDTFLEFDEVLNMLYWVPDWDGV--IPTPAIIKPKP 570

Query: 602 MWTGKQVFSLLIRPNKKSSVVINLDAKNKVYIPPKHKHLPNEMSINDGFVVIRGSQILSG 661
           +W+GKQV S+ I       + +    +    + PK          ++G +V+ G QI+ G
Sbjct: 571 LWSGKQVLSIAI----PRGIHLQRFDEGTTLLSPK----------DNGMLVVDG-QIIFG 615

Query: 662 VMDKSVLGDGKKHSVFYTILRDFGPKEAAYAMNRMAKLCARYLGNRGFSIGIND-VTPGF 720
           V+DK  +G      + + + R+ GP   A     + K+   +L + GFS GI D +  G 
Sbjct: 616 VVDKKTVG-SSNGGLIHVVTREKGPTICAKLFGNIQKVVNFWLLHNGFSTGIGDTIADGS 674

Query: 721 ELKNKKEVMVEDAYAKCDDLIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVC 780
            +K   E  + DA  K +D+  +     L  + G    ++ E  +   L++ R++ G + 
Sbjct: 675 TIKEITET-IADAKRKVEDVTKEAQSNLLTAKHGMTLRESFEDNVVRFLNEARDKAGRLA 733

Query: 781 IKELDNLNSCLIMANCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSKT 840
              L++LN+   M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+  +
Sbjct: 734 EMNLNDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIGYGFVDRTLPHFSKDDYS 793

Query: 841 PQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD 900
           P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   YD
Sbjct: 794 PESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYD 853

Query: 901 NTIRTSSNGIVQFTYGGDGLDPIDME 926
            T R S   ++QF YG DG+D   +E
Sbjct: 854 GTARNSLGNVIQFIYGEDGMDAAHIE 879

 Score = 84.0 bits (206), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 39/69 (56%), Positives = 49/69 (71%)

Query: 1076 KYHKAKVEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVI 1135
            ++ ++ V PG  VG + A SIGEP TQMTL TFHFAGVAS  VT GVPR+KEI+N +K +
Sbjct: 1052 QFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNM 1111

Query: 1136 STPIINAVL 1144
             TP +   L
Sbjct: 1112 KTPSLTVYL 1120

>KNAG0C03970 Chr3 complement(778936..784101) [5166 bp, 1721 aa] {ON}
           Anc_7.314 YDL140C
          Length = 1721

 Score =  563 bits (1452), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 355/930 (38%), Positives = 514/930 (55%), Gaps = 82/930 (8%)

Query: 9   APKR-IKGLEFSALSASDIVGQSKVEISTRDLFDLENGRKPKSGGALDTRMGVSSSQAEC 67
           AP R +K ++F   S  ++   S  +I   +  D E   + K GG  D R+G      +C
Sbjct: 9   APLRTVKEVQFGLFSPEEVRAISVAKIKFPETMD-ETQTRAKIGGLNDPRLGSIDRNLKC 67

Query: 68  STCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKSCAALLLSE--EDKRQFLS 125
            TC   ++ C GHFGHI L+ PVFHVG+     +V + +C  C  LLL E  E  RQ ++
Sbjct: 68  QTCQEGMSECPGHFGHIDLAKPVFHVGFITKIKKVCECVCMHCGKLLLDENNEQMRQVMA 127

Query: 126 ELRRPGIDNLRRMGILKKVVDQCKKQRRCLRCGSLNXXXXXXXXXXXXXXLKILHDTFRW 185
            ++ P     +R      +   CK +  C                     +   +D  + 
Sbjct: 128 -IKDPK----KRFNATWAL---CKTKMVC------------------ETDVPSENDPTKL 161

Query: 186 VGK------KSAPEKD--KWVGDWK---TVLSHNPELERYVKKCMDDLNPLKTLNLFKQV 234
           V +      +    KD  K VG WK   T+    PE +R        L+  + LN+FK +
Sbjct: 162 VSRGGCGNTQPTVRKDGLKLVGSWKRKKTIEGEEPE-QRV-------LSTEEILNIFKHI 213

Query: 235 SPEDCELMGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVW 294
           S ED   +G +      RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+ 
Sbjct: 214 STEDFIRLGFNEEFS--RPEWMILTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILK 270

Query: 295 TSSLIKAGLEKGISINNMMEQWDYLQLAVAMYINSDSVNP--AMMPGGSTGGKTKPIRGF 352
            +  ++     G   + + E    LQ  VA Y+++D      A+   G      +P++  
Sbjct: 271 ANISLETLEHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSG------RPVKSI 324

Query: 353 CQRLKGKQGRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNK 412
             RLKGK+GR RGNL GKRVDFS RTV+S DPNL +D+V VP  +A+ LTYPE+VT YN 
Sbjct: 325 RARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIARTLTYPEVVTPYNI 384

Query: 413 AKLQQLVINGPNEHPGANYLLKKDEEARRNLRYGDRIKLAKNLQYGDLVERHLEDGDVVL 472
            +L QLV NGPNEHPGA Y+++++ + R +LRY  R    + LQYG  VERH+ D D VL
Sbjct: 385 DRLTQLVRNGPNEHPGAKYVIRENGD-RIDLRYSKRAGDVQ-LQYGWKVERHIMDDDPVL 442

Query: 473 FNRQPSLHRLSILSHFAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAIN 532
           FNRQPSLH++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   
Sbjct: 443 FNRQPSLHKMSMMAHKVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQ 502

Query: 533 LMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYSRAEFVQLLSMMSDGNMQFDIP 592
           L  V   +++P+S +P +   QD + G  +++ +D+F      + +L  + D +    IP
Sbjct: 503 LCAVPLQIVSPQSNKPCMGIVQDTLCGIRILTLRDTFLELDHVLNMLYWVPDWDGV--IP 560

Query: 593 PPAIMKPYYMWTGKQVFSLLIRPNKKSSVVINLDAKNKVYIPPKHKHLPNEMSINDGFVV 652
            PAI+KP  +WTGKQ+ S+ I PN    + +    +    + PK          ++G ++
Sbjct: 561 TPAILKPKPLWTGKQILSVAI-PN---GIHLQRFDEGTTLLSPK----------DNGMLI 606

Query: 653 IRGSQILSGVMDKSVLGDGKKHSVFYTILRDFGPKEAAYAMNRMAKLCARYLGNRGFSIG 712
           I G QI+ GV+DK  +G      + + + R+ GP+  A     + K+   +L + GFS G
Sbjct: 607 IDG-QIIFGVVDKKTVG-SSSGGLIHVVTREKGPQTCARLFGNIQKVVNFWLLHNGFSTG 664

Query: 713 IND-VTPGFELKNKKEVMVEDAYAKCDDLIDQFNKGKLETQPGCNEEQTLEAKIGGLLSK 771
           I D +  G  +K   E + E A  K +++  +     L  + G    ++ E  +   L++
Sbjct: 665 IGDTIADGATIKEITETIAE-AKKKVEEVTKEAQANLLTAKHGMTLRESFEDNVVRFLNE 723

Query: 772 VREEVGEVCIKELDNLNSCLIMANCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSL 831
            R++ G +    L++ N    M + GSKGS +N++QM A VGQQ + G R+  GF DR+L
Sbjct: 724 ARDKAGRLAEVNLNDTNFVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIGFGFVDRTL 783

Query: 832 PHFLKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKS 891
           PHF K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+
Sbjct: 784 PHFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKA 843

Query: 892 LEDLSCQYDNTIRTSSNGIVQFTYGGDGLD 921
           LED+   YDNT R S   ++QF YG DG+D
Sbjct: 844 LEDIMVHYDNTTRNSLGNVIQFIYGEDGID 873

 Score = 84.0 bits (206), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 39/69 (56%), Positives = 49/69 (71%)

Query: 1076 KYHKAKVEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVI 1135
            ++ ++ V PG  VG + A SIGEP TQMTL TFHFAGVAS  VT GVPR+KEI+N +K +
Sbjct: 1051 QFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNM 1110

Query: 1136 STPIINAVL 1144
             TP +   L
Sbjct: 1111 KTPSLTVYL 1119

>YDL140C Chr4 complement(205360..210561) [5202 bp, 1733 aa] {ON}
           RPO21RNA polymerase II largest subunit B220, part of
           central core; phosphorylation of C-terminal heptapeptide
           repeat domain regulates association with transcription
           and splicing factors; similar to bacterial beta-prime
          Length = 1733

 Score =  563 bits (1450), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 354/927 (38%), Positives = 509/927 (54%), Gaps = 65/927 (7%)

Query: 9   APKR-IKGLEFSALSASDIVGQSKVEISTRDLFDLENGRKPKSGGALDTRMGVSSSQAEC 67
           AP R +K ++F   S  ++   S  +I   +  D E   + K GG  D R+G      +C
Sbjct: 9   APLRTVKEVQFGLFSPEEVRAISVAKIRFPETMD-ETQTRAKIGGLNDPRLGSIDRNLKC 67

Query: 68  STCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKSCAALLLSEEDKRQFLSEL 127
            TC   +  C GHFGHI L+ PVFHVG+     +V + +C  C  LLL E +      EL
Sbjct: 68  QTCQEGMNECPGHFGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHN------EL 121

Query: 128 RRPGI---DNLRRMGILKKVVDQCKKQRRCLR--CGSLNXXXXXXXXXXXXXXLKILHDT 182
            R  +   D+ +R   +  +   CK +  C        +                I  D 
Sbjct: 122 MRQALAIKDSKKRFAAIWTL---CKTKMVCETDVPSEDDPTQLVSRGGCGNTQPTIRKDG 178

Query: 183 FRWVGKKSAPEKDKWVGDWKTVLSHNPELERYVKKCMDDLNPLKTLNLFKQVSPEDCELM 242
            + VG   + +KD+  GD     +  PEL          L+  + LN+FK +S +D   +
Sbjct: 179 LKLVG---SWKKDRATGD-----ADEPELRV--------LSTEEILNIFKHISVKDFTSL 222

Query: 243 GIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKAG 302
           G +      RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  ++  
Sbjct: 223 GFNEVFS--RPEWMILTCLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETL 279

Query: 303 LEKGISINNMMEQWDYLQLAVAMYINSDSVNP--AMMPGGSTGGKTKPIRGFCQRLKGKQ 360
              G   + + E    LQ  VA Y+++D      A+   G      +P++    RLKGK+
Sbjct: 280 EHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSG------RPVKSIRARLKGKE 333

Query: 361 GRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKAKLQQLVI 420
           GR RGNL GKRVDFS RTV+S DPNL +D+V VP  +AK LTYPE+VT YN  +L QLV 
Sbjct: 334 GRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVR 393

Query: 421 NGPNEHPGANYLLKKDEEARRNLRYGDRIKLAKNLQYGDLVERHLEDGDVVLFNRQPSLH 480
           NGPNEHPGA Y+++ D   R +LRY  R    + LQYG  VERH+ D D VLFNRQPSLH
Sbjct: 394 NGPNEHPGAKYVIR-DSGDRIDLRYSKRAGDIQ-LQYGWKVERHIMDNDPVLFNRQPSLH 451

Query: 481 RLSILSHFAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL 540
           ++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   +
Sbjct: 452 KMSMMAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQI 511

Query: 541 LTPKSGEPIIAATQDFITGSYLISHKDSFYSRAEFVQLLSMMSDGNMQFDIPPPAIMKPY 600
           ++P+S +P +   QD + G   ++ +D+F    + + +L  + D +    IP PAI+KP 
Sbjct: 512 VSPQSNKPCMGIVQDTLCGIRKLTLRDTFIELDQVLNMLYWVPDWDGV--IPTPAIIKPK 569

Query: 601 YMWTGKQVFSLLIRPNKKSSVVINLDAKNKVYIPPKHKHLPNEMSINDGFVVIRGSQILS 660
            +W+GKQ+ S+ I PN    + +    +    + PK          ++G ++I G QI+ 
Sbjct: 570 PLWSGKQILSVAI-PN---GIHLQRFDEGTTLLSPK----------DNGMLIIDG-QIIF 614

Query: 661 GVMDKSVLGDGKKHSVFYTILRDFGPKEAAYAMNRMAKLCARYLGNRGFSIGIND-VTPG 719
           GV++K  +G      + + + R+ GP+  A     + K+   +L + GFS GI D +  G
Sbjct: 615 GVVEKKTVGSSNG-GLIHVVTREKGPQVCAKLFGNIQKVVNFWLLHNGFSTGIGDTIADG 673

Query: 720 FELKNKKEVMVEDAYAKCDDLIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 779
             ++   E + E A  K  D+  +     L  + G    ++ E  +   L++ R++ G +
Sbjct: 674 PTMREITETIAE-AKKKVLDVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDKAGRL 732

Query: 780 CIKELDNLNSCLIMANCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSK 839
               L +LN+   M   GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+  
Sbjct: 733 AEVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDY 792

Query: 840 TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 899
           +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   Y
Sbjct: 793 SPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHY 852

Query: 900 DNTIRTSSNGIVQFTYGGDGLDPIDME 926
           DNT R S   ++QF YG DG+D   +E
Sbjct: 853 DNTTRNSLGNVIQFIYGEDGMDAAHIE 879

 Score = 84.0 bits (206), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 39/69 (56%), Positives = 49/69 (71%)

Query: 1076 KYHKAKVEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVI 1135
            ++ ++ V PG  VG + A SIGEP TQMTL TFHFAGVAS  VT GVPR+KEI+N +K +
Sbjct: 1052 QFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNM 1111

Query: 1136 STPIINAVL 1144
             TP +   L
Sbjct: 1112 KTPSLTVYL 1120

>Smik_4.95 Chr4 complement(182198..187357) [5160 bp, 1719 aa] {ON}
           YDL140C (REAL)
          Length = 1719

 Score =  561 bits (1447), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 353/927 (38%), Positives = 509/927 (54%), Gaps = 65/927 (7%)

Query: 9   APKR-IKGLEFSALSASDIVGQSKVEISTRDLFDLENGRKPKSGGALDTRMGVSSSQAEC 67
           AP R +K ++F   S  ++   S  +I   +  D E   + K GG  D R+G      +C
Sbjct: 9   APLRTVKEVQFGLFSPEEVRAISVAKIRFPETMD-ETQTRAKIGGLNDPRLGSIDRNLKC 67

Query: 68  STCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKSCAALLLSEEDKRQFLSEL 127
            TC   +  C GHFGHI L+ PVFHVG+     +V + +C  C  LLL E +      EL
Sbjct: 68  QTCQEGMNECPGHFGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHN------EL 121

Query: 128 RRPGI---DNLRRMGILKKVVDQCKKQRRCLR--CGSLNXXXXXXXXXXXXXXLKILHDT 182
            R  +   D+ +R   +  +   CK +  C        +                +  D 
Sbjct: 122 MRQALAIKDSKKRFAAIWTL---CKTKMVCETDVPSEDDPTQLVSRGGCGNTQPTVRKDG 178

Query: 183 FRWVGKKSAPEKDKWVGDWKTVLSHNPELERYVKKCMDDLNPLKTLNLFKQVSPEDCELM 242
            + VG   + +KD+  GD     +  PEL          L+  + LN+FK +S +D   +
Sbjct: 179 LKLVG---SWKKDRASGD-----AEEPELRV--------LSTEEILNIFKHISVKDFTSL 222

Query: 243 GIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKAG 302
           G +      RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  ++  
Sbjct: 223 GFNEVFS--RPEWMILTCLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETL 279

Query: 303 LEKGISINNMMEQWDYLQLAVAMYINSDSVNP--AMMPGGSTGGKTKPIRGFCQRLKGKQ 360
              G   + + E    LQ  VA Y+++D      A+   G      +P++    RLKGK+
Sbjct: 280 EHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSG------RPVKSIRARLKGKE 333

Query: 361 GRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKAKLQQLVI 420
           GR RGNL GKRVDFS RTV+S DPNL +D+V VP  +AK LTYPE+VT YN  +L QLV 
Sbjct: 334 GRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVR 393

Query: 421 NGPNEHPGANYLLKKDEEARRNLRYGDRIKLAKNLQYGDLVERHLEDGDVVLFNRQPSLH 480
           NGPNEHPGA Y+++ D   R +LRY  R    + LQYG  VERH+ D D VLFNRQPSLH
Sbjct: 394 NGPNEHPGAKYVIR-DSGDRIDLRYSKRAGDIQ-LQYGWKVERHIMDNDPVLFNRQPSLH 451

Query: 481 RLSILSHFAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL 540
           ++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   +
Sbjct: 452 KMSMMAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQI 511

Query: 541 LTPKSGEPIIAATQDFITGSYLISHKDSFYSRAEFVQLLSMMSDGNMQFDIPPPAIMKPY 600
           ++P+S +P +   QD + G   ++ +D+F    + + +L  + D +    IP PAI+KP 
Sbjct: 512 VSPQSNKPCMGIVQDTLCGIRKLTLRDTFIELDQVLNMLYWVPDWDGV--IPTPAIIKPK 569

Query: 601 YMWTGKQVFSLLIRPNKKSSVVINLDAKNKVYIPPKHKHLPNEMSINDGFVVIRGSQILS 660
            +W+GKQ+ S+ I PN    + +    +    + PK          ++G ++I G QI+ 
Sbjct: 570 PLWSGKQILSVAI-PN---GIHLQRFDEGTTLLSPK----------DNGMLIIDG-QIIF 614

Query: 661 GVMDKSVLGDGKKHSVFYTILRDFGPKEAAYAMNRMAKLCARYLGNRGFSIGIND-VTPG 719
           GV++K  +G      + + + R+ GP+  A     + K+   +L + GFS GI D +  G
Sbjct: 615 GVVEKKTVGSSNG-GLIHVVTREKGPQVCAKLFGNIQKVVNFWLLHNGFSTGIGDTIADG 673

Query: 720 FELKNKKEVMVEDAYAKCDDLIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 779
             ++   E + E A  K  D+  +     L  + G    ++ E  +   L++ R++ G +
Sbjct: 674 PTMREITETIAE-AKKKVLDVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDKAGRL 732

Query: 780 CIKELDNLNSCLIMANCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSK 839
               L +LN+   M   GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+  
Sbjct: 733 AEVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDY 792

Query: 840 TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 899
           +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   Y
Sbjct: 793 SPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHY 852

Query: 900 DNTIRTSSNGIVQFTYGGDGLDPIDME 926
           DNT R S   ++QF YG DG+D   +E
Sbjct: 853 DNTTRNSLGNVIQFIYGEDGMDAAHIE 879

 Score = 83.6 bits (205), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 39/69 (56%), Positives = 49/69 (71%)

Query: 1076 KYHKAKVEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVI 1135
            ++ ++ V PG  VG + A SIGEP TQMTL TFHFAGVAS  VT GVPR+KEI+N +K +
Sbjct: 1052 QFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNM 1111

Query: 1136 STPIINAVL 1144
             TP +   L
Sbjct: 1112 KTPSLTVYL 1120

>TBLA0F02170 Chr6 (535350..540530) [5181 bp, 1726 aa] {ON} Anc_7.314
           YDL140C
          Length = 1726

 Score =  561 bits (1445), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 352/933 (37%), Positives = 510/933 (54%), Gaps = 77/933 (8%)

Query: 9   APKR-IKGLEFSALSASDIVGQSKVEISTRDLFDLENGRKPKSGGALDTRMGVSSSQAEC 67
           AP R IK ++F   S  +I   S  +I   +  D E   + K GG  D R+G      +C
Sbjct: 9   APLRTIKEVQFGLFSPEEIRAISVAKIRFPETMD-ETQTRAKIGGLNDPRLGSIDRNLKC 67

Query: 68  STCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKSCAALLLSE--EDKRQFLS 125
            TC   +  C GHFGHI L+ PVFH+G+     +V + IC  C  LLL E  E  RQ L 
Sbjct: 68  QTCQEGMNECPGHFGHIDLAKPVFHIGFISKIKKVCECICMHCGKLLLDEHNEQMRQIL- 126

Query: 126 ELRRPGIDNLRRMGILKKVVDQCKKQRRCLRCGSLNXXXXXXXXXXXXXXLKILHDTFRW 185
           +++    D+ +R   +  +   CK +  C                     +   HD  + 
Sbjct: 127 KIK----DSKKRFNAIWSL---CKTKMIC------------------DTDVPSEHDPTQL 161

Query: 186 VGK------KSAPEKD--KWVGDWKTV--LSHNPELERYVKKCMDDLNPLKTLNLFKQVS 235
           V +      +    KD  K VG WK     S   E E+ +      L+  + LN+FK +S
Sbjct: 162 VSRGGCGNAQPTVRKDGLKLVGSWKKEKNTSDGDEPEQRI------LSTEEILNIFKHIS 215

Query: 236 PEDCELMGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWT 295
           PED   MG +   +  RPE      LP PP  +RPS+   +S    EDDLT KL +I+  
Sbjct: 216 PEDSIAMGFNE--EFSRPEWMFLTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKA 272

Query: 296 SSLIKAGLEKGISINNMMEQWDYLQLAVAMYINSDSVNP--AMMPGGSTGGKTKPIRGFC 353
           +  ++     G   + + E    LQ  VA Y+++D      A+   G      +P++   
Sbjct: 273 NISLETLEHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSG------RPVKSIR 326

Query: 354 QRLKGKQGRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKA 413
            RLKGK+GR RGNL GKRVDFS RTV+S DPNL +D+V VP  +AK LTYPE+VT YN  
Sbjct: 327 ARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNID 386

Query: 414 KLQQLVINGPNEHPGANYLLKKDEEARRNLRYGDRIKLAKNLQYGDLVERHLEDGDVVLF 473
           +L  LV NGPNEHPGA Y+++ D   R +LRY  R    + LQYG  VERH+ D D VLF
Sbjct: 387 RLTHLVRNGPNEHPGAKYVIR-DNGDRIDLRYSKRAGDIQ-LQYGWKVERHIMDNDPVLF 444

Query: 474 NRQPSLHRLSILSHFAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINL 533
           NRQPSLH++S+++H  ++ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L
Sbjct: 445 NRQPSLHKMSMMAHRVRVMPFSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQL 504

Query: 534 MGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYSRAEFVQLLSMMSDGNMQFDIPP 593
             V   +++ +S +P +   QD + G   ++ +D+F    + + LL  + D +    IP 
Sbjct: 505 CAVPLQIVSAQSNKPCMGIVQDTLCGIRKLTLRDNFIEFDQVLNLLYWVPDWDGV--IPT 562

Query: 594 PAIMKPYYMWTGKQVFSLLIRPNKKSSVVINLDAKNKVYIPPKHKHLPNEMSINDGFVVI 653
           PAI+KP  +W+GKQ+ S+ I       + +    +   ++ PK          ++G ++I
Sbjct: 563 PAILKPKPLWSGKQILSIAI----PKGIHLQRFDEGTTFLSPK----------DNGMLII 608

Query: 654 RGSQILSGVMDKSVLGDGKKHSVFYTILRDFGPKEAAYAMNRMAKLCARYLGNRGFSIGI 713
            G QI+ GV+DK  +G      + + + R+ GP+  A   + + K+   +  + GFS GI
Sbjct: 609 DG-QIIFGVVDKKTVGSSSG-GLIHVVTREKGPQICAKLFSNIQKVTNYWFLHNGFSTGI 666

Query: 714 NDVTPGFELKNKKEVMVEDAYAKCDDLIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVR 773
            D     E   +    + +A  K +++  +     L  + G    ++ E  +   L++ R
Sbjct: 667 GDTIADGETMREITGTIAEAKRKVEEVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEAR 726

Query: 774 EEVGEVCIKELDNLNSCLIMANCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPH 833
           ++ G +    L++ N+   M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPH
Sbjct: 727 DKAGRLAEVNLNDTNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPH 786

Query: 834 FLKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLE 893
           F K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LE
Sbjct: 787 FSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALE 846

Query: 894 DLSCQYDNTIRTSSNGIVQFTYGGDGLDPIDME 926
           D+   YD+T R S   ++QF YG DG+D   +E
Sbjct: 847 DIMVHYDSTTRNSLGNVIQFVYGEDGIDAGHIE 879

 Score = 85.5 bits (210), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 40/69 (57%), Positives = 50/69 (72%)

Query: 1076 KYHKAKVEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVI 1135
            ++ ++ V PG  VG + A SIGEP TQMTL TFHFAGVAS  VT GVPR+KEI+N +K +
Sbjct: 1052 QFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNM 1111

Query: 1136 STPIINAVL 1144
             TP + A L
Sbjct: 1112 KTPSLTAYL 1120

>Ecym_8065 Chr8 (139544..144775) [5232 bp, 1743 aa] {ON} similar to
           Ashbya gossypii ADR086C
          Length = 1743

 Score =  561 bits (1445), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 359/934 (38%), Positives = 510/934 (54%), Gaps = 79/934 (8%)

Query: 9   APKR-IKGLEFSALSASDIVGQSKVEISTRDLFDLENGRKPKSGGALDTRMGVSSSQAEC 67
           AP R IK ++F   S  ++   S  +I   +  D E   + K GG  D R+G      +C
Sbjct: 9   APLRTIKEVQFGLFSPEEVRAISVAKIEFPETMD-ETQMRAKVGGLNDPRLGSIDRNYKC 67

Query: 68  STCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKSCAALLLSEEDKRQFLSEL 127
            TC   +  C GHFGHI+L+ PVFH+G+     +V + +C  C  LLL E       +EL
Sbjct: 68  QTCGEGMNDCPGHFGHIELAKPVFHIGFISKIKKVCECVCMHCGKLLLDE------YNEL 121

Query: 128 RRPGI---DNLRRMGILKKVVDQCKKQRRCLRCGSLNXXXXXXXXXXXXXXLKILHDTFR 184
            R  I   D  RR      V   CK +  C                     +    D  +
Sbjct: 122 MRQAIKIKDPKRR---FNAVWSLCKSKMVC------------------DTEVPSEDDPSK 160

Query: 185 WVGK------KSAPEKD--KWVGDWKTVLSHNPELERYVKKCMDDLNPLKTLNLFKQVSP 236
           ++ +      + +  KD    VG WK     N E     +K +  L+  + LN+FK ++P
Sbjct: 161 YISRGGCGNAQPSIRKDGLSLVGTWKK--DKNSEDSDQPEKRI--LSAEEILNVFKHITP 216

Query: 237 EDCELMGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTS 296
           ED   +G +      RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +
Sbjct: 217 EDSLRLGFNEDF--ARPEWMILTVLPVPPPPVRPSISFNES-QRGEDDLTYKLGDILKAN 273

Query: 297 SLIKAGLEKGISINNMMEQWDYLQLAVAMYINSDSVNP--AMMPGGSTGGKTKPIRGFCQ 354
             ++     G   + + E    LQ  VA Y+++D      A+   G      +PI+    
Sbjct: 274 INVQRLEINGSPQHVIQESESLLQFHVATYMDNDIAGQPQAVQKSG------RPIKSIRA 327

Query: 355 RLKGKQGRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKAK 414
           RLKGK+GR RGNL GKRVDFS RTV+S DPNL +D+V VP  +AK LTYPE+VT YN  +
Sbjct: 328 RLKGKEGRIRGNLMGKRVDFSARTVISGDPNLDLDQVGVPKSIAKTLTYPEVVTPYNIDR 387

Query: 415 LQQLVINGPNEHPGANYLLKKDEEARRNLRYGDRIKLAKNLQYGDLVERHLEDGDVVLFN 474
           L QLV NGPNEHPGA Y+++ D   R +LRY  R    + LQYG  VERH+ D D VLFN
Sbjct: 388 LTQLVRNGPNEHPGAKYVIR-DNGDRIDLRYSKRAGDIQ-LQYGWKVERHIIDNDPVLFN 445

Query: 475 RQPSLHRLSILSHFAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLM 534
           RQPSLH++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L 
Sbjct: 446 RQPSLHKMSMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLC 505

Query: 535 GVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYSRAEFVQLLSMMSDGNMQFDIPPP 594
            V   +++P+S +P +   QD + G   ++ +D+F    + + +L  + D +    IP P
Sbjct: 506 AVPQQIVSPQSNKPCMGIVQDTLCGIRKMTLRDTFIELDQVLNMLYWIPDWDGV--IPKP 563

Query: 595 AIMKPYYMWTGKQVFSLLIRPNKKSSVVINLDAKNKVYIPPKHKHLPNEMSINDGFVVIR 654
            I+KP  +W+GKQ+ S+ I PN    + +    +   Y+ PK          ++G ++I 
Sbjct: 564 TILKPKPLWSGKQLLSMAI-PN---GIHLQRFDEGTTYLSPK----------DNGMLIID 609

Query: 655 GSQILSGVMDKSVLGDGKKHSVFYTILRDFGPKEAAYAMNRMAKLCARYLGNRGFSIGIN 714
           G QI+ GV+DK  +G      + + + R+ GP+  A     + K+   +L + GFSIGI 
Sbjct: 610 G-QIIFGVVDKKTVG-SSSGGLIHVVTREKGPQVCAKLFGNIQKVVNYWLLHNGFSIGIG 667

Query: 715 DVTPGFELKNKKEVMVEDAYAK--CDDLIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKV 772
           D     + K  +E+    A AK    ++  +     L  + G    ++ E  +   L++ 
Sbjct: 668 DTIA--DEKTMREITEAIALAKKRVQEVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEA 725

Query: 773 REEVGEVCIKELDNLNSCLIMANCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLP 832
           R++ G      L +LN+   M + GSKGS +N++QM A VGQQ + G R+  GF DR+LP
Sbjct: 726 RDKAGRSAELNLRDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFADRTLP 785

Query: 833 HFLKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSL 892
           HF K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+L
Sbjct: 786 HFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKAL 845

Query: 893 EDLSCQYDNTIRTSSNGIVQFTYGGDGLDPIDME 926
           ED+   YD T R S   I+QF YG DG+D   +E
Sbjct: 846 EDIMVHYDGTTRNSLGNIIQFVYGEDGMDASHIE 879

 Score = 84.3 bits (207), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 39/71 (54%), Positives = 50/71 (70%)

Query: 1076 KYHKAKVEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVI 1135
            ++ ++ V PG  VG + A SIGEP TQMTL TFHFAGVAS  VT GVPR+KEI+N +K +
Sbjct: 1052 QFLRSIVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNM 1111

Query: 1136 STPIINAVLGQ 1146
             TP +   L +
Sbjct: 1112 KTPSLTVYLNE 1122

>CAGL0I03828g Chr9 complement(328922..334069) [5148 bp, 1715 aa]
           {ON} highly similar to uniprot|P04050 Saccharomyces
           cerevisiae YDL140c RPO21 DNA-directed RNA polymerase II
          Length = 1715

 Score =  560 bits (1442), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 361/931 (38%), Positives = 512/931 (54%), Gaps = 73/931 (7%)

Query: 9   APKR-IKGLEFSALSASDIVGQSKVEISTRDLFDLENGRKPKSGGALDTRMGVSSSQAEC 67
           AP R +K ++F   S  +I   S  +I   +  D E   + K GG  D R+G      +C
Sbjct: 9   APLRTVKEVQFGLFSPEEIRAISVAKIRLPETMD-ETQTRAKIGGLNDPRLGSIDRNLKC 67

Query: 68  STCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKSCAALLLSE--EDKRQFLS 125
            TC   +  C GHFGHI L+ PVFH+G+     +V +S+C  C  LLL E  E  RQ + 
Sbjct: 68  QTCQEGMNECPGHFGHIDLAKPVFHIGFITKIKKVCESLCMHCGKLLLDEHNEQMRQAI- 126

Query: 126 ELRRPGIDNLRRMGILKKVVDQCKKQRRCLR--CGSLNXXXXXXXXXXXXXXLKILHDTF 183
           +++ P     +R      V   CK +  C        +                I  D  
Sbjct: 127 QIKDPK----KR---FNAVWSLCKTKMVCETDVPSEDDPTKLISRGGCGNTQPTIRKDGL 179

Query: 184 RWVGKKSAPEKDKWVGDWKTVLSHNPELERYVKKCMDDLNPLKTLNLFKQVSPEDCELMG 243
           + VG   + +KDK  GD     +  PE +R        L+  + LN+FK +SPED   +G
Sbjct: 180 KLVG---SWKKDKSTGD-----ADEPE-QRV-------LSTEEILNIFKHISPEDSYRLG 223

Query: 244 IDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKAGL 303
            +   +  RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  ++   
Sbjct: 224 FNE--EFARPEWMILTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETLE 280

Query: 304 EKGISINNMMEQWDYLQLAVAMYINSDSVNP--AMMPGGSTGGKTKPIRGFCQRLKGKQG 361
             G   + + E    LQ  VA Y+++D      A+   G      +P++    RLKGK+G
Sbjct: 281 HNGAPHHAVEEAESLLQFHVATYMDNDIAGQPQALQKSG------RPVKSIRARLKGKEG 334

Query: 362 RFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKAKLQQLVIN 421
           R RGNL GKRVDFS RTV+S DPNL +D+V VP  +A+ LTYPE+VT YN  +L QLV N
Sbjct: 335 RIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIARTLTYPEVVTPYNIDRLSQLVRN 394

Query: 422 GPNEHPGANYLLKKDEEARRNLRYGDRIKLAKNLQYGDLVERHLEDGDVVLFNRQPSLHR 481
           GPNEHPGA Y+++ D   R +LRY  R    + LQYG  VERH+ D D VLFNRQPSLH+
Sbjct: 395 GPNEHPGAKYVIR-DNGDRIDLRYSKRSGDVQ-LQYGWKVERHIMDDDPVLFNRQPSLHK 452

Query: 482 LSILSHFAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLL 541
           +S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   ++
Sbjct: 453 MSMMAHRVKVVPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIV 512

Query: 542 TPKSGEPIIAATQDFITGSYLISHKDSFYSRAEFVQLLSMMS-----DGNMQFDIPPPAI 596
           +P+S +P +   QD + G   ++ +D+F    EF Q+L+M+      DG     IP PAI
Sbjct: 513 SPQSNKPCMGIVQDTLCGIRKLTLRDTFL---EFDQVLNMLYWVPDWDGV----IPTPAI 565

Query: 597 MKPYYMWTGKQVFSLLIRPNKKSSVVINLDAKNKVYIPPKHKHLPNEMSINDGFVVIRGS 656
           +KP  +W+GKQ+ S+ I       + +    +    + PK          ++G +VI G 
Sbjct: 566 IKPKPLWSGKQILSVAI----PKGIHLQRFDEGTTLLSPK----------DNGMLVIDG- 610

Query: 657 QILSGVMDKSVLGDGKKHSVFYTILRDFGPKEAAYAMNRMAKLCARYLGNRGFSIGIND- 715
           +I+ GV+DK  +G      + + + R+ GP   A     + K+   +L + GFS GI D 
Sbjct: 611 EIIFGVVDKKTVG-SSSGGLIHVVTREKGPTICARLFGNIQKVVNFWLLHNGFSTGIGDT 669

Query: 716 VTPGFELKNKKEVMVEDAYAKCDDLIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREE 775
           V  G  ++   E + E A  K + +  +     L  + G    ++ E  +   L++ R+ 
Sbjct: 670 VADGQTMREISETIAE-AKQKVEAVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDR 728

Query: 776 VGEVCIKELDNLNSCLIMANCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFL 835
            G +    L +LN+   M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF 
Sbjct: 729 AGRLAEMNLKDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIGFGFVDRTLPHFS 788

Query: 836 KNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDL 895
           K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+
Sbjct: 789 KDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDI 848

Query: 896 SCQYDNTIRTSSNGIVQFTYGGDGLDPIDME 926
              YD T R S   ++QF YG DG+D   +E
Sbjct: 849 MVHYDGTTRNSLGNVIQFIYGEDGMDAGHIE 879

 Score = 84.0 bits (206), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 39/69 (56%), Positives = 49/69 (71%)

Query: 1076 KYHKAKVEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVI 1135
            ++ ++ V PG  VG + A SIGEP TQMTL TFHFAGVAS  VT GVPR+KEI+N +K +
Sbjct: 1052 QFLRSIVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNM 1111

Query: 1136 STPIINAVL 1144
             TP +   L
Sbjct: 1112 KTPSLTVYL 1120

>Skud_4.114 Chr4 complement(201053..206233) [5181 bp, 1726 aa] {ON}
           YDL140C (REAL)
          Length = 1726

 Score =  558 bits (1439), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 354/927 (38%), Positives = 507/927 (54%), Gaps = 65/927 (7%)

Query: 9   APKR-IKGLEFSALSASDIVGQSKVEISTRDLFDLENGRKPKSGGALDTRMGVSSSQAEC 67
           AP R +K ++F   S  ++   S  +I   +  D E   + K GG  D R+G      +C
Sbjct: 9   APLRTVKEVQFGLFSPEEVRAISVAKIRFPETMD-ETQTRAKIGGLNDPRLGSIDRNLKC 67

Query: 68  STCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKSCAALLLSEEDKRQFLSEL 127
            TC   +  C GHFGHI L+ PVFHVG+     ++ + +C  C  LLL E +      EL
Sbjct: 68  QTCQEGMNECPGHFGHIDLAKPVFHVGFIAKIKKLCECVCMHCGKLLLDEHN------EL 121

Query: 128 RRPGI---DNLRRMGILKKVVDQCKKQRRC-LRCGSLNXXXXXXXXXX-XXXXLKILHDT 182
            R  +   D+ +R   +  +   CK +  C     S N                 +  D 
Sbjct: 122 MRQALAIKDSKKRFAAIWTL---CKTKMVCETDVPSENDPTQLVSRGGCGNTQPTVRKDG 178

Query: 183 FRWVGKKSAPEKDKWVGDWKTVLSHNPELERYVKKCMDDLNPLKTLNLFKQVSPEDCELM 242
            + VG   + +KD+  GD     +  PEL          L+  + LN+FK +S ED   +
Sbjct: 179 LKLVG---SWKKDRASGD-----ADEPELRV--------LSTEEILNIFKHISVEDFTSL 222

Query: 243 GIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKAG 302
           G +      RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  ++  
Sbjct: 223 GFNEVFS--RPEWMILTCLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETL 279

Query: 303 LEKGISINNMMEQWDYLQLAVAMYINSDSVNP--AMMPGGSTGGKTKPIRGFCQRLKGKQ 360
              G   + + E    LQ  VA Y+++D      A+   G      +P++    RLKGK+
Sbjct: 280 EHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSG------RPVKSIRARLKGKE 333

Query: 361 GRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKAKLQQLVI 420
           GR RGNL GKRVDFS RTV+S DPNL +D+V VP  +AK LTYPE+VT YN  +L QLV 
Sbjct: 334 GRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVR 393

Query: 421 NGPNEHPGANYLLKKDEEARRNLRYGDRIKLAKNLQYGDLVERHLEDGDVVLFNRQPSLH 480
           NGPNEHPGA Y+++ D   R +LRY  R    + LQYG  VERH+ D D VLFNRQPSLH
Sbjct: 394 NGPNEHPGAKYVIR-DSGDRIDLRYSKRAGDIQ-LQYGWKVERHIMDNDPVLFNRQPSLH 451

Query: 481 RLSILSHFAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL 540
           ++S+++H   + P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   +
Sbjct: 452 KMSMMAHRVIVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQI 511

Query: 541 LTPKSGEPIIAATQDFITGSYLISHKDSFYSRAEFVQLLSMMSDGNMQFDIPPPAIMKPY 600
           ++P+S +P +   QD + G   ++ +D+F    + + +L  + D +    IP PAI+KP 
Sbjct: 512 VSPQSNKPCMGIVQDTLCGIRKLTLRDTFIELDQVLNMLYWVPDWDGV--IPTPAIIKPK 569

Query: 601 YMWTGKQVFSLLIRPNKKSSVVINLDAKNKVYIPPKHKHLPNEMSINDGFVVIRGSQILS 660
            +W+GKQV S  I     S + +    +    + PK          ++G ++I G QI+ 
Sbjct: 570 PLWSGKQVLSAAI----PSGIHLQRFDEGTTLLSPK----------DNGMLIIDG-QIVF 614

Query: 661 GVMDKSVLGDGKKHSVFYTILRDFGPKEAAYAMNRMAKLCARYLGNRGFSIGIND-VTPG 719
           GV++K  +G      + + + R+ GP+  A     + K+   +L + GFS GI D +  G
Sbjct: 615 GVVEKKTVGSSNG-GLIHVVTREKGPQVCAKLFGNIQKVVNFWLLHNGFSTGIGDTIADG 673

Query: 720 FELKNKKEVMVEDAYAKCDDLIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 779
             ++   E + E A  K  D+  +     L  + G    ++ E  +   L++ R++ G +
Sbjct: 674 PTMREITETIAE-AKKKVFDVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDKAGRL 732

Query: 780 CIKELDNLNSCLIMANCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSK 839
               L +LN+   M   GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+  
Sbjct: 733 AEVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDY 792

Query: 840 TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 899
           +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   Y
Sbjct: 793 SPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHY 852

Query: 900 DNTIRTSSNGIVQFTYGGDGLDPIDME 926
           DNT R S   ++QF YG DG+D   +E
Sbjct: 853 DNTTRNSLGNVIQFIYGEDGMDAAHIE 879

 Score = 83.6 bits (205), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 39/69 (56%), Positives = 49/69 (71%)

Query: 1076 KYHKAKVEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVI 1135
            ++ ++ V PG  VG + A SIGEP TQMTL TFHFAGVAS  VT GVPR+KEI+N +K +
Sbjct: 1052 QFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNM 1111

Query: 1136 STPIINAVL 1144
             TP +   L
Sbjct: 1112 KTPSLTVYL 1120

>ADR086C Chr4 complement(860406..865643) [5238 bp, 1745 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL140C
           (RPO21)
          Length = 1745

 Score =  558 bits (1437), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 357/934 (38%), Positives = 510/934 (54%), Gaps = 79/934 (8%)

Query: 9   APKR-IKGLEFSALSASDIVGQSKVEISTRDLFDLENGRKPKSGGALDTRMGVSSSQAEC 67
           AP R IK ++F   S  ++   S  +I   +  D E   + K GG  D R+G      +C
Sbjct: 9   APLRTIKEVQFGLFSPEEVRAISVAKIEFPETMD-ETQMRAKVGGLNDPRLGSIDRNFKC 67

Query: 68  STCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKSCAALLLSEEDKRQFLSEL 127
            TC   +  C GHFGHI+L+ PVFH+G+     +V + +C  C  LLL E       +EL
Sbjct: 68  QTCGEGMNDCPGHFGHIELAKPVFHIGFISKIKKVCECVCMHCGKLLLDE------YNEL 121

Query: 128 RRPGI---DNLRRMGILKKVVDQCKKQRRCLRCGSLNXXXXXXXXXXXXXXLKILHDTFR 184
            R  I   D  RR      V   CK +  C                     +    D  +
Sbjct: 122 MRQAIKIKDPKRR---FNAVWSLCKAKMVC------------------DTEVPSEDDPSK 160

Query: 185 WVGK------KSAPEKD--KWVGDWKTVLSHNPELERYVKKCMDDLNPLKTLNLFKQVSP 236
           ++ +      + +  KD    VG WK     N E     +K +  ++  + LN+FK +SP
Sbjct: 161 YISRGGCGNAQPSIRKDGLSLVGTWKK--DKNAEDADQPEKRI--ISAEEILNVFKHISP 216

Query: 237 EDCELMGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTS 296
           ED   +G +      RPE  +   LP PP  +RPS+   +S    EDDLT KL +I+  +
Sbjct: 217 EDSWRLGFNEDFS--RPEWMLLTVLPVPPPPVRPSISFNES-QRGEDDLTYKLGDILKAN 273

Query: 297 SLIKAGLEKGISINNMMEQWDYLQLAVAMYINSDSVNP--AMMPGGSTGGKTKPIRGFCQ 354
             ++     G   + + E    LQ  VA Y+++D      A+   G      +PI+    
Sbjct: 274 INVQRLEINGSPQHVIQESESLLQFHVATYMDNDIAGQPQAVQKSG------RPIKSIRA 327

Query: 355 RLKGKQGRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKAK 414
           RLKGK+GR RGNL GKRVDFS RTV+S DPNL +D+V VP  +AK LTYPE+VT YN  +
Sbjct: 328 RLKGKEGRIRGNLMGKRVDFSARTVISGDPNLDLDQVGVPKSIAKTLTYPEVVTPYNIDR 387

Query: 415 LQQLVINGPNEHPGANYLLKKDEEARRNLRYGDRIKLAKNLQYGDLVERHLEDGDVVLFN 474
           L QLV NGPNEHPGA Y+++ D   R +LRY  R    + LQYG  VERH+ D D VLFN
Sbjct: 388 LTQLVRNGPNEHPGAKYVIR-DNGDRIDLRYSKRAGDIQ-LQYGWKVERHIMDDDPVLFN 445

Query: 475 RQPSLHRLSILSHFAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLM 534
           RQPSLH++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L 
Sbjct: 446 RQPSLHKMSMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLC 505

Query: 535 GVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYSRAEFVQLLSMMSDGNMQFDIPPP 594
            V   +++P+S +P +   QD + G   ++ +D+F    + + +L  + D +    IP P
Sbjct: 506 AVPLQIVSPQSNKPCMGIVQDTLCGIRKMTLRDTFIELDQVLNMLYWIPDWDGV--IPTP 563

Query: 595 AIMKPYYMWTGKQVFSLLIRPNKKSSVVINLDAKNKVYIPPKHKHLPNEMSINDGFVVIR 654
            I+KP  +W+GKQ+ S+ I     S + +    +   Y+ PK          ++G ++I 
Sbjct: 564 TILKPKPLWSGKQLLSMAI----PSGIHLQRFDEGTTYLSPK----------DNGMLIID 609

Query: 655 GSQILSGVMDKSVLGDGKKHSVFYTILRDFGPKEAAYAMNRMAKLCARYLGNRGFSIGIN 714
           G QI+ GV+DK  +G      + + + R+ GP+  A     + K+   +L + GFSIGI 
Sbjct: 610 G-QIIFGVVDKKTVG-SSSGGLIHVVTREKGPEVCAKLFGNIQKVVNYWLLHNGFSIGIG 667

Query: 715 DVTPGFELKNKKEVMVEDAYAK--CDDLIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKV 772
           D     + K  +E+    A AK   +++  +     L  + G    ++ E  +   L++ 
Sbjct: 668 DTIA--DEKTMREITDAIALAKKKVEEVTKEAQANLLTAKHGMTLRESFEDNVVRYLNEA 725

Query: 773 REEVGEVCIKELDNLNSCLIMANCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLP 832
           R++ G      L +LN+   M + GSKGS +N++QM A VGQQ + G R+  GF DR+LP
Sbjct: 726 RDKAGRSAEVNLKDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFADRTLP 785

Query: 833 HFLKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSL 892
           HF K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+L
Sbjct: 786 HFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKAL 845

Query: 893 EDLSCQYDNTIRTSSNGIVQFTYGGDGLDPIDME 926
           ED+   YD T R S   I+QF YG DG+D   +E
Sbjct: 846 EDIMVHYDGTTRNSLGNIIQFVYGEDGMDAAHIE 879

 Score = 83.6 bits (205), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 39/69 (56%), Positives = 49/69 (71%)

Query: 1076 KYHKAKVEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVI 1135
            ++ ++ V PG  VG + A SIGEP TQMTL TFHFAGVAS  VT GVPR+KEI+N +K +
Sbjct: 1052 QFLRSIVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNM 1111

Query: 1136 STPIINAVL 1144
             TP +   L
Sbjct: 1112 KTPSLTVYL 1120

>Kpol_162.1 s162 complement(211..4146) [3936 bp, 1311 aa] {ON}
            complement(211..4146) [3936 nt, 1312 aa]
          Length = 1311

 Score =  536 bits (1380), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 338/841 (40%), Positives = 471/841 (56%), Gaps = 95/841 (11%)

Query: 347  KPIRGFCQRLKGKQGRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEM 406
            +P++    RLKGK+GR RGNL GKRVDFS RTV+S DPNL +D+V VP  +AK LTYPE+
Sbjct: 2    RPVKSIRARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEV 61

Query: 407  VTRYNKAKLQQLVINGPNEHPGANYLLKKDEEARRNLRYGDRIKLAKNLQYGDLVERHLE 466
            VT YN  +L QLV NGPNEHPGA Y+++ D   R +LRY  R    + LQYG  VERH+ 
Sbjct: 62   VTPYNIDRLTQLVRNGPNEHPGAKYVIR-DNGDRIDLRYSKRAGDIQ-LQYGWKVERHIM 119

Query: 467  DGDVVLFNRQPSLHRLSILSHFAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEA 526
            D D VLFNRQPSLH++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE 
Sbjct: 120  DNDPVLFNRQPSLHKMSMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEET 179

Query: 527  RAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYSRAEFVQLLSMMS--- 583
            RAE   L  V   +++P+S +P +   QD + G   ++ +DSF    EF Q+L+M+    
Sbjct: 180  RAELSQLCAVPMQIVSPQSNKPCMGIVQDTLCGIRKLTLRDSFI---EFDQVLNMLYWVP 236

Query: 584  --DGNMQFDIPPPAIMKPYYMWTGKQVFSLLIRPNKKSSVVINLDAKNKVYIPPKHKHLP 641
              DG     IP PAI+KP  +WTGKQ+ S+ I       + +    +    + PK     
Sbjct: 237  DWDGV----IPQPAILKPKPLWTGKQILSIAI----PKGIHLQRFDEGTTMLSPK----- 283

Query: 642  NEMSINDGFVVIRGSQILSGVMDKSVLGDGKKHSVFYTILRDFGPKEAAYAMNRMAKLCA 701
                 ++G +VI G QI+ GV+DK  +G      + + + R+ GP+  A     + K+  
Sbjct: 284  -----DNGMLVIDG-QIVFGVVDKKTVGSSSG-GLIHVVTREKGPQVCAKMFGNIQKVVN 336

Query: 702  RYLGNRGFSIGIND-VTPGFELKNKKEVMVEDAYAKCDDLIDQFNKGKLETQPGCNEEQT 760
             +L + GFS GI D +  G  +K   E + E A  K +++  +     L  + G    ++
Sbjct: 337  FWLLHNGFSTGIGDTIADGETMKEITETIAE-AKKKVEEVTKEAQANLLTAKHGMTLRES 395

Query: 761  LEAKIGGLLSKVREEVGEVCIKELDNLNSCLIMANCGSKGSNLNVSQMVAVVGQQIISGN 820
             E  +   L++ R++ G +    L++ N+   M + GSKGS +N++QM A VGQQ + G 
Sbjct: 396  FEDNVVRFLNEARDKAGRLAEVNLNDTNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGK 455

Query: 821  RVPDGFQDRSLPHFLKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAE 880
            R+  GF DR+LPHF K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAE
Sbjct: 456  RIAFGFVDRTLPHFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAE 515

Query: 881  TGYMSRRLMKSLEDLSCQYDNTIRTSSNGIVQFTYGGDGLDP-------IDMEGNAQPVN 933
            TGY+ RRL+K+LED+   YD+T R S   ++QF YG DG+D        ID  G +    
Sbjct: 516  TGYIQRRLVKALEDIMVHYDSTTRNSLGNVIQFVYGEDGIDASYIEKQSIDTIGGSNQAF 575

Query: 934  FTR------SWDHANNITFNHSDKPLLPYQIMQQTNSILQPLEEKLVRYDNLGRTLDPSL 987
              R      S +H+ + T   S   ++    +Q        L+E+  +  N  R L    
Sbjct: 576  EKRYRIDLMSPEHSLDTTLLESGSEIIGDVKIQSM------LDEEYKQLVNDRRFL---- 625

Query: 988  QDRAEFIDQDDAE------RNFYKSLREYL---HTKASHLAKIRSHKGLKQFLDEPAPEL 1038
              R  FID +         R   ++ ++     HTK S L       G+K        EL
Sbjct: 626  --RNVFIDGEQNWPLPVNIRRIVQNAQQTFRIDHTKPSDLTIRDVVYGVK--------EL 675

Query: 1039 QSMDLDEGSPSALL--ASVDQL----CKISSKLVAK------FLEIAIFKYHKAKVE--- 1083
            +S  L     S ++  A  D +    C + S+L A+       L    F +  + +E   
Sbjct: 676  ESKLLVLRGKSKIIEEAQNDAITLFCCLLRSRLAARRVLEEYRLTKQAFDWVLSNIESQF 735

Query: 1084 ------PGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVIST 1137
                  PG  VG + A SIGEP TQMTL TFHFAGVAS  VT GVPR+KEI+N +K + T
Sbjct: 736  LRSIVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKT 795

Query: 1138 P 1138
            P
Sbjct: 796  P 796

>KLTH0D01628g Chr4 complement(157597..162561) [4965 bp, 1654 aa] {ON}
            highly similar to uniprot|P10964 Saccharomyces cerevisiae
            YOR341W RPA190 RNA polymerase I subunit largest subunit
            of RNA polymerase I
          Length = 1654

 Score =  436 bits (1121), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 310/953 (32%), Positives = 487/953 (51%), Gaps = 133/953 (13%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLI----------- 299
            R + +    +  PP   R PS + ++   + ++ L   L++I+ TS LI           
Sbjct: 346  RADMFFLEVVIVPPTRFRLPSKLGEEIHENTQNQL---LSKILTTSLLIRDLNEEMSKLQ 402

Query: 300  --KAGLE-KGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGGKTKPIRGFCQRL 356
              K  +E K +  N +M  +  +Q  V  +I+S          G+TGGK  PI G  Q L
Sbjct: 403  KDKVSVEDKKVIFNRLMNAFVTIQNDVNAFIDSTKAQ------GNTGGKV-PIPGVKQAL 455

Query: 357  KGKQGRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKAKLQ 416
            + K+G FR ++ GKRV+++ R+V+SPDPN+  +E+ VP   A  LTYPE VT YN A+L+
Sbjct: 456  EKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSYNIAELR 515

Query: 417  QLVINGPNEHPGANYLLKKDEE--ARRNLRYGDRIKLAKNL----------QYGDLVERH 464
            Q VINGP++ PGA  +  +D    +   +    R  LA  L               V RH
Sbjct: 516  QAVINGPDKWPGATQIQNEDGSLVSLVGMTTEQRKALANQLLTPSSHSATHSLNKKVYRH 575

Query: 465  LEDGDVVLFNRQPSLHRLSILSHFAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQT 523
            +++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ 
Sbjct: 576  IKNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQN 635

Query: 524  EEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYSRAEFVQLLSMM- 582
            E ARAEA NL    +  LTP SG P+    QD I+    +++KDSF++R E+ Q +    
Sbjct: 636  ENARAEAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTNKDSFFTREEYQQYIYGCI 695

Query: 583  --SDGNM---QFDIPPPAIMKPYYMWTGKQVFS-LLIRPNKKSSVVINLDAKNKVYIPPK 636
               DG+    +    PPA+ KP  +WTGKQ+ + +L+         INL +KNK+    K
Sbjct: 696  RPEDGHATRNKLLTVPPAVFKPVPLWTGKQIITTVLLNVTPADMPGINLLSKNKI----K 751

Query: 637  HKHLPNEMSINDGFVVIRGSQILSGVMDKSVLGDGKKHSVFYTILRDFGPKEAAYAMNRM 696
            +++     + ND  VV +  ++L G++DKS  G   K+ + +++   +GP  +A  ++ +
Sbjct: 752  NEYWGKGSTEND--VVFKNGELLCGILDKSQYG-ASKYGIVHSLHEVYGPDVSAKVLSVL 808

Query: 697  AKLCARYLGNRGFSIGINDVTPGFE--------LKNKKEV----------MVEDAYAKCD 738
             +L   Y+    F+ G++D+    E        LK   +V          + +D  A   
Sbjct: 809  GRLFTNYITATAFTCGMDDLRLTEEGNKWRSDILKTSTDVGRVAAAEVTNLDKDVSANDS 868

Query: 739  DLIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVCI-----KELDNLNSCLIM 793
            +L+ +      E     N+   L+A     ++ +  +V   C+     K+  N NS   M
Sbjct: 869  ELLKRLE----EILRDDNKLGILDAVTSSKVNSITSQVVSKCVPDGTMKKFPN-NSMQAM 923

Query: 794  ANCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSKTPQSKGFVRNSFFS 853
            A  G+KGSN+NVSQ++ ++GQQ + G RVP     ++LP F        + G+++  F+S
Sbjct: 924  ALSGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPFETDAMAGGYIKGRFYS 983

Query: 854  GLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTIRTSSNGIVQF 913
            G+ P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN++R +   ++QF
Sbjct: 984  GIKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNSVRDADGTLIQF 1043

Query: 914  TYGGDGLDPIDMEGNAQPVNFTRSWDHANNITFNHSDKPLLPYQIMQQTNSILQPLEEKL 973
             YGGD +D +  E +     F      A+N                              
Sbjct: 1044 LYGGDAVD-VTQESHMTQFKFC-----ADN------------------------------ 1067

Query: 974  VRYDNLGRTLDPSLQDRAEFIDQDDAERNFYKSLREYLHT-KASHLA-KIRSHKGLKQFL 1031
              YD L +  +P+     E +D + A +   K+L+    T K  H + K++    + +F 
Sbjct: 1068 --YDALLKKYNPAA--LIEHLDVESALKYSKKALKHRKKTEKVPHYSQKVKYDPVVSKF- 1122

Query: 1032 DEPAPELQSMDLD-EGSPSALLASVDQLCK----ISSKLVAKFLEIAIFKYHKAKVEPGT 1086
              P+  L S+  + +    + + S + L K    +S K   KF  +   KY ++ + PG 
Sbjct: 1123 -NPSKYLGSVSENFQDKLESFIDSNNDLFKSRDTVSEK---KFRALMQLKYMRSLINPGE 1178

Query: 1087 AVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTP 1138
            AVG + + S+GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP
Sbjct: 1179 AVGIIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTP 1231

 Score = 56.6 bits (135), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 42/148 (28%), Positives = 69/148 (46%), Gaps = 14/148 (9%)

Query: 13  IKGLEFSALSASDIVGQSKVEISTRDLFDLENGRKPKSGGALDTRMGVSSSQAECSTCHG 72
           I  ++F  ++A DI   S ++I+   + D  N   P SGG  D  +G       C+TC  
Sbjct: 11  ITSVDFGVMTAQDIRNFSAMQITNPTVLD--NLGHPISGGLYDLALGAFLRNL-CATCGL 67

Query: 73  NLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKSCAALLLSEEDKRQFLSELRRPGI 132
           +   C GH GHI+L +P ++  +F      L+S C  C    L   +  ++  +L+    
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFSQLYIFLRSSCLYCHGFRLKASEVHRYACKLK---- 123

Query: 133 DNLRRMGILKKVVDQCKKQRRCLRCGSL 160
             L + G+    +D+C K    LR G+L
Sbjct: 124 --LLQYGL----IDECYKLDE-LRVGTL 144

>Kwal_26.6979 s26 complement(150350..155314) [4965 bp, 1654 aa] {ON}
            YOR341W (RPA190) - RNA polymerase I subunit 190 (alpha)
            [contig 46] FULL
          Length = 1654

 Score =  436 bits (1121), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 305/950 (32%), Positives = 485/950 (51%), Gaps = 127/950 (13%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK---------- 300
            R + +    +  PP   R PS + ++   ++++ L   L++I+ TS LI+          
Sbjct: 345  RADMFFLEVVIVPPTRFRLPSKLGEEIHENSQNQL---LSKILTTSLLIRDLNEEMSKLQ 401

Query: 301  ----AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGGKTKPIRGFCQRL 356
                +  +K +  N +M  +  +Q  V  +I+S          GS GGK  PI G  Q L
Sbjct: 402  KDKVSAQDKIVIFNRLMNAFVTIQNDVNAFIDSTKAQ------GSAGGKV-PIPGVKQAL 454

Query: 357  KGKQGRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKAKLQ 416
            + K+G FR ++ GKRV+++ R+V+SPDPN+  +E+ VP   A  LTYPE VT YN A+L+
Sbjct: 455  EKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSYNIAELR 514

Query: 417  QLVINGPNEHPGANYLLKKDEE--ARRNLRYGDRIKLAKNL----------QYGDLVERH 464
            Q VINGP++ PGA+ +  +D    +   +    R  LA  L               V RH
Sbjct: 515  QAVINGPDKWPGASQIQNEDGSLVSLVGMTTEQRKALANQLLTPSSHSSTHSLNKKVYRH 574

Query: 465  LEDGDVVLFNRQPSLHRLSILSHFAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQT 523
            +++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ 
Sbjct: 575  IKNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQN 634

Query: 524  EEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYSRAEFVQLLSMM- 582
            E ARAEA NL    +  LTP SG P+    QD I+    ++ KDSF++R E+ Q +    
Sbjct: 635  ENARAEAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREEYQQYIYGCI 694

Query: 583  --SDGNM---QFDIPPPAIMKPYYMWTGKQVF-SLLIRPNKKSSVVINLDAKNKVYIPPK 636
               DG+    +    PPA+MKP  +WTGKQ+  ++L+         INL +KNK+    K
Sbjct: 695  RPEDGHATRNKLVTVPPAVMKPVPLWTGKQIITTVLLNVTPADMPGINLISKNKI----K 750

Query: 637  HKHLPNEMSINDGFVVIRGSQILSGVMDKSVLGDGKKHSVFYTILRDFGPKEAAYAMNRM 696
            + +     + ND  V+ +  ++L G++DKS  G   K+ + +++   +GP  +A  ++ +
Sbjct: 751  NDYWGKHSTEND--VIFKNGELLCGILDKSQYG-ASKYGIVHSLHEVYGPAVSAKVLSVL 807

Query: 697  AKLCARYLGNRGFSIGINDVTPGFE--------LKNKKEV----------MVEDAYAKCD 738
             +L   Y+    F+ G++D+    +        LK   +V          +  D  A   
Sbjct: 808  GRLFTNYITATAFTCGMDDLRLTDDGNKWRSDILKTSTDVGRAAAAEVTNLDPDVSANDT 867

Query: 739  DLIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVCI-----KELDNLNSCLIM 793
            +L+ +      E     N+   L+A     ++ +  +V   C+     K+  N NS   M
Sbjct: 868  ELLKRLE----EILRDDNKLGILDAVTSSKVNTITSQVVSKCVPGGTMKKFPN-NSMQAM 922

Query: 794  ANCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSKTPQSKGFVRNSFFS 853
            A  G+KGSN+NVSQ++ ++GQQ + G RVP     ++LP F        + G+++  F+S
Sbjct: 923  ALSGAKGSNVNVSQIMCLLGQQALEGRRVPVMISGKTLPSFKPFETDAMAGGYIKGRFYS 982

Query: 854  GLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTIRTSSNGIVQF 913
            G+ P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN++R +   ++QF
Sbjct: 983  GIRPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNSVRDADGTLIQF 1042

Query: 914  TYGGDGLDPIDMEGNAQPVNFTRSWDHANNITFNHSDKPLLPYQIMQQTNSILQPLEEKL 973
             YGGD +D +  E +     F      A+N                              
Sbjct: 1043 LYGGDAVD-VTQESHMTEFKFC-----ADN------------------------------ 1066

Query: 974  VRYDNLGRTLDPSLQDRAEFIDQDDAERNFYKSLREY-LHTKASHLA-KIRSHKGLKQFL 1031
              YD L +  +PS     E +D + A +   K+L+    + +  H A K++    + +F 
Sbjct: 1067 --YDALLKKYNPSA--LIEHLDVESALKYSKKALKNRKKNERVPHFAQKVKYDPVVSKF- 1121

Query: 1032 DEPAPELQSMDLD-EGSPSALLASVDQLCKISSKL-VAKFLEIAIFKYHKAKVEPGTAVG 1089
              P+  L S+  + +    + + S ++L K    +   KF  +   KY ++ + PG AVG
Sbjct: 1122 -NPSKYLGSVSENFQDKLESFIDSNNELFKSRDSVNEKKFRALMQLKYMRSLINPGEAVG 1180

Query: 1090 AVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTP 1138
             + + S+GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP
Sbjct: 1181 IIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTP 1230

 Score = 56.2 bits (134), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 42/149 (28%), Positives = 70/149 (46%), Gaps = 14/149 (9%)

Query: 13  IKGLEFSALSASDIVGQSKVEISTRDLFDLENGRKPKSGGALDTRMGVSSSQAECSTCHG 72
           I  ++F  ++A DI   S ++I+   + D  N   P SGG  D  +G       C+TC  
Sbjct: 11  ITSVDFGVMTAQDIRNFSAMQITNPTVLD--NLGHPISGGLYDLALGAFLRNL-CATCGL 67

Query: 73  NLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKSCAALLLSEEDKRQFLSELRRPGI 132
           +   C GH GHI+L +P ++  +F      L+S C  C    L   +  ++  +L+    
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFSQLYIYLRSSCLYCHGFRLKAPEVHRYACKLK---- 123

Query: 133 DNLRRMGILKKVVDQCKKQRRCLRCGSLN 161
             L + G+    +D+C +    LR GSL+
Sbjct: 124 --LLQYGL----IDECHRLDE-LRVGSLD 145

>ZYRO0D04532g Chr4 (374177..379180) [5004 bp, 1667 aa] {ON} highly
            similar to uniprot|P10964 Saccharomyces cerevisiae
            YOR341W RPA190 RNA polymerase I subunit largest subunit
            of RNA polymerase I
          Length = 1667

 Score =  435 bits (1118), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 310/952 (32%), Positives = 480/952 (50%), Gaps = 125/952 (13%)

Query: 249  KSGRPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK------A 301
            KS  P+ +    +  PP   R PS + ++   + ++ L   L++++ TS LI+      +
Sbjct: 349  KSVTPDVFFMEVVLVPPTRFRLPSKLGEEVHENTQNQL---LSKVLTTSLLIRDLNDEMS 405

Query: 302  GLEKG--------ISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGGKTKPIRGFC 353
             L+K         +  + +M  +  +Q  V  +I+S          GSTGGK  PI G  
Sbjct: 406  NLQKDKVSVEDRRVIFSRLMNAFVTIQNDVNSFIDSTKAQ------GSTGGKV-PIPGVK 458

Query: 354  QRLKGKQGRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKA 413
            Q L+ K+G FR ++ GKRV+ + R+V+SPDPN+  +E+ VP   A  LTYPE VT YN A
Sbjct: 459  QALEKKEGLFRKHMMGKRVNHAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSYNIA 518

Query: 414  KLQQLVINGPNEHPGANYLLKKDEE---------ARRNLRYGDRIKLAKNLQYGDL---V 461
            +L+Q VINGP++ PGA  +  +D            +RN      +  + N     L   V
Sbjct: 519  ELRQAVINGPDKWPGATQIQNEDGSLVSLVGMTLEQRNALANQLLTPSSNPATHTLNKKV 578

Query: 462  ERHLEDGDVVLFNRQPSLHRLSILSHFAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHV 520
             RH+++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H 
Sbjct: 579  FRHIKNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHF 638

Query: 521  PQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYSRAEFVQLLS 580
            PQ E AR+EA NL    +  LTP SG P+    QD I+    +++KDSF++R ++ Q + 
Sbjct: 639  PQNENARSEAFNLANTDSQYLTPTSGSPLRGLIQDHISAGVWLTNKDSFFTRDQYQQYIY 698

Query: 581  MM---SDGNM---QFDIPPPAIMKPYYMWTGKQVFSLLIRPNKKSSVV-INLDAKNKVYI 633
                  DG+    +    PPA+MKP  +WTGKQ+ + +I     + +  INL +KNK+  
Sbjct: 699  GCIRPEDGHSTRPKIVTVPPAVMKPVPLWTGKQIITTVIMNVTPADMPGINLLSKNKI-- 756

Query: 634  PPKHKHLPNEMSINDGFVVIRGSQILSGVMDKSVLGDGKKHSVFYTILRDFGPKEAAYAM 693
              K+++     + N+  V+ +   +L G++DKS  G   K+ + +++   +GP+ AA  +
Sbjct: 757  --KNEYWGQGSTENE--VIFKDGALLCGILDKSQYG-ASKYGIVHSLHEVYGPETAAKVL 811

Query: 694  NRMAKLCARYLGNRGFSIGINDVTPGFE-LKNKKEVMV------EDAYAKCDDLIDQFNK 746
            + + +L   ++ N  FS G++D+    E  K++K+++         A A+  +L      
Sbjct: 812  SVLGRLFTNFITNTAFSCGMDDLRLTAEGNKDRKDLLKTSTDVGRQAAAEVTNLPTDTPS 871

Query: 747  GKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVCIKELDNL-----------NSCLIMAN 795
               E      E    + K G L +    +V  V  K +  +           NS   MA 
Sbjct: 872  NDPELLKRLEEILRDDNKSGILDAVTSSKVNSVTSKVVSTVIPKGTMKKFPQNSMQAMAL 931

Query: 796  CGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSKTPQSKGFVRNSFFSGL 855
             G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F        + G+++  F+SG+
Sbjct: 932  SGAKGSTVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPFETDSMAGGYIKGRFYSGI 991

Query: 856  SPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTIRTSSNGIVQFTY 915
             P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDNT+R     +VQF Y
Sbjct: 992  KPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGIHVSYDNTVRDGDGTLVQFLY 1051

Query: 916  GGDGLDPIDMEGNAQPVNFTRSWDHANNITFNHSDKPLLPYQIMQQTNSILQPLEEKLVR 975
            GGD +D             T    H     F                          L  
Sbjct: 1052 GGDAVD-------------TTKESHMTQFDFC-------------------------LEN 1073

Query: 976  YDNLGRTLDPSLQDRAEFIDQDDAERNFYKSL-------REYLHTKASHLAKIRSHKGLK 1028
            YD L R  +PS     E +D + A +   K+L       +E  +  +     + S     
Sbjct: 1074 YDALLRKYNPSA--LVEHLDVESALKYSKKALKSRKKIDKEPHYKNSDKYDPVLSKYNPA 1131

Query: 1029 QFLDEPAPELQSMDLDEGSPSALLASVDQLCKISSKL-VAKFLEIAIFKYHKAKVEPGTA 1087
            ++L   + + Q  D  EG     L S  +  K+ S +   KF  +   KY ++ V PG A
Sbjct: 1132 KYLGSVSEKFQ--DKLEG----FLDSHSKQLKLHSGINEKKFRALMQLKYMRSLVNPGEA 1185

Query: 1088 VGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTP 1138
            VG + A S+GEP TQMTL TFHFAG  + NVTLG+PR++EI+  AS  I TP
Sbjct: 1186 VGIIAAQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIVMTASAAIKTP 1237

 Score = 52.8 bits (125), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 54/116 (46%), Gaps = 3/116 (2%)

Query: 13  IKGLEFSALSASDIVGQSKVEISTRDLFDLENGRKPKSGGALDTRMGVSSSQAECSTCHG 72
           I  ++F+  SA +I   S  +I+   + D  N   P SGG  D  +G       C+TC  
Sbjct: 11  ISSVDFNVFSAEEIRNLSAKQITNPTVLD--NLGHPISGGLYDLALGAFLRNL-CATCGL 67

Query: 73  NLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKSCAALLLSEEDKRQFLSELR 128
           +   C GH GHI+L +P ++  +F      L+S C  C    L   +  +F  +LR
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFSQLYIYLRSSCLYCHRFRLRSIEVNRFACKLR 123

>TDEL0H04000 Chr8 (680730..685727) [4998 bp, 1665 aa] {ON} Anc_7.51
            YOR341W
          Length = 1665

 Score =  434 bits (1116), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 306/956 (32%), Positives = 483/956 (50%), Gaps = 139/956 (14%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK------AGLE 304
            + + +    +  PP   R PS M ++   + ++ L   L++I+ TS LI+      + ++
Sbjct: 350  KADNFFMEVVLVPPTRFRLPSKMGEEVHENTQNQL---LSKILTTSLLIRDLNDEMSTIQ 406

Query: 305  KG-ISINN-------MMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGGKTKPIRGFCQRL 356
            K  +S+++       +M  +  +Q  V  +I+S          GS   K  P+ G  Q L
Sbjct: 407  KDKVSVDDRRVIFSRLMNAFVTIQNDVNAFIDSTKAQ------GSASSKI-PVPGVKQAL 459

Query: 357  KGKQGRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKAKLQ 416
            + K+G FR ++ GKRV+++ R+V+SPDPN+  +E+ VP   A  LTYPE VT YN A+L+
Sbjct: 460  EKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTAYNIAELR 519

Query: 417  QLVINGPNEHPGANYLLKKDEE--ARRNLRYGDRIKLAKNLQ----------YGDLVERH 464
            Q VINGP++ PGA+ +  +D    +   +    R  LA  L               V RH
Sbjct: 520  QAVINGPDKWPGASQIQNEDGTLVSLVGMTLEQRKALANQLMTPSSNVSTHPLNKKVYRH 579

Query: 465  LEDGDVVLFNRQPSLHRLSILSHFAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQT 523
            +++ DVVL NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ 
Sbjct: 580  IKNRDVVLMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQN 639

Query: 524  EEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYSRAEFVQLL---- 579
            E ARAEA NL    +  LTP SG P+    QD I+    ++ KDSF++R E+ Q +    
Sbjct: 640  ENARAEAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREEYQQYIYGCI 699

Query: 580  ----SMMSDGNMQFDIPPPAIMKPYYMWTGKQVFS-LLIRPNKKSSVVINLDAKNKVYIP 634
                   S G +     PPA++KP  +WTGKQ+ S +L+         INL++ NK+   
Sbjct: 700  RPEHGHASRGKIV--TMPPAVLKPVPLWTGKQIISTVLLNVTPADMPGINLESNNKI--- 754

Query: 635  PKHKHLPNEMSINDGFVVIRGSQILSGVMDKSVLGDGKKHSVFYTILRDFGPKEAAYAMN 694
             K+++     + ND  V+ +  +++ G++DKS  G   K+ + +++   +GP+ AA  ++
Sbjct: 755  -KNEYWGKGSTEND--VIFKNGELVCGILDKSQYG-ASKYGIVHSLHEVYGPEVAAKVLS 810

Query: 695  RMAKLCARYLGNRGFSIGINDVTPGFELKNKK----------------EVMVEDAYAKCD 738
             + +L   Y+    F+ G++D+    E    +                EV   D     D
Sbjct: 811  VLGRLFTNYITATAFTCGMDDLRLTAEGNKSRSEILKTSIDIGRQAAAEVTNLDKDTPSD 870

Query: 739  DLIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVCIKELDN----LNSCLIMA 794
            D+  +  K   E     N+   L+A     ++ V  +V   C+ +        NS   MA
Sbjct: 871  DV--ELLKRLEEILRDENKSGILDAVTSSKVNTVTSKVVSTCVPDGTMKKFPYNSMQAMA 928

Query: 795  NCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSKTPQSKGFVRNSFFSG 854
              G+KGSN+NVSQ++ ++GQQ + G RVP     ++LP F        + G+++  F+SG
Sbjct: 929  LSGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPFETDSMAGGYIKGRFYSG 988

Query: 855  LSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTIRTSSNGIVQFT 914
            + P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN++R     ++QF 
Sbjct: 989  IKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNSVRDGDGSLIQFL 1048

Query: 915  YGGDGLDPIDMEGNAQPVNFTRSWDHANNITFN------HSD-KPLLPYQIM----QQTN 963
            YGGD +D +  E +    +F R    A    +N      H D +  L Y       ++ N
Sbjct: 1049 YGGDAVD-VTKESHMTQFDFCRENYDALLKKYNPVALAEHLDVETALQYSKKVSKNRKKN 1107

Query: 964  SILQPLEEKLVRYDNLGRTLDPSLQDRAEFIDQDDAERNFYKSLREYLHTKASHLAKIRS 1023
            S     E+K V+YD +    +P+                +  S+ E  H K         
Sbjct: 1108 SKTAHYEQK-VKYDPVLAKYNPA---------------KYLGSVSEKFHDK--------- 1142

Query: 1024 HKGLKQFLDEPAPELQSMDLDEGSPSALLASVDQLCKISSKLVAKFLEIAIFKYHKAKVE 1083
               L+ +L++ A E +S +                  +S+K   +F  +   KY ++ + 
Sbjct: 1143 ---LESYLEDKAKEFKSRE-----------------SVSAK---RFRALMQLKYMRSLIN 1179

Query: 1084 PGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTP 1138
            PG AVG + + S+GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP
Sbjct: 1180 PGEAVGIIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASSAIKTP 1235

 Score = 52.8 bits (125), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 55/116 (47%), Gaps = 3/116 (2%)

Query: 13  IKGLEFSALSASDIVGQSKVEISTRDLFDLENGRKPKSGGALDTRMGVSSSQAECSTCHG 72
           I  L+F+ L+  DI   S  +I+   + D  N   P SGG  D  +G       CSTC  
Sbjct: 11  ITSLDFNILTPQDIRNLSAKQITNPTVLD--NLGHPISGGLYDLSLGAFLRNL-CSTCGL 67

Query: 73  NLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKSCAALLLSEEDKRQFLSELR 128
           +   C GH GHI+L +P ++  +F      L+S C  C    L + +  ++  +L+
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRSCCLFCHHFRLKKVEVHRYACKLK 123

>CAGL0E05500g Chr5 (539213..544144) [4932 bp, 1643 aa] {ON} highly
            similar to uniprot|P10964 Saccharomyces cerevisiae
            YOR341w RPA190 DNA-directed RNA polymerase I
          Length = 1643

 Score =  433 bits (1113), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 309/959 (32%), Positives = 480/959 (50%), Gaps = 145/959 (15%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLI----------- 299
            + + +    L  PP   R PS +  +   ++++ L   L++I+ TS LI           
Sbjct: 337  KADMFFMDVLVVPPTRFRLPSKLGDEVHENSQNQL---LSKILTTSLLIRDLNDELSTLQ 393

Query: 300  --KAGLE-KGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGGKTKPIRGFCQRL 356
              K  LE + I  + +M  +  +Q  V  +I+S          G+TGGK  PI G  Q L
Sbjct: 394  KDKVSLEDRRIIFSRLMNAFVTIQNDVNSFIDSTKAQ------GNTGGKV-PIPGVKQAL 446

Query: 357  KGKQGRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKAKLQ 416
            + K+G FR ++ GKRV+++ R+V+SPDPN+  +E+ VP   A  LTYPE VT YN A+L+
Sbjct: 447  EKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSYNIAELR 506

Query: 417  QLVINGPNEHPGANYLLKKDEE--ARRNLRYGDRIKLAKNLQ----------YGDLVERH 464
            Q +INGP++ PGA+ +  +D    +   +    R  LA  L               V RH
Sbjct: 507  QAIINGPDKWPGASQIQNEDGSLISLVGMTLEQRKALANQLMTPSSNPYTHTLNKKVYRH 566

Query: 465  LEDGDVVLFNRQPSLHRLSILSHFAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQT 523
            +++ D+VL NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ 
Sbjct: 567  IKNRDIVLMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQN 626

Query: 524  EEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYSRAEFVQLLSMM- 582
            E ARAEA NL    +  LTP SG P+    QD I+    +++KDSF++R ++ Q +    
Sbjct: 627  ENARAEAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTNKDSFFTREQYQQYIYGCI 686

Query: 583  --SDGN---MQFDIPPPAIMKPYYMWTGKQVF-SLLIRPNKKSSVVINLDAKNKVYIPPK 636
               DG+    +    PPAI KP  +WTGKQ+  ++L+         INL + NK+    K
Sbjct: 687  RPEDGHATRAKLVTLPPAIHKPIPLWTGKQIITTVLLNVTPPDMPGINLKSSNKI----K 742

Query: 637  HKHLPNEMSINDGFVVIRGSQILSGVMDKSVLGDGKKHSVFYTILRDFGPKEAAYAMNRM 696
            +++       ND  V+ +  Q+L G++DKS  G   K+ + +++   +GP+ AA  ++ +
Sbjct: 743  NEYWGKHSEEND--VIFKDGQLLCGILDKSQYG-ASKYGIVHSLHEVYGPETAAKVLSVL 799

Query: 697  AKLCARYLGNRGFSIGINDVTPGFE-LKNKKEVMVE--DAYAKCDDLIDQFNKGKLETQP 753
             +L   Y+ N  F+ G++D+    +  K + +++ E  D   +    +   +K      P
Sbjct: 800  GRLFTNYIMNTAFTCGMDDLRLTSDGNKWRSDILKESVDIGRQAAAEVTNLDKDTPSNDP 859

Query: 754  GC-----------NEEQTLEAKIGGLLSKVREEVGEVCI-----KELDNLNSCLIMANCG 797
                         N+   L+A     ++ +  +V   C+     K+    NS   MA  G
Sbjct: 860  ELLKRLEEILRDNNKLGILDAVSSAKVNTITSKVVSQCVPGGTMKKFPE-NSMQAMALSG 918

Query: 798  SKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSKTPQSKGFVRNSFFSGLSP 857
            +KGSN+NVSQ++ ++GQQ + G RVP     ++LP F        + G+++  F+SG+ P
Sbjct: 919  AKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMAGGYIKGRFYSGIKP 978

Query: 858  PEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTIRTSSNGIVQFTYGG 917
             E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN++R +   ++QF YGG
Sbjct: 979  QEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNSVRDADGTLIQFLYGG 1038

Query: 918  DGLDPIDMEGNAQPVNFTRSWDHANNITFNHSDKPLLPYQIMQQTNSILQPLEEKLVRYD 977
            D +D I  E +    NF                                      L  YD
Sbjct: 1039 DAVDVIK-ESHMTEFNFC-------------------------------------LDNYD 1060

Query: 978  NLGRTLDPSLQDRAEFIDQDDAERNFYKSLREYLHTKASHLAKIRSHKGLKQFLD-EPAP 1036
             L +  +PS     E +D + A +   K+L+        +  K +  K  KQ L  +P  
Sbjct: 1061 ALLKKYNPSA--LVEHVDVETALKYSKKTLK--------NRKKHKDEKHYKQTLKYDPV- 1109

Query: 1037 ELQSMDLDEGSPSALLASVDQ--------LCKISSKLV--------AKFLEIAIFKYHKA 1080
                  L + +P+  L +V +            SSK           KF  +   KY ++
Sbjct: 1110 ------LSKYNPAKYLGAVSENFQDKLELFLDKSSKTFKEYESINEKKFRALMQLKYMRS 1163

Query: 1081 KVEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTP 1138
             + PG AVG + + S+GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP
Sbjct: 1164 LINPGEAVGIIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTP 1222

 Score = 53.1 bits (126), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 53/116 (45%), Gaps = 3/116 (2%)

Query: 13  IKGLEFSALSASDIVGQSKVEISTRDLFDLENGRKPKSGGALDTRMGVSSSQAECSTCHG 72
           I  ++F  L+++DI   S   I+   + D  N   P SGG  D  +G       C TC  
Sbjct: 11  ISSVDFGILTSADIRNLSAKRITNPTVLD--NLGHPISGGLYDLALGAFLRNL-CGTCGL 67

Query: 73  NLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKSCAALLLSEEDKRQFLSELR 128
           +   C GH GHI+L +P ++  +F      L+S C  C    L   D  ++  +LR
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRSACLFCHHFKLKSLDVHRYACKLR 123

>Smik_15.519 Chr15 (910592..915589) [4998 bp, 1665 aa] {ON} YOR341W
            (REAL)
          Length = 1665

 Score =  432 bits (1112), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 314/948 (33%), Positives = 484/948 (51%), Gaps = 123/948 (12%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLI----------- 299
            + +++    +  PP   R PS + ++   ++++ L   L++++ TS LI           
Sbjct: 351  KADSFFMDVIVVPPTRFRLPSKLGEEVHENSQNQL---LSKVLTTSLLIRDLNDDLSKLQ 407

Query: 300  --KAGLE-KGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGGKTKPIRGFCQRL 356
              K  LE + +  + +M  +  +Q  V  +I+S          G T GK  P+ G  Q L
Sbjct: 408  KDKVSLEDRRVIFSRLMNAFVTIQNDVNAFIDSTKAQ------GRTSGKV-PVPGVKQAL 460

Query: 357  KGKQGRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKAKLQ 416
            + K+G FR ++ GKRV+++ R+V+SPDPN+  +E+ VP   A  LTYPE VT YN A+L+
Sbjct: 461  EKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFAVKLTYPEPVTAYNIAELR 520

Query: 417  QLVINGPNEHPGANYLLKKDE----------EARRNLRYGDRIKLAKNLQYGDL---VER 463
            Q VINGP++ PGA  +  +D           E R+ L     +  + N+    L   V R
Sbjct: 521  QAVINGPDKWPGATQIQNEDGSLVSLIGMSLEQRKALA-NQLLTPSSNVSTHTLNKKVYR 579

Query: 464  HLEDGDVVLFNRQPSLHRLSILSHFAKIRP-WRTFRLNECVCTPYNADFDGDEMNLHVPQ 522
            H+++ DVVL NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ
Sbjct: 580  HIKNRDVVLMNRQPTLHKASMMGHKVRVLPNEKTLRLHYANTGAYNADFDGDEMNMHFPQ 639

Query: 523  TEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYSRAEFVQLLSMM 582
             E ARAEA+NL    +  LTP SG P+    QD I+    ++ KDSF++R ++ Q +   
Sbjct: 640  NENARAEALNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIYGC 699

Query: 583  ---SDGNM---QFDIPPPAIMKPYYMWTGKQVFS-LLIRPNKKSSVVINLDAKNKVYIPP 635
                DG+    +    PP I KPY +WTGKQ+ + +L+         INL +KNK+    
Sbjct: 700  IRPEDGHTTRSKIVTLPPTIFKPYPLWTGKQIITTVLLNVTPPDMPGINLLSKNKIKNEY 759

Query: 636  KHK-HLPNEMSINDGFVVIRGSQILSGVMDKSVLGDGKKHSVFYTILRDFGPKEAAYAMN 694
              K  L NE+   DG        +L G++DKS  G   K+ + +++   +GP+ AA  ++
Sbjct: 760  WGKGSLENEVLFKDG-------ALLCGILDKSQYG-ASKYGIVHSLHEVYGPEVAAKVLS 811

Query: 695  RMAKLCARYLGNRGFSIGINDVTPGFE--------LKNK--------KEVMVEDAYAKCD 738
             + +L   Y+    F+ G++D+    E        LK           EV   D     D
Sbjct: 812  VLGRLFTNYITATAFTCGMDDLRLTAEGNKWRTDILKTSVDTGRQAAAEVTNLDKDTPAD 871

Query: 739  DLIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVCIKELDN----LNSCLIMA 794
            D   +  K   E     N+   L+A     ++ +  +V   C+ +        NS   MA
Sbjct: 872  D--PELLKRLQEILRDNNKSGILDAVTSSKVNSITSQVVSKCVPDGTMKKFPYNSMQAMA 929

Query: 795  NCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSKTPQSKGFVRNSFFSG 854
              G+KGSN+NVSQ++ ++GQQ + G RVP     ++LP F        + G+V+  F+SG
Sbjct: 930  LSGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMAGGYVKGRFYSG 989

Query: 855  LSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTIRTSSNGIVQFT 914
            + P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN+IR +   +VQF 
Sbjct: 990  IKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNSIRDADGTLVQFM 1049

Query: 915  YGGDGLDPIDMEGNAQPVNFTRSWDHANNITFNHSDKPLLPYQIMQQTN--SILQPLE-E 971
            YGGD    ID+   +    F    D+               Y ++++ N  ++++ L+ E
Sbjct: 1050 YGGDA---IDITKESHMTQFEFCLDNY--------------YALLKKYNPSALIEHLDVE 1092

Query: 972  KLVRYDNLGRTLDPSLQDRAEFIDQDDAERNFYKSLREYLHTKASHLAKIRSHKGLKQFL 1031
              ++Y         +L+ R + I +       YK   +Y       LAK    K L    
Sbjct: 1093 SALKYSK------KTLKYRKKHIKEP-----HYKQSIKY----DPVLAKYNPAKYLGSVS 1137

Query: 1032 DEPAPELQSMDLDEGSPSALLASVDQLCKISSKLVAKFLEIAIFKYHKAKVEPGTAVGAV 1091
            +    +L+S  LD+G  S L  S D + +       KF  +   KY ++ + PG AVG +
Sbjct: 1138 ENFQDKLESF-LDKG--SKLFKSADGVNE------KKFRALMQLKYMRSLINPGEAVGII 1188

Query: 1092 GAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTP 1138
             + S+GEP TQMTL TFHFAG  + NVTLG+PR++EI+  AS  I TP
Sbjct: 1189 ASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRLREIVMTASAAIKTP 1236

 Score = 51.6 bits (122), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 54/116 (46%), Gaps = 3/116 (2%)

Query: 13  IKGLEFSALSASDIVGQSKVEISTRDLFDLENGRKPKSGGALDTRMGVSSSQAECSTCHG 72
           I  ++F  L+A +I   S  +I+   + D  N   P SGG  D  +G       CSTC  
Sbjct: 11  ITSVDFGILTAKEIRNLSAKQITNPTVLD--NLGHPVSGGLYDLALGAFLRNL-CSTCGL 67

Query: 73  NLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKSCAALLLSEEDKRQFLSELR 128
           +   C GH GHI+L +P ++  +F      L++ C  C    L   +  ++  +LR
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRASCLFCHHFRLKSVEVHRYACKLR 123

>YOR341W Chr15 (960987..965981) [4995 bp, 1664 aa] {ON}  RPA190RNA
            polymerase I largest subunit A190
          Length = 1664

 Score =  431 bits (1109), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 314/958 (32%), Positives = 477/958 (49%), Gaps = 143/958 (14%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLI----------- 299
            + +++    L  PP   R PS + ++   ++++ L   L++++ TS LI           
Sbjct: 351  KADSFFMDVLVVPPTRFRLPSKLGEEVHENSQNQL---LSKVLTTSLLIRDLNDDLSKLQ 407

Query: 300  --KAGLE-KGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGGKTKPIRGFCQRL 356
              K  LE + +  + +M  +  +Q  V  +I+S          G T GK  PI G  Q L
Sbjct: 408  KDKVSLEDRRVIFSRLMNAFVTIQNDVNAFIDSTKAQ------GRTSGKV-PIPGVKQAL 460

Query: 357  KGKQGRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKAKLQ 416
            + K+G FR ++ GKRV+++ R+V+SPDPN+  +E+ VP   A  LTYPE VT YN A+L+
Sbjct: 461  EKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFAVKLTYPEPVTAYNIAELR 520

Query: 417  QLVINGPNEHPGANYLLKKDE----------EARRNLRYGDRIKLAKNLQYGDL---VER 463
            Q VINGP++ PGA  +  +D           E R+ L     +  + N+    L   V R
Sbjct: 521  QAVINGPDKWPGATQIQNEDGSLVSLIGMSVEQRKALA-NQLLTPSSNVSTHTLNKKVYR 579

Query: 464  HLEDGDVVLFNRQPSLHRLSILSHFAKIRP-WRTFRLNECVCTPYNADFDGDEMNLHVPQ 522
            H+++ DVVL NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ
Sbjct: 580  HIKNRDVVLMNRQPTLHKASMMGHKVRVLPNEKTLRLHYANTGAYNADFDGDEMNMHFPQ 639

Query: 523  TEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYSRAEFVQLLSMM 582
             E ARAEA+NL    +  LTP SG P+    QD I+    ++ KDSF++R ++ Q +   
Sbjct: 640  NENARAEALNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIYGC 699

Query: 583  ---SDGNM---QFDIPPPAIMKPYYMWTGKQVFS-LLIRPNKKSSVVINLDAKNKVYIPP 635
                DG+    +    PP I KPY +WTGKQ+ + +L+         INL +KNK+    
Sbjct: 700  IRPEDGHTTRSKIVTLPPTIFKPYPLWTGKQIITTVLLNVTPPDMPGINLISKNKIKNEY 759

Query: 636  KHK-HLPNEMSINDGFVVIRGSQILSGVMDKSVLGDGKKHSVFYTILRDFGPKEAAYAMN 694
              K  L NE+   DG        +L G++DKS  G   K+ + +++   +GP+ AA  ++
Sbjct: 760  WGKGSLENEVLFKDG-------ALLCGILDKSQYG-ASKYGIVHSLHEVYGPEVAAKVLS 811

Query: 695  RMAKLCARYLGNRGFSIGIND------------------VTPGFELKNKKEVMVEDAYAK 736
             + +L   Y+    F+ G++D                  V  G E   +   + +D  A 
Sbjct: 812  VLGRLFTNYITATAFTCGMDDLRLTAEGNKWRTDILKTSVDTGREAAAEVTNLDKDTPAD 871

Query: 737  CDDLIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVCIKELDN----LNSCLI 792
              +L+ +      E     N+   L+A     ++ +  +V   C+ +        NS   
Sbjct: 872  DPELLKRLQ----EILRDNNKSGILDAVTSSKVNAITSQVVSKCVPDGTMKKFPCNSMQA 927

Query: 793  MANCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSKTPQSKGFVRNSFF 852
            MA  G+KGSN+NVSQ++ ++GQQ + G RVP     ++LP F        + G+V+  F+
Sbjct: 928  MALSGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMAGGYVKGRFY 987

Query: 853  SGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTIRTSSNGIVQ 912
            SG+ P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN+IR +   +VQ
Sbjct: 988  SGIKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNSIRDADGTLVQ 1047

Query: 913  FTYGGDGLDPIDMEGNAQPVNFTRSWDHANNITFNHSDKPLLPYQIMQQTNSILQPLEEK 972
            F YGGD +D I  E +     F                                      
Sbjct: 1048 FMYGGDAID-ITKESHMTQFEFC------------------------------------- 1069

Query: 973  LVRYDNLGRTLDPSLQDRAEFIDQDDAERNFYKSLR-EYLHTKASH----------LAKI 1021
            L  Y  L +  +PS     E +D + A +   K+L+    H+K  H          LAK 
Sbjct: 1070 LDNYYALLKKYNPSA--LIEHLDVESALKYSKKTLKYRKKHSKEPHYKQSVKYDPVLAKY 1127

Query: 1022 RSHKGLKQFLDEPAPELQSMDLDEGSPSALLASVDQLCKISSKLVAKFLEIAIFKYHKAK 1081
               K L    +    +L+S  LD+   S L  S D + +       KF  +   KY ++ 
Sbjct: 1128 NPAKYLGSVSENFQDKLESF-LDKN--SKLFKSSDGVNE------KKFRALMQLKYMRSL 1178

Query: 1082 VEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTP 1138
            + PG AVG + + S+GEP TQMTL TFHFAG  + NVTLG+PR++EI+  AS  I TP
Sbjct: 1179 INPGEAVGIIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRLREIVMTASAAIKTP 1236

 Score = 51.6 bits (122), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 54/116 (46%), Gaps = 3/116 (2%)

Query: 13  IKGLEFSALSASDIVGQSKVEISTRDLFDLENGRKPKSGGALDTRMGVSSSQAECSTCHG 72
           I  ++F  L+A +I   S  +I+   + D  N   P SGG  D  +G       CSTC  
Sbjct: 11  ITSVDFGILTAKEIRNLSAKQITNPTVLD--NLGHPVSGGLYDLALGAFLRNL-CSTCGL 67

Query: 73  NLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKSCAALLLSEEDKRQFLSELR 128
           +   C GH GHI+L +P ++  +F      L++ C  C    L   +  ++  +LR
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRASCLFCHHFRLKSVEVHRYACKLR 123

>Skud_15.506 Chr15 (901437..906434) [4998 bp, 1665 aa] {ON} YOR341W
            (REAL)
          Length = 1665

 Score =  430 bits (1106), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 314/955 (32%), Positives = 473/955 (49%), Gaps = 137/955 (14%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLI----------- 299
            + +++    +  PP   R PS +  +   ++++ L   L++++ TS LI           
Sbjct: 351  KADSFFMDVIVVPPTRFRLPSKLGDEVHENSQNQL---LSKVLTTSLLIRDLNDDLSKLQ 407

Query: 300  --KAGLE-KGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGGKTKPIRGFCQRL 356
              K  LE + +  + +M  +  +Q  V  +I+S          G T GK  PI G  Q L
Sbjct: 408  KDKVSLEDRKVIFSRLMNAFVTIQNDVNAFIDSTKAQ------GRTSGKV-PIPGVKQAL 460

Query: 357  KGKQGRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKAKLQ 416
            + K+G FR ++ GKRV+++ R+V+SPDPN+  +E+ VP   A  LTYPE VT YN A+L+
Sbjct: 461  EKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFAVKLTYPEPVTAYNIAELR 520

Query: 417  QLVINGPNEHPGANYLLKKDEE--ARRNLRYGDRIKLAKNL----------QYGDLVERH 464
            Q VINGP++ PGA  +  +D    +   + +  R  LA  L               V RH
Sbjct: 521  QAVINGPDKWPGATQIQNEDGSLVSLIGMSFEQRKALANQLLTPSSNVSTHTLNKKVYRH 580

Query: 465  LEDGDVVLFNRQPSLHRLSILSHFAKIRP-WRTFRLNECVCTPYNADFDGDEMNLHVPQT 523
            +++ DVVL NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ 
Sbjct: 581  IKNRDVVLMNRQPTLHKASMMGHKVRVLPNEKTLRLHYANTGAYNADFDGDEMNMHFPQN 640

Query: 524  EEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYSRAEFVQLLSMM- 582
            E ARAEA+NL    +  LTP SG P+    QD I+    ++ KDSF++R ++ Q +    
Sbjct: 641  ENARAEALNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIYGCI 700

Query: 583  --SDGNM---QFDIPPPAIMKPYYMWTGKQVFS-LLIRPNKKSSVVINLDAKNKVYIPPK 636
               DG+    +    PP I KPY +WTGKQ+ + +L+         INL +KNK+     
Sbjct: 701  RPEDGHTTRSKIVTLPPTIFKPYPLWTGKQIITTVLLNVTPPDMPGINLISKNKIKNEYW 760

Query: 637  HK-HLPNEMSINDGFVVIRGSQILSGVMDKSVLGDGKKHSVFYTILRDFGPKEAAYAMNR 695
             K  L +E+   DG        +L G++DKS  G   K+ + +++   +GP+ AA  ++ 
Sbjct: 761  GKGSLESEVLFKDG-------ALLCGILDKSQYG-ASKYGIVHSLHEVYGPEVAAKVLSV 812

Query: 696  MAKLCARYLGNRGFSIGINDVTPGFE--------LKNK--------KEVMVEDAYAKCDD 739
            + +L   Y+    F+ G++D+    E        LK           EV   D     DD
Sbjct: 813  LGRLFTNYITATAFTCGMDDLRLTAEGNKWRTDILKTSVDTGRQAAAEVTNLDKETPSDD 872

Query: 740  LIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVCIKELDN----LNSCLIMAN 795
               +  K   E     N+   L+A     ++ +  +V   C+ +        NS   MA 
Sbjct: 873  --PELLKRLQEILRDNNKSGILDAVTSSKVNVITSQVVSKCVPDGTMKKFPCNSMQAMAL 930

Query: 796  CGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSKTPQSKGFVRNSFFSGL 855
             G+KGSN+NVSQ++ ++GQQ + G RVP     ++LP F        + G+V+  F+SG+
Sbjct: 931  SGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMAGGYVKGRFYSGI 990

Query: 856  SPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTIRTSSNGIVQFTY 915
             P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN+IR +   ++QF Y
Sbjct: 991  KPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNSIRDADGTLIQFMY 1050

Query: 916  GGDGLDPIDMEGNAQPVNFTRSWDHANNITFNHSDKPLLPYQIMQQTNSILQPLEEKLVR 975
            GGD +D I  E +     F                                      L  
Sbjct: 1051 GGDAVD-ITKESHMTQFEFC-------------------------------------LDN 1072

Query: 976  YDNLGRTLDPSLQDRAEFIDQDDAERNFYKSLR-EYLHTKASH----------LAKIRSH 1024
            Y  L +  +PS     E +D + A +   K+L+    H+K  H          LAK    
Sbjct: 1073 YYALLKKYNPSA--LIEHLDVESALKYSKKTLKYRKKHSKEPHYKQSMKYDPVLAKYSPA 1130

Query: 1025 KGLKQFLDEPAPELQSMDLDEGSPSALLASVDQLCKISSKLVAKFLEIAIFKYHKAKVEP 1084
            K L    +    +L+S  LDE   S L  S D + +       KF  +   KY ++ + P
Sbjct: 1131 KYLGSVSENFQDKLESF-LDEN--SKLFKSTDGVNE------KKFRALMQLKYMRSLINP 1181

Query: 1085 GTAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTP 1138
            G AVG + + S+GEP TQMTL TFHFAG  + NVTLG+PR++EI+  AS  I TP
Sbjct: 1182 GEAVGIIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRLREIVMTASAAIKTP 1236

 Score = 51.2 bits (121), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 54/116 (46%), Gaps = 3/116 (2%)

Query: 13  IKGLEFSALSASDIVGQSKVEISTRDLFDLENGRKPKSGGALDTRMGVSSSQAECSTCHG 72
           I  ++F  L+A +I   S  +I+   + D  N   P SGG  D  +G       CSTC  
Sbjct: 11  ITSVDFGILTAKEIRNLSAKQITNPTVLD--NLGHPVSGGLYDLALGAFLRNL-CSTCGL 67

Query: 73  NLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKSCAALLLSEEDKRQFLSELR 128
           +   C GH GHI+L +P ++  +F      L++ C  C    L   +  ++  +LR
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRASCLFCHHFRLKSVEVHRYACKLR 123

>KAFR0K00540 Chr11 complement(114196..119184) [4989 bp, 1662 aa] {ON}
            Anc_7.51 YOR341W
          Length = 1662

 Score =  430 bits (1106), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 308/958 (32%), Positives = 483/958 (50%), Gaps = 146/958 (15%)

Query: 254  ETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK------AGLEKG 306
            + +    +  PP   R PS + ++   ++++ L   L++I+ TS LI+      + L+K 
Sbjct: 352  DAFFMDVVVVPPTRFRLPSKLGEEVHENSQNQL---LSKILTTSLLIRDLNDEMSKLQKD 408

Query: 307  --------ISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGGKTKPIRGFCQRLKG 358
                    I  + +M  +  +Q  V  +I+S          G+T GK  P+ G  Q L+ 
Sbjct: 409  KVSVDDRRIIFSRLMNAFVTIQNDVNAFIDSTKAQ------GNTSGKV-PVPGVKQALEK 461

Query: 359  KQGRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKAKLQQL 418
            K+G FR ++ GKRV+++ R+V+SPDPN+  +E+ VP   A  LTYPE VT +N A+L+Q 
Sbjct: 462  KEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSFNIAELRQA 521

Query: 419  VINGPNEHPGANYLLKKD----------EEARRNLRYGDRIKLAKNLQYGDL---VERHL 465
            VINGP++ PGA  +  +D           E R+ L        + N     L   V RH+
Sbjct: 522  VINGPDKWPGATQIQNEDGSLVSLIGMSAEQRKALANQLMTPTSHNGATHTLNKKVYRHI 581

Query: 466  EDGDVVLFNRQPSLHRLSILSHFAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQTE 524
            ++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ E
Sbjct: 582  KNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQNE 641

Query: 525  EARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYSRAEFVQLLSMM-- 582
             ARAEA NL    +  LTP SG P+    QD I+    +++KDSF++R ++ Q +     
Sbjct: 642  NARAEAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTNKDSFFTREQYQQYIYGCIR 701

Query: 583  -SDGNM---QFDIPPPAIMKPYYMWTGKQVFS-LLIRPNKKSSVVINLDAKNKVYIPPKH 637
              DG+    +    PPA+MKP  +WTGKQ+ + +L+         INL + NK+    K+
Sbjct: 702  PEDGHATRAKLATVPPAVMKPVPLWTGKQIITTVLLNITPPDMPGINLKSSNKI----KN 757

Query: 638  KHLPNEMSINDGFVVIRGSQILSGVMDKSVLGDGKKHSVFYTILRDFGPKEAAYAMNRMA 697
             +       N+  V+ +  ++L G++DKS  G   K+ + + +   +GP  +A A++ + 
Sbjct: 758  DYWGK--GSNENEVIFKNGELLCGILDKSQYG-ASKYGIIHCLHEVYGPDVSAKALSVLG 814

Query: 698  KLCARYLGNRGFSIGINDVTPGFE-LKNKKEVMV------EDAYAKCDDLID-------Q 743
            +L   Y+    F+ G++D+    E  K +KE++        +A A+  +L         +
Sbjct: 815  RLFTNYITATAFTCGMDDLRLTEEGNKWRKEILKTSVDTGREAAAEVTNLPKDTPSNDPE 874

Query: 744  FNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVCI-----KELDNLNSCLIMANCGS 798
              K   E     N+   L+A     ++ +  +V   C+     K+    NS   MA  G+
Sbjct: 875  LLKRLEEIIRDNNKSGILDAVTSSKVNTITSKVVSTCVPGGTMKKFPE-NSMQSMALSGA 933

Query: 799  KGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSKTPQSKGFVRNSFFSGLSPP 858
            KGSN+NVSQ++ ++GQQ + G RVP     ++LP F       ++ G+++  F+SG+ P 
Sbjct: 934  KGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDARAGGYIKGRFYSGIRPQ 993

Query: 859  EFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTIRTSSNGIVQFTYGGD 918
            E+ FH ++GREGL+DTAVKTA +GY+ R L K LE +   YDN+IR +   ++Q  YGGD
Sbjct: 994  EYYFHCMAGREGLIDTAVKTASSGYLQRCLTKQLEGVHVSYDNSIRDADGTLIQMLYGGD 1053

Query: 919  GLDPIDMEGNAQPVNFTRSWDHANNITFNHSDKPLLPYQIMQQTNSILQPLEEKLVRYDN 978
             +D +  E +    NF                                      L  YD 
Sbjct: 1054 AID-VTKESHLTKFNFC-------------------------------------LENYDA 1075

Query: 979  LGRTLDPSLQDRAEFIDQDDAERNFYKSLR-EYLHTKASHLAKIRSHKGLKQFLDEPAPE 1037
            L +  +PS     E +D + A +   KSL+    H K +H  +   +  +          
Sbjct: 1076 LLKKYNPSA--LIEHLDVETALKYSKKSLKYRKKHAKEAHYQQTVKYDPI---------- 1123

Query: 1038 LQSMDLDEGSPSALLASV-----DQLCKI---SSKLV--------AKFLEIAIFKYHKAK 1081
                 L + +P+  L SV     DQL      +SKL+         KF  +   KY ++ 
Sbjct: 1124 -----LSKYNPAKYLGSVSENFQDQLENFLHDNSKLLKSHEDVNEKKFRALMQLKYMRSL 1178

Query: 1082 VEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTP 1138
            + PG AVG + + S+GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP
Sbjct: 1179 INPGEAVGIIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRLREIIMTASAAIKTP 1236

 Score = 55.5 bits (132), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 55/116 (47%), Gaps = 3/116 (2%)

Query: 13  IKGLEFSALSASDIVGQSKVEISTRDLFDLENGRKPKSGGALDTRMGVSSSQAECSTCHG 72
           I  ++FS L++ DI   S  +I    + D  N   P SGG  D  +G       C+TC  
Sbjct: 11  ITSVDFSILTSKDIRSLSAKQIINPTVLD--NLGHPISGGLYDLSLGAFLRNL-CTTCGL 67

Query: 73  NLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKSCAALLLSEEDKRQFLSELR 128
           +   C GH GHI+L +PV++  +F      L+S C  C    L   +  +F  +L+
Sbjct: 68  DEKFCPGHVGHIELPVPVYNPLFFNQLYIYLRSSCLFCHHFRLKSAEVHRFALKLK 123

>TPHA0H02800 Chr8 (659254..664200) [4947 bp, 1648 aa] {ON} Anc_7.51
            YOR341W
          Length = 1648

 Score =  429 bits (1103), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 311/953 (32%), Positives = 476/953 (49%), Gaps = 123/953 (12%)

Query: 247  TVKSGRPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK----- 300
            T K  + + +    +  PP   R PS +  +   ++++ L   L++I+ TS LI+     
Sbjct: 340  TGKIVKADDFFMDVVLVPPTRFRLPSKLGDEVHENSQNQL---LSKILTTSLLIRDLNDE 396

Query: 301  ---------AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGGKTKPIRG 351
                     A  ++ I  + +M  +  +Q  V  +I+S          G+  GK  P+ G
Sbjct: 397  ISKLQKDKVALDDRRIIFSRLMNAFVTIQNDVNSFIDSSKAQ------GNNSGKL-PVPG 449

Query: 352  FCQRLKGKQGRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYN 411
              Q L+ K+G FR ++ GKRV+++ R+V+SPDPN+  DE+ VP   A  LTYPE VT YN
Sbjct: 450  VKQALEKKEGLFRKHMMGKRVNYAARSVISPDPNIETDEIGVPPVFATKLTYPEPVTSYN 509

Query: 412  KAKLQQLVINGPNEHPGANYLLKKDEE--ARRNLRYGDRIKLAKNLQ----------YGD 459
             A+L+Q VINGP++ PGA  +  +D    +   +    R  LA  L              
Sbjct: 510  IAELRQAVINGPDKWPGATQIQNEDGSLVSLIGMTVEQRKALANQLMTPSSNPATHTLNK 569

Query: 460  LVERHLEDGDVVLFNRQPSLHRLSILSHFAKIRPW-RTFRLNECVCTPYNADFDGDEMNL 518
             V RH+++ DVV+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+
Sbjct: 570  KVYRHIKNRDVVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNM 629

Query: 519  HVPQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYSRAEFVQL 578
            H PQ E ARAEA NL    +  LTP SG P+    QD I+    ++ KDS+++R ++ Q 
Sbjct: 630  HFPQNENARAEAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSYFTREQYQQY 689

Query: 579  LSMM---SDG---NMQFDIPPPAIMKPYYMWTGKQVFS-LLIRPNKKSSVVINLDAKNKV 631
            +       DG   N +    PPAI+KP  +WTGKQ+ + +L+  +      INL +KNK+
Sbjct: 690  IYGCIRPEDGHSANNKLLTIPPAIIKPVPLWTGKQIITTVLLNVSPVDMPGINLKSKNKI 749

Query: 632  YIPPKHKHLP-NEMSINDGFVVIRGSQILSGVMDKSVLGDGKKHSVFYTILRDFGPKEAA 690
                  +H   NE+   DG        +L G++DKS  G   K+ + + +   +GP+ AA
Sbjct: 750  KDEYWGQHSEENEVLFKDG-------ALLCGILDKSQYG-ASKYGIVHALQEVYGPEVAA 801

Query: 691  YAMNRMAKLCARYLGNRGFSIGINDVTPGFE------------LKNKKEVMVEDAYAKCD 738
              ++ + +L   Y+ N  F+ G++D+    E            +   ++  VE    + D
Sbjct: 802  KVLSVLGRLFTNYITNTAFTCGMDDLRLTDEGNKWRTDILKTSVDRGRQAAVEVTNLEKD 861

Query: 739  DLID--QFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVCI-----KELDNLNSCL 791
               D  +  K   E     N+   L+A     ++ +  +V   C+     K     NS  
Sbjct: 862  TSADDSELLKRLEEILRDDNKSGILDAVTSSKVNAITSQVVSKCVPGGTMKRFPE-NSMQ 920

Query: 792  IMANCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSKTPQSKGFVRNSF 851
             MA  G+KGSN+NVSQ++ ++GQQ + G RVP     ++LP F        + G+++  F
Sbjct: 921  SMALSGAKGSNVNVSQIMCLLGQQALEGRRVPIMVSGKTLPSFKPFETDAMAGGYIKGRF 980

Query: 852  FSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTIRTSSNGIV 911
            +SG+ P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDNT+R     ++
Sbjct: 981  YSGIKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNTVRDGDGTLI 1040

Query: 912  QFTYGGDGLDPIDMEGNAQPVNFTRSWDHANNITFNHSDKPLLPYQIMQQTNSILQPLEE 971
            +F YGGD +D +  E      +F                                     
Sbjct: 1041 EFLYGGDAVD-VTKESYMNQFDFC------------------------------------ 1063

Query: 972  KLVRYDNLGRTLDPSLQDRAEFIDQDDAERNFYKSLREYLHTK--ASHLAKIRSHKGLKQ 1029
             L  YD+L +  +P+     +F+D D A +   K+L+     K    +L  I+    L +
Sbjct: 1064 -LDNYDSLLKRYNPAA--LIDFLDVDSALKYSKKTLKHRKKNKNVPHYLQNIKYDPVLAK 1120

Query: 1030 FLDEPAPELQSMDLD-EGSPSALLASVDQLCKISSKLV--AKFLEIAIFKYHKAKVEPGT 1086
            +   PA  L S+    +      L S  QL K S K V   KF  +   KY ++ + PG 
Sbjct: 1121 Y--NPAKYLGSVSEKFQDKLENFLDSNSQLFK-SHKSVNEKKFRALMQLKYMRSLINPGE 1177

Query: 1087 AVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTP 1138
            AVG + + S+GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP
Sbjct: 1178 AVGIIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTP 1230

 Score = 54.3 bits (129), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 42/143 (29%), Positives = 64/143 (44%), Gaps = 12/143 (8%)

Query: 13  IKGLEFSALSASDIVGQSKVEISTRDLFDLENGRKPKSGGALDTRMGVSSSQAECSTCHG 72
           I  ++FS LSA +I   S  +I+   + D  N   P SGG  D  +G       CSTC  
Sbjct: 11  ITSVDFSILSAEEIRNLSTKQITNPTVLD--NLGHPISGGLYDLALGAFLRNL-CSTCGL 67

Query: 73  NLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKSCAALLLSEEDKRQFLSELR---- 128
           +   C GH GHI+L +P ++  +F      L+S C  C    L   +  ++  +L+    
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRSSCLFCHHFRLRSVEVHRYTCKLKLLQY 127

Query: 129 -----RPGIDNLRRMGILKKVVD 146
                   IDNL   G+ + + D
Sbjct: 128 GLIEESYQIDNLTIGGLDESITD 150

>KLLA0F23243g Chr6 (2165407..2170368) [4962 bp, 1653 aa] {ON} highly
            similar to uniprot|P10964 Saccharomyces cerevisiae
            YOR341W RPA190 RNA polymerase I subunit largest subunit
            of RNA polymerase I
          Length = 1653

 Score =  428 bits (1101), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 300/945 (31%), Positives = 475/945 (50%), Gaps = 121/945 (12%)

Query: 254  ETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK------------ 300
            + +    L  PP   R PS +  +   + ++ L   L++I+ TS LI+            
Sbjct: 353  DMFFMEVLIVPPTRFRLPSKLGDEVHENTQNQL---LSKILTTSLLIRDLNDEMSRLQKD 409

Query: 301  --AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGGKTKPIRGFCQRLKG 358
              +  ++ +  N +M  +  +Q  V  +I+S           S+ G   PI G  Q L+ 
Sbjct: 410  KVSADDRKVIFNRLMNAFVTIQNDVNAFIDSTKAQ-------SSSGNKVPIPGLKQALEK 462

Query: 359  KQGRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKAKLQQL 418
            K+G FR ++ GKRV+++ R+V+SPDPN+  +E+ VP   A  LTYPE VT YN A+L+Q 
Sbjct: 463  KEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTAYNVAELRQA 522

Query: 419  VINGPNEHPGANYLLKKDEE--ARRNLRYGDRIKLAKNL----------QYGDLVERHLE 466
            VINGP++ PGA  +  +D    +   +    R  LA  L               V RH++
Sbjct: 523  VINGPDKWPGATQIQNEDGSFVSLVGMTLEQRKALANQLLTPSTHDVAHSINKKVYRHIK 582

Query: 467  DGDVVLFNRQPSLHRLSILSHFAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQTEE 525
            + DVV+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ E 
Sbjct: 583  NRDVVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQNEN 642

Query: 526  ARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYSRAEFVQLLSMM--- 582
            A+AEA+NL    +  LTP SG P+    QD I+    ++ KDSF++R ++ Q +      
Sbjct: 643  AKAEALNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIYGCIRP 702

Query: 583  SDGNM---QFDIPPPAIMKPYYMWTGKQVFS-LLIRPNKKSSVVINLDAKNKVYIPPKHK 638
             DG+    +    PPA+MKP  +WTGKQ+ + +L+     +   INL++KNK+    K++
Sbjct: 703  EDGHATRNKLVTIPPAVMKPEPLWTGKQIITTVLLNTCPANMPGINLNSKNKI----KNE 758

Query: 639  HLPNEMSINDGFVVIRGSQILSGVMDKSVLGDGKKHSVFYTILRDFGPKEAAYAMNRMAK 698
            +       N+  VV +  Q+L G++DKS  G   K  + +++   +GP  AA  ++ + +
Sbjct: 759  YWGKSSEENN--VVFKDGQLLCGILDKSQYG-ASKFGIVHSLHEVYGPDVAAKVLSVLGR 815

Query: 699  LCARYLGNRGFSIGINDV---TPGFELKN-------------KKEVMVEDAYAKCDDLID 742
            L   Y+    F+ G++D+     G + +N               EV   D   K DD   
Sbjct: 816  LFTNYITATAFTCGMDDLRLTAEGNKWRNDILQTSVDIGRVAAAEVTNLDKDVKSDD--G 873

Query: 743  QFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVCIKELDN----LNSCLIMANCGS 798
            +  K   E     N+   L+A     ++ +  +V   C+ +        NS   MA  G+
Sbjct: 874  ELLKRLEEILRDDNKLGILDAITSSKVNSITSQVVSKCVPDGTMKKFPYNSMQAMALSGA 933

Query: 799  KGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSKTPQSKGFVRNSFFSGLSPP 858
            KGSN+NVSQ++ ++GQQ + G RVP     ++LP F       ++ G+++  F+SG+ P 
Sbjct: 934  KGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPFETDARAGGYIKGRFYSGIRPQ 993

Query: 859  EFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTIRTSSNGIVQFTYGGD 918
            E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN++R     ++QF YGGD
Sbjct: 994  EYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNSVRDGDGTLIQFLYGGD 1053

Query: 919  GLDPIDMEGNAQPVNFTRSWDHANNITFNHSDKPLLPYQIMQQTNSILQPLEEKLVRYDN 978
             +D I  E +     F                                      +  YD 
Sbjct: 1054 AVD-ITKESHMTEFKFC-------------------------------------VDNYDA 1075

Query: 979  LGRTLDPSLQDRAEFIDQDDAERNFYKSLREY-LHTKASHLAKIRSHKG-LKQFLDEPAP 1036
            L +  +PS     + +D + A +   K+L+    ++K  H A+   +   L +F   P+ 
Sbjct: 1076 LLKKYNPSA--LVDHLDVESALKYSKKTLKNRKKNSKLPHYAQTSKYDPVLSKF--NPSK 1131

Query: 1037 ELQSMDLD-EGSPSALLASVDQLCKISSKLVAK-FLEIAIFKYHKAKVEPGTAVGAVGAH 1094
             L ++  + +      +++ D   K    +  K F  +   KY ++ + PG AVG + + 
Sbjct: 1132 YLGAVSENFQDKLEKFISTNDDFFKKDENVNEKKFRALMQLKYMRSLINPGEAVGIIASQ 1191

Query: 1095 SIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTP 1138
            S+GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP
Sbjct: 1192 SVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTP 1236

 Score = 51.6 bits (122), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 59/133 (44%), Gaps = 12/133 (9%)

Query: 13  IKGLEFSALSASDIVGQSKVEISTRDLFDLENGRKPKSGGALDTRMGVSSSQAECSTCHG 72
           I  ++FS L++ +I   S  +++   + D  N   P  GG  D  +G       C+TC  
Sbjct: 11  ITSIDFSVLTSDEIRKLSAKQVTNPTVLD--NLGHPIQGGLYDLALGAFLKNL-CATCGL 67

Query: 73  NLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKSCAALLLSEEDKRQFLSELR---- 128
           +   C GH GHI+L +P ++  +F      L+S C  C    L   +   +  +LR    
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRSSCLFCHHFRLKSSEVHLYACKLRLLQY 127

Query: 129 -----RPGIDNLR 136
                R  IDN+R
Sbjct: 128 ALIDERYQIDNIR 140

>NDAI0H01200 Chr8 complement(280165..285174) [5010 bp, 1669 aa] {ON}
            Anc_7.51
          Length = 1669

 Score =  427 bits (1099), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 306/952 (32%), Positives = 483/952 (50%), Gaps = 135/952 (14%)

Query: 254  ETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK------AGLEKG 306
            + +    +  PP   R PS +  +   ++++ L   L++I+ T+ LI+      + L+K 
Sbjct: 356  DMFFMDVIVVPPTRFRLPSKLGDEIHENSQNQL---LSKILTTALLIRDLNDEMSKLQKD 412

Query: 307  -ISINN-------MMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGGKTKPIRGFCQRLKG 358
             +S+++       +M  +  +Q  V  +I+S          G+TGGK  PI G  Q L+ 
Sbjct: 413  KVSVDDRRVIFSRLMNAFVTIQNDVNAFIDSTKAQ------GTTGGKV-PIPGVKQALEK 465

Query: 359  KQGRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKAKLQQL 418
            K+G FR ++ GKRV+++ R+V+SPDPN+  +E+ VP   A  LTYPE VT YN A+L+Q 
Sbjct: 466  KEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSYNIAELRQA 525

Query: 419  VINGPNEHPGANYLLKKD----------EEARRNLRYGDRIKLAKNLQYGDL---VERHL 465
            VINGP++ PGA  +  +D           E R+ L     +  + N+    L   V RH+
Sbjct: 526  VINGPDKWPGAAQIQNEDGSLVSLVGMSAEQRKALA-NQLMTPSSNVGTHTLNKKVYRHI 584

Query: 466  EDGDVVLFNRQPSLHRLSILSHFAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQTE 524
            ++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ E
Sbjct: 585  KNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQNE 644

Query: 525  EARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYSRAEFVQLLSMM-- 582
             ARAEA NL    +  LTP SG P+    QD I+    ++ KDSF++R ++ Q +     
Sbjct: 645  NARAEAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIYGCIR 704

Query: 583  -SDGNM---QFDIPPPAIMKPYYMWTGKQVFS-LLIRPNKKSSVVINLDAKNKVYIPPKH 637
              DG+    +    PP I KP  +WTGKQ+ S +L+         INL + NK+    K+
Sbjct: 705  PEDGHATRPKLITLPPTIYKPVPLWTGKQIISTVLLNVTPADMPGINLTSSNKI----KN 760

Query: 638  KHLPNEMSINDGFVVIRGSQILSGVMDKSVLGDGKKHSVFYTILRDFGPKEAAYAMNRMA 697
            ++     S N+  V+ +  ++L G++DKS  G   K  + +++   +GP  AA  ++ + 
Sbjct: 761  EYWGK--SSNENEVLFKNGELLCGILDKSQYG-ASKFGIVHSLHEVYGPSIAAKVLSVLG 817

Query: 698  KLCARYLGNRGFSIGIND------------------VTPGFELKNKKEVMVEDAYAKCDD 739
            +L   Y+ +  F+ G++D                  V  G E   +   + +D  A   +
Sbjct: 818  RLFTNYIMSTAFTCGMDDLRLSEEGNKWRSDILKTSVDTGREAAAEVTNLDKDTAADDAE 877

Query: 740  LIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREE-VGEVCIKELDNLNSCLIMANCGS 798
            L+ +  +   +       +    +K+  + SKV  + V +  +K+    NS   MA  G+
Sbjct: 878  LLKRLEEILRDNNKSGILDAVTSSKVNSITSKVVSKCVPDGTMKKFP-YNSMQAMALSGA 936

Query: 799  KGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSKTPQSKGFVRNSFFSGLSPP 858
            KGSN+NVSQ++ ++GQQ + G RVP     ++LP F        + G+++  F+SG+ P 
Sbjct: 937  KGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMAGGYIKGRFYSGIKPQ 996

Query: 859  EFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTIRTSSNGIVQFTYGGD 918
            E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN++R     ++QF YGGD
Sbjct: 997  EYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNSVRDGDGTLIQFLYGGD 1056

Query: 919  GLDPIDMEGNAQPVNFTRSWDHANNITFNHSDKPLLPYQIMQQTNSILQPLEEKLVRYDN 978
             +D +  E +    +F                                      L  YD 
Sbjct: 1057 AVD-VTKESHMTEFDFC-------------------------------------LDNYDA 1078

Query: 979  LGRTLDPSLQDRAEFIDQDDAERNFYKSLREY-LHTKASH----------LAKIRSHKGL 1027
            L    +PS     E +D + A +   K+L+    H K +H          L+K    K L
Sbjct: 1079 LLNKYNPSA--LIEHLDVETALKYSKKTLKNRKKHAKEAHHKNATKYDPVLSKFNPAKYL 1136

Query: 1028 KQFLDEPAPELQSMDLDEGSPSALLASVDQLCKISSKLVAKFLEIAIFKYHKAKVEPGTA 1087
                ++   +L+S  LD+   S L  S D + +       KF  +   KY ++ + PG A
Sbjct: 1137 GSVSEKFQDKLESY-LDKN--SKLFKSHDNVSE------KKFRALMQLKYMRSLINPGEA 1187

Query: 1088 VGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTP 1138
            VG + + S+GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP
Sbjct: 1188 VGIIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTP 1239

 Score = 51.2 bits (121), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 56/116 (48%), Gaps = 3/116 (2%)

Query: 13  IKGLEFSALSASDIVGQSKVEISTRDLFDLENGRKPKSGGALDTRMGVSSSQAECSTCHG 72
           I  ++F  L++ +I   S  +I+   + D  N   P SGG  D  +G       CS+C  
Sbjct: 11  ITSVDFGILTSEEIRQLSAKQITNPTVLD--NLGHPISGGLYDLSLGAFLRNL-CSSCGL 67

Query: 73  NLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKSCAALLLSEEDKRQFLSELR 128
           +   C GH GHI+L +P ++  +F      L++ C  C  L L + +  +F  +LR
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRTSCLFCHHLKLKQIEVHRFACKLR 123

>Suva_8.391 Chr8 (702691..707688) [4998 bp, 1665 aa] {ON} YOR341W
            (REAL)
          Length = 1665

 Score =  427 bits (1097), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 311/958 (32%), Positives = 476/958 (49%), Gaps = 143/958 (14%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLI----------- 299
            + +++    +  PP   R PS +  +   ++++ L   L++++ T+ LI           
Sbjct: 351  KADSFFMDVIVVPPTRFRLPSKLGDEVHENSQNQL---LSKVLTTALLIRDLNDDLSKLQ 407

Query: 300  --KAGLE-KGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGGKTKPIRGFCQRL 356
              K  LE + +  + +M  +  +Q  V  +I+S          G T GK  PI G  Q L
Sbjct: 408  KDKVSLEDRRVIFSRLMNAFVTIQNDVNAFIDSTKAQ------GRTSGKV-PIPGVKQAL 460

Query: 357  KGKQGRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKAKLQ 416
            + K+G FR ++ GKRV+++ R+V+SPDPN+  +E+ VP   A  LTYPE VT YN A+L+
Sbjct: 461  EKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFAVKLTYPEPVTAYNIAELR 520

Query: 417  QLVINGPNEHPGANYLLKKDE----------EARRNLRYGDRIKLAKNLQYGDL---VER 463
            Q VINGP++ PGA  +  +D           E R+ L     +  + N+    L   V R
Sbjct: 521  QAVINGPDKWPGATQIQNEDGSLVSLIGMSLEQRKALA-NQLLTPSSNVSTHTLNKKVYR 579

Query: 464  HLEDGDVVLFNRQPSLHRLSILSHFAKIRP-WRTFRLNECVCTPYNADFDGDEMNLHVPQ 522
            H+++ DVVL NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ
Sbjct: 580  HIKNRDVVLMNRQPTLHKASMMGHKVRVLPNEKTLRLHYANTGAYNADFDGDEMNMHFPQ 639

Query: 523  TEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYSRAEFVQLLSMM 582
             E ARAEA+NL    +  LTP SG P+    QD I+    ++ KDSF++R ++ Q +   
Sbjct: 640  NENARAEALNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIYGC 699

Query: 583  ---SDGNM---QFDIPPPAIMKPYYMWTGKQVF-SLLIRPNKKSSVVINLDAKNKVYIPP 635
                DG+    +    PPAI KPY +WTGKQ+  ++L+         INL + NK+    
Sbjct: 700  IRPEDGHTTRNKIITLPPAIFKPYPLWTGKQIITTVLLNVTPPDMPGINLISTNKIKNEY 759

Query: 636  KHK-HLPNEMSINDGFVVIRGSQILSGVMDKSVLGDGKKHSVFYTILRDFGPKEAAYAMN 694
              K  L NE+   DG        +L G++DKS  G   K+ + +++   +GP+ AA  ++
Sbjct: 760  WGKGSLENEVLFKDG-------ALLCGILDKSQYG-ASKYGIVHSLHEVYGPEVAAKVLS 811

Query: 695  RMAKLCARYLGNRGFSIGIND------------------VTPGFELKNKKEVMVEDAYAK 736
             + +L   Y+    F+ G++D                  V  G +   +   + +D  A 
Sbjct: 812  VLGRLFTNYITATAFTCGMDDLRLTAEGNKWRTDILKTSVDTGRQAAAEVTNLNKDTPAD 871

Query: 737  CDDLIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVCIKELDN----LNSCLI 792
              +L+ +      E     N+   L+A     ++ +  +V   C+ +        NS   
Sbjct: 872  DAELLKRLQ----EILRDNNKSGILDAVTSSKVNVITSQVVSKCVPDGTMKKFPCNSMQA 927

Query: 793  MANCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSKTPQSKGFVRNSFF 852
            MA  G+KGSN+NVSQ++ ++GQQ + G RVP     ++LP F        + G+V+  F+
Sbjct: 928  MALSGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMAGGYVKGRFY 987

Query: 853  SGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTIRTSSNGIVQ 912
            SG+ P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN+IR +   +VQ
Sbjct: 988  SGIKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNSIRDADGTLVQ 1047

Query: 913  FTYGGDGLDPIDMEGNAQPVNFTRSWDHANNITFNHSDKPLLPYQIMQQTNSILQPLEEK 972
            F YGGD +D I  E +     F                                      
Sbjct: 1048 FMYGGDAVD-ITKESHMTQFEFC------------------------------------- 1069

Query: 973  LVRYDNLGRTLDPSLQDRAEFIDQDDAERNFYKSLR-EYLHTKASH----------LAKI 1021
            L  Y  L +  +PS     E +D + A +   K+L+    H+K  H          LAK 
Sbjct: 1070 LDNYYALLKKYNPSA--LIEHLDVESALKYSKKTLKYRKKHSKEPHYKQAVKYDPVLAKY 1127

Query: 1022 RSHKGLKQFLDEPAPELQSMDLDEGSPSALLASVDQLCKISSKLVAKFLEIAIFKYHKAK 1081
               K L    +    +L+S  LD+   S L  S D + +       KF  +   KY ++ 
Sbjct: 1128 NPAKYLGSVSENFQDKLESF-LDKN--SKLFKSADGVNE------KKFRALMQLKYMRSL 1178

Query: 1082 VEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTP 1138
            + PG AVG + + S+GEP TQMTL TFHFAG  + NVTLG+PR++EI+  AS  I TP
Sbjct: 1179 INPGEAVGIIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRLREIVMTASSAIKTP 1236

 Score = 50.1 bits (118), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 54/116 (46%), Gaps = 3/116 (2%)

Query: 13  IKGLEFSALSASDIVGQSKVEISTRDLFDLENGRKPKSGGALDTRMGVSSSQAECSTCHG 72
           I  ++F  L+A +I   S  +I+   + D  N   P SGG  D  +G       CSTC  
Sbjct: 11  ITSVDFGILTAKEIRNLSAKQITNPTVLD--NLGHPVSGGLYDLALGAFLRNL-CSTCGL 67

Query: 73  NLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKSCAALLLSEEDKRQFLSELR 128
           +   C GH GHI+L +P ++  +F      L++ C  C    L   +  ++  +L+
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRASCLFCHHFRLKSVEVHRYACKLK 123

>KNAG0D04970 Chr4 (905179..910194) [5016 bp, 1671 aa] {ON} Anc_7.51
            YOR341W
          Length = 1671

 Score =  426 bits (1095), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 305/941 (32%), Positives = 472/941 (50%), Gaps = 132/941 (14%)

Query: 264  PPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK------AGLEKG--------IS 308
            PP   R PS M ++   ++++ L   L++I+ T+ LI+      + L+K         I 
Sbjct: 367  PPTRFRLPSKMGEEIHENSQNQL---LSKILTTALLIRDLNDEMSKLQKDKVSVDDRRII 423

Query: 309  INNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGGKTKPIRGFCQRLKGKQGRFRGNLS 368
             + +M  +  +Q  V  +I+S          GSTGG   P+ G  Q L+ K+G FR ++ 
Sbjct: 424  FSRLMNGFVTIQNDVNAFIDSTKAQ------GSTGGNV-PVPGVKQALEKKEGLFRKHMM 476

Query: 369  GKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKAKLQQLVINGPNEHPG 428
            GKRV+++ R+V+SPDPN+  +E+ VP   A  LTYPE VT YN A+L+Q VINGP++ PG
Sbjct: 477  GKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSYNIAELRQAVINGPDKWPG 536

Query: 429  ANYLLKKDEE--ARRNLRYGDRIKLAKNLQ-----------YGDLVERHLEDGDVVLFNR 475
            A  +  +D    +   +    R  LA  L                V RH+++ D+V+ NR
Sbjct: 537  ALQIQNEDGSLVSLIGMTLEQRKALANQLMTPSYVGGATHTLNKKVYRHIKNRDIVIMNR 596

Query: 476  QPSLHRLSILSHFAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLM 534
            QP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ E ARAEA NL 
Sbjct: 597  QPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQNENARAEAFNLA 656

Query: 535  GVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYSRAEFVQLLSMM---SDGNM---Q 588
               +  LTP SG P+    QD I+    ++ KDSF++R ++ Q +       DG+    +
Sbjct: 657  NTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIYGCIRPEDGHATRPK 716

Query: 589  FDIPPPAIMKPYYMWTGKQVFS-LLIRPNKKSSVVINLDAKNKVYIPPKHKHLPNEMSIN 647
                PPA+ KP  +WTGKQ+ + +L+         INL + NK+    K+++       N
Sbjct: 717  LVTVPPAVWKPVPLWTGKQIITTVLLNVTPADMPGINLKSNNKI----KNEYWGKSSEEN 772

Query: 648  DGFVVIRGSQILSGVMDKSVLGDGKKHSVFYTILRDFGPKEAAYAMNRMAKLCARYLGNR 707
            +  V+ +  ++L G++DK+  G   K+ + +++   +GP  AA  ++ + +L   Y+   
Sbjct: 773  E--VLFKNGELLCGILDKNQYG-ASKYGIVHSLHEVYGPDIAAKVLSVLGRLFTNYIMAT 829

Query: 708  GFSIGINDVTPGFE------------LKNKKEVMVEDAYAKCDDLID--QFNKGKLETQP 753
             F+ G++D+    E            +   +E   E    + D   D  +  K   E   
Sbjct: 830  AFTCGMDDLRLTAEGNKWRKDILKTSVDTGREAAAEVTNLEKDTTADDPELLKRLQEVLR 889

Query: 754  GCNEEQTLEAKIGGLLSKVREEVGEVCIKELDN----LNSCLIMANCGSKGSNLNVSQMV 809
              N+   L+A     ++ +  +V   C+ +        NS   MA  G+KGSN+NVSQ++
Sbjct: 890  DNNKSGILDAVTSSKVNAITSKVVSTCVPDGTMKKFPYNSMQAMALSGAKGSNVNVSQIM 949

Query: 810  AVVGQQIISGNRVPDGFQDRSLPHFLKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGRE 869
             ++GQQ + G RVP     ++LP F        + G+V+  F+SG+ P E+ FH ++GRE
Sbjct: 950  CLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMAGGYVKGRFYSGIKPQEYYFHCMAGRE 1009

Query: 870  GLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTIRTSSNGIVQFTYGGDGLDPIDMEGNA 929
            GL+DTAVKT+ +GY+ R L K LE +   YDN++R     ++QF YGGD +D +  E + 
Sbjct: 1010 GLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNSVRDGDGTLIQFLYGGDAVD-VTKESHM 1068

Query: 930  QPVNFTRSWDHANNITFNHSDKPLLPYQIMQQTNSILQPLEEKLVRYDNLGRTLDPSLQD 989
               +F                                      L  YD L +  +PS   
Sbjct: 1069 TKFDFC-------------------------------------LENYDALLKKYNPSA-- 1089

Query: 990  RAEFIDQDDAERNFYKSLR-EYLHTKASH----------LAKIRSHKGLKQFLDEPAPEL 1038
              E +D + A +   KSL+    H K +H          LAK    K L    ++   +L
Sbjct: 1090 LIEHLDVESALKYSKKSLKYRKKHAKEAHYKQSPKYDPVLAKYNPAKYLGSVSEKFQDKL 1149

Query: 1039 QSMDLDEGSPSALLASVDQLCKISSKLVAKFLEIAIFKYHKAKVEPGTAVGAVGAHSIGE 1098
            ++  +D+   S L    D    IS K   KF  +   KY ++ + PG AVG + + S+GE
Sbjct: 1150 ETF-IDKN--SKLFKHNDD---ISEK---KFRALMQLKYMRSLINPGEAVGIIASQSVGE 1200

Query: 1099 PGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTP 1138
            P TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP
Sbjct: 1201 PSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTP 1241

 Score = 53.1 bits (126), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 55/117 (47%), Gaps = 3/117 (2%)

Query: 12  RIKGLEFSALSASDIVGQSKVEISTRDLFDLENGRKPKSGGALDTRMGVSSSQAECSTCH 71
           RI  ++F   SA ++   S  +I+   + D  N   P SGG  D  +G +  +  C++C 
Sbjct: 10  RISSVDFDVFSAKEVRALSVKQITNPTVLD--NLGHPISGGLYDLALG-AFLRNMCASCG 66

Query: 72  GNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKSCAALLLSEEDKRQFLSELR 128
            +   C GH GHI+L +P ++  +F      L+S C  C    L   +   F  +LR
Sbjct: 67  LDEKFCPGHLGHIELPVPCYNPLFFNQLYIYLRSSCLFCYRFRLKALEVHAFAMKLR 123

>NCAS0F00730 Chr6 complement(143500..148524) [5025 bp, 1674 aa] {ON}
            Anc_7.51 YOR341W
          Length = 1674

 Score =  425 bits (1092), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 293/882 (33%), Positives = 451/882 (51%), Gaps = 107/882 (12%)

Query: 304  EKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGGKTKPIRGFCQRLKGKQGRF 363
            ++ I  + +M  +  +Q  V  +I+S          G+ GGK  PI G  Q L+ K+G F
Sbjct: 423  DRRIIFSRLMNAFVTIQNDVNAFIDSTKAQ------GTAGGKL-PIPGVKQALEKKEGLF 475

Query: 364  RGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKAKLQQLVINGP 423
            R ++ GKRV+++ R+V+SPDPN+  +E+ VP   A  LTYPE VT YN A+L+Q VINGP
Sbjct: 476  RKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSYNIAELRQAVINGP 535

Query: 424  NEHPGANYLLKKD----------EEARRNLRYGDRIKLAKNLQYGDL---VERHLEDGDV 470
            ++ PGA  +  +D           E R+ L     +  + N+    L   V RH+++ D+
Sbjct: 536  DKWPGATQIQNEDGSLVSLIGMSTEQRKALA-NQLMTPSSNITTHTLNKKVYRHIKNRDI 594

Query: 471  VLFNRQPSLHRLSILSHFAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAE 529
            V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ E ARAE
Sbjct: 595  VIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQNENARAE 654

Query: 530  AINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYSRAEFVQLLSMM---SDGN 586
            A NL    +  LTP SG P+    QD I+    ++ KDSF++R ++ Q +       DG+
Sbjct: 655  ASNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIYGCIRPEDGH 714

Query: 587  M---QFDIPPPAIMKPYYMWTGKQVFS-LLIRPNKKSSVVINLDAKNKVYIPPKHKHLPN 642
                +    PP I KP  +WTGKQ+ S +L+     +   INL + NK+    K+++   
Sbjct: 715  ATRSKLITMPPTIHKPVPLWTGKQIISTVLLNITPANMPGINLKSSNKI----KNEYWGT 770

Query: 643  EMSINDGFVVIRGSQILSGVMDKSVLGDGKKHSVFYTILRDFGPKEAAYAMNRMAKLCAR 702
                N+  V+ +  ++L G++DKS  G   K  + +++   +GP  AA  ++ + +L   
Sbjct: 771  GSQENE--VLFKNGELLCGILDKSQYG-ASKFGIVHSLHEVYGPSVAAKVLSVLGRLFTN 827

Query: 703  YLGNRGFSIGIND------------------VTPGFELKNKKEVMVEDAYAKCDDLIDQF 744
            Y+ +  F+ G++D                  V  G E   +   + +D  A   +L+ + 
Sbjct: 828  YIMSTAFTCGMDDLRLTEEGNKWRSDILKTSVDTGREAAAEVTNLDKDTPANDPELLKRL 887

Query: 745  NKGKLETQPGCNEEQTLEAKIGGLLSKVREE-VGEVCIKELDNLNSCLIMANCGSKGSNL 803
             +   +       +    +K+  + SKV  + V +  +K+    NS   MA  G+KGSN+
Sbjct: 888  QEILRDNNKSGILDAVTSSKVNSITSKVVSKCVPDGTMKKFP-YNSMQAMALSGAKGSNV 946

Query: 804  NVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSKTPQSKGFVRNSFFSGLSPPEFLFH 863
            NVSQ++ ++GQQ + G RVP     ++LP F        + G+V+  F+SG+ P E+ FH
Sbjct: 947  NVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMAGGYVKGRFYSGIKPQEYYFH 1006

Query: 864  AISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTIRTSSNGIVQFTYGGDGLDPI 923
             ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN++R +   ++QF YGGD +D +
Sbjct: 1007 CMAGREGLIDTAVKTSRSGYLQRCLTKQLEGIHISYDNSVRDTDGTLIQFLYGGDAVD-V 1065

Query: 924  DMEGNAQPVNFTRSWDHANNITFNHSDKPLLPYQIMQQTNSILQPLEEKLVRYDNLGRTL 983
              E +    +F                                      L  YD L    
Sbjct: 1066 TKESHMTEFDFC-------------------------------------LDNYDALLNKY 1088

Query: 984  DPSLQDRAEFIDQDDAERNFYKSLREY-LHTKASHLAK-IRSHKGLKQFLDEPAPELQSM 1041
            +PS     E +D + A +   KSL+    H K  H  + I+    L +F   PA  L S 
Sbjct: 1089 NPSA--LIEHLDVESALKYSKKSLKNRKKHIKEPHYKQNIKYDPVLSKF--NPAKYLGS- 1143

Query: 1042 DLDEGSPSALLASVDQLCKI----SSKLVAKFLEIAIFKYHKAKVEPGTAVGAVGAHSIG 1097
             + E     L   +D+  K+     S    KF  +   KY ++ + PG AVG + + S+G
Sbjct: 1144 -VSEKFQDKLEGYLDKNSKLFKSHDSVNEKKFRALMQLKYMRSLINPGEAVGIIASQSVG 1202

Query: 1098 EPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTP 1138
            EP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP
Sbjct: 1203 EPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTP 1244

 Score = 51.2 bits (121), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 55/116 (47%), Gaps = 3/116 (2%)

Query: 13  IKGLEFSALSASDIVGQSKVEISTRDLFDLENGRKPKSGGALDTRMGVSSSQAECSTCHG 72
           I  ++F  L++ +I   S  +I+   + D  N   P +GG  D  +G       CSTC  
Sbjct: 11  ITSVDFGILTSDEIRQLSAKQITNPTVLD--NLGHPITGGLYDLSLGAFLRNL-CSTCGL 67

Query: 73  NLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKSCAALLLSEEDKRQFLSELR 128
           +   C GH GHI+L +P ++  +F      L++ C  C    L   +  +F S+LR
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRTSCLFCHHFRLRSIEVHRFASKLR 123

>Kpol_1040.3 s1040 complement(6642..11612) [4971 bp, 1656 aa] {ON}
            complement(6642..11612) [4971 nt, 1657 aa]
          Length = 1656

 Score =  423 bits (1087), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 303/957 (31%), Positives = 479/957 (50%), Gaps = 141/957 (14%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK------AGLE 304
            + +T+    +  PP   R PS +  +   + ++ L   L++I+ TS LI+      + L+
Sbjct: 346  KADTFFMEVVLVPPTRFRLPSKLGDEVHENTQNQL---LSKILTTSLLIRDLNDEMSKLQ 402

Query: 305  KG--------ISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGGKTKPIRGFCQRL 356
            K         +  + +M  +  +Q  V  +I+S          G+TGGK  PI G  Q L
Sbjct: 403  KDKVSLQDRRVIFSRLMNAFVTIQNDVNAFIDSTKAQ------GNTGGKV-PIPGVKQAL 455

Query: 357  KGKQGRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKAKLQ 416
            + K+G FR ++ GKRV+++ R+V+SPDPN+  +E+ VP   A  LTYPE VT YN A+L+
Sbjct: 456  EKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSYNIAELR 515

Query: 417  QLVINGPNEHPGANYLLKKDE----------EARRNLRYGDRIKLAKNLQYGDL---VER 463
            Q VINGP++ PGA+ +  +D           E R+ L     +  + N+    L   V R
Sbjct: 516  QAVINGPDKWPGASQIQNEDGSLVSLIGMTLEQRKALA-NQLMTPSSNIATHTLNKKVYR 574

Query: 464  HLEDGDVVLFNRQPSLHRLSILSHFAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQ 522
            H+++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ
Sbjct: 575  HIKNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQ 634

Query: 523  TEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYSRAEFVQLL--- 579
             E ARAEA NL    +  LTP SG P+    QD I+    ++ KDSF++R ++ Q +   
Sbjct: 635  NENARAEAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIYGC 694

Query: 580  ---SMMSDGNMQFDIPPPAIMKPYYMWTGKQVFS-LLIRPNKKSSVVINLDAKNKVYIPP 635
                       +    PPA+ KP  +WTGKQ+ + +L+         INL++ NK+    
Sbjct: 695  IRPEHGHTTRSKIVTVPPAVFKPVPLWTGKQIITTVLLNVTPSDMPGINLNSSNKI---- 750

Query: 636  KHKHLPNEMSINDGFVVIRGSQILSGVMDKSVLGDGKKHSVFYTILRDFGPKEAAYAMNR 695
            K+++  N  + ND  V+ +  ++L G++DKS  G   K+ + +++   +GP  AA  ++ 
Sbjct: 751  KNEYWGNGSTEND--VIFKNGELLCGILDKSQYG-ASKYGIVHSLHEVYGPDVAAKVLSV 807

Query: 696  MAKLCARYLGNRGFSIGINDV----------------------TPGFELKN-KKEVMVED 732
            + +L   Y+    F+ G++D+                          E+ N +KE   +D
Sbjct: 808  LGRLFTNYITATAFTCGMDDLRLTDEGNKWRKDILKTSVDTGRQAACEVTNLEKETASDD 867

Query: 733  A--YAKCDDLIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREE-VGEVCIKELDNLNS 789
            +    + ++++   NK  +        +    +K+  + SKV  + V +  +K+    NS
Sbjct: 868  SELLKRLEEILRDDNKSGIL-------DAVTSSKVNSITSKVVSKCVPDGTMKKFP-YNS 919

Query: 790  CLIMANCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSKTPQSKGFVRN 849
               MA  G+KGSN+NVSQ++ ++GQQ + G RVP     ++LP F        + G+++ 
Sbjct: 920  MQAMALSGAKGSNVNVSQIMCLLGQQALEGRRVPTMVSGKTLPSFKPFETDAMAGGYIKG 979

Query: 850  SFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTIRTSSNG 909
             F+SG+ P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN++R     
Sbjct: 980  RFYSGIKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNSVRDGDGT 1039

Query: 910  IVQFTYGGDGLDPIDMEGNAQPVNFTRSWDHANNITFNHSDKPLLPYQIMQQTNSILQPL 969
            ++QF YGGD             V+ T+                           S L   
Sbjct: 1040 LIQFLYGGDS------------VDVTKE--------------------------SHLTQF 1061

Query: 970  EEKLVRYDNLGRTLDPSLQDRAEFIDQDDAERNFYKSLREYL----HTKASHLAK-IRSH 1024
            E  L  YD+L +  +PS       I+  D E     S +       + K  H  + I+  
Sbjct: 1062 EFCLENYDSLLKKYNPS-----ALIEHLDVETALKYSKKASKSRKKNRKVPHYEQNIKYD 1116

Query: 1025 KGLKQFLDEPAPELQSMDLDEGSPSALLASVDQLCKISSKLV--AKFLEIAIFKYHKAKV 1082
              L +F   PA  L ++         L    +     S K V   KF  +   KY ++ +
Sbjct: 1117 PALAKF--NPAKYLGAVSEKFQDKLELFLDSNASLFESDKSVNEKKFRALMQLKYMRSLI 1174

Query: 1083 EPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTP 1138
             PG +VG + + S+GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP
Sbjct: 1175 NPGESVGIIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTP 1231

 Score = 52.8 bits (125), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 55/116 (47%), Gaps = 3/116 (2%)

Query: 13  IKGLEFSALSASDIVGQSKVEISTRDLFDLENGRKPKSGGALDTRMGVSSSQAECSTCHG 72
           I  ++FS L+A +I   S  +I+   + D  N   P SGG  D  +G       CSTC  
Sbjct: 11  ITSIDFSILTAQEIRNLSAKQITNPTVLD--NLGHPISGGLYDLALGAFLRNL-CSTCGL 67

Query: 73  NLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKSCAALLLSEEDKRQFLSELR 128
           +   C GH GHI+L +P ++  +F      L+S C  C    L   +  ++  +L+
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRSSCLFCHHFRLRSIEVHRYTCKLK 123

>TBLA0E01930 Chr5 (468692..473671) [4980 bp, 1659 aa] {ON} Anc_7.51
            YOR341W
          Length = 1659

 Score =  414 bits (1063), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 297/962 (30%), Positives = 480/962 (49%), Gaps = 145/962 (15%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLI----------- 299
            +P+ +    +  PP   R PS +  +   + ++ L   L++I+ TS LI           
Sbjct: 353  KPDAFFMDVIVVPPTRFRLPSKLGDEVHENTQNQL---LSKILTTSLLIRDLNDEMSKLQ 409

Query: 300  --KAGLE-KGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGGKTKPIRGFCQRL 356
              K  LE + +  + +M  +  +Q  V  +I+S          G+TGG    I G  Q L
Sbjct: 410  KDKVSLEDRRVIFSRLMNAFVTIQNDVNSFIDSSKAQ------GNTGG-NDVIPGVKQAL 462

Query: 357  KGKQGRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKAKLQ 416
            + K+G FR ++ GKRV+++ R+V+SPDPN+  +E+ VP   A  LTYPE VT YN A+L+
Sbjct: 463  EKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFAVKLTYPEPVTSYNIAELR 522

Query: 417  QLVINGPNEHPGANYLLKKDEE--ARRNLRYGDRIKLAKNLQ----------YGDLVERH 464
            Q VINGP++ PGA  +  +D    +   +    R  LA  L               V RH
Sbjct: 523  QAVINGPDKWPGAIQIQNEDGTLVSLIGMTLEQRKALANQLMTPSSNSSSHVLNKKVYRH 582

Query: 465  LEDGDVVLFNRQPSLHRLSILSHFAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQT 523
            +++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ 
Sbjct: 583  IKNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQN 642

Query: 524  EEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYSRAEFVQLLSMM- 582
            E ARAE++ L    +  LTP SG P+    QD I+    +++KDSF++R ++ Q +    
Sbjct: 643  ENARAESLFLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTNKDSFFTREQYQQYIYGCI 702

Query: 583  --SDGN---MQFDIPPPAIMKPYYMWTGKQVF-SLLIRPNKKSSVVINLDAKNKVYIPPK 636
               DG+    +    PP I KP  +WTGKQ+  ++L+         INL +KNK+    K
Sbjct: 703  RPEDGHATRAKIVTLPPTIFKPIPLWTGKQIITTVLLNITPSDMPGINLHSKNKI----K 758

Query: 637  HKHLPNEMSINDGFVVIRGSQILSGVMDKSVLGDGKKHSVFYTILRDFGPKEAAYAMNRM 696
            +++       N+  V+ +   +L G++DK+  G   K+ + +++   +GP  AA  ++ +
Sbjct: 759  NEYWGK--GSNENEVIFKDGALLCGILDKNQYG-SSKYGIVHSLHELYGPDVAAKVLSVL 815

Query: 697  AKLCARYLGNRGFSIGIND------------------VTPGFELKNKKEVMVEDAYAKCD 738
             +L   Y+    F+ G++D                  V  G +   +   + +D  A   
Sbjct: 816  GRLFTNYITATAFTCGMDDLRLTDEGNKWRRDILKTSVDTGRQAAAEVTNLSKDTPADDP 875

Query: 739  DLIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVCI-----KELDNLNSCLIM 793
            +L+ +      E     N+   L+A     ++ +  +V   C+     K+    NS   M
Sbjct: 876  ELLKRLE----EILRDDNKSGILDAVTSSKVNAITSKVVSTCVPGGTMKKFP-YNSMQAM 930

Query: 794  ANCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSKTPQSKGFVRNSFFS 853
            A  G+KGSN+NVSQ++ ++GQQ + G RVP     ++LP F        + G+++  F+S
Sbjct: 931  ALSGAKGSNVNVSQIMCLLGQQALEGRRVPTMVSGKTLPSFKPYETDAMAGGYIKGRFYS 990

Query: 854  GLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTIRTSSNGIVQF 913
            G+ P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDNT+R     +++F
Sbjct: 991  GIKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNTVRDGDGTLIEF 1050

Query: 914  TYGGDGLDPI-------------DMEGNAQPVNFTRSWDHANNITFNHSDKPLLPYQIMQ 960
             YGGD +D               + +G  +  N +   +H N  +     K  L Y+  +
Sbjct: 1051 LYGGDAVDVTKESYMTQFKFCLENYDGLVKKYNPSALIEHLNVESALKYSKKALKYR--K 1108

Query: 961  QTNSILQPLEEKLVRYDNLGRTLDPSLQDRAEFIDQDDAERNFYKSLREYLHTKASHLAK 1020
            + +S+   L+    +YD +    +PS                +  S+ E    K      
Sbjct: 1109 KHSSVPHYLQNS--KYDPVLAKYNPS---------------KYLGSVSEKFQDK------ 1145

Query: 1021 IRSHKGLKQFLDEPAPELQSMDLDEGSPSALLASVDQLCKISSKLVAKFLEIAIFKYHKA 1080
                  L++FL+E +  ++S    EG              ++ K   KF  +   KY ++
Sbjct: 1146 ------LEEFLNENSKLVKST---EG--------------VNEK---KFRALMQLKYMRS 1179

Query: 1081 KVEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPI 1139
             ++PG +VG + + S+GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP 
Sbjct: 1180 LIDPGESVGIIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASSSIKTPQ 1239

Query: 1140 IN 1141
            +N
Sbjct: 1240 MN 1241

 Score = 51.6 bits (122), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 52/116 (44%), Gaps = 3/116 (2%)

Query: 13  IKGLEFSALSASDIVGQSKVEISTRDLFDLENGRKPKSGGALDTRMGVSSSQAECSTCHG 72
           I  ++F  LS+  I   S  +I+   + D  N   P SGG  D  +G       CSTC  
Sbjct: 11  ITSVDFEILSSDQIRNLSAKQITNPTVLD--NLGHPISGGLYDLALGAFLRNL-CSTCGQ 67

Query: 73  NLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKSCAALLLSEEDKRQFLSELR 128
           +   C GH GHI+L +P ++  +F      L+S C  C    L   D   +  +L+
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLFIYLRSSCLYCHHFRLKSLDTHLYSCKLK 123

>SAKL0B10736g Chr2 (925889..930841) [4953 bp, 1650 aa] {ON} highly
            similar to uniprot|P10964 Saccharomyces cerevisiae
            YOR341W RPA190 RNA polymerase I subunit largest subunit
            of RNA polymerase I
          Length = 1650

 Score =  409 bits (1051), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 303/947 (31%), Positives = 477/947 (50%), Gaps = 121/947 (12%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK------AGLE 304
            + + +    +  PP   R PS +  +   + ++ L   L++I+ TS LI+      + L+
Sbjct: 340  KADMFFMEVVVVPPTRFRLPSKLGDEVHENTQNQL---LSKILTTSLLIRDLNDEMSKLQ 396

Query: 305  KG--------ISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGGKTKPIRGFCQRL 356
            K         +  N +M  +  +Q  V  +I+           G+TGGK  PI G  Q L
Sbjct: 397  KDKVSVDDRKVIFNRLMNAFVTIQNDVNAFIDVTKAQ------GNTGGKV-PIPGVKQAL 449

Query: 357  KGKQGRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKAKLQ 416
            + K+G FR ++ GKRV+++ R+V+SPDPN+  +E+ VP   A  LTYPE VT YN A+L+
Sbjct: 450  EKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTAYNIAELR 509

Query: 417  QLVINGPNEHPGANYLLKKDEE--ARRNLRYGDRIKLAKNLQ----------YGDLVERH 464
            Q VINGP++ PGA  +  +D    +   +    R  LA  L               V RH
Sbjct: 510  QAVINGPDKWPGATQIQNEDGSLVSLIGMTLEQRKALANQLMTPSTHNSTHILNKKVYRH 569

Query: 465  LEDGDVVLFNRQPSLHRLSILSHFAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQT 523
            +++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ 
Sbjct: 570  IKNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQN 629

Query: 524  EEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYSRAEFVQLLSMM- 582
            E ARAEA NL    +  LTP SG P+    QD I+    ++ KDSF++R ++ Q +    
Sbjct: 630  ENARAEAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIYGCI 689

Query: 583  --SDGNM---QFDIPPPAIMKPYYMWTGKQVFS-LLIRPNKKSSVVINLDAKNKVYIPPK 636
               DG+    +    PPA++KP  +WTGKQ+ + +L+         INL +KNK+    K
Sbjct: 690  RPEDGHATRNKIVTVPPAVVKPVPLWTGKQIITTVLLNSTPPEMPGINLISKNKI----K 745

Query: 637  HKHLPNEMSINDGFVVIRGSQILSGVMDKSVLGDGKKHSVFYTILRDFGPKEAAYAMNRM 696
            +++       N+  V+ +  ++L G++DKS  G   K  + +++   +GP  A   ++ +
Sbjct: 746  NEYWGE--GSNESEVIFKNGELLCGILDKSQYG-ASKFGIVHSLHEVYGPDIAGKVLSVL 802

Query: 697  AKLCARYLGNRGFSIGINDVTPGFE--------LKNK--------KEVMVEDAYAKCDDL 740
             +L   Y+    F+ G++D+    E        LK           EV   +   K DD 
Sbjct: 803  GRLFTNYITATAFTCGMDDLRLTEEGNKWRTEILKTSVDIGRAAAAEVTNLEGDVKADD- 861

Query: 741  IDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVCIKELDN----LNSCLIMANC 796
              +  K   E     N+   L+A     ++ +  +V   C+ +        NS   MA  
Sbjct: 862  -PELLKRLEEILRDDNKLGILDAVTSSKVNVITSQVVSKCVPDGTMKKFPYNSMQAMALS 920

Query: 797  GSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSKTPQSKGFVRNSFFSGLS 856
            G+KGSN+NVSQ++ ++GQQ + G RVP     ++LP F       ++ G+++  F+SG+ 
Sbjct: 921  GAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPFETDARAGGYIKGRFYSGIR 980

Query: 857  PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTIRTSSNGIVQFTYG 916
            P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDNT+R     ++QF YG
Sbjct: 981  PQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNTVRDGDGTLIQFLYG 1040

Query: 917  GDGLDPIDMEGNAQPVNFTRSWDHANNITFNHSDKPLLPYQIMQQTNSILQPLE-EKLVR 975
            GD +D +  E +     F            ++ D  L  Y      +++++ L+ E  ++
Sbjct: 1041 GDAVD-VTKESHMTEFKF----------CVDNYDALLKKY----NPSALIEHLDVESALK 1085

Query: 976  YDNLG---RTLDPSLQDRAEFIDQDDAERNFYKSLREYLHTKASHLAKIRSHKGLKQFLD 1032
            Y       R  +  +   A  I  D     +  S  +YL + + +         L++F+D
Sbjct: 1086 YSKKAMKNRKKNEKIPHYAHNIKYDPVLSKYNPS--KYLGSVSENF-----QDKLEKFID 1138

Query: 1033 EPAPELQSMDLDEGSPSALLASVDQLCKISSKLVAKFLEIAIFKYHKAKVEPGTAVGAVG 1092
                          S S LL S D + +       KF  +   KY ++ + PG AVG + 
Sbjct: 1139 --------------SNSKLLKSKDNVNE------KKFRALMQLKYMRSLINPGEAVGIIA 1178

Query: 1093 AHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTP 1138
            + S+GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP
Sbjct: 1179 SQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTP 1225

 Score = 52.0 bits (123), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 55/116 (47%), Gaps = 3/116 (2%)

Query: 13  IKGLEFSALSASDIVGQSKVEISTRDLFDLENGRKPKSGGALDTRMGVSSSQAECSTCHG 72
           I  ++FS L+A +I   S  +I+   + D  N   P SGG  D  +G       C+TC  
Sbjct: 11  IISVDFSVLTAQEIRKLSAKQITNPTVLD--NLGHPISGGLYDLSLGAFLRNL-CATCGL 67

Query: 73  NLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKSCAALLLSEEDKRQFLSELR 128
           +   C GH GHI+L +P ++  +F      L+S C  C    L   +  ++  +L+
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRSSCLYCHHFRLKTSEVHRYACKLK 123

>ADR374C Chr4 complement(1372609..1377531) [4923 bp, 1640 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YOR341W
            (RPA190)
          Length = 1640

 Score =  407 bits (1047), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 302/944 (31%), Positives = 476/944 (50%), Gaps = 115/944 (12%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLI----------- 299
            + + +    +  PP   R PS +  +   + ++ L   L++I+ TS LI           
Sbjct: 331  KADMFFMEVIVVPPTRFRLPSKLGDEVHENTQNQL---LSKILTTSLLIRDLNEEMSKLQ 387

Query: 300  --KAGLE-KGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGGKTKPIRGFCQRL 356
              K  LE + I  N +M  +  +Q  V  +I+S          GSTGGK  PI G  Q L
Sbjct: 388  KDKVSLEDRKIIFNRLMNAFVTIQNDVNAFIDSTKAQ------GSTGGKV-PIPGVKQAL 440

Query: 357  KGKQGRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKAKLQ 416
            + K+G FR ++ GKRV+++ R+V+SPDPN+  +E+ VP   A  LTYPE VT YN A+++
Sbjct: 441  EKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTAYNIAEMR 500

Query: 417  QLVINGPNEHPGANYLLKKDEE--ARRNLRYGDRIKLAKNLQ----YGDL------VERH 464
            Q VINGP++ PGA  +  +D    +   +    R  LA  L     +G        V RH
Sbjct: 501  QAVINGPDKWPGATQIQNEDGSLVSLVGMTSDQRKALANQLMTPSTHGSTHTLNKKVYRH 560

Query: 465  LEDGDVVLFNRQPSLHRLSILSHFAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQT 523
            +++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ 
Sbjct: 561  IKNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQN 620

Query: 524  EEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYSRAEFVQLLSMM- 582
            E AR+EA  L    +  LTP SG P+    QD I+    +++KDSF++R ++ Q +    
Sbjct: 621  ENARSEAFTLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTNKDSFFTREQYQQYIYGCI 680

Query: 583  --SDGNM---QFDIPPPAIMKPYYMWTGKQVFS-LLIRPNKKSSVVINLDAKNKVYIPPK 636
               DG+    +    PPA++KP  +WTGKQ+ + +L+         INL +KNK+    K
Sbjct: 681  RPEDGHASRSKIITVPPAVVKPVPLWTGKQIITTVLLNATPADIPGINLVSKNKI----K 736

Query: 637  HKHLPNEMSINDGFVVIRGSQILSGVMDKSVLGDGKKHSVFYTILRDFGPKEAAYAMNRM 696
            +++       N+  V+ +   +L G++DKS  G   K+ + +++   +GP  ++  ++ +
Sbjct: 737  NEYWGKSSYENE--VIFKNGALLCGILDKSQYG-ASKYGIVHSLHELYGPDVSSKVLSIL 793

Query: 697  AKLCARYLGNRGFSIGINDVTPG-------FELKNKKEVMVEDAYAKCDDLIDQFNKGKL 749
             +L   Y+ +  F+ G++D+           ++  K   +   A A+  +L         
Sbjct: 794  GRLFTNYITSTAFTCGMDDLRLTDEGNKWRIDILKKSTDIGRAAAAEVTNLGGDVRPDDA 853

Query: 750  ETQPGCNEEQTLEAKIGGL----LSKVREEVGEVCIKELDN-------LNSCLIMANCGS 798
            E      E    + K+G L     SKV     EV  K + +        NS   MA  G+
Sbjct: 854  ELLKRLEEILRDDNKLGILDAVTSSKVNTITSEVVSKCVPDGTMKKFPYNSMQAMALSGA 913

Query: 799  KGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSKTPQSKGFVRNSFFSGLSPP 858
            KGSN+NVSQ++ ++GQQ + G RVP     ++LP F       ++ G+++  F+SG+ P 
Sbjct: 914  KGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPFETDAKAGGYIKGRFYSGIKPQ 973

Query: 859  EFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTIRTSSNGIVQFTYGGD 918
            E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDNT+R     +VQF YGGD
Sbjct: 974  EYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNTVRDGDGTLVQFLYGGD 1033

Query: 919  GLDPIDMEGNAQPVNFTRSWDHANNITFNHSDKPLLPYQIMQQTNSILQPLEEKLVRYDN 978
                ID+   +    F    D+ + +   ++     P  ++Q  + +   L+       N
Sbjct: 1034 A---IDVTKESHMSEFKFCVDNYDALLKRYN-----PSALIQHLD-VESALKYSKKAMKN 1084

Query: 979  LGRTLDPSLQDRAEFIDQDDAERN---FYKSLREYLHTKASHLAKIRSHKGLKQFLDEPA 1035
              + L+     R +  D   ++ N   F  S+ E    K            L+ F+D  A
Sbjct: 1085 RKKNLNLPHYARHDKYDPVLSKYNPSKFLGSVSENFQDK------------LESFIDSNA 1132

Query: 1036 PELQSMDLDEGSPSALLASVDQLCKISSKLVAKFLEIAIFKYHKAKVEPGTAVGAVGAHS 1095
               +             A+V++          KF  +   KY ++ + PG AVG + + S
Sbjct: 1133 SLFKGQ-----------ATVNE---------KKFRALMQLKYMRSLINPGEAVGIIASQS 1172

Query: 1096 IGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTP 1138
            +GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP
Sbjct: 1173 VGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTP 1216

 Score = 48.5 bits (114), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/116 (27%), Positives = 54/116 (46%), Gaps = 3/116 (2%)

Query: 13  IKGLEFSALSASDIVGQSKVEISTRDLFDLENGRKPKSGGALDTRMGVSSSQAECSTCHG 72
           I  ++FS +SA++I   S  +I+   + D  +   P  GG  D  +G       C+TC  
Sbjct: 11  ISSVDFSVMSAAEIRALSVKQITNPTVLD--HLGHPIRGGLYDLSLGAFLRNL-CATCGL 67

Query: 73  NLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKSCAALLLSEEDKRQFLSELR 128
           +   C GH GHI+L +P +   +F      L+S C  C    L   +  ++  +L+
Sbjct: 68  DEKFCSGHQGHIELPVPCYSPLFFNQLYIYLRSSCLYCHHFRLKAVEVHRYACKLK 123

>Kpol_1019.27 s1019 complement(51067..52161) [1095 bp, 364 aa] {ON}
           complement(51067..52161) [1095 nt, 365 aa]
          Length = 364

 Score = 79.0 bits (193), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 86/289 (29%), Positives = 127/289 (43%), Gaps = 31/289 (10%)

Query: 9   APKR-IKGLEFSALSASDIVGQSKVEISTRDLFDLENGRKPKSGGALDTRMGVSSSQAEC 67
           AP R IK ++F   S  ++   S  +I   +  D E   + K GG  D R+G      +C
Sbjct: 9   APVRTIKEVQFGLFSPEEVRAISVAKIRFPETMD-ETQTRAKIGGLNDPRLGSIDRNVKC 67

Query: 68  STCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKSCAALLLSEEDKRQFLS-E 126
            TC   +  C GHFGHI L+ PVFH+G+     +V + +C  C  LLL E +++   + +
Sbjct: 68  QTCQEGMNECPGHFGHIDLAKPVFHIGFISKIKKVCECVCMHCGKLLLDEHNEQMNQAIK 127

Query: 127 LRRPGIDNLRRMGILKKVVDQCKKQRRCLRCGSLNXXXXXXXXXXXXXXLKILHDTFRWV 186
           ++ P     +R      V   CK +   + C +                      T R  
Sbjct: 128 IKDPK----KR---FNAVWTLCKTK---MICETDVPSEDDPTKLVSRGGCGNAQPTIRKD 177

Query: 187 GKKSAPEKDKWVGDWKTVLSHN--PELERYVKKCMDDLNPLKTLNLFKQVSPEDCELMGI 244
           G K        VG WK   + N   E E+ V      L+  + LN+FK +S ED   +G 
Sbjct: 178 GLK-------LVGSWKKDKNTNDGDEPEQRV------LSTEEILNIFKHISSEDYIRLGF 224

Query: 245 DSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIV 293
           +      RPE  +   LP PP  +RPS+   +S    EDDLT KL +I+
Sbjct: 225 NEEF--ARPEWMLLTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADIL 270

>TBLA0B02340 Chr2 complement(545918..548128) [2211 bp, 736 aa] {ON}
            Anc_3.101 YOL095C
          Length = 736

 Score = 42.0 bits (97), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 30/80 (37%), Positives = 47/80 (58%), Gaps = 7/80 (8%)

Query: 990  RAEFIDQDDAE-RNFYKSLREYL--HTKASHLAKIRSHKGLKQFLDEPAPELQSMD-LDE 1045
            R+ FI++  AE + F  S+  Y+   TK+  L KI +HK +KQF+DE +P + + + L E
Sbjct: 457  RSTFINKLYAECKEFNCSIWNYITSETKSKRLTKITTHKTVKQFIDELSPYINNKEYLYE 516

Query: 1046 GSPSALLASVDQLCKISSKL 1065
             +P  LL +V   C I+  L
Sbjct: 517  DNPIKLLKNV---CDIAFNL 533

>NCAS0A14200 Chr1 complement(2795611..2796354) [744 bp, 247 aa] {ON}
            Anc_7.362 YDL173W
          Length = 247

 Score = 35.4 bits (80), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 30/74 (40%), Positives = 37/74 (50%), Gaps = 5/74 (6%)

Query: 932  VNFTRSWDHANNITFNHSD-KPLLPYQIMQQTNSILQPL-EEKLVRYDNLGRTLDPSLQD 989
            V F R    A NI  +HS  KP L  Q   QT SI+QP+         NL R +DP L  
Sbjct: 34   VTFGRGG--AGNIITSHSKPKPKLIKQ-GSQTPSIIQPVYSTGRGGAGNLKRNIDPKLTR 90

Query: 990  RAEFIDQDDAERNF 1003
            RA+ +D  DAE + 
Sbjct: 91   RAQDVDDTDAESDI 104

>YOR236W Chr15 (780906..781541) [636 bp, 211 aa] {ON}
           DFR1Dihydrofolate reductase involved in tetrahydrofolate
           biosynthesis; required for respiratory metabolism
          Length = 211

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 49/105 (46%), Gaps = 25/105 (23%)

Query: 599 PYYMWTGKQVFSLLIRPNKKSSVVINLDAKNKVYIPPKHKHLPNEM------SINDGFV- 651
           P  M   +QV SL   PNKK++++  +  K    IPPK + LPN M      S  D FV 
Sbjct: 32  PSEMKYFRQVTSLTKDPNKKNALI--MGRKTWESIPPKFRPLPNRMNVIISRSFKDDFVH 89

Query: 652 -----VIRGSQILSGVMDKS-----------VLGDGKKHSVFYTI 680
                +++ + + + +M+             V+G G+ +S  ++I
Sbjct: 90  DKERSIVQSNSLANAIMNLESNFKEHLERIYVIGGGEVYSQIFSI 134

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.398 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 121,650,541
Number of extensions: 5408460
Number of successful extensions: 14738
Number of sequences better than 10.0: 74
Number of HSP's gapped: 14800
Number of HSP's successfully gapped: 155
Length of query: 1148
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1027
Effective length of database: 39,606,813
Effective search space: 40676196951
Effective search space used: 40676196951
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 71 (32.0 bits)