Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_55.214445.430ON64463324680.0
KLTH0F16148g5.430ON64663519530.0
SAKL0G02442g5.430ON62347315230.0
Kpol_1016.85.430ON63760614940.0
TPHA0H017805.430ON62260314010.0
KLLA0E21165g5.430ON62747213860.0
KAFR0E039105.430ON62548013750.0
NDAI0B056405.430ON66946813710.0
NCAS0F033505.430ON63947813610.0
Suva_2.5385.430ON62948013531e-180
Smik_4.6325.430ON62748213391e-177
AER259W5.430ON61946913311e-176
YDR365C (ESF1)5.430ON62847512971e-171
TBLA0A065405.430ON65948712871e-169
ZYRO0F09944g5.430ON61145112541e-165
CAGL0L11638g5.430ON60846412521e-165
KNAG0C049405.430ON64248512251e-160
Skud_4.6355.430ON62947112201e-160
TDEL0E019505.430ON61748012171e-159
Ecym_47905.430ON63028210321e-131
TDEL0E025605.372ON46986716.0
NDAI0C012205.500ON150996717.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_55.21444
         (644 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_55.21444 s55 (839767..841701) [1935 bp, 644 aa] {ON} YDR365...   955   0.0  
KLTH0F16148g Chr6 (1310041..1311981) [1941 bp, 646 aa] {ON} simi...   756   0.0  
SAKL0G02442g Chr7 complement(201924..203795) [1872 bp, 623 aa] {...   591   0.0  
Kpol_1016.8 s1016 (16620..18533) [1914 bp, 637 aa] {ON} (16620.....   580   0.0  
TPHA0H01780 Chr8 complement(409713..411581) [1869 bp, 622 aa] {O...   544   0.0  
KLLA0E21165g Chr5 (1890314..1892197) [1884 bp, 627 aa] {ON} simi...   538   0.0  
KAFR0E03910 Chr5 complement(773170..775047) [1878 bp, 625 aa] {O...   534   0.0  
NDAI0B05640 Chr2 complement(1377917..1379926) [2010 bp, 669 aa] ...   532   0.0  
NCAS0F03350 Chr6 complement(677168..679087) [1920 bp, 639 aa] {O...   528   0.0  
Suva_2.538 Chr2 complement(960917..962806) [1890 bp, 629 aa] {ON...   525   e-180
Smik_4.632 Chr4 complement(1130422..1132305) [1884 bp, 627 aa] {...   520   e-177
AER259W Chr5 (1113896..1115755) [1860 bp, 619 aa] {ON} Syntenic ...   517   e-176
YDR365C Chr4 complement(1204497..1206383) [1887 bp, 628 aa] {ON}...   504   e-171
TBLA0A06540 Chr1 (1602559..1604538) [1980 bp, 659 aa] {ON} Anc_5...   500   e-169
ZYRO0F09944g Chr6 complement(807207..809042) [1836 bp, 611 aa] {...   487   e-165
CAGL0L11638g Chr12 (1243194..1245020) [1827 bp, 608 aa] {ON} sim...   486   e-165
KNAG0C04940 Chr3 (953539..955467) [1929 bp, 642 aa] {ON} Anc_5.4...   476   e-160
Skud_4.635 Chr4 complement(1133271..1135160) [1890 bp, 629 aa] {...   474   e-160
TDEL0E01950 Chr5 (367743..369596) [1854 bp, 617 aa] {ON} Anc_5.4...   473   e-159
Ecym_4790 Chr4 complement(1534067..1535959) [1893 bp, 630 aa] {O...   402   e-131
TDEL0E02560 Chr5 (493910..495319) [1410 bp, 469 aa] {ON} Anc_5.3...    32   6.0  
NDAI0C01220 Chr3 (246762..251291) [4530 bp, 1509 aa] {ON} Anc_5....    32   7.1  

>Kwal_55.21444 s55 (839767..841701) [1935 bp, 644 aa] {ON} YDR365C -
           Protein required for cell viability [contig 130] FULL
          Length = 644

 Score =  955 bits (2468), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 495/633 (78%), Positives = 495/633 (78%)

Query: 1   MSQEKHAGKEESSDPRFANVHSDPKFRETKAKKFKIKLDDRFSKKDLQFKRKARVDKYGR 60
           MSQEKHAGKEESSDPRFANVHSDPKFRETKAKKFKIKLDDRFSKKDLQFKRKARVDKYGR
Sbjct: 1   MSQEKHAGKEESSDPRFANVHSDPKFRETKAKKFKIKLDDRFSKKDLQFKRKARVDKYGR 60

Query: 61  SLKGQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIGDSAAVKPVSL 120
           SLKGQ                                           IGDSAAVKPVSL
Sbjct: 61  SLKGQENKDKKDFDKYYEKDDKKKEDKVKPDDEEKSDSEAESANEAKDIGDSAAVKPVSL 120

Query: 121 DRARGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTKPQSGDSSKTLAVVNL 180
           DRARG                                      TKPQSGDSSKTLAVVNL
Sbjct: 121 DRARGEVPSDYVSSSEDESSSESEAGSEDSDIESEESEVEIEDTKPQSGDSSKTLAVVNL 180

Query: 181 DWDHVKSTDLMITFSSFVPSGGKIIKIAVYPSEFGKERLKREEMEGPPREIFXXXXXXXX 240
           DWDHVKSTDLMITFSSFVPSGGKIIKIAVYPSEFGKERLKREEMEGPPREIF        
Sbjct: 181 DWDHVKSTDLMITFSSFVPSGGKIIKIAVYPSEFGKERLKREEMEGPPREIFKSKNSKKK 240

Query: 241 XXXXXXXXXVDVRDLYEEGDAEDYDAKSLRRYQLDRLRYFYAVVYCNNVATAEAIYKNCD 300
                    VDVRDLYEEGDAEDYDAKSLRRYQLDRLRYFYAVVYCNNVATAEAIYKNCD
Sbjct: 241 SHDDDSDSDVDVRDLYEEGDAEDYDAKSLRRYQLDRLRYFYAVVYCNNVATAEAIYKNCD 300

Query: 301 GTEFESTANMFDLRYVPDGMTFDDEARDECTSIPKNYQPSQFSTDALQHSKVKLTWDETP 360
           GTEFESTANMFDLRYVPDGMTFDDEARDECTSIPKNYQPSQFSTDALQHSKVKLTWDETP
Sbjct: 301 GTEFESTANMFDLRYVPDGMTFDDEARDECTSIPKNYQPSQFSTDALQHSKVKLTWDETP 360

Query: 361 ADRVAMSKRAFTQKEIEDMDFKAYLASDSEESEPENNQDLKTKLKSLVSQSVKVGDKSIF 420
           ADRVAMSKRAFTQKEIEDMDFKAYLASDSEESEPENNQDLKTKLKSLVSQSVKVGDKSIF
Sbjct: 361 ADRVAMSKRAFTQKEIEDMDFKAYLASDSEESEPENNQDLKTKLKSLVSQSVKVGDKSIF 420

Query: 421 DQAPEEGESDVDMQITFAPGLAEGAEDDKQENAXXXXXXXXXXXXXXXXXXXXXXXXXXX 480
           DQAPEEGESDVDMQITFAPGLAEGAEDDKQENA                           
Sbjct: 421 DQAPEEGESDVDMQITFAPGLAEGAEDDKQENAEETTLEKLKRKEKERKKMRKERIKELK 480

Query: 481 XXXXXXXXXXXXXSRYKPESTVEDAKSKAELELLMMDDDENNSSSKLNKKAHFNMNEIVR 540
                        SRYKPESTVEDAKSKAELELLMMDDDENNSSSKLNKKAHFNMNEIVR
Sbjct: 481 KQAEEEKKQKRKESRYKPESTVEDAKSKAELELLMMDDDENNSSSKLNKKAHFNMNEIVR 540

Query: 541 SEKEKGKKSRYQNKDKIVEDEFKPDLNDPRFAEVFEDRDFAIDPSQPEFKGTAAMKQILQ 600
           SEKEKGKKSRYQNKDKIVEDEFKPDLNDPRFAEVFEDRDFAIDPSQPEFKGTAAMKQILQ
Sbjct: 541 SEKEKGKKSRYQNKDKIVEDEFKPDLNDPRFAEVFEDRDFAIDPSQPEFKGTAAMKQILQ 600

Query: 601 ERTKRSHKGQNKKRKADGNLANQNGQSDLKGLV 633
           ERTKRSHKGQNKKRKADGNLANQNGQSDLKGLV
Sbjct: 601 ERTKRSHKGQNKKRKADGNLANQNGQSDLKGLV 633

>KLTH0F16148g Chr6 (1310041..1311981) [1941 bp, 646 aa] {ON} similar
           to uniprot|Q06344 YDR365C Saccharomyces cerevisiae ESF1
           Nucleolar protein involved in pre-rRNA processing
          Length = 646

 Score =  756 bits (1953), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/635 (61%), Positives = 445/635 (70%), Gaps = 5/635 (0%)

Query: 1   MSQEKHAGKEESSDPRFANVHSDPKFRETKAKKFKIKLDDRFSKKDLQFKRKARVDKYGR 60
           MS+E    +  SSDPRFA V +DPKFRET+AKKFKIKLDDRFSKKDL+FKRKARVDKYGR
Sbjct: 1   MSKENETRQGGSSDPRFAGVENDPKFRETRAKKFKIKLDDRFSKKDLEFKRKARVDKYGR 60

Query: 61  SLKGQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIGDSAAVKPVSL 120
            LKGQ                                              +A+ K VSL
Sbjct: 61  RLKGQESKDKRDFDKYYEKEKSGKTAPDSELVGKPSEEDSEGGSSDEE--GAASAKTVSL 118

Query: 121 DRARGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTKPQSGDSSKTLAVVNL 180
           DRARG                                       + +SGDSSKTLAVVNL
Sbjct: 119 DRARGEVHSDYVSSSDEESSSESEEDSADSDLESEESEVQIEEGEVKSGDSSKTLAVVNL 178

Query: 181 DWDHVKSTDLMITFSSFVPSGGKIIKIAVYPSEFGKERLKREEMEGPPREIFXXXXXXXX 240
           DWDHVKSTDLM+TFSSFVP GGKI ++A+YPSEFGKERL +EE EGPPREIF        
Sbjct: 179 DWDHVKSTDLMVTFSSFVPKGGKINRVAIYPSEFGKERLAKEETEGPPREIFKSKEKGKK 238

Query: 241 XXXXXXXXXVDVRDLYEEGDAEDYDAKSLRRYQLDRLRYFYAVVYCNNVATAEAIYKNCD 300
                    + V+DLYEEGDA+D+DAKSLRRYQL+RLRY+YAVVYCNN  TAE+IYKNCD
Sbjct: 239 SHGDDSDEELTVKDLYEEGDADDFDAKSLRRYQLERLRYYYAVVYCNNKQTAESIYKNCD 298

Query: 301 GTEFESTANMFDLRYVPDGMTFDDEARDECTSIPKNYQPSQFSTDALQHSKVKLTWDETP 360
           GTE+ESTANMFDLRYVPDGM FDDEARDEC S+PKNY+PS+FSTDALQHSKVK TWDETP
Sbjct: 299 GTEYESTANMFDLRYVPDGMDFDDEARDECDSVPKNYRPSEFSTDALQHSKVKFTWDETP 358

Query: 361 ADRVAMSKRAFTQKEIEDMDFKAYLASDSEESEPENNQDLKTKLKSLVSQSVKVGDKSIF 420
           ADR AM+KRAFTQ+EIEDMDFKAYLASDSE+SEPENNQ+LK KLKSLV+QSV+VG+KSIF
Sbjct: 359 ADRTAMAKRAFTQREIEDMDFKAYLASDSEDSEPENNQELKNKLKSLVNQSVQVGEKSIF 418

Query: 421 DQAPEEGESDVDMQITFAPGLAEGAEDDKQ--ENAXXXXXXXXXXXXXXXXXXXXXXXXX 478
           DQ P++GESDVDMQITFAP LAEG   D    E                           
Sbjct: 419 DQDPKDGESDVDMQITFAPALAEGGSGDADDGEKTEETTLEKVRRKEKERKKMRKERIKE 478

Query: 479 XXXXXXXXXXXXXXXSRYKPESTVEDAKSKAELELLMMDDDENNSSSKLNKKAHFNMNEI 538
                          +R KPE +  D+KS+AELELLMMDD E  ++SKLNKKAHFNMNEI
Sbjct: 479 LKKQAEDDKKQKLKEARRKPEPSATDSKSQAELELLMMDDSE-EANSKLNKKAHFNMNEI 537

Query: 539 VRSEKEKGKKSRYQNKDKIVEDEFKPDLNDPRFAEVFEDRDFAIDPSQPEFKGTAAMKQI 598
           VRSEKEKGKK+++Q+K++IVEDEFKPDLNDPRF+EVFED DFAIDPSQPEFKGTAAMKQI
Sbjct: 538 VRSEKEKGKKAKFQDKNRIVEDEFKPDLNDPRFSEVFEDHDFAIDPSQPEFKGTAAMKQI 597

Query: 599 LQERTKRSHKGQNKKRKADGNLANQNGQSDLKGLV 633
           LQER KRS KG+NKKR+A+G++A  +G +DLKGLV
Sbjct: 598 LQERNKRSQKGKNKKREANGDIAEPSGNNDLKGLV 632

>SAKL0G02442g Chr7 complement(201924..203795) [1872 bp, 623 aa] {ON}
           similar to uniprot|Q06344 YDR365C Saccharomyces
           cerevisiae ESF1 Nucleolar protein involved in pre-rRNA
           processing
          Length = 623

 Score =  591 bits (1523), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/473 (63%), Positives = 358/473 (75%), Gaps = 6/473 (1%)

Query: 164 TKPQSGDSSKTLAVVNLDWDHVKSTDLMITFSSFVPSGGKIIKIAVYPSEFGKERLKREE 223
           +KP +GD+++ LAVVNLDWDHVKSTDLM+TFSSFVP GGKI+KIA+YPSEFGKER++REE
Sbjct: 142 SKPPTGDATRMLAVVNLDWDHVKSTDLMVTFSSFVPKGGKILKIAIYPSEFGKERMQREE 201

Query: 224 MEGPPREIFXXXXXXXXXXXXXXXXXVDVRDLYEEGDAE-DYDAKSLRRYQLDRLRYFYA 282
           +EGPPRE+F                 VD++DLYEEGDAE DYD+K+LRRYQLDRLRY+YA
Sbjct: 202 VEGPPRELFQGKKKKSQRKDGDDSD-VDIKDLYEEGDAEKDYDSKALRRYQLDRLRYYYA 260

Query: 283 VVYCNNVATAEAIYKNCDGTEFESTANMFDLRYVPDGMTFDDEARDECTSIPKNYQPSQF 342
           VV+CNNV TAEAIY+NCDGTE+ESTANMFDLRYVP+GM F DE +DEC  +PKNY+P+QF
Sbjct: 261 VVFCNNVETAEAIYQNCDGTEYESTANMFDLRYVPEGMDFSDEPKDECEDVPKNYKPAQF 320

Query: 343 STDALQHSKVKLTWDETPADRVAMSKRAFTQKEIEDMDFKAYLASDSEESEPENNQDLKT 402
           STDALQHS VKLTWDETPA+RV MSKRAFTQKEIEDMDFKAYLASDSE SE E N+D + 
Sbjct: 321 STDALQHSNVKLTWDETPAERVEMSKRAFTQKEIEDMDFKAYLASDSEGSEEEINEDSRN 380

Query: 403 KLKSLVSQSVKVGDKSIFDQAPEEGESDVDMQITFAPGLAEGAEDDKQ-ENAXXXXXXXX 461
           KLKSLVS+S+++GDKS+FD++  EG  DVDM+ITF PGL E  +DD+  ++         
Sbjct: 381 KLKSLVSESIRIGDKSLFDKSDNEG-GDVDMEITFTPGLDEAKKDDEDGKDETTIEKIRR 439

Query: 462 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSRYKPESTVE-DAKSKAELELLMMDDDE 520
                                           S+ K    VE + KSKAELELLMMDDD 
Sbjct: 440 KEKERRKMRKERVKELKKKAEEKKREKLNKSDSQSKTADEVEKEKKSKAELELLMMDDD- 498

Query: 521 NNSSSKLNKKAHFNMNEIVRSEKEKGKKSRYQNKDKIVEDEFKPDLNDPRFAEVFEDRDF 580
           N++ SKLNKKAHFNM EI+RSEKEKGK+++YQN++KIVEDEFKPDLNDPRF EVFED DF
Sbjct: 499 NDTESKLNKKAHFNMTEILRSEKEKGKRTKYQNREKIVEDEFKPDLNDPRFREVFEDHDF 558

Query: 581 AIDPSQPEFKGTAAMKQILQERTKRSHKGQNKKRKADGNLANQNGQSDLKGLV 633
           AIDPSQPEFKGT AMK+IL+ER +R  K +  K++        N  ++L GLV
Sbjct: 559 AIDPSQPEFKGTTAMKEILKERNQRVSKKKGNKKRKLEQPRKNNNSNELNGLV 611

 Score = 80.9 bits (198), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 45/52 (86%)

Query: 12 SSDPRFANVHSDPKFRETKAKKFKIKLDDRFSKKDLQFKRKARVDKYGRSLK 63
          ++DPRF+ +HSDPKF++ K K  KIKLDDRFSKKDL+ K+KA+VDKYGR LK
Sbjct: 11 TNDPRFSGIHSDPKFKDAKPKNLKIKLDDRFSKKDLEIKKKAKVDKYGRRLK 62

>Kpol_1016.8 s1016 (16620..18533) [1914 bp, 637 aa] {ON}
           (16620..18533) [1914 nt, 638 aa]
          Length = 637

 Score =  580 bits (1494), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/606 (54%), Positives = 386/606 (63%), Gaps = 37/606 (6%)

Query: 11  ESSDPRFANVHSDPKFRETKAKKFKIKLDDRFSKKDLQFKRKARVDKYGRSLKGQXXXXX 70
           +SSDPRF+ ++SDPKF+ +K K  KIKLDDRF K DLQ K K++VDKYGR LK       
Sbjct: 9   QSSDPRFSGIYSDPKFKNSKRKNIKIKLDDRFDKSDLQIKHKSKVDKYGRKLKD------ 62

Query: 71  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIGDSAAVKPVSLDRARGXXXXX 130
                                                 IG  A VK   LDRARG     
Sbjct: 63  -------------VKDNKELEDFDKYFEKEDEEDKEEEIGTEAKVK--VLDRARGEVPSD 107

Query: 131 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTKPQSGDSSKTLAVVNLDWDHVKSTDL 190
                                            +KP+SGDSSKTLAVVNLDWD+VKS DL
Sbjct: 108 YESSSEEFTSSDSESSGESEVDSDEESEDEVETSKPESGDSSKTLAVVNLDWDYVKSQDL 167

Query: 191 MITFSSFVPSGGKIIKIAVYPSEFGKERLKREEMEGPPREIFXXXXXXXXXXXXXXXXX- 249
           MITFSSF+P GGKI KI +YPSEFGKER+ REE+EGPPRE+F                  
Sbjct: 168 MITFSSFLPKGGKIEKICIYPSEFGKERMAREEVEGPPRELFNKKKNKKSSKKSSKDDDE 227

Query: 250 -------VDVRDLYEEGDAE-DYDAKSLRRYQLDRLRYFYAVVYCNNVATAEAIYKNCDG 301
                  VD+R+LYEEGDAE D D+K+LR+YQL+RLRY+YAVVYCNN+A+AE+IY+NCDG
Sbjct: 228 DDESDSDVDIRELYEEGDAEKDVDSKALRQYQLERLRYYYAVVYCNNIASAESIYENCDG 287

Query: 302 TEFESTANMFDLRYVPDGMTFDDEARDECTSIPKNYQPSQFSTDALQHSKVKLTWDETPA 361
           TE+ES+AN+FDLRYVPDG  FDDE RDEC  +PKNY+  QF+TDALQHS VKLTWDETPA
Sbjct: 288 TEYESSANIFDLRYVPDGTEFDDEPRDECLQLPKNYKVRQFTTDALQHSNVKLTWDETPA 347

Query: 362 DRVAMSKRAFTQKEIEDMDFKAYLASDSEESEPENNQDLKTKLKSLVSQSVKVGDKSIFD 421
           DRV ++KRAFTQKEIE+MDFKAYLASDS+ESE E N D+K KLKSLVSQS  +GDKSIFD
Sbjct: 348 DRVEIAKRAFTQKEIEEMDFKAYLASDSDESEEEPNDDVKNKLKSLVSQSTTIGDKSIFD 407

Query: 422 QAPEEGES-DVDMQITFAPGLAEGAED-----DKQENAXXXXXXXXXXXXXXXXXXXXXX 475
              +  E  DVDM+ITF PGL EG ED     D +E                        
Sbjct: 408 DKGDNNEEDDVDMEITFTPGLGEGGEDGDEDKDNEETTIEKVRRKEKERRKARKDKLKQL 467

Query: 476 XXXXXXXXXXXXXXXXXXSRYKPESTVEDAKSKAELELLMMDDDENNSSSKLNKKAHFNM 535
                                  ++T  DAK+KAELELLMM DDE  S+S LNKKAHFNM
Sbjct: 468 KQQSENEKKEKLKELKKERNGNGKNTNVDAKAKAELELLMM-DDETESTSTLNKKAHFNM 526

Query: 536 NEIVRSEKEKGKKSRYQNKDKIVEDEFKPDLNDPRFAEVFEDRDFAIDPSQPEFKGTAAM 595
           NEIVRSEKEKGKKS+YQ+K+KIVED+FKPDLNDPRF E+FED DFAIDP+Q EFK T AM
Sbjct: 527 NEIVRSEKEKGKKSKYQDKNKIVEDDFKPDLNDPRFKEIFEDHDFAIDPTQSEFKETTAM 586

Query: 596 KQILQE 601
           K+IL+E
Sbjct: 587 KEILKE 592

>TPHA0H01780 Chr8 complement(409713..411581) [1869 bp, 622 aa] {ON}
           Anc_5.430 YDR365C
          Length = 622

 Score =  544 bits (1401), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/603 (51%), Positives = 377/603 (62%), Gaps = 35/603 (5%)

Query: 12  SSDPRFANVHSDPKFRETKAKKFKIKLDDRFSKKDLQFKRKARVDKYGRSLKGQXXXXXX 71
           ++D RF+ V +DPKF+  + K  KIKLD RFSK DL+  RKARVDKYGR +         
Sbjct: 8   NTDERFSGVFNDPKFKNARKKNLKIKLDSRFSKSDLEVNRKARVDKYGRKISNLNNQEAK 67

Query: 72  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIGDSAAVKPVSLDRARGXXXXXX 131
                                                     AVKP+ +DRARG      
Sbjct: 68  DFDKYFEKEEDGKGE-------------------------EIAVKPL-IDRARGEVPSDY 101

Query: 132 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTKPQSGDSSKTLAVVNLDWDHVKSTDLM 191
                                           TKP+SGDSSKT+AVVNLDWDHVK+TDL+
Sbjct: 102 QSSLDDYTSSESEDSEDEDLESEGESEAEIEETKPESGDSSKTIAVVNLDWDHVKATDLL 161

Query: 192 ITFSSFVPSGGKIIKIAVYPSEFGKERLKREEMEGPPREIFXXXXXXXXXXXXXX---XX 248
           +TFSSFVP GGKI +IA++PSEFGK+R++REE+EGPP+E+F                   
Sbjct: 162 VTFSSFVPKGGKIERIAIFPSEFGKQRMEREELEGPPKELFQKKKKKNSKKSNAEFNDDS 221

Query: 249 XVDVRDLYEEGDAE-DYDAKSLRRYQLDRLRYFYAVVYCNNVATAEAIYKNCDGTEFEST 307
            VD+ DLYEEGD + + D+KSLR+YQLDRLRY+YAVV+CNN++TAEAIY NCDGTE+EST
Sbjct: 222 DVDINDLYEEGDVDKEVDSKSLRQYQLDRLRYYYAVVFCNNISTAEAIYNNCDGTEYEST 281

Query: 308 ANMFDLRYVPDGMTFDDEARDECTSIPKNYQPSQFSTDALQHSKVKLTWDETPADRVAMS 367
           AN+FDLRYVPDGM F+D+  DECT +PKNY P  F+TDALQHS VKLTWDETPADRV ++
Sbjct: 282 ANVFDLRYVPDGMDFEDQPYDECTELPKNYTPLNFTTDALQHSNVKLTWDETPADRVEIA 341

Query: 368 KRAFTQKEIEDMDFKAYLASDSEESEPENNQDLKTKLKSLVSQSVKVGDKSIFDQAPEEG 427
           KRAFTQKEI++MDFKAYLAS   E     N+++K KLKSLV  S+K+GDKSI D   +  
Sbjct: 342 KRAFTQKEIDEMDFKAYLAS-DSEESEGENEEVKNKLKSLVGLSMKIGDKSIMDNKSDNE 400

Query: 428 ESDVDMQITFAPGLAEGAEDDKQENAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 487
           + +VDM+ITF PGLAE   +DK+E                                    
Sbjct: 401 DGEVDMEITFTPGLAENDNNDKEEENEETTIEKVRRKEKERRKARKQKLKEIKQNSEQEK 460

Query: 488 XXXXXXSRY----KPESTVEDAKSKAELELLMMDDDENNSSSKLNKKAHFNMNEIVRSEK 543
                  +     K E T  D  +KAELELLMMD+DE N +S +NKKAHFNM EI+RSEK
Sbjct: 461 REKLKSLKTERSKKSEDTESDKNAKAELELLMMDEDEINGTSTINKKAHFNMKEILRSEK 520

Query: 544 EKGKKSRYQNKDKIVEDEFKPDLNDPRFAEVFEDRDFAIDPSQPEFKGTAAMKQILQERT 603
           EK KKS++QNK+KIVED FK DLNDPRF E+FED DFAIDP+Q E+K TAAMK+IL+ER+
Sbjct: 521 EKTKKSKFQNKEKIVEDNFKADLNDPRFNEMFEDHDFAIDPTQSEYKETAAMKEILKERS 580

Query: 604 KRS 606
           KRS
Sbjct: 581 KRS 583

>KLLA0E21165g Chr5 (1890314..1892197) [1884 bp, 627 aa] {ON} similar
           to uniprot|Q06344 YDR365C Saccharomyces cerevisiae ESF1
           Nucleolar protein involved in pre-rRNA processing
          Length = 627

 Score =  538 bits (1386), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/472 (58%), Positives = 344/472 (72%), Gaps = 10/472 (2%)

Query: 165 KPQSGDSSKTLAVVNLDWDHVKSTDLMITFSSFVPSGGKIIKIAVYPSEFGKERLKREEM 224
           KP SG+++ TLAVVNLDWDHVKS DL +TF SFVP GG+I KIA+YPSEFGKER++REE+
Sbjct: 151 KPASGNATNTLAVVNLDWDHVKSADLFVTFKSFVPKGGEIQKIAIYPSEFGKERMQREEI 210

Query: 225 EGPPREIFXXXXXXXXXXXXXXXXXVDVRDLYEEGDAEDYDAKSLRRYQLDRLRYFYAVV 284
           EGPP+E+F                 ++V  +YEEGDAEDYD+K+LRRYQL+RLRY+YAVV
Sbjct: 211 EGPPKELFQSKKSKKNDKDDDE---INVESIYEEGDAEDYDSKALRRYQLERLRYYYAVV 267

Query: 285 YCNNVATAEAIYKNCDGTEFESTANMFDLRYVPDGMTFDDEARDECTSIPKNYQPSQFST 344
           YC+++ TAE+IY+NCDGTE+ESTAN+FDLRYVPDGM  DD+ RDECTS+PKNY+P+QFST
Sbjct: 268 YCSDIRTAESIYQNCDGTEYESTANVFDLRYVPDGMEMDDDPRDECTSLPKNYKPAQFST 327

Query: 345 DALQHSKVKLTWDETPADRVAMSKRAFTQKEIEDMDFKAYLASDSEESEPENNQDLKTKL 404
           DALQHSKVKLTWDETPADRV +SKRAFTQKEIE+MDFKAYLASDSEESE E++  +K KL
Sbjct: 328 DALQHSKVKLTWDETPADRVEISKRAFTQKEIEEMDFKAYLASDSEESEVEHDDQVKNKL 387

Query: 405 KSLVSQSVKVGDKSIFDQAPEEGESDVDMQITFAPGLAEGAEDDKQENAXXXXXXXXXXX 464
           K+LV  SVKVG KS+FDQ  +E +++ DM+ITF PGL E  + D  +N            
Sbjct: 388 KALVMDSVKVGQKSLFDQKEDEDDNEADMEITFTPGLDESGQQDTNDNEEESTIDKIRRK 447

Query: 465 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXSRYKPESTVEDAKSKAELELLMMDDDENNSS 524
                                         +    S ++D K K ELELLM+  DEN   
Sbjct: 448 EKERRKKRKDRVKELKKESEAKLKENLKKKKDTSHS-IDDDKKKGELELLML--DENEGE 504

Query: 525 SKLNKKAHFNMNEIVRSEKEKGKKSRYQNKDKIVEDEFKPDLNDPRFAEVFEDRDFAIDP 584
           S +N KAHFNMNEI++SEKEK KK++YQNK+KIV+DEF PD+NDPRF EVFED DFAIDP
Sbjct: 505 STINNKAHFNMNEILKSEKEKSKKAKYQNKEKIVDDEFTPDVNDPRFKEVFEDHDFAIDP 564

Query: 585 SQPEFKGTAAMKQILQERTKRSHKGQNKKRKADGNLANQNGQSDLK---GLV 633
           +QPEFK T AM++IL+ERT RS K +++ +K +  +AN     D+    GLV
Sbjct: 565 TQPEFKKTPAMEKILKERTVRSSK-KSRGKKRNHEIANTEHSKDINKIGGLV 615

 Score = 82.4 bits (202), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 35/51 (68%), Positives = 45/51 (88%)

Query: 12 SSDPRFANVHSDPKFRETKAKKFKIKLDDRFSKKDLQFKRKARVDKYGRSL 62
          + DPRF+ +H+DPKFR TK+K FKIKLDDRFSK+DL+ +RKA+VDKYGR +
Sbjct: 12 TEDPRFSGIHNDPKFRSTKSKNFKIKLDDRFSKQDLEVRRKAKVDKYGRKI 62

>KAFR0E03910 Chr5 complement(773170..775047) [1878 bp, 625 aa] {ON}
           Anc_5.430 YDR365C
          Length = 625

 Score =  534 bits (1375), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/480 (60%), Positives = 349/480 (72%), Gaps = 17/480 (3%)

Query: 164 TKPQSGDSSKTLAVVNLDWDHVKSTDLMITFSSFVPSGGKIIKIAVYPSEFGKERLKREE 223
           TKP++GD+SKTLAVVNLDWDHVKS DLM+TFSSFVP GGKI +I +YPSEFGKERL+REE
Sbjct: 138 TKPETGDASKTLAVVNLDWDHVKSADLMVTFSSFVPKGGKISRICIYPSEFGKERLQREE 197

Query: 224 MEGPPREIFXXXXXXXXXXXXX--XXXXVDVRDLYEEGDAE-DYDAKSLRRYQLDRLRYF 280
           +EGPP+E+F                   VD++DLYEEGDAE D D+K+LR+YQL+RLRY+
Sbjct: 198 VEGPPKELFQKKNKKKASHKEDFDSDSDVDIKDLYEEGDAEKDVDSKALRQYQLERLRYY 257

Query: 281 YAVVYCNNVATAEAIYKNCDGTEFESTANMFDLRYVPDGMTFDDEARDECTSIPKNYQPS 340
           YAVVYCNN+ TA AIY+NCDGTE+ESTANMFDLRYVPDGMTFDDE RDEC S+PKNY+P 
Sbjct: 258 YAVVYCNNIDTARAIYENCDGTEYESTANMFDLRYVPDGMTFDDEPRDECNSLPKNYKPM 317

Query: 341 QFSTDALQHSKVKLTWDETPADRVAMSKRAFTQKEIEDMDFKAYLASDSEESEPENNQDL 400
           QFSTDALQHS VKLTWDETPADRV ++KRAF+QKEIEDMDFKAYLASDS+ESE E N++ 
Sbjct: 318 QFSTDALQHSNVKLTWDETPADRVEVAKRAFSQKEIEDMDFKAYLASDSDESEEEVNENS 377

Query: 401 KTKLKSLVSQSVKVGDKSIFDQAPEEGESDVDMQITFAPGL---AEGAEDDKQENAXXXX 457
           K KLK+LV +S+  G     D     GES+VDM+ITF PGL    E  E+ ++       
Sbjct: 378 KNKLKALVGESLDFGTNGASD-----GESEVDMEITFTPGLDEAKESEEEKEESTIEKVR 432

Query: 458 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSRYKPESTVEDAKSKAELELLMMD 517
                                               SR       E AK+KAELELLM+ 
Sbjct: 433 RKEKERRKARKDKLKQLKKDAENEKKEKMRSLHDKKSRKAETENEEAAKAKAELELLMI- 491

Query: 518 DDENNSSSKLNKKAHFNMNEIVRSEKEKGKKSRYQNKDKIVEDEFKPDLNDPRFAEVFED 577
           +DE+++   LNKKAHFN+NEI+RSEKEKGKK +YQ K+KIVED+FKPDL+DPRF EVFED
Sbjct: 492 EDEDDTEQSLNKKAHFNLNEIIRSEKEKGKKGKYQRKEKIVEDDFKPDLSDPRFKEVFED 551

Query: 578 RDFAIDPSQPEFKGTAAMKQILQERTKRSHK----GQNKKRKADGNLANQNGQSDLKGLV 633
            DFAIDPSQPEFK T AMKQIL ER+KRS +    G+NKKRK D + + +NG++ +  +V
Sbjct: 552 HDFAIDPSQPEFKQTNAMKQILNERSKRSKERSKGGKNKKRKLDTSTS-KNGKNAISNIV 610

 Score = 70.5 bits (171), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 43/56 (76%)

Query: 8  GKEESSDPRFANVHSDPKFRETKAKKFKIKLDDRFSKKDLQFKRKARVDKYGRSLK 63
          G ++S DPRF+ +++DPKF+  K K  KI+LD RFSK+DL+ + KA+VDKYGR  K
Sbjct: 4  GGKKSDDPRFSRIYNDPKFKNAKTKHLKIRLDSRFSKRDLEIRNKAKVDKYGRKTK 59

>NDAI0B05640 Chr2 complement(1377917..1379926) [2010 bp, 669 aa]
           {ON} Anc_5.430 YDR365C
          Length = 669

 Score =  532 bits (1371), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/468 (59%), Positives = 328/468 (70%), Gaps = 20/468 (4%)

Query: 166 PQSGDSSKTLAVVNLDWDHVKSTDLMITFSSFVPSGGKIIKIAVYPSEFGKERLKREEME 225
           P+SG+ SKTLAVVNLDWDHVKS+DLMITFSSF+P GG+I  IA+YPSEFGKER++RE++E
Sbjct: 165 PESGEPSKTLAVVNLDWDHVKSSDLMITFSSFLPEGGRIENIAIYPSEFGKERMQREDVE 224

Query: 226 GPPREIFXXXXXXXX-------XXXXXXXXXVDVRDLYEEGDAE-DYDAKSLRRYQLDRL 277
           GPP+E+F                        VD++DLYEEGDA+ D D K+LR+YQL+RL
Sbjct: 225 GPPKELFQKRKKKTSKSKKISDEANDSDVSDVDIKDLYEEGDADKDVDTKALRQYQLERL 284

Query: 278 RYFYAVVYCNNVATAEAIYKNCDGTEFESTANMFDLRYVPDGMTFDDEARDECTSIPKNY 337
           RY+YAVVYCNN+ TA AIY+NCDGTE+ESTANMFDLRYVPDGM F DE RD+C S+PKNY
Sbjct: 285 RYYYAVVYCNNIETATAIYQNCDGTEYESTANMFDLRYVPDGMDFTDEPRDQCDSLPKNY 344

Query: 338 QPSQFSTDALQHSKVKLTWDETPADRVAMSKRAFTQKEIEDMDFKAYLASDSEESEPENN 397
           +P QFSTDALQHS VKLTWDETP +R  ++KRAFTQKEI+DMDFKAYLASDS+ SE E N
Sbjct: 345 KPHQFSTDALQHSNVKLTWDETPVERQEVAKRAFTQKEIDDMDFKAYLASDSDGSEDELN 404

Query: 398 QDLKTKLKSLVSQSVKVGDKSIF---DQAPEEGESDVDMQITFAPGLAEGAEDDKQENAX 454
           +D K KLK+LV      G + IF        E E +VDM+ITF P L E +  +  E+  
Sbjct: 405 EDAKNKLKALVGGG-GFGSREIFGGKGAKAGEDEDEVDMEITFNPALDENSPKEDGEHEE 463

Query: 455 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSRYKPESTVEDA------KSK 508
                                                     K  +  +DA      KS+
Sbjct: 464 TTIEKVARKEKERRKARKQKLKELKTKAQQEKKDKLKLSKNKKNHTKEDDAEAKKNQKSR 523

Query: 509 AELELLMMDDDENNSSSKLNKKAHFNMNEIVRSEKEKGKKSRYQNKDKIVEDEFKPDLND 568
           AELELLMMDDDE   S+ +N KAHFNMNEI+RSEKEKGK+ +YQNKDKIVEDEFKPDLND
Sbjct: 524 AELELLMMDDDEETGST-INNKAHFNMNEILRSEKEKGKRGKYQNKDKIVEDEFKPDLND 582

Query: 569 PRFAEVFEDRDFAIDPSQPEFKGTAAMKQILQERTKRSH-KGQNKKRK 615
           PRF EVFED DFAIDPS+PEFK T AMK+IL+ER+KR H KG NKKR+
Sbjct: 583 PRFKEVFEDHDFAIDPSRPEFKETKAMKEILKERSKRIHKKGSNKKRR 630

 Score = 82.4 bits (202), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 46/52 (88%)

Query: 11 ESSDPRFANVHSDPKFRETKAKKFKIKLDDRFSKKDLQFKRKARVDKYGRSL 62
          ES+DPRFA +++DPKFR+TK K  KIKLDDRFSKKDL+ +RK++VDKYGR L
Sbjct: 10 ESTDPRFAKIYNDPKFRKTKNKDLKIKLDDRFSKKDLEIRRKSKVDKYGRKL 61

>NCAS0F03350 Chr6 complement(677168..679087) [1920 bp, 639 aa] {ON}
           Anc_5.430 YDR365C
          Length = 639

 Score =  528 bits (1361), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/478 (58%), Positives = 343/478 (71%), Gaps = 11/478 (2%)

Query: 166 PQSGDSSKTLAVVNLDWDHVKSTDLMITFSSFVPSGGKIIKIAVYPSEFGKERLKREEME 225
           P++GD++KTLAVVNLDWDHV+S+DLMITFS F+P GGKI KI V PSEFGKER++REE E
Sbjct: 145 PETGDATKTLAVVNLDWDHVRSSDLMITFSGFLPKGGKIEKIVVLPSEFGKERMQREETE 204

Query: 226 GPPREIFXXXXXXXXXXXXXXXXXVD---VRDLYEEGDAE-DYDAKSLRRYQLDRLRYFY 281
           GPPRE+F                      ++DLYEEGDA+ D D ++LR+YQL+RLRY+Y
Sbjct: 205 GPPRELFQKKKKKGKRASVESDSDDSDVDIKDLYEEGDADKDVDTRALRQYQLERLRYYY 264

Query: 282 AVVYCNNVATAEAIYKNCDGTEFESTANMFDLRYVPDGMTFDDEARDECTSIPKNYQPSQ 341
           AVVYCN+V  A AIY+NCDGTE+ESTANMFDLRYVPDGM FDDE RD+C+S+PKNY+P Q
Sbjct: 265 AVVYCNSVEAARAIYENCDGTEYESTANMFDLRYVPDGMDFDDEPRDQCSSLPKNYKPHQ 324

Query: 342 FSTDALQHSKVKLTWDETPADRVAMSKRAFTQKEIEDMDFKAYLASDSEESEPENNQDLK 401
           FSTDALQHS VKLTWDETPA+RV ++KRAFTQKEIEDMDFKAYLASDS+ SE E NQD K
Sbjct: 325 FSTDALQHSNVKLTWDETPAERVEVAKRAFTQKEIEDMDFKAYLASDSDGSEDEVNQDAK 384

Query: 402 TKLKSLVSQSVKVGDKSIF-DQAPEEGE-SDVDMQITFAPGLAEGAEDDKQENAXXXXXX 459
            KLKSLV  S+++G++ IF  +   EGE  +VDM+ITF PGL+EG E  ++         
Sbjct: 385 NKLKSLVGDSLRIGNQPIFGSKDTLEGEDEEVDMEITFDPGLSEGVEKTEEHEETTIEKV 444

Query: 460 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSRYKPESTVED---AKSKAELELLMM 516
                                              +   +ST  D   AKSKAELELLMM
Sbjct: 445 ARKEKERRKARKQKLKELKNNAQKEKKDKLKSLKGKKHNDSTEGDASTAKSKAELELLMM 504

Query: 517 DDDENNSSSKLNKKAHFNMNEIVRSEKEKGKKSRYQNKDKIVEDEFKPDLNDPRFAEVFE 576
            DDE+++ + +NKKAHFNM EI+RSEKEK KK +YQ+K +IVED FKPDLNDPRF EVFE
Sbjct: 505 -DDEDDTETGINKKAHFNMKEILRSEKEKSKKGKYQDKRRIVEDNFKPDLNDPRFKEVFE 563

Query: 577 DRDFAIDPSQPEFKGTAAMKQILQERTKRSHKGQNKKRKADGNLANQ-NGQSDLKGLV 633
           D DFAIDPS+PEFK T AMK+IL+ER+KRS K   KK+++   + NQ N  SD+  +V
Sbjct: 564 DHDFAIDPSRPEFKETPAMKEILKERSKRSSKNAQKKKRSHSLMDNQANETSDISNIV 621

 Score = 73.2 bits (178), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 32/51 (62%), Positives = 43/51 (84%)

Query: 12 SSDPRFANVHSDPKFRETKAKKFKIKLDDRFSKKDLQFKRKARVDKYGRSL 62
          + D RF+ +++DPKFR+TK K  KIKLD+RFSKKDL+ +RKA+VDKYGR +
Sbjct: 10 TDDSRFSGIYNDPKFRKTKNKNLKIKLDERFSKKDLEIRRKAKVDKYGRKI 60

>Suva_2.538 Chr2 complement(960917..962806) [1890 bp, 629 aa] {ON}
           YDR365C (REAL)
          Length = 629

 Score =  525 bits (1353), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 271/480 (56%), Positives = 333/480 (69%), Gaps = 13/480 (2%)

Query: 164 TKPQSGDSSKTLAVVNLDWDHVKSTDLMITFSSFVPSGGKIIKIAVYPSEFGKERLKREE 223
            KP+SGD+SKTLAVVNLDWDHVKS DLMITFS FVP GGKI +I+VYPSEFGKER++REE
Sbjct: 138 AKPESGDASKTLAVVNLDWDHVKSEDLMITFSGFVPKGGKIERISVYPSEFGKERMQREE 197

Query: 224 MEGPPREIFXXXXXXXXXXXXXXXXXVD-----VRDLYEEGDAE-DYDAKSLRRYQLDRL 277
           +EGPP+E+F                        ++DLYEEGDA+ D D+++LR+YQLDRL
Sbjct: 198 IEGPPKELFQRKKQVKASKKENADDSDSDIDIGIKDLYEEGDADKDVDSRALRQYQLDRL 257

Query: 278 RYFYAVVYCNNVATAEAIYKNCDGTEFESTANMFDLRYVPDGMTFDDEARDECTSIPKNY 337
           RY+YA+V C++++TA AIY+NCDGTE+ESTANMFDLRYVPDGMTFDD ARD C+++PKNY
Sbjct: 258 RYYYAIVDCSDISTARAIYENCDGTEYESTANMFDLRYVPDGMTFDDTARDACSTLPKNY 317

Query: 338 QPSQFSTDALQHSKVKLTWDETPADRVAMSKRAFTQKEIEDMDFKAYLASDSEESEPENN 397
           +P QFSTDALQHS VKLTWDETPADRV ++KRAFTQKEI+DMDFKAYLASDS+ES+ E N
Sbjct: 318 RPHQFSTDALQHSNVKLTWDETPADRVEVAKRAFTQKEIDDMDFKAYLASDSDESDEEVN 377

Query: 398 QDLKTKLKSLVSQSVKVGDKSIFDQAPEEGESDVDMQITFAPGLAEGAE---DDKQENAX 454
           +D K+KLKSLV     +G  S  + A +  E +VDM+ITF P L  G E   + ++E + 
Sbjct: 378 EDAKSKLKSLVGG---LGFNSKKENANDGDEEEVDMEITFTPALEGGDEKPIEGQEETSI 434

Query: 455 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSRYKPESTVEDAKSKAELELL 514
                                                       E    +AKSKAELELL
Sbjct: 435 EKIRRKEKERRKARKQKVKELKQQSEKEKRGKFKSANKKHVADEEEIKNNAKSKAELELL 494

Query: 515 MMDDDENNSSSKLNKKAHFNMNEIVRSEKEKGKKSRYQNKDKIVEDEFKPDLNDPRFAEV 574
           M DD +  + S +N KAHFNMNEI+RSEKEK KKSRYQ K++IVED F PDL DPRF EV
Sbjct: 495 MDDDGDAEAESSINSKAHFNMNEILRSEKEKHKKSRYQKKERIVEDNFTPDLEDPRFKEV 554

Query: 575 FEDRDFAIDPSQPEFKGTAAMKQILQERTKRSHKGQNKKRKADGNLA-NQNGQSDLKGLV 633
           FED DFAIDP+QPE+KGT AM +IL+ER KR H  + K  K + ++  + N   ++  LV
Sbjct: 555 FEDHDFAIDPTQPEYKGTQAMNKILKERGKRVHDRKRKHGKNENDVTEDGNDNKNIGNLV 614

 Score = 69.3 bits (168), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 42/53 (79%)

Query: 11 ESSDPRFANVHSDPKFRETKAKKFKIKLDDRFSKKDLQFKRKARVDKYGRSLK 63
          ES D RFA +++DPKF+ T+ +  KIKLD RFSKKDL+ + K++VDKYGR +K
Sbjct: 9  ESVDARFAGIYNDPKFKNTRTRDHKIKLDSRFSKKDLEVQHKSKVDKYGRKIK 61

>Smik_4.632 Chr4 complement(1130422..1132305) [1884 bp, 627 aa] {ON}
           YDR365C (REAL)
          Length = 627

 Score =  520 bits (1339), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 267/482 (55%), Positives = 334/482 (69%), Gaps = 21/482 (4%)

Query: 165 KPQSGDSSKTLAVVNLDWDHVKSTDLMITFSSFVPSGGKIIKIAVYPSEFGKERLKREEM 224
           KP+ GD SKTLAVVNLDWDHVKS DLMITFSSFVP GGK+ ++A+YPSEFGKER++REE+
Sbjct: 139 KPECGDVSKTLAVVNLDWDHVKSEDLMITFSSFVPKGGKLERVAIYPSEFGKERMQREEV 198

Query: 225 EGPPREIFXXXXXXXXXXXXXXXXX-----VDVRDLYEEGDAE-DYDAKSLRRYQLDRLR 278
           EGPP+E+F                      + + DLYEEGDA+ D D+++LR+YQLDRLR
Sbjct: 199 EGPPKELFQKKNKNKVSRKKKSDESDSDIDIGINDLYEEGDADKDVDSRALRQYQLDRLR 258

Query: 279 YFYAVVYCNNVATAEAIYKNCDGTEFESTANMFDLRYVPDGMTFDDEARDECTSIPKNYQ 338
           Y+YA+VYC+++ T++AIY NCDGTE+ESTANMFDLRYVPDGMTFDD  RDECT +PKNY+
Sbjct: 259 YYYAIVYCSDITTSKAIYDNCDGTEYESTANMFDLRYVPDGMTFDDAVRDECTLLPKNYR 318

Query: 339 PSQFSTDALQHSKVKLTWDETPADRVAMSKRAFTQKEIEDMDFKAYLASDSEESEPENNQ 398
           P QFSTDALQHS VKLTWDETPADR+ ++KRAFTQKEI+DMDFKAYLASDS+ES+ + ++
Sbjct: 319 PHQFSTDALQHSNVKLTWDETPADRLEVAKRAFTQKEIDDMDFKAYLASDSDESDEQIDE 378

Query: 399 DLKTKLKSLVSQSVKVGDKSIFDQAPEEGESDVDMQITFAPGLAEGAE---DDKQENAXX 455
           D K KLKSLV   +    K    +  ++ + +VDM+ITF P L  G E   ++++E    
Sbjct: 379 DAKNKLKSLVG-GINFNSKK---ENVKDSDEEVDMEITFTPALEGGNEQPSEEQEETTIE 434

Query: 456 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSRYKPESTVEDAKSKAELELLM 515
                                                      E    +AK+KAELELL 
Sbjct: 435 KIRRKEKERRKARKQKVKELKQQSEKDKKTKLKSINKKYAEGEEDIKNNAKAKAELELL- 493

Query: 516 MDDDENNSSSKLNKKAHFNMNEIVRSEKEKGKKSRYQNKDKIVEDEFKPDLNDPRFAEVF 575
           MDDD+  +   +N KAHFNMNEI+RSEKEK KKSRYQNK++IVED F PDLNDPRF EVF
Sbjct: 494 MDDDDAEAQGTINNKAHFNMNEILRSEKEKNKKSRYQNKERIVEDNFTPDLNDPRFKEVF 553

Query: 576 EDRDFAIDPSQPEFKGTAAMKQILQERTKRSHKGQNKKRKADGN----LANQNGQSDLKG 631
           ED DFAIDP+QPE+K T AM +IL+ER KR    ++KKRK DG+    + N + + ++  
Sbjct: 554 EDHDFAIDPTQPEYKSTQAMNKILKERGKRV---KDKKRKHDGSENDIIKNGDSKGNIGN 610

Query: 632 LV 633
           LV
Sbjct: 611 LV 612

 Score = 71.6 bits (174), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 35/64 (54%), Positives = 49/64 (76%), Gaps = 2/64 (3%)

Query: 1  MSQEKHAGKEESSDPRFANVHSDPKFRETKAKKFKIKLDDRFSKKDLQFKRKARVDKYGR 60
          M++EK   ++E +D RFA ++SDPKF+ T+ K  KIKLD RFSKKDL+ + K++VDKYGR
Sbjct: 1  MAEEK--PQKEGADTRFAGIYSDPKFKNTRTKDHKIKLDSRFSKKDLEVQHKSKVDKYGR 58

Query: 61 SLKG 64
           +K 
Sbjct: 59 KIKN 62

>AER259W Chr5 (1113896..1115755) [1860 bp, 619 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR365C (ESF1)
          Length = 619

 Score =  517 bits (1331), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 290/469 (61%), Positives = 340/469 (72%), Gaps = 10/469 (2%)

Query: 168 SGDSSKTLAVVNLDWDHVKSTDLMITFSSFVPSGGKIIKIAVYPSEFGKERLKREEMEGP 227
           SGD SK LAVVNLDWDHVK  DL++ F+SFVP GGKI ++A+YPSEFGKER++REE+EGP
Sbjct: 146 SGDPSKVLAVVNLDWDHVKCADLLVAFNSFVPEGGKIERVAIYPSEFGKERMQREEVEGP 205

Query: 228 PREIFXXXXXXXXXXXXXXXXXVDVRDLYEEGDAE-DYDAKSLRRYQLDRLRYFYAVVYC 286
           PRE+F                 + ++DLYE+GDAE DYD+K+LRRYQL+RLRY+YAVVYC
Sbjct: 206 PREVFKSKKDKKAKQDDDDE--IGLKDLYEQGDAEKDYDSKALRRYQLERLRYYYAVVYC 263

Query: 287 NNVATAEAIYKNCDGTEFESTANMFDLRYVPDGMTFDDEARDECTSIPKNYQPSQFSTDA 346
           NNVATAEAIY+NCDGTE+ESTANMFDLRYVP+G+TFDDE R+EC S+PK+Y+P QFST A
Sbjct: 264 NNVATAEAIYQNCDGTEYESTANMFDLRYVPEGVTFDDEPREECASVPKDYKPVQFSTSA 323

Query: 347 LQHSKVKLTWDETPADRVAMSKRAFTQKEIEDMDFKAYLASDSEESEPENNQDLKTKLKS 406
           LQH +VKLTWDETPADRV M+KRAF+QKEIEDMDFKAYLASDSEESE ++N + K KL+S
Sbjct: 324 LQHLQVKLTWDETPADRVEMAKRAFSQKEIEDMDFKAYLASDSEESEADDNSEAKNKLRS 383

Query: 407 LVSQSVKVGDKSIFDQAPEEGESDVDMQITFAPGLAEGAEDDKQENAXXXXXXXXXXXXX 466
           LVS SVKV DK +F  A E  E + D+QITF PGL  G   ++                 
Sbjct: 384 LVS-SVKVADKPLF--ADESDEEEADVQITFTPGLEGGEAKEEDAEEENILEKLKRKEKE 440

Query: 467 XXXXXXXXXXXXXXXXXXXXXXXXXXXSRYKPESTVEDAKSK-AELELLMMDDDENNSSS 525
                                         K ES  +    K AELELLMM+DDEN+ S 
Sbjct: 441 RRKKRKERVKELKKQAEEEKKSSKKEKHASKSESEQKSENDKRAELELLMMEDDENSQS- 499

Query: 526 KLNKKAHFNMNEIVRSEKEKGKKSRYQNKDKIVEDEFKPDLNDPRFAEVFEDRDFAIDPS 585
            +N  AHFNMN+I+RSEKE+GKKS+YQ KDKIVED+FKPDLNDPRF EVFEDRDFAIDPS
Sbjct: 500 -INSSAHFNMNDILRSEKERGKKSKYQKKDKIVEDDFKPDLNDPRFKEVFEDRDFAIDPS 558

Query: 586 QPEFKGTAAMKQILQERTKRSHKGQNKKRKADGNL-ANQNGQSDLKGLV 633
           QPEFK TAAMKQILQER KRS K  +KKRK D    +  +   DLKGLV
Sbjct: 559 QPEFKETAAMKQILQERRKRSSKSASKKRKTDEQSDSAMDSAGDLKGLV 607

 Score = 75.9 bits (185), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 46/62 (74%)

Query: 1  MSQEKHAGKEESSDPRFANVHSDPKFRETKAKKFKIKLDDRFSKKDLQFKRKARVDKYGR 60
          M++      ++S D RFA + SDPKFR  K K  KIKLDDRFSK+DL++KRKA+VDKYGR
Sbjct: 1  MAKNNEGTGKDSIDKRFARIESDPKFRAPKQKNLKIKLDDRFSKQDLEYKRKAKVDKYGR 60

Query: 61 SL 62
           +
Sbjct: 61 RI 62

>YDR365C Chr4 complement(1204497..1206383) [1887 bp, 628 aa] {ON}
           ESF1Nucleolar protein involved in pre-rRNA processing;
           depletion causes severely decreased 18S rRNA levels
          Length = 628

 Score =  504 bits (1297), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 270/475 (56%), Positives = 329/475 (69%), Gaps = 20/475 (4%)

Query: 165 KPQSGDSSKTLAVVNLDWDHVKSTDLMITFSSFVPSGGKIIKIAVYPSEFGKERLKREEM 224
           KP+SGD SK LAVVNLDWDHVKS DLMITFSSFVP GGKI ++A+YPSEFGKER++REE+
Sbjct: 139 KPESGDISKNLAVVNLDWDHVKSEDLMITFSSFVPKGGKIERVAIYPSEFGKERMQREEV 198

Query: 225 EGPPREIFXXXXXXXXXXXXXXXXX-----VDVRDLYEEGDAE-DYDAKSLRRYQLDRLR 278
           EGPP+E+F                      + ++DLYEEGDA+ D D+++LR+YQLDRLR
Sbjct: 199 EGPPKELFQKKNKNKTSKKKKTDDSDSDMDIGIKDLYEEGDADKDVDSRALRQYQLDRLR 258

Query: 279 YFYAVVYCNNVATAEAIYKNCDGTEFESTANMFDLRYVPDGMTFDDEARDECTSIPKNYQ 338
           Y+YA+VYC++  T++AIY NCDGTE+ESTANMFDLRYVPDGMTFDD+ RDEC+ +PKNY+
Sbjct: 259 YYYAIVYCSDTTTSKAIYDNCDGTEYESTANMFDLRYVPDGMTFDDDVRDECSILPKNYR 318

Query: 339 PSQFSTDALQHSKVKLTWDETPADRVAMSKRAFTQKEIEDMDFKAYLASDSEESEPENNQ 398
           P QFSTDALQHS VKLTWDETPADRV ++KRAFTQKEI+DMDFKAYLASDS+ES+ + ++
Sbjct: 319 PHQFSTDALQHSSVKLTWDETPADRVEVAKRAFTQKEIDDMDFKAYLASDSDESDGQVDE 378

Query: 399 DLKTKLKSLVSQSVKVGDKSIFD--QAPEEGESDVDMQITFAPGLAEGAE---DDKQENA 453
           + K KLKSL      VGD       + P + + +VDM+ITF P L  G E   +DK+E  
Sbjct: 379 EAKNKLKSL------VGDFGFNSKKETPNDEDEEVDMEITFTPALEGGNEKSSEDKEETT 432

Query: 454 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSRYKPESTVEDAKSKAELEL 513
                                                        E   ++AKSKAELEL
Sbjct: 433 IEKIRRKEKERRKARKQKVKELKQQSEKDKKSKLKSVNKKHTNDEEEIEKNAKSKAELEL 492

Query: 514 LMMDDDENNSSSKLNKKAHFNMNEIVRSEKEKGKKSRYQNKDKIVEDEFKPDLNDPRFAE 573
           LM DDD+  +   +N KAHFNMNEI+RSEKEK KK RYQ K++IVED F PDL DPRF E
Sbjct: 493 LMDDDDDTETQGTINNKAHFNMNEILRSEKEKHKKGRYQKKERIVEDTFTPDLEDPRFKE 552

Query: 574 VFEDRDFAIDPSQPEFKGTAAMKQILQERTKRSHKGQNKKRKADGNLANQNGQSD 628
           VFED DFAIDP+QPEFKGT AM +IL+ER+KR    +NKKRK  G+  N    +D
Sbjct: 553 VFEDHDFAIDPTQPEFKGTQAMSKILKERSKRV---KNKKRKLGGSENNMTNNAD 604

 Score = 72.0 bits (175), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 34/55 (61%), Positives = 43/55 (78%)

Query: 9  KEESSDPRFANVHSDPKFRETKAKKFKIKLDDRFSKKDLQFKRKARVDKYGRSLK 63
          K+E  D RFA ++SDPKF+ TK K  KIKLD RFSKKDL+ + K++VDKYGR +K
Sbjct: 7  KKEGVDARFAGIYSDPKFKNTKTKDHKIKLDSRFSKKDLEVQHKSKVDKYGRKIK 61

>TBLA0A06540 Chr1 (1602559..1604538) [1980 bp, 659 aa] {ON}
           Anc_5.430 YDR365C
          Length = 659

 Score =  500 bits (1287), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 277/487 (56%), Positives = 334/487 (68%), Gaps = 20/487 (4%)

Query: 165 KPQSGDSSKTLAVVNLDWDHVKSTDLMITFSSFVPSGGKIIKIAVYPSEFGKERLKREEM 224
           KP++GD SKT+AVVNLDWDHVKSTDLMITFS F+P GGKI KIA+YPSEFGKER++REE+
Sbjct: 161 KPETGDPSKTVAVVNLDWDHVKSTDLMITFSGFIPKGGKINKIAIYPSEFGKERMQREEI 220

Query: 225 EGPPREIFXXXXXXXXXXXXXXX----XXVDVRDLYEEGDAE-DYDAKSLRRYQLDRLRY 279
           EGPP+E+F                     VD+ DLYEEGDA+ + D+KSLR+YQL+RLRY
Sbjct: 221 EGPPKELFKKKNKKGKKSTAEDNEDDVSDVDINDLYEEGDADKNIDSKSLRQYQLERLRY 280

Query: 280 FYAVVYCNNVATAEAIYKNCDGTEFESTANMFDLRYVPDGMTFDDEARDECTSIPKNYQP 339
           +YAVVYCNN+ TAE+IYKNCDGTE+ESTAN+FD+RYVPD MTFDD  RDEC  +PKNY+P
Sbjct: 281 YYAVVYCNNIGTAESIYKNCDGTEYESTANVFDIRYVPDEMTFDDTPRDECDQLPKNYKP 340

Query: 340 SQFSTDALQHSKVKLTWDETPADRVAMSKRAFTQKEIEDMDFKAYLASDSEESEPENNQD 399
            QFSTDALQHS VKLTWDETPADRV +SKRAF+QKEI++MDFKAYLASDS+ESE E N D
Sbjct: 341 LQFSTDALQHSNVKLTWDETPADRVEISKRAFSQKEIDEMDFKAYLASDSDESESELNND 400

Query: 400 LKTKLKSLVSQSV---KVGDKSIFDQAPEEGESDVDMQITFAPGL-----AEGAEDDKQE 451
            K KLKSLV         G  + +D    + E  VDM+ITF PGL     A   E  K+E
Sbjct: 401 SKNKLKSLVGGGAFGNVFGKDTEYDLDGSDDEDGVDMEITFTPGLDEKKEASDNETKKEE 460

Query: 452 NAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSRYKPESTVEDAK----- 506
           +                                         ++      ++D K     
Sbjct: 461 STIEKLQRKEKERRKLRKQKVKDLKEKSVQERKEKLNSNRNRNKKNNNELLKDEKEKQDK 520

Query: 507 SKAELELLMMDDDENNSSSKLNKKAHFNMNEIVRSEKEKGKKSRYQNKDKIVEDEFKPDL 566
           SKAELELLMMD+D+  S   +N KAHFNMNEI+RSEKEKGKKS+YQ+K+KIV+DEFKP+L
Sbjct: 521 SKAELELLMMDEDDRISG--VNNKAHFNMNEILRSEKEKGKKSKYQDKNKIVQDEFKPNL 578

Query: 567 NDPRFAEVFEDRDFAIDPSQPEFKGTAAMKQILQERTKRSHKGQNKKRKADGNLANQNGQ 626
           ND RF E+FED  FAIDP+QPEFK T+AMK+IL ERTKR+ K QNK +           +
Sbjct: 579 NDSRFDEIFEDHAFAIDPTQPEFKQTSAMKEILNERTKRASKKQNKDKDNKKRKNTNEDK 638

Query: 627 SDLKGLV 633
           SD+  +V
Sbjct: 639 SDISNIV 645

 Score = 64.3 bits (155), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 37/49 (75%)

Query: 14 DPRFANVHSDPKFRETKAKKFKIKLDDRFSKKDLQFKRKARVDKYGRSL 62
          D RFA V +DPKFR +K    K+KLD+RFSKKDLQ   K++VD+YGR +
Sbjct: 9  DARFAGVFTDPKFRRSKKDSLKVKLDNRFSKKDLQVNYKSKVDRYGRKI 57

>ZYRO0F09944g Chr6 complement(807207..809042) [1836 bp, 611 aa] {ON}
           similar to uniprot|Q06344 YDR365C Saccharomyces
           cerevisiae ESF1 Nucleolar protein involved in pre-rRNA
           processing
          Length = 611

 Score =  487 bits (1254), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 266/451 (58%), Positives = 326/451 (72%), Gaps = 22/451 (4%)

Query: 164 TKPQSGDSSKTLAVVNLDWDHVKSTDLMITFSSFVPSGGKIIKIAVYPSEFGKERLKREE 223
            KP+SGD SKTLAVVNLDWDHV++ DLMITFSSF+PSGGKI KI +YPSEFGKER++REE
Sbjct: 141 AKPESGDPSKTLAVVNLDWDHVRAADLMITFSSFLPSGGKIEKICIYPSEFGKERMQREE 200

Query: 224 MEGPPREIFXXXXXXXXXXXXXXXXXVDVRDLYEEGDAE-DYDAKSLRRYQLDRLRYFYA 282
            EGPPREIF                 VD+RDLYEEGDA+ + D  +LR+YQL+RLRY+YA
Sbjct: 201 KEGPPREIFNKKKKHHDEDSDSD---VDIRDLYEEGDADKEVDNAALRQYQLERLRYYYA 257

Query: 283 VVYCNNVATAEAIYKNCDGTEFESTANMFDLRYVPDGMTFDDEARDECTSIPKNYQPSQF 342
           +VYCNNV T E+IY NCDGTE+ESTAN+FDLRYVP+GM FDDE +DEC  +PKNY+P +F
Sbjct: 258 IVYCNNVETGESIYSNCDGTEYESTANIFDLRYVPEGMEFDDEPKDECKELPKNYKPLEF 317

Query: 343 STDALQHSKVKLTWDETPADRVAMSKRAFTQKEIEDMDFKAYLASDSEESE--PENNQDL 400
           STDALQHS VKLTWDETP DR+ +SKRAF+QKE+EDMDF+AYLAS ++ES+    NN++ 
Sbjct: 318 STDALQHSNVKLTWDETPTDRLEVSKRAFSQKELEDMDFQAYLASGTDESDGEENNNEEA 377

Query: 401 KTKLKSLVSQSVKVGDKSIFDQAPEEGESDVDMQITFAPGLAEG---AEDDKQENAXXXX 457
           K KLKSLV QS+  G         ++ E + DM+ITF PGL +    A++D +E      
Sbjct: 378 KNKLKSLVGQSLAYG---------KQQEEEPDMEITFTPGLDDSKPQADEDHEETTIEKV 428

Query: 458 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSRYKPESTVEDAKSKAELELLMMD 517
                                                + + ES   DAKSKAELELLMM 
Sbjct: 429 KRKEQERRKARKQRLKELKQQAEQEKKEKLRSGKNKKQVEDES---DAKSKAELELLMM- 484

Query: 518 DDENNSSSKLNKKAHFNMNEIVRSEKEKGKKSRYQNKDKIVEDEFKPDLNDPRFAEVFED 577
           +DE+++   LNKKAHFNMNEI++SEKEK KK +YQ+K KI+EDEFKPDLNDPRF EVFE+
Sbjct: 485 EDEDDTEKSLNKKAHFNMNEILKSEKEKKKKGKYQDKGKIMEDEFKPDLNDPRFNEVFEN 544

Query: 578 RDFAIDPSQPEFKGTAAMKQILQERTKRSHK 608
           +DFAIDPSQPE+K T AMK+IL+ER+KR+HK
Sbjct: 545 QDFAIDPSQPEYKSTKAMKEILEERSKRAHK 575

 Score = 79.3 bits (194), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 37/58 (63%), Positives = 45/58 (77%)

Query: 8  GKEESSDPRFANVHSDPKFRETKAKKFKIKLDDRFSKKDLQFKRKARVDKYGRSLKGQ 65
          G + SSDPRFA + +DPKFR  K K  K+KLDDRFSKKDL  +RKA+VDKYGR + G+
Sbjct: 6  GSKGSSDPRFAGIQNDPKFRNFKKKGLKVKLDDRFSKKDLDVRRKAKVDKYGRRITGE 63

>CAGL0L11638g Chr12 (1243194..1245020) [1827 bp, 608 aa] {ON}
           similar to uniprot|Q06344 Saccharomyces cerevisiae
           YDR365c
          Length = 608

 Score =  486 bits (1252), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 266/464 (57%), Positives = 330/464 (71%), Gaps = 12/464 (2%)

Query: 164 TKPQSGDSSKTLAVVNLDWDHVKSTDLMITFSSFVPSGGKIIKIAVYPSEFGKERLKREE 223
           TK ++GD++KTLA VNLDWDHV+S D+M+TFSSF+P GGKI KI +YPSEFGKER+KREE
Sbjct: 141 TKVETGDATKTLAAVNLDWDHVRSVDMMVTFSSFLPKGGKIEKICIYPSEFGKERMKREE 200

Query: 224 MEGPPREIFXXXXXXXX--XXXXXXXXXVDVRDLYEEGDAED-YDAKSLRRYQLDRLRYF 280
           +EGPPRE+F                   VD++DLYEEG+A+D  D ++LR+YQLDRLRY+
Sbjct: 201 VEGPPRELFQKNKKKKKKNSSEDEEESDVDIKDLYEEGNADDQVDKRALRQYQLDRLRYY 260

Query: 281 YAVVYCNNVATAEAIYKNCDGTEFESTANMFDLRYVPDGMTFDDEARDECTSIPKNYQPS 340
           YAV+YCNNV +A+AIY+NCDGTE+ESTAN+ DLRYVPDGM FDDE +D+C  +PKNY+P 
Sbjct: 261 YAVIYCNNVESAKAIYENCDGTEYESTANIIDLRYVPDGMDFDDEPKDQCEELPKNYKPH 320

Query: 341 QFSTDALQHSKVKLTWDETPADRVAMSKRAFTQKEIEDMDFKAYLASDSEESEPENNQDL 400
           QFSTDALQHS VKLTWDETP DRV ++KRAFTQKEIEDMDFKAYLASDS+ESE E N++ 
Sbjct: 321 QFSTDALQHSNVKLTWDETPVDRVEVAKRAFTQKEIEDMDFKAYLASDSDESEEEVNEEA 380

Query: 401 KTKLKSLVSQSVKVGDKSIFDQAPEEGESDVDMQITFAPGLAEGAEDDKQENAXXXXXXX 460
           K KLKSLV +S+K+  K   D+  +EG   +DM+ITF PGL E   + + ++        
Sbjct: 381 KNKLKSLVGESLKIDGKDGSDE--DEG---MDMEITFTPGLDEANAEGEDKDGEDNEETT 435

Query: 461 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSRYKPESTVEDAKSKAELELLMMDDDE 520
                                             + K +  + D K KAELELLMM  DE
Sbjct: 436 IEKVRRKEKERRKARKQKLKELKQKSEEEKKQKLKSKHDEPLSD-KKKAELELLMM--DE 492

Query: 521 NNSSSKLNKKAHFNMNEIVRSEKEKGKKSRYQNKDKIVEDEFKPDLNDPRFAEVFEDRDF 580
           N S+S +N KAHFNMNEI+RSEKEK KK ++Q K +IVED+FKP+L+D RF EVFED DF
Sbjct: 493 NESNSGINSKAHFNMNEILRSEKEKSKKGKFQKKQRIVEDDFKPNLDDDRFKEVFEDHDF 552

Query: 581 AIDPSQPEFKGTAAMKQILQERTKRSHKGQN-KKRKADGNLANQ 623
           AIDPSQPEFK T AMK+IL+ER KRS   ++ K+   D N  N+
Sbjct: 553 AIDPSQPEFKETKAMKEILKERRKRSRDSKHGKEEHTDKNDINK 596

 Score = 75.1 bits (183), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 47/54 (87%)

Query: 10 EESSDPRFANVHSDPKFRETKAKKFKIKLDDRFSKKDLQFKRKARVDKYGRSLK 63
          E+S+DPRF+ +++DPKF+++ +K+ KIKLDDRF KKDL+  R+A+VDKYGR +K
Sbjct: 4  EKSNDPRFSRIYNDPKFKKSNSKQLKIKLDDRFGKKDLEVARRAKVDKYGRKIK 57

>KNAG0C04940 Chr3 (953539..955467) [1929 bp, 642 aa] {ON} Anc_5.430
           YDR365C
          Length = 642

 Score =  476 bits (1225), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 270/485 (55%), Positives = 336/485 (69%), Gaps = 17/485 (3%)

Query: 165 KPQSGDSSKTLAVVNLDWDHVKSTDLMITFSSFVPSGGKIIKIAVYPSEFGKERLKREEM 224
           KP+SGD SKTLAVVNLDWDHVKS DLMITF+ F+P GGKI +I +YPSEFGKERL REE 
Sbjct: 146 KPESGDPSKTLAVVNLDWDHVKSVDLMITFTGFIPKGGKIERICIYPSEFGKERLNREEK 205

Query: 225 EGPPREIFXXXXX----------XXXXXXXXXXXXVDVRDLYEEGDAE-DYDAKSLRRYQ 273
           EGPP+E+F                           VD++DLYEEGDAE D D+K+LR+YQ
Sbjct: 206 EGPPKELFHKKKSKKNSAAKSKGAESGKSDDDVSDVDIKDLYEEGDAEKDIDSKALRQYQ 265

Query: 274 LDRLRYFYAVVYCNNVATAEAIYKNCDGTEFESTANMFDLRYVPDGMTFDDEARDECTSI 333
           L+RLRYFYAVVYCNNV TA+AIY NCD TE+ESTANMFDLRYVP+GMTFDD+ RDEC ++
Sbjct: 266 LERLRYFYAVVYCNNVETAKAIYDNCDATEYESTANMFDLRYVPEGMTFDDDPRDECEAL 325

Query: 334 PKNYQPSQFSTDALQHSKVKLTWDETPADRVAMSKRAFTQKEIEDMDFKAYLASDSEESE 393
           PKNY+P  F+TDALQHS VKLTWDETPADRV ++KRAF+QKEI+DMDFKAYLASDSE+S+
Sbjct: 326 PKNYKPLNFATDALQHSNVKLTWDETPADRVEIAKRAFSQKEIDDMDFKAYLASDSEDSD 385

Query: 394 PENNQDLKTKLKSLVSQSVKVGDKSIFDQAPEEGESDVDMQITFAPGLAEGAEDDKQENA 453
            + ++ +K +LK+LV  ++K        +  E+ E  +DM+ITF PGL E    +++  A
Sbjct: 386 AKVDETMKNRLKALVGGTLKASRPKGGAEEDEDDEEGMDMEITFTPGLDEAQVAEQEAAA 445

Query: 454 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXS----RYKPESTVEDAKSKA 509
                                                   S    R   E    D K+KA
Sbjct: 446 EEESTIDKIRRKEKERRKNRKQKLKELKKNAEKEKRDKLKSLKKGRKNGEEEPVDDKAKA 505

Query: 510 ELELLMMD-DDENNSSSKLNKKAHFNMNEIVRSEKEKGKKSRYQNKDKIVEDEFKPDLND 568
           ELELLMMD D+E +S S LNKK HFNMNEI+RSEKEK KKS++Q+K++IVEDEFKPDL+D
Sbjct: 506 ELELLMMDEDEERDSKSTLNKKMHFNMNEIMRSEKEKKKKSKFQDKNRIVEDEFKPDLSD 565

Query: 569 PRFAEVFEDRDFAIDPSQPEFKGTAAMKQILQERTKRSHKGQNKKRKADGNLANQNGQSD 628
            RF EVFED DFAIDPS+PEFK T AM++ILQER+ R+ + + KKRK+     + + ++D
Sbjct: 566 DRFKEVFEDHDFAIDPSRPEFKETPAMQKILQERSNRA-RSKGKKRKSAEQSTDTSDKTD 624

Query: 629 LKGLV 633
           +  +V
Sbjct: 625 ISQIV 629

 Score = 80.1 bits (196), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 45/52 (86%)

Query: 12 SSDPRFANVHSDPKFRETKAKKFKIKLDDRFSKKDLQFKRKARVDKYGRSLK 63
          SSDPRF+ V++DPKFR TK KK K+KLD RFSKKDL+ K+KA+VDKYGR +K
Sbjct: 6  SSDPRFSGVYNDPKFRSTKEKKLKVKLDSRFSKKDLEVKKKAKVDKYGRKIK 57

>Skud_4.635 Chr4 complement(1133271..1135160) [1890 bp, 629 aa] {ON}
           YDR365C (REAL)
          Length = 629

 Score =  474 bits (1220), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 265/471 (56%), Positives = 319/471 (67%), Gaps = 15/471 (3%)

Query: 167 QSGDSSKTLAVVNLDWDHVKSTDLMITFSSFVPSGGKIIKIAVYPSEFGKERLKREEMEG 226
           +SGD SKTLAVVNLDWDHVKS DLMITFSSFVP GGKI +IA++PSEFG+ER++REE+EG
Sbjct: 141 ESGDVSKTLAVVNLDWDHVKSEDLMITFSSFVPRGGKIERIAIFPSEFGRERMEREEVEG 200

Query: 227 PPREIFXXXXXXXXXXXXXXXXX-----VDVRDLYEEGDAE-DYDAKSLRRYQLDRLRYF 280
           PP+E+F                      + + DLYEEGDA+ D D+++LR+YQLDRLRY+
Sbjct: 201 PPKELFQKKNKNKHAKEKNSVGTDSDGDIGINDLYEEGDADKDVDSRALRQYQLDRLRYY 260

Query: 281 YAVVYCNNVATAEAIYKNCDGTEFESTANMFDLRYVPDGMTFDDEARDECTSIPKNYQPS 340
           YAVV C++  +A+AIY NCDGTE+ESTANMFDLRYVPDGMTFDD ARDECTS+PKNY+P 
Sbjct: 261 YAVVCCSDTTSAKAIYDNCDGTEYESTANMFDLRYVPDGMTFDDAARDECTSLPKNYRPH 320

Query: 341 QFSTDALQHSKVKLTWDETPADRVAMSKRAFTQKEIEDMDFKAYLASDSEESEPENNQDL 400
           QFSTDALQHS VKLTWDETPADR+ ++KRAFTQKEI+DMDFKAYLASDS+ES+ + ++D 
Sbjct: 321 QFSTDALQHSNVKLTWDETPADRLEVAKRAFTQKEIDDMDFKAYLASDSDESDEQVDEDA 380

Query: 401 KTKLKSLVSQSVKVGDKSIFDQAPEEGESDVDMQITFAPGLAEGAEDDKQENAXXXXXXX 460
           K KLKSLV        K   +   EEGE  VDM+ITF P L EG  +   E         
Sbjct: 381 KNKLKSLVGGLDFNMKKKGANDGKEEGE--VDMEITFTPAL-EGENEKPIEGQDETTIEK 437

Query: 461 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSRYK----PESTVEDAKSKAELELLMM 516
                                               K     E    +AKSKAELELL M
Sbjct: 438 IRRKEKERRKARKQKVKELKQQSEKDKKSKLKSVNKKHVADEEEIKNNAKSKAELELL-M 496

Query: 517 DDDENNSSSKLNKKAHFNMNEIVRSEKEKGKKSRYQNKDKIVEDEFKPDLNDPRFAEVFE 576
           D+D+  +   +N KAHF+M EI+RSEKEK K+ RYQ K++IVED F PDL DPRF EVFE
Sbjct: 497 DEDDAETEGSMNSKAHFSMKEILRSEKEKHKRGRYQKKERIVEDTFAPDLEDPRFKEVFE 556

Query: 577 DRDFAIDPSQPEFKGTAAMKQILQERTKRSHKGQNKKRKADGNLANQNGQS 627
           D DFAIDP+QPE+K T AM  IL+ER KR  K + +K   +GN   +NG S
Sbjct: 557 DHDFAIDPTQPEYKNTQAMSTILKERGKRV-KDKKRKHSDNGNDVAKNGDS 606

 Score = 68.9 bits (167), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 41/53 (77%)

Query: 11 ESSDPRFANVHSDPKFRETKAKKFKIKLDDRFSKKDLQFKRKARVDKYGRSLK 63
          ES D RFA + SDPKF+ T+ +  KIKLD RFSKKDL+ + K++VDKYGR +K
Sbjct: 9  ESIDARFAGISSDPKFKNTRTRDHKIKLDSRFSKKDLEVQHKSKVDKYGRKIK 61

>TDEL0E01950 Chr5 (367743..369596) [1854 bp, 617 aa] {ON} Anc_5.430
           YDR365C
          Length = 617

 Score =  473 bits (1217), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 273/480 (56%), Positives = 342/480 (71%), Gaps = 19/480 (3%)

Query: 164 TKPQSGDSSKTLAVVNLDWDHVKSTDLMITFSSFVPSGGKIIKIAVYPSEFGKERLKREE 223
           T+P SGDSSKTLAVVNLDWD+V+S+DLMITFSSF+P+GG+I KIA+YPSEFGKER++REE
Sbjct: 133 TEPSSGDSSKTLAVVNLDWDNVRSSDLMITFSSFLPAGGRIEKIAIYPSEFGKERMQREE 192

Query: 224 MEGPPREIFXXXXXXXXX-XXXXXXXXVDVRDLYEEGDAE-DYDAKSLRRYQLDRLRYFY 281
           +EGPP+E+F                  +DV+DLYEEGDA+ + D K+LR+YQLDRLRY+Y
Sbjct: 193 VEGPPKELFQKKKKKSKKGQQEDSDSDIDVKDLYEEGDADKNVDNKALRQYQLDRLRYYY 252

Query: 282 AVVYCNNVATAEAIYKNCDGTEFESTANMFDLRYVPDGMTFDDEARDECTSIPKNYQPSQ 341
           AVVYCNNVA AE+IY NCDGTE+ESTAN+FD+RYVPDGM FD + +D CT +PKNY+P Q
Sbjct: 253 AVVYCNNVAAAESIYNNCDGTEYESTANIFDIRYVPDGMDFDGKPKDSCTELPKNYKPLQ 312

Query: 342 FSTDALQHSKVKLTWDETPADRVAMSKRAFTQKEIEDMDFKAYLASDSEESEPENNQDLK 401
           FSTDALQHS VKLTWDETPADR+ ++KRAFTQKEIEDMDFKAYLASDS++SE E +   K
Sbjct: 313 FSTDALQHSNVKLTWDETPADRLDVAKRAFTQKEIEDMDFKAYLASDSDDSEDEVDAQSK 372

Query: 402 TKLKSLVSQSVKVGDKSIFD----QAPEEGESD--VDMQITFAPGLAEGAEDDKQENAXX 455
           +KLKSLV+ S      S FD     A E   +D  VDM+ITF PGL E  +D ++     
Sbjct: 373 SKLKSLVTGS------SAFDFTRKNADEVDGNDEEVDMEITFTPGLDEANKDGQEGQEEE 426

Query: 456 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSRYKPESTVE-DAKSKAELELL 514
                                                  R K  S +E D KSKAELELL
Sbjct: 427 STIDKVRRKEKERRKARKAKVKELKHQAEQDKKVKLKKGRGKQTSDIEQDPKSKAELELL 486

Query: 515 MMDDDENNSSSKLNKKAHFNMNEIVRSEKEKGKKSRYQNKDKIVEDEFKPDLNDPRFAEV 574
           MM DDE+++   +NKKAHFNM EI++SEKEK KK++YQ+K+KIV D+FKPDL DPRF E+
Sbjct: 487 MM-DDEDDTEKSINKKAHFNMKEILKSEKEKKKKNKYQDKNKIVVDDFKPDLEDPRFKEM 545

Query: 575 FEDRDFAIDPSQPEFKGTAAMKQILQERTKRSHKGQNKKRKADG-NLANQNGQSDLKGLV 633
           FE  DFAIDP+Q EF+GT AMK++L +R+K++H+  +K++ A   N  N+NG  D+  +V
Sbjct: 546 FEGHDFAIDPTQSEFRGTKAMKEMLNKRSKQAHRVNSKRKIATQENDTNENG--DIANIV 603

 Score = 75.1 bits (183), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 41/52 (78%)

Query: 12 SSDPRFANVHSDPKFRETKAKKFKIKLDDRFSKKDLQFKRKARVDKYGRSLK 63
          S DPRF+ ++ DPKF   K K FK+KLDDRFSKKDL+ KRK +VDKYGR ++
Sbjct: 6  SKDPRFSKIYDDPKFNNVKTKGFKVKLDDRFSKKDLEIKRKTKVDKYGRRMR 57

>Ecym_4790 Chr4 complement(1534067..1535959) [1893 bp, 630 aa] {ON}
           similar to Ashbya gossypii AER259W + AER260C
          Length = 630

 Score =  402 bits (1032), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 185/282 (65%), Positives = 227/282 (80%), Gaps = 3/282 (1%)

Query: 164 TKPQSGDSSKTLAVVNLDWDHVKSTDLMITFSSFVPSGGKIIKIAVYPSEFGKERLKREE 223
           +KP++GD +K  AVVNLDWDHV+S DL+ TF+SFVP+GG I K+A+YPSEFGKER+KREE
Sbjct: 146 SKPETGDPTKVFAVVNLDWDHVRSVDLLATFNSFVPNGGSIKKVAIYPSEFGKERMKREE 205

Query: 224 MEGPPREIFXXXXXXXXXXXXXXXXXVDVRDLYEEGDAE-DYDAKSLRRYQLDRLRYFYA 282
           +EGPPRE+F                 +D+ DLYE  DAE DYD+K+LRRYQLDRLRY+YA
Sbjct: 206 VEGPPRELFKRKQSKKEKDSDDENSDIDINDLYEVDDAEKDYDSKALRRYQLDRLRYYYA 265

Query: 283 VVYCNNVATAEAIYKNCDGTEFESTANMFDLRYVPDGMTFDDEARDECTSIPKNYQPSQF 342
           VVYC++V TA+AIY+NCDGTEFESTANMFDLRYVPD M F+D+ RD+C S+PK+Y+P+QF
Sbjct: 266 VVYCSDVLTAKAIYQNCDGTEFESTANMFDLRYVPDNMKFEDDPRDQCVSVPKDYKPTQF 325

Query: 343 STDALQHSKVKLTWDETPADRVAMSKRAFTQKEIEDMDFKAYLASDSEESEPENNQDLKT 402
           ST ALQHS+VKLTWDETPADRV +SKRAF QKEIE+MDFKAYLASDS+ SE E N+  K 
Sbjct: 326 STSALQHSQVKLTWDETPADRVEISKRAFNQKEIEEMDFKAYLASDSDSSEGETNEKTKN 385

Query: 403 KLKSLVSQSVKVGDKSIFDQAPEEGESDVDMQITFAPGLAEG 444
            L+SLV+ S++V  KS+FD+   E E+DV  +ITF PGL  G
Sbjct: 386 ALRSLVNDSIQVAHKSVFDKHGSEEEADV--EITFTPGLENG 425

 Score =  141 bits (356), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 76/112 (67%), Positives = 88/112 (78%), Gaps = 4/112 (3%)

Query: 525 SKLNKKAHFNMNEIVRSEKEKGKKSRYQNKDKIVEDEFKPDLNDPRFAEVFEDRDFAIDP 584
           S LN  AHFNMNEI++S+KEK KKSRYQNK+ IV+D FKPDLNDPRF EVFED DFAIDP
Sbjct: 507 STLNNNAHFNMNEIIKSQKEKTKKSRYQNKNVIVDDNFKPDLNDPRFKEVFEDHDFAIDP 566

Query: 585 SQPEFKGTAAMKQILQERTKRSHKGQN--KKRKADGNLANQNGQSD-LKGLV 633
           SQPEFK T AMK+IL+ERT+RS K +    KRKA  +   Q+GQ+D L  LV
Sbjct: 567 SQPEFKKTPAMKEILEERTRRSSKMKKAFNKRKASYDHP-QSGQTDSLNSLV 617

 Score = 78.2 bits (191), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 37/62 (59%), Positives = 47/62 (75%)

Query: 1  MSQEKHAGKEESSDPRFANVHSDPKFRETKAKKFKIKLDDRFSKKDLQFKRKARVDKYGR 60
          MS ++      ++D RFA +H+DPKFR+ K  K KI LDDRFSKKDL+FKRKA+VDKYGR
Sbjct: 1  MSDKREKRDPVTNDSRFAGIHNDPKFRKPKVNKLKITLDDRFSKKDLEFKRKAKVDKYGR 60

Query: 61 SL 62
           +
Sbjct: 61 RI 62

>TDEL0E02560 Chr5 (493910..495319) [1410 bp, 469 aa] {ON} Anc_5.372
           YDR329C
          Length = 469

 Score = 32.0 bits (71), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 37/86 (43%), Gaps = 5/86 (5%)

Query: 547 KKSRYQNKDKIVEDEFKPDLNDPRFAEVFEDRDFAIDPSQPEFKGTAAMKQILQE----- 601
           K+  YQ + KI E  F  +    RF +  ED  +A+    P F    A K  L+E     
Sbjct: 41  KRWLYQQQLKITEQHFIREQIRRRFTQTQEDTLYALYELIPVFAMVLAKKLDLEELLIAL 100

Query: 602 RTKRSHKGQNKKRKADGNLANQNGQS 627
           R K+  KG   K K   N A  +G S
Sbjct: 101 RDKKLSKGTGNKGKLSDNDALSSGIS 126

>NDAI0C01220 Chr3 (246762..251291) [4530 bp, 1509 aa] {ON} Anc_5.500
          Length = 1509

 Score = 32.0 bits (71), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 47/96 (48%), Gaps = 16/96 (16%)

Query: 516 MDDDENNSSSKLNKKAHFN------MNEIVRS-EKEKGKKSRYQNKDKIVEDEFKPDLN- 567
           +DDD ++S S L++   F+      + ++ RS   + G  S Y N+D   E  F PD+  
Sbjct: 14  IDDDASSSQSNLHEYHGFDYDAEQRVRDLARSLTHQSGNISTYSNQDAATESIFTPDMEG 73

Query: 568 -DPRF----AEVFEDRDFAIDPSQPEFKGTAAMKQI 598
            +P F    AE + ++   +DP+   F   A ++ +
Sbjct: 74  INPIFTNKEAEEYNEK---LDPTSENFSSKAWVQNM 106

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.128    0.356 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 55,316,199
Number of extensions: 2298559
Number of successful extensions: 10009
Number of sequences better than 10.0: 114
Number of HSP's gapped: 10358
Number of HSP's successfully gapped: 160
Length of query: 644
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 528
Effective length of database: 40,180,143
Effective search space: 21215115504
Effective search space used: 21215115504
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 69 (31.2 bits)