Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_55.214375.431ON55455427110.0
KLTH0F16126g5.431ON55453821050.0
SAKL0G02464g5.431ON56356315720.0
Suva_8.1715.431ON56755013111e-175
YOR118W (RTC5)5.431ON56755013051e-175
Smik_15.2965.431ON56654912691e-169
KLLA0E21143g5.431ON57254712051e-159
Ecym_47645.431ON56654912021e-159
NCAS0H020505.431ON57355312011e-159
Skud_15.2815.431ON56753811911e-157
NDAI0C016105.431ON58457011851e-156
TDEL0E019405.431ON56755111561e-152
ZYRO0F09966g5.431ON55454911311e-148
TPHA0H017905.431ON56554510901e-142
KNAG0B042305.431ON57754810731e-139
Kpol_1016.75.431ON56254910631e-138
AER258C5.431ON5575489601e-123
CAGL0L11616g5.431ON5555499391e-120
TBLA0A065305.431ON4925235881e-68
YNL224C (SQS1)2.17ON76781800.45
KLTH0E13706g8.592ON38478742.1
TPHA0L020202.649ON58343714.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_55.21437
         (554 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_55.21437 s55 complement(836842..838506) [1665 bp, 554 aa] {...  1048   0.0  
KLTH0F16126g Chr6 complement(1308133..1309797) [1665 bp, 554 aa]...   815   0.0  
SAKL0G02464g Chr7 (204358..206049) [1692 bp, 563 aa] {ON} simila...   610   0.0  
Suva_8.171 Chr8 (304635..306338) [1704 bp, 567 aa] {ON} YOR118W ...   509   e-175
YOR118W Chr15 (546857..548560) [1704 bp, 567 aa] {ON}  RTC5Prote...   507   e-175
Smik_15.296 Chr15 (507990..509690) [1701 bp, 566 aa] {ON} YOR118...   493   e-169
KLLA0E21143g Chr5 complement(1888085..1889803) [1719 bp, 572 aa]...   468   e-159
Ecym_4764 Chr4 complement(1484832..1486532) [1701 bp, 566 aa] {O...   467   e-159
NCAS0H02050 Chr8 (398606..400327) [1722 bp, 573 aa] {ON} Anc_5.4...   467   e-159
Skud_15.281 Chr15 (503290..504993) [1704 bp, 567 aa] {ON} YOR118...   463   e-157
NDAI0C01610 Chr3 complement(343850..345604) [1755 bp, 584 aa] {O...   461   e-156
TDEL0E01940 Chr5 complement(365414..367117) [1704 bp, 567 aa] {O...   449   e-152
ZYRO0F09966g Chr6 (809604..811268) [1665 bp, 554 aa] {ON} simila...   440   e-148
TPHA0H01790 Chr8 (412229..413926) [1698 bp, 565 aa] {ON} Anc_5.4...   424   e-142
KNAG0B04230 Chr2 complement(803845..805578) [1734 bp, 577 aa] {O...   417   e-139
Kpol_1016.7 s1016 complement(14315..16003) [1689 bp, 562 aa] {ON...   414   e-138
AER258C Chr5 complement(1111936..1113609) [1674 bp, 557 aa] {ON}...   374   e-123
CAGL0L11616g Chr12 complement(1240790..1242457) [1668 bp, 555 aa...   366   e-120
TBLA0A06530 Chr1 complement(1600111..1601589) [1479 bp, 492 aa] ...   231   1e-68
YNL224C Chr14 complement(224796..227099) [2304 bp, 767 aa] {ON} ...    35   0.45 
KLTH0E13706g Chr5 complement(1213291..1214445) [1155 bp, 384 aa]...    33   2.1  
TPHA0L02020 Chr12 complement(419703..421454) [1752 bp, 583 aa] {...    32   4.9  

>Kwal_55.21437 s55 complement(836842..838506) [1665 bp, 554 aa] {ON}
           YOR118W - Hypothetical ORF [contig 130] FULL
          Length = 554

 Score = 1048 bits (2711), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 520/554 (93%), Positives = 520/554 (93%)

Query: 1   MGQXXXXXXXXXXXXPQFNSEKDVIIWFDKKAIKSLTSPELVSFKANINGKDLSDVVTSD 60
           MGQ            PQFNSEKDVIIWFDKKAIKSLTSPELVSFKANINGKDLSDVVTSD
Sbjct: 1   MGQSTSTVSSNTSATPQFNSEKDVIIWFDKKAIKSLTSPELVSFKANINGKDLSDVVTSD 60

Query: 61  ELLKVLRLDGVNETVSSLIFNCVQTLSNFPFIRDCYENITYSGLLKSCVLLNKARCLSYV 120
           ELLKVLRLDGVNETVSSLIFNCVQTLSNFPFIRDCYENITYSGLLKSCVLLNKARCLSYV
Sbjct: 61  ELLKVLRLDGVNETVSSLIFNCVQTLSNFPFIRDCYENITYSGLLKSCVLLNKARCLSYV 120

Query: 121 KNKRYDHTKLVYISLALNKTVKEVXXXXXXXXXLDAPRIIATFNSVCVEELTVPSEVMLE 180
           KNKRYDHTKLVYISLALNKTVKEV         LDAPRIIATFNSVCVEELTVPSEVMLE
Sbjct: 121 KNKRYDHTKLVYISLALNKTVKEVSSSSNSQESLDAPRIIATFNSVCVEELTVPSEVMLE 180

Query: 181 FITLMLKMSKSTIIKNSKLDPNVSEGWESFRPFALSILRTMNTNIATQNDLLKYGITFSQ 240
           FITLMLKMSKSTIIKNSKLDPNVSEGWESFRPFALSILRTMNTNIATQNDLLKYGITFSQ
Sbjct: 181 FITLMLKMSKSTIIKNSKLDPNVSEGWESFRPFALSILRTMNTNIATQNDLLKYGITFSQ 240

Query: 241 FQSTISTVCPNLLLPFESLMEHVLFLGRDLVDIDASQPPLLESKLVSEPLLAQLATVWPR 300
           FQSTISTVCPNLLLPFESLMEHVLFLGRDLVDIDASQPPLLESKLVSEPLLAQLATVWPR
Sbjct: 241 FQSTISTVCPNLLLPFESLMEHVLFLGRDLVDIDASQPPLLESKLVSEPLLAQLATVWPR 300

Query: 301 ELVFSRLQKLYVGRDSGFSMRSFQAKAFKWMAPSILLIHGVRIPNDEEYAKSKNHRYKNF 360
           ELVFSRLQKLYVGRDSGFSMRSFQAKAFKWMAPSILLIHGVRIPNDEEYAKSKNHRYKNF
Sbjct: 301 ELVFSRLQKLYVGRDSGFSMRSFQAKAFKWMAPSILLIHGVRIPNDEEYAKSKNHRYKNF 360

Query: 361 LEEYPRLKEEDQVLLPPFSGKKKLLFAVYVNVPWKVTNSELFGDLKTTIIQLSPIQEVYK 420
           LEEYPRLKEEDQVLLPPFSGKKKLLFAVYVNVPWKVTNSELFGDLKTTIIQLSPIQEVYK
Sbjct: 361 LEEYPRLKEEDQVLLPPFSGKKKLLFAVYVNVPWKVTNSELFGDLKTTIIQLSPIQEVYK 420

Query: 421 ASRPGNIYFNTLGGGIGVGSPQPIVKPTSRKYLPGNVSLTIDPNLEFAVFRSAGFGGSIK 480
           ASRPGNIYFNTLGGGIGVGSPQPIVKPTSRKYLPGNVSLTIDPNLEFAVFRSAGFGGSIK
Sbjct: 421 ASRPGNIYFNTLGGGIGVGSPQPIVKPTSRKYLPGNVSLTIDPNLEFAVFRSAGFGGSIK 480

Query: 481 PSSTIVNEHKFLIQDIEAWGCGGEKELEEQMKNXXXXXXXXXXXXXINLKSINDDRALLE 540
           PSSTIVNEHKFLIQDIEAWGCGGEKELEEQMKN             INLKSINDDRALLE
Sbjct: 481 PSSTIVNEHKFLIQDIEAWGCGGEKELEEQMKNWEWEEAEAQRRQRINLKSINDDRALLE 540

Query: 541 MAGLVGQNQSGGSI 554
           MAGLVGQNQSGGSI
Sbjct: 541 MAGLVGQNQSGGSI 554

>KLTH0F16126g Chr6 complement(1308133..1309797) [1665 bp, 554 aa]
           {ON} similar to uniprot|Q12108 YOR118W Saccharomyces
           cerevisiae Hypothetical ORF
          Length = 554

 Score =  815 bits (2105), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/538 (71%), Positives = 453/538 (84%)

Query: 17  QFNSEKDVIIWFDKKAIKSLTSPELVSFKANINGKDLSDVVTSDELLKVLRLDGVNETVS 76
            F SE D++ W+DKKA+K +++PELVS+K NI+GK L   +   EL++VLRL   NE V 
Sbjct: 17  HFESENDLLSWYDKKALKLVSTPELVSYKGNIDGKPLDAALNRKELMRVLRLQNANEAVE 76

Query: 77  SLIFNCVQTLSNFPFIRDCYENITYSGLLKSCVLLNKARCLSYVKNKRYDHTKLVYISLA 136
            L+FNCVQTL+NFP I+DCYEN+TY G+LKSCVLLNK RCL YV++KRY+HTKLVYISLA
Sbjct: 77  GLLFNCVQTLANFPLIKDCYENVTYMGVLKSCVLLNKNRCLEYVQDKRYNHTKLVYISLA 136

Query: 137 LNKTVKEVXXXXXXXXXLDAPRIIATFNSVCVEELTVPSEVMLEFITLMLKMSKSTIIKN 196
           LNK VKE+         LDAP++IATFN+V  EEL VP+E MLEF+TLML MSK+T+IKN
Sbjct: 137 LNKAVKEMSSLPNSNDSLDAPKVIATFNNVAEEELVVPAETMLEFLTLMLTMSKATVIKN 196

Query: 197 SKLDPNVSEGWESFRPFALSILRTMNTNIATQNDLLKYGITFSQFQSTISTVCPNLLLPF 256
           S+LD N+SE W+SF+  ALSILRTMNT+I T  D LK  I+++QFQ+ IS+VCPNLL+P 
Sbjct: 197 SRLDVNISEKWDSFKTCALSILRTMNTDILTSQDALKNVISYTQFQNVISSVCPNLLVPL 256

Query: 257 ESLMEHVLFLGRDLVDIDASQPPLLESKLVSEPLLAQLATVWPRELVFSRLQKLYVGRDS 316
           E LMEHVLFL RDLVD++AS+P + +SKLV+EPLLAQLATVWPRELVFSRLQKLYVGRDS
Sbjct: 257 ECLMEHVLFLNRDLVDLEASKPLIPQSKLVTEPLLAQLATVWPRELVFSRLQKLYVGRDS 316

Query: 317 GFSMRSFQAKAFKWMAPSILLIHGVRIPNDEEYAKSKNHRYKNFLEEYPRLKEEDQVLLP 376
           GFSMRSFQAKAFKWMAPSILL+ G RIP+D++YAK+KN RYK FL+EYPRLK+EDQ +LP
Sbjct: 317 GFSMRSFQAKAFKWMAPSILLVQGSRIPDDQDYAKNKNQRYKKFLDEYPRLKDEDQHILP 376

Query: 377 PFSGKKKLLFAVYVNVPWKVTNSELFGDLKTTIIQLSPIQEVYKASRPGNIYFNTLGGGI 436
             SGK+KLLFA+ +N PWKVTNSELFGD+KTTI+QLSPIQEVYKAS+PGN+YFNTLGGGI
Sbjct: 377 ALSGKRKLLFAILINEPWKVTNSELFGDIKTTIVQLSPIQEVYKASKPGNVYFNTLGGGI 436

Query: 437 GVGSPQPIVKPTSRKYLPGNVSLTIDPNLEFAVFRSAGFGGSIKPSSTIVNEHKFLIQDI 496
           G+GSPQPI+K +  K++PGNVSLTIDPNLEFA FR+ GFGGSI PS+T  +EHKFLIQDI
Sbjct: 437 GIGSPQPIIKSSGVKFVPGNVSLTIDPNLEFAAFRNVGFGGSIAPSNTPTSEHKFLIQDI 496

Query: 497 EAWGCGGEKELEEQMKNXXXXXXXXXXXXXINLKSINDDRALLEMAGLVGQNQSGGSI 554
           E WGCGGEKELEEQMKN             INLKS+NDDRALLE+AGLVGQNQSGGS+
Sbjct: 497 ETWGCGGEKELEEQMKNWEWEEAEAQRRQRINLKSVNDDRALLELAGLVGQNQSGGSV 554

>SAKL0G02464g Chr7 (204358..206049) [1692 bp, 563 aa] {ON} similar
           to uniprot|Q12108 YOR118W Saccharomyces cerevisiae
           Hypothetical ORF
          Length = 563

 Score =  610 bits (1572), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/563 (53%), Positives = 407/563 (72%), Gaps = 9/563 (1%)

Query: 1   MGQXXXXXXXXXXXXPQFNSEKDVIIWFDKKAIKSLTSPELVSFKANINGKDLSDVVTSD 60
           MGQ             QF S+ D++ +F  +A K  T+PELV+FK+N+ GKD +D V+ +
Sbjct: 1   MGQTASSGTGTTGNVLQFESQHDLLGYFAARATKQFTTPELVAFKSNLKGKDQNDKVSVE 60

Query: 61  ELLKVLRLDGVNETVSSLIFNCVQTLSNFPFIRDCYENITYSGLLKSCVLLNKARCLSYV 120
           E+L++L++   NE ++ L+ NC++TLSNFP IR+ Y++IT +GLLKSC+LL+  RC+ YV
Sbjct: 61  EMLQLLKIPLGNELLADLLHNCIKTLSNFPLIRESYDDITVAGLLKSCILLSHDRCIKYV 120

Query: 121 KNKRYDHTKLVYISLALNKTVKEVXXXXXXXXXLDAPRIIATFNSVCVEELTVPSEVMLE 180
             K YD  KL+YI+LAL KTVKE+          DA  II  +NSV +++L VP++ ML+
Sbjct: 121 GFKNYDQLKLIYIALALRKTVKELPSSPDPAKPWDAKSIIRNYNSVDIDDLYVPADSMLQ 180

Query: 181 FITLMLKMSKSTIIKNSKLDPNVSEGWESFRPFALSILRTMNTNIATQNDLLKYGITFSQ 240
            +TL L +S+   + N+K+  +V + W+ ++  A+++LRTMN +I    D ++  I+F Q
Sbjct: 181 LLTLSLVLSRHCTVNNAKIRESVFQHWDDYKANAMNLLRTMNPDIVNTQDTVQCVISFEQ 240

Query: 241 FQSTISTVCPNLLLPFESLMEHVLFLGRDLVDIDASQPPLLESKLVSEPLLAQLATVWPR 300
           F + I+ V P +L P E L+EH+L+L RDL D   S      SKLV+EPLLAQL+T+ P+
Sbjct: 241 FSNAIAAVFPQVLKPLEILVEHMLYLDRDLTDELNSTSMPSTSKLVTEPLLAQLSTMLPK 300

Query: 301 ELVFSRLQKLYVGRDSGFSMRSFQAKAFKWMAPSILLIHGVRIPNDEEYAKSKNHRYKNF 360
           ELV+S+L+KLYVGR+SGFSMRSFQ+KAFKWMAPSILLI G+RI +D+EYA +KN RYK F
Sbjct: 301 ELVYSKLRKLYVGRESGFSMRSFQSKAFKWMAPSILLIGGMRITDDQEYATTKNPRYKKF 360

Query: 361 LEEYPRLKEEDQVLLPPFS-GKKKLLFAVYVNVPWKVTNSELFGDLKTTIIQLSPIQEVY 419
           LEEYPRLK++DQ ++ P S  ++KLLFAVYVN PWKVTN ELFGDLKTT++QLSP QE++
Sbjct: 361 LEEYPRLKDKDQHIIDPCSLNRRKLLFAVYVNEPWKVTNKELFGDLKTTVVQLSPKQELF 420

Query: 420 KASRPGNIYFNTLGGGIGVGSPQPIVKPTSRKYLPGNVSLTIDPNLEFAVFRSAGFGGSI 479
           KA R GN+YFNTLGGGIGVG  QP++KP  +KY PGNVSLTID +LEFA FR  G+GG+I
Sbjct: 421 KAVRTGNVYFNTLGGGIGVGCAQPVIKPNGKKYFPGNVSLTIDSSLEFASFRHVGYGGAI 480

Query: 480 KPSSTIVN--------EHKFLIQDIEAWGCGGEKELEEQMKNXXXXXXXXXXXXXINLKS 531
            P + +          E+KF++QD+E WGCGGEKEL+EQ+K              INL+S
Sbjct: 481 SPGTLMTKLEEEKTTFEYKFIVQDVEVWGCGGEKELQEQIKQWEWEEAEAKRRQRINLQS 540

Query: 532 INDDRALLEMAGLVGQNQSGGSI 554
           I +DRALLEMAGLVGQ+QSGGS+
Sbjct: 541 IGEDRALLEMAGLVGQHQSGGSM 563

>Suva_8.171 Chr8 (304635..306338) [1704 bp, 567 aa] {ON} YOR118W
           (REAL)
          Length = 567

 Score =  509 bits (1311), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 267/550 (48%), Positives = 366/550 (66%), Gaps = 14/550 (2%)

Query: 17  QFNSEKDVIIWFDKKAIKSLTSPELVSFKANINGKDLSDVVTSDELLKVLRLDGVNETVS 76
           +F +  DV+ +F+ KA + +T PELVS K N+  +D++  ++   L  VL     +  +S
Sbjct: 20  KFTNNGDVLAYFNHKAQQQVTVPELVSLKGNLQIEDMNTPISHKSLCSVLHFPQKHTLLS 79

Query: 77  SLIFNCVQTLSNFPFIRDCYENITYSGLLKSCVLLNKARCLSYVKNKRYDHTKLVYISLA 136
            ++ N ++ LSNFP +   YE IT  GLLK  +LLNK RC  Y+K K YD  KL++ISL+
Sbjct: 80  GIVTNMLRVLSNFPLMNSSYEPITGYGLLKCILLLNKGRCGKYLKFKSYDQLKLLFISLS 139

Query: 137 LNKTVKEVXXXXXX---XXXLDAPRIIATFNSVCVEELTVPSEVMLEFITLMLKMSKSTI 193
           L KT KE              +  +IIA F+ V  E L VP++ ML+F++ +L +S    
Sbjct: 140 LQKTDKEELSEENENNVKKERNIKQIIANFDDVDSEVLYVPADFMLQFLSWLLILSVECP 199

Query: 194 IKNSKL-DPNVSEGWESFRPFALSILRTMNTNIATQNDLLKYGITFSQFQSTISTVCPNL 252
             NSK+ +  + + W+SF+  A+++LRTMN ++ +  +   + ITF QF ++I TV PNL
Sbjct: 200 TSNSKMGNSKIYDQWDSFKISAMNLLRTMNPDVVSNTE--SHLITFDQFSTSIRTVMPNL 257

Query: 253 LLPFESLMEHVLFLGRDLVDIDASQPPLLESKLVSEPLLAQLATVWPRELVFSRLQKLYV 312
           L P E+LMEH  +L  DLV+ D S   + +S++++  LL QL+TV PREL   +LQ LY+
Sbjct: 258 LKPLENLMEHFFYLENDLVNYDTSLSSVRDSRIMTPALLTQLSTVLPRELFIQKLQSLYI 317

Query: 313 GRDSGFSMRSFQAKAFKWMAPSILLIHGVRIPNDEEYAKSKNHRYKNFLEEYPRLKEEDQ 372
           GR SGFSMRS QAK FKWMAPSIL++ G RI N +EYA  KN RY++FLEE+P+LK+ DQ
Sbjct: 318 GRKSGFSMRSLQAKVFKWMAPSILIVSGTRITNSDEYAAQKNPRYRHFLEEFPKLKDSDQ 377

Query: 373 VLLPPFSGKKKLLFAVYVNVPWKVTNSELFGDLKTTIIQLSPIQEVYKASRPGNIYFNTL 432
            +   ++ KKK  FAVY++ PWKVTN + FGD+ T IIQ+SP Q++YK +R G IYFNT+
Sbjct: 378 KMDASYTNKKKTTFAVYIDDPWKVTNKDYFGDMNTRIIQISPRQDIYKVNRKGTIYFNTI 437

Query: 433 GGGIGVGSPQPIVKPTSRKYLPGNVSLTIDPNLEFAVFRSAGFGGSIKPSSTIVN----- 487
           GGGIG+G  QP++KP S++++PGNVSLT D  LEFAVFR  G+GGS++P S  V      
Sbjct: 438 GGGIGIGDKQPLIKPASKRFIPGNVSLTFDSTLEFAVFRHTGYGGSLEPGSLSVERKEED 497

Query: 488 ---EHKFLIQDIEAWGCGGEKELEEQMKNXXXXXXXXXXXXXINLKSINDDRALLEMAGL 544
              E  FLIQD+E WGCGGEKELEEQMK              INL+S+ +DRALLEMAGL
Sbjct: 498 SFFELHFLIQDVEVWGCGGEKELEEQMKQMAWEEAESKRRQQINLRSLGEDRALLEMAGL 557

Query: 545 VGQNQSGGSI 554
           VGQN+ GGS+
Sbjct: 558 VGQNRGGGSM 567

>YOR118W Chr15 (546857..548560) [1704 bp, 567 aa] {ON}  RTC5Protein
           of unknown function; green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm; null
           mutation suppresses cdc13-1 temperature sensitivity
          Length = 567

 Score =  507 bits (1305), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 266/550 (48%), Positives = 363/550 (66%), Gaps = 14/550 (2%)

Query: 17  QFNSEKDVIIWFDKKAIKSLTSPELVSFKANINGKDLSDVVTSDELLKVLRLDGVNETVS 76
           +F + KD++ +F+ KA + +T PELVSFK N+  +DL+  ++   L   L     +  + 
Sbjct: 20  KFTNSKDILAYFNNKAQQQVTIPELVSFKGNLQIEDLNTPISHKALCNSLYFPQNHAMIV 79

Query: 77  SLIFNCVQTLSNFPFIRDCYENITYSGLLKSCVLLNKARCLSYVKNKRYDHTKLVYISLA 136
            ++ N ++ LSNFP ++  YE IT  GLLK  +LLN+ARC  ++K K YD  KL++ISL+
Sbjct: 80  GIVTNMLRVLSNFPLMKSSYEPITGYGLLKCILLLNRARCAKFLKTKSYDQLKLLFISLS 139

Query: 137 LNKTVKEVXXXXXXX---XXLDAPRIIATFNSVCVEELTVPSEVMLEFITLMLKMSKSTI 193
           L KT KE             L   +II  F+ V  E L +P++ ML+F+T +L ++    
Sbjct: 140 LQKTDKEELSEESENDGNKELTIKQIITGFDDVDTEMLCIPADFMLQFLTWLLILTVDCP 199

Query: 194 IKNSKLD-PNVSEGWESFRPFALSILRTMNTNIATQNDLLKYGITFSQFQSTISTVCPNL 252
             NSKLD     + W +F+  AL++LRTMN ++    D+  + ITF QF + I TV PNL
Sbjct: 200 TTNSKLDNTETHDQWGNFKVSALNLLRTMNPDVV--GDIESHSITFQQFSTAIRTVMPNL 257

Query: 253 LLPFESLMEHVLFLGRDLVDIDASQPPLLESKLVSEPLLAQLATVWPRELVFSRLQKLYV 312
           L P E+LMEH  +L  DLVD D +   + +SK+++  LLAQL+T  P+EL   +LQ LY+
Sbjct: 258 LKPLENLMEHFFYLQHDLVDHDTNLSSIQDSKVMTPALLAQLSTGLPKELFIHKLQSLYI 317

Query: 313 GRDSGFSMRSFQAKAFKWMAPSILLIHGVRIPNDEEYAKSKNHRYKNFLEEYPRLKEEDQ 372
           GR SGFSMRS QAK FKWMAPSIL++ G+RI N EEYA  KN RY++FLEE+P+LKE DQ
Sbjct: 318 GRKSGFSMRSLQAKVFKWMAPSILVVSGMRITNSEEYAAEKNPRYRHFLEEFPKLKESDQ 377

Query: 373 VLLPPFSGKKKLLFAVYVNVPWKVTNSELFGDLKTTIIQLSPIQEVYKASRPGNIYFNTL 432
           ++      K+K  FAVY++ PWKVTN + FGDL T II++SP Q++YK ++ G IYFNT+
Sbjct: 378 MMDASHLNKRKTTFAVYIDDPWKVTNKDYFGDLNTRIIEISPRQDIYKVNQKGTIYFNTI 437

Query: 433 GGGIGVGSPQPIVKPTSRKYLPGNVSLTIDPNLEFAVFRSAGFGGSIKPSSTIVN----- 487
           GGGIG+G  QP++KP S++Y+PGNVSLT D  LEFAVFR+ G+GGS+ P    +      
Sbjct: 438 GGGIGIGDKQPLIKPASKRYIPGNVSLTFDSTLEFAVFRNTGYGGSLDPGLLSMERKEEN 497

Query: 488 ---EHKFLIQDIEAWGCGGEKELEEQMKNXXXXXXXXXXXXXINLKSINDDRALLEMAGL 544
              E  FLIQD+E WGCGGEKELEEQ+K              INL+S+ +DRALLEMAGL
Sbjct: 498 SPYELHFLIQDVEVWGCGGEKELEEQIKQLEWEEAESKRRQQINLRSLGEDRALLEMAGL 557

Query: 545 VGQNQSGGSI 554
           VGQ+Q GGS+
Sbjct: 558 VGQHQGGGSM 567

>Smik_15.296 Chr15 (507990..509690) [1701 bp, 566 aa] {ON} YOR118W
           (REAL)
          Length = 566

 Score =  493 bits (1269), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 260/549 (47%), Positives = 362/549 (65%), Gaps = 13/549 (2%)

Query: 17  QFNSEKDVIIWFDKKAIKSLTSPELVSFKANINGKDLSDVVTSDELLKVLRLDGVNETVS 76
           +F +++DV+ +F+ KA + +T PELVS K N+  ++L+  ++   L   L     +  + 
Sbjct: 20  KFANDRDVLTYFNTKAQRQITVPELVSLKGNLQIENLNTPISHKRLCNFLYFPQNHTIIV 79

Query: 77  SLIFNCVQTLSNFPFIRDCYENITYSGLLKSCVLLNKARCLSYVKNKRYDHTKLVYISLA 136
            ++ N ++ LSNFP +   YE IT  GLLK  VLLNK+RC  ++K K YD  KL++ISL+
Sbjct: 80  GIVTNMLRVLSNFPLVNSSYEPITGYGLLKCIVLLNKSRCEKFLKIKSYDQLKLLFISLS 139

Query: 137 LNKTVKEVXXXXXXXXXL---DAPRIIATFNSVCVEELTVPSEVMLEFITLMLKMSKSTI 193
           L KT KE          +   +  +II  F+ V  E L +P++ ML+F+T +L +S    
Sbjct: 140 LQKTDKEELSEDNENNGVKEKNIKQIITGFDDVDTEVLYLPADFMLQFLTWLLILSVECP 199

Query: 194 IKNSKLDPNVSEGWESFRPFALSILRTMNTNIATQNDLLKYGITFSQFQSTISTVCPNLL 253
             NS ++   +  W+ F+  A+++LRTMN ++   N++  + IT+ QF + I TV PNLL
Sbjct: 200 TTNSTINNETNVQWDKFKIPAMNLLRTMNPDVV--NNIESHFITYQQFSTAIRTVMPNLL 257

Query: 254 LPFESLMEHVLFLGRDLVDIDASQPPLLESKLVSEPLLAQLATVWPRELVFSRLQKLYVG 313
            P E+LMEH L+L  DLVD D +   + +SK+++  LLAQL+T  P+EL   +LQ LY+G
Sbjct: 258 KPLENLMEHFLYLQHDLVDYDTNLSSIQDSKIMTPALLAQLSTGLPKELFIQKLQSLYIG 317

Query: 314 RDSGFSMRSFQAKAFKWMAPSILLIHGVRIPNDEEYAKSKNHRYKNFLEEYPRLKEEDQV 373
           R SGFSMRS QAK FKWMAPSIL++ GVRI N EEYA +KN RY++FLEE+P LK+ DQ 
Sbjct: 318 RKSGFSMRSLQAKVFKWMAPSILVVSGVRITNSEEYAANKNPRYRHFLEEFPILKDSDQK 377

Query: 374 LLPPFSGKKKLLFAVYVNVPWKVTNSELFGDLKTTIIQLSPIQEVYKASRPGNIYFNTLG 433
           +      KKK  FAVY++ PWKVTN + FGDL T IIQ+SP Q++YK ++ G +YFNT+G
Sbjct: 378 MDASLMNKKKTTFAVYIDDPWKVTNKDYFGDLNTRIIQISPRQDIYKVNKKGTVYFNTIG 437

Query: 434 GGIGVGSPQPIVKPTSRKYLPGNVSLTIDPNLEFAVFRSAGFGGSIKPSSTIVN------ 487
           GGIG+G+ QP++K  S++Y+PGNVSLT D  LEFAVFR+ G+GGS+ P    +       
Sbjct: 438 GGIGIGNKQPLIKSASKRYVPGNVSLTFDSTLEFAVFRNTGYGGSLDPGLLSMERKEENS 497

Query: 488 --EHKFLIQDIEAWGCGGEKELEEQMKNXXXXXXXXXXXXXINLKSINDDRALLEMAGLV 545
             E   LIQD+E WGCGGEKELEEQ+K              INL+S+ +DRALLEMAGLV
Sbjct: 498 SFELHILIQDVEVWGCGGEKELEEQIKQLAWEEAESKRRQQINLRSLGEDRALLEMAGLV 557

Query: 546 GQNQSGGSI 554
           GQ+Q GGS+
Sbjct: 558 GQHQGGGSM 566

>KLLA0E21143g Chr5 complement(1888085..1889803) [1719 bp, 572 aa]
           {ON} similar to uniprot|Q12108 YOR118W Saccharomyces
           cerevisiae Hypothetical ORF
          Length = 572

 Score =  468 bits (1205), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 261/547 (47%), Positives = 362/547 (66%), Gaps = 20/547 (3%)

Query: 27  WFDKKAIKSLTSPELVSFKANI-NGKDLSDVVTSDELLKVLRLDGVNETVSSLIFNCVQT 85
           +F+ + +K LT+ EL+SFK NI  GK+L+D V   ++ ++  +   +  + S+  N   T
Sbjct: 27  FFNDRCLKQLTTAELISFKNNIPEGKELNDYVEVSDISRMYYIPKDSAVMLSVFMNMFHT 86

Query: 86  LSNFPFIRDCYENITYSGLLKSCVLLNKARCLSYVKNKRYDHTKLVYISLALNKTVKE-- 143
           L+NFP ++D YE +T+  LLK+ +LL K R + Y   K+Y+  K+++I+L+L K +K   
Sbjct: 87  LANFPLLQDSYEKVTFKTLLKATLLLVKERAIKYTDWKKYNDLKMLFITLSLEKNIKAEP 146

Query: 144 VXXXXXXXXXLDAPRIIATFNSVCVEELTVPSEVMLEFITLMLKMSKSTIIKNSKLDPNV 203
           +          D   +I ++N    +EL V +  +L F+ L+L +S+  I+ N K+D +V
Sbjct: 147 LMDSSALSDCKDWKGVIRSYNGTDFDELKVNANNLLHFLALILALSRCCILNNCKIDNDV 206

Query: 204 -SEGWESFRPFALSILRTMNTNIATQNDLLKYGITFSQFQSTISTVCPNLLLPFESLMEH 262
            ++  E F+  AL+I+RTMN  I + +D L   IT++QF   ++ V PNLL P + LMEH
Sbjct: 207 LAKSLEDFKHQALNIVRTMNPEIISMSDCLDSSITYTQFSMAVNDVAPNLLNPLKMLMEH 266

Query: 263 VLFLGRDLVDIDASQPPLLESKLVSEPLLAQLATVWPRELVFSRLQKLYVGRDSGFSMRS 322
           VL++ RDLVD D  QP    +K+V+E  L+QLAT  P+E+VFSR QKLYVGR+SGFSMRS
Sbjct: 267 VLYMDRDLVDADVLQPISNPTKIVNESELSQLATFLPKEIVFSRFQKLYVGRESGFSMRS 326

Query: 323 FQAKAFKWMAPSILLIHGVRIPNDEE-----YAKSKNHRYKNFLEEYPRLKEEDQVLLPP 377
           FQ+K FKWMAP+IL + G+RI ++++     YA  KN RY+NFL+EY +LK EDQ L   
Sbjct: 327 FQSKVFKWMAPTILFVEGMRIRDEDDEDGDAYA-VKNPRYRNFLQEYGKLKSEDQHLDTL 385

Query: 378 FSGKKKLLFAVYVNVPWKVTNSELFGDLKTTIIQLSPIQEVYKAS--RPGNIYFNTLGGG 435
              K+KLLFAV +  PWKV+N +LFGD  T IIQL P QE++ A   + GN+YFNT+GGG
Sbjct: 386 SKKKRKLLFAVCIRDPWKVSNKDLFGDSSTKIIQLHPRQEIFDADPFKTGNVYFNTVGGG 445

Query: 436 IGVGSPQPIVKPTSRKYLPGNVSLTIDPNLEFAVFRSAGFGGSIKPSSTIVN-------- 487
           IG+GS QPI+K   +KY PGNVSLTID +LEF +FR  G GGS KP   I          
Sbjct: 446 IGIGSSQPIIKANGKKYFPGNVSLTIDSSLEFGIFRHLGAGGSFKPGRLISGRGEERNSF 505

Query: 488 EHKFLIQDIEAWGCGGEKELEEQMKNXXXXXXXXXXXXXINLKSINDDRALLEMAGLVGQ 547
           E++F+IQD+E WGCGGEKELEEQ+K              INL+S+ +DRALLEMAGLVGQ
Sbjct: 506 EYRFIIQDVEVWGCGGEKELEEQVKQWQWEEAEAKRRQKINLQSMGEDRALLEMAGLVGQ 565

Query: 548 NQSGGSI 554
           +QSGGSI
Sbjct: 566 HQSGGSI 572

>Ecym_4764 Chr4 complement(1484832..1486532) [1701 bp, 566 aa] {ON}
           similar to Ashbya gossypii AER258C
          Length = 566

 Score =  467 bits (1202), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 236/549 (42%), Positives = 351/549 (63%), Gaps = 13/549 (2%)

Query: 18  FNSEKDVIIWFDKKAIKSLTSPELVSFKANIN-GKDLSDVVTSDELLKVLRLDGVNETVS 76
           F  EK+++ +FD +A++ L   ELV+F+ NI    DL D ++ + L+++ +L        
Sbjct: 19  FRDEKEILEFFDNQAVRQLHGLELVAFQNNIGLDADLKDYLSCEFLVQLCKLPRHKYGFV 78

Query: 77  SLIFNCVQTLSNFPFIRD-CYENI-TYSGLLKSCVLLNKARCLSYVKNKRYDHTKLVYIS 134
            + +  +   S FP +     E++ T+ GL+K+C+L +  + L Y + K YD   L++I 
Sbjct: 79  KVFYQMIGNASKFPLMGGGAGEDVPTFVGLVKACLLFDYKKLLKYAQCKTYDQVSLIFIL 138

Query: 135 LALNKTVK-EVXXXXXXXXXLDAPRIIATFNSVCVEELTVPSEVMLEFITLMLKMSKSTI 193
           LAL    K             DA +I+ +FN + +E + V ++ +L+F+T +L ++K  I
Sbjct: 139 LALEPHAKVSKKELGRPPSSYDARKIMESFNDINLETIEVSADDLLQFMTFLLVITKYCI 198

Query: 194 IKNSKLDPNVSEGWESFRPFALSILRTMNTNIATQNDLLKYGITFSQFQSTISTVCPNLL 253
            +N +++P++ E W+ +   AL+ILRTMN  I + +D  K  +T +QF+  I+ VCPNLL
Sbjct: 199 FENVEVNPSIYENWKDYESQALNILRTMNPCIVSYSDAAKNVVTLAQFKDCITAVCPNLL 258

Query: 254 LPFESLMEHVLFLGRDLVDIDASQPPLLESKLVSEPLLAQLATVWPRELVFSRLQKLYVG 313
            P    M+HVL+    LV    +      S ++++PLLAQL T+WP+ +++  L+KL++ 
Sbjct: 259 TPLGVFMKHVLYKSEHLVSDSGATINDRSSTVMTDPLLAQLCTLWPKHIIYQNLKKLFIA 318

Query: 314 RDSGFSMRSFQAKAFKWMAPSILLIHGVRIPNDEEYAKSKNHRYKNFLEEYPRLKEEDQV 373
           + SGFS+RSFQAK   WMAPSILL+ G++I +D +   +KN RYK+FL+EYP+LK+EDQ 
Sbjct: 319 KQSGFSIRSFQAKVVNWMAPSILLVSGMKIMDDSKLL-AKNQRYKSFLQEYPKLKDEDQK 377

Query: 374 LLPPFSGKKKLLFAVYVNVPWKVTNSELFGDLKTTIIQLSPIQEVYKASRPGNIYFNTLG 433
                 GK+K+ FAV+V+  WKVTN E FG+LKT I+QLSP QEV++AS+ GNIYFNT+G
Sbjct: 378 ADSIVGGKRKVTFAVFVHEAWKVTNKEQFGNLKTLILQLSPRQEVFQASKNGNIYFNTVG 437

Query: 434 GGIGVGSPQPIVKPTSRKYLPGNVSLTIDPNLEFAVFRSAGFGGSIKPSSTIVN------ 487
           GGIG+G+ QP++K + +KY PGNVSLTIDP+ EF VFR+ G GGSI P    +       
Sbjct: 438 GGIGIGNSQPVIKSSGKKYFPGNVSLTIDPSFEFGVFRNVGHGGSISPGKLFLERPDVEQ 497

Query: 488 --EHKFLIQDIEAWGCGGEKELEEQMKNXXXXXXXXXXXXXINLKSINDDRALLEMAGLV 545
             E +F+IQD+E WGCGG+KE E Q+K              INL SI +D+ALLEM GLV
Sbjct: 498 SLECRFIIQDVEVWGCGGDKEFEAQLKQWEWEEAESERRQYINLSSIGEDKALLEMVGLV 557

Query: 546 GQNQSGGSI 554
           G +QSGGS+
Sbjct: 558 GHHQSGGSL 566

>NCAS0H02050 Chr8 (398606..400327) [1722 bp, 573 aa] {ON} Anc_5.431
           YOR118W
          Length = 573

 Score =  467 bits (1201), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 247/553 (44%), Positives = 349/553 (63%), Gaps = 22/553 (3%)

Query: 18  FNSEKDVIIWFDKKAIKSLTSPELVSFKANINGKDLSD------VVTSDELLKVLRLDGV 71
           FNSE+++   F ++ +   T  ELV+FK  I G + +D       ++ +EL  +L L   
Sbjct: 27  FNSEEELRESFKRRILCHFTPLELVAFKKKI-GHEQTDSEAGVEYISKNELTNLLHLPRE 85

Query: 72  NETVSSLIFNCVQTLSNFPFIRDCYENITYSGLLKSCVLLNKARCLSYVKNKRYDHTKLV 131
           N  +  L +  +  LSNFP +R+    +T  GLL   +LL+K RC  ++ +  YD   L+
Sbjct: 86  NVLLVDLTYKLIAILSNFPLLREPQTEVTEIGLLMCIILLSKERCHRFIGSNTYDQLGLI 145

Query: 132 YISLALNKTVKEVXXXXXXXXXLDAPRIIATFNSVCVEELTVPSEVMLEFITLMLKMSKS 191
           +I+++L+   K +         L+   ++ TF+++ ++EL +P+ V+L+F++  L +   
Sbjct: 146 FIAMSLDYADK-LLPYARTPKKLNVEELLRTFDNIPIDELEIPAPVLLQFLSWGLLLLIK 204

Query: 192 TIIKNSKLDP--NVSEGWESFRPFALSILRTMNTNIATQNDLLKYGITFSQFQSTISTVC 249
               N +L P     + W S+   A +I+R+M+ +I    +L    I ++QF      V 
Sbjct: 205 CPTSNCQLKPINEFYQNWSSYEKAAKNIIRSMDQSII--RNLTDVRINYTQFSDVFKAVL 262

Query: 250 PNLLLPFESLMEHVLFLGRDLVDIDASQPPLLESKLVSEPLLAQLATVWPRELVFSRLQK 309
           PN   P ESLM H+L++  DL+D +    P+  SKL+SEPLLAQLATV P+EL  S+LQK
Sbjct: 263 PNFTTPLESLMGHLLYMDSDLIDHETM--PMNNSKLMSEPLLAQLATVLPKELFLSKLQK 320

Query: 310 LYVGRDSGFSMRSFQAKAFKWMAPSILLIHGVRIPNDEEYAKSKNHRYKNFLEEYPRLKE 369
           LYVGR+SGFSMRS Q+K F W APSILL+ G+ I +D +YAK KN RY  FLE+YP+LKE
Sbjct: 321 LYVGRESGFSMRSLQSKCFNWEAPSILLVSGMLISDDLQYAKEKNPRYGKFLEQYPKLKE 380

Query: 370 EDQVLLPPFSGKKKLLFAVYVNVPWKVTNSELFGDLKTTIIQLSPIQEVYKASRPGNIYF 429
           E Q L    S +KK  FAVY++ PW+VTN E FG + + IIQL+P Q+V+ AS+P  IYF
Sbjct: 381 EQQHLDACHSQRKKATFAVYIDDPWRVTNKEFFGSMNSMIIQLAPRQDVFHASKPNMIYF 440

Query: 430 NTLGGGIGVGSPQPIVKPTSRKYLPGNVSLTIDPNLEFAVFRSAGFGGSIKPSSTIVN-- 487
           NT+GGGIG G+ QP++    +KY+PGNVSLTID  LEFAVFR  G+GG+ KPS+ +    
Sbjct: 441 NTVGGGIGFGNKQPLISNAHKKYIPGNVSLTIDSTLEFAVFRHIGYGGAFKPSALLTKRG 500

Query: 488 ------EHKFLIQDIEAWGCGGEKELEEQMKNXXXXXXXXXXXXXINLKSINDDRALLEM 541
                 E KF+IQD+E WGCGGEKEL+EQ+K              INLKS+ +DRALLEM
Sbjct: 501 KEDESFEIKFIIQDVEVWGCGGEKELQEQIKKLEWEEAEAKRRQHINLKSLGEDRALLEM 560

Query: 542 AGLVGQNQSGGSI 554
           AGLVGQ+QSGGS+
Sbjct: 561 AGLVGQSQSGGSM 573

>Skud_15.281 Chr15 (503290..504993) [1704 bp, 567 aa] {ON} YOR118W
           (REAL)
          Length = 567

 Score =  463 bits (1191), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 249/538 (46%), Positives = 346/538 (64%), Gaps = 14/538 (2%)

Query: 17  QFNSEKDVIIWFDKKAIKSLTSPELVSFKANINGKDLSDVVTSDELLKVLRLDGVNETVS 76
           +F + +DV+ +F+ KA + +T PELVSFK N+  ++L+  ++   L  VL     +  V 
Sbjct: 20  KFTNNRDVLSYFNNKAQQQVTIPELVSFKGNLQIENLNTPISHKPLFNVLHFPPNHTIVV 79

Query: 77  SLIFNCVQTLSNFPFIRDCYENITYSGLLKSCVLLNKARCLSYVKNKRYDHTKLVYISLA 136
            ++ N ++ LSNFP I   YE IT  GLLK  +LLN+ RC  ++K K YD  KL++ISL+
Sbjct: 80  GIVTNMLRVLSNFPLINSSYEPITGFGLLKCILLLNRTRCEKFLKIKSYDQLKLLFISLS 139

Query: 137 LNKTVKEVXXXXXXXXXL---DAPRIIATFNSVCVEELTVPSEVMLEFITLMLKMSKSTI 193
           L KT KE                 +II  F+ V  E L +P++ ML+F++ +L +S    
Sbjct: 140 LQKTDKEELSEENEENINRERHVKQIITDFDDVDTEMLCLPADFMLQFLSWLLILSVKFP 199

Query: 194 IKNSKLDPNVS-EGWESFRPFALSILRTMNTNIATQNDLLKYGITFSQFQSTISTVCPNL 252
             NSK D + + E W++F+  A+++LRTMN ++ +  ++  + ITF QF + I TV PNL
Sbjct: 200 TTNSKTDNDKTYEQWDTFKISAMNLLRTMNPDVVS--NVESHFITFEQFSTAIRTVMPNL 257

Query: 253 LLPFESLMEHVLFLGRDLVDIDASQPPLLESKLVSEPLLAQLATVWPRELVFSRLQKLYV 312
             P E+LMEH  +L  DLV  DA+   + +S++++  LLAQL+T  P+EL   +LQ LY+
Sbjct: 258 FKPLENLMEHFFYLDNDLVSRDANLSSIQDSRIMTPALLAQLSTGLPKELFIQKLQSLYI 317

Query: 313 GRDSGFSMRSFQAKAFKWMAPSILLIHGVRIPNDEEYAKSKNHRYKNFLEEYPRLKEEDQ 372
           GR SGFSMRS QAK FKWMAPSIL++ G+RI N +EYA  KN RY++FL+E+P+LK+ DQ
Sbjct: 318 GRKSGFSMRSLQAKVFKWMAPSILVVSGMRITNSDEYAAEKNPRYRHFLDEFPKLKDSDQ 377

Query: 373 VLLPPFSGKKKLLFAVYVNVPWKVTNSELFGDLKTTIIQLSPIQEVYKASRPGNIYFNTL 432
            +      KKK  FAVY++ PWKVTN + FGDL T IIQ+SP Q++YK ++ G IYFNT+
Sbjct: 378 KMDASHLSKKKTTFAVYIDDPWKVTNKDYFGDLNTRIIQISPRQDIYKVNQKGTIYFNTI 437

Query: 433 GGGIGVGSPQPIVKPTSRKYLPGNVSLTIDPNLEFAVFRSAGFGGSIKPSSTIVN----- 487
           GGGIG+G  QP +K  S++Y+PGNVSLT D  LEFAVFR  G+GG + P    +      
Sbjct: 438 GGGIGIGDKQPFIKAASKRYIPGNVSLTFDSTLEFAVFRHTGYGGLLDPGLLSMERKEEN 497

Query: 488 ---EHKFLIQDIEAWGCGGEKELEEQMKNXXXXXXXXXXXXXINLKSINDDRALLEMA 542
              E  FLIQD+E WGCGGEKELEEQ+K              IN +S+ +DRALLEMA
Sbjct: 498 SFFELHFLIQDVEVWGCGGEKELEEQIKQMAWEEAESKRRQQINFRSLGEDRALLEMA 555

>NDAI0C01610 Chr3 complement(343850..345604) [1755 bp, 584 aa] {ON}
           Anc_5.431 YOR118W
          Length = 584

 Score =  461 bits (1185), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 247/570 (43%), Positives = 355/570 (62%), Gaps = 39/570 (6%)

Query: 17  QFNSEKDVIIWFDKKAIKSLTSPELVSFKANINGKDLSDVVTSDELLKVLRLDGVNETVS 76
           QF +  +V  +F K+ I   T  EL+S+K  +N   L D++T +E++++L L   N  +S
Sbjct: 22  QFGNALEVQKYFQKRTIGHFTPLELISYKNKLNHDHLDDMITKEEIIQLLHLPDDNVILS 81

Query: 77  SLIFNCVQTLSNFPFIRDCYENITYSGLLKSCVLLNKARCLSYVKNKRYDHTKLVYISLA 136
           ++IFN V +L NFPF+ +   +IT   LL   +LL+  RC  ++ +K YD  KL++I L 
Sbjct: 82  NMIFNMVHSLCNFPFLGERIWDITAGNLLTCIILLDNDRCQRFIGSKSYDQIKLLFILLC 141

Query: 137 L-------------NKTVKE------VXXXXXXXXXLDAPRIIATFNSVCVEELTVPSEV 177
           L             N  ++E                 +   I+ ++N + +++L+VP+  
Sbjct: 142 LSTNNSSGKPLSASNSKLREKSENISTTSIYSQEIGYNLTDILQSYNGISIDDLSVPALS 201

Query: 178 MLEFITLMLKMSKSTIIKNSKLDPN--VSEGWESFRPFALSILRTMNTNIATQNDLLKYG 235
           + E  T  L MS      N K+ PN  +   W  ++  +L+ILR+M+++I +  D   Y 
Sbjct: 202 LSECFTWTLIMSIKCPTANCKILPNETIYNSWNEYQKASLNILRSMDSSIVSNLD--DYR 259

Query: 236 ITFSQFQSTISTVCPNLLLPFESLMEHVLFLGRDLVDIDASQPPLLESKLVSEPLLAQLA 295
           I+F+QF++  ++V PN   P E++M H+L++ +DL++    + P  +SKL+SE LLAQL+
Sbjct: 260 ISFTQFENVFTSVVPNFTHPLENIMNHLLYMDKDLINHPVMEIP--KSKLMSESLLAQLS 317

Query: 296 TVWPRELVFSRLQKLYVGRDSGFSMRSFQAKAFKWMAPSILLIHGVRIPNDEEYAKSKNH 355
           T  P+EL  S+LQKLY+GR SGFSMRS Q+K FKW+AP+ILL+ G+ IPNDEEY    N 
Sbjct: 318 TTLPKELFISKLQKLYIGRQSGFSMRSLQSKCFKWLAPTILLVSGLIIPNDEEY---NNP 374

Query: 356 RYKNFLEEYPRLKEEDQVLLPPFSGKKKLLFAVYVNVPWKVTNSELFGDLKTTIIQLSPI 415
           R+K FL+E+P+L + +Q L P  S KKK+ FAVY++ PW+VTN E FGDL + II+LSP 
Sbjct: 375 RFKRFLQEFPKLNDNEQSLEPCHSYKKKISFAVYIDEPWRVTNKEFFGDLNSRIIELSPR 434

Query: 416 QEVYKASRPGN-IYFNTLGGGIGVGSPQPIVK--PTSRKYLPGNVSLTIDPNLEFAVFRS 472
           Q+++K+ +    IYFNT+G GIG+G  QP V     SRKY PGNVSLT++  LEFAVFR 
Sbjct: 435 QDIFKSLKSHELIYFNTIGCGIGIGDKQPHVSNGANSRKYQPGNVSLTLESTLEFAVFRH 494

Query: 473 AGFGGSIKPSSTIVN--------EHKFLIQDIEAWGCGGEKELEEQMKNXXXXXXXXXXX 524
            G GG+  PS  +          E KF+IQD+E WGCGGEKELEEQMK            
Sbjct: 495 VGHGGAFSPSELLTKRGTEEESFEIKFIIQDVEVWGCGGEKELEEQMKQLAWEEAEAKRR 554

Query: 525 XXINLKSINDDRALLEMAGLVGQNQSGGSI 554
             +NLKSI++DRALLEM GLVGQ+QSGGS+
Sbjct: 555 QQVNLKSISEDRALLEMVGLVGQHQSGGSM 584

>TDEL0E01940 Chr5 complement(365414..367117) [1704 bp, 567 aa] {ON}
           Anc_5.431 YOR118W
          Length = 567

 Score =  449 bits (1156), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 241/551 (43%), Positives = 349/551 (63%), Gaps = 16/551 (2%)

Query: 17  QFNSEKDVIIWFDKKAIKSLTSPELVSFKANINGKDLSDVVTSDELLKVLRLDGVNETVS 76
           QF S  +++ +FDK+A+   T+ EL +FK+ + GK L D V S+EL + LR+   N  + 
Sbjct: 20  QFTSNSELMEFFDKRAVHMFTATELAAFKSKLEGKTLKDPVRSEELTRWLRIPCENVLLC 79

Query: 77  SLIFNCVQTLSNFPFIRDCYENITYSGLLKSCVLLNKARCLSYVKNKRYDHTKLVYISLA 136
             ++  V+ LSNFP ++D ++++T  GLLKS +L N ++C  YV  K YDH KL++I+L+
Sbjct: 80  EAVYEFVRVLSNFPLMKDSFDDVTGVGLLKSVLLTNPSKCHKYVGVKNYDHMKLLFIALS 139

Query: 137 LNKTVKEVXXXXXXXXXLDAP---RIIATFNSVCVEELTVPSEVMLEFITLMLKMSKSTI 193
           + K+VKE           D      ++ T+N++ V++L +P+  +++ +  +L ++    
Sbjct: 140 MRKSVKEEPSCSSSTSLEDGGGSINLLRTYNNIVVDDLAIPATSLVQLLAWLLILTSYCP 199

Query: 194 IKNSKLDPNVSEG-WESFRPFALSILRTMNTNIATQNDLLKYGITFSQFQSTISTVCPNL 252
             N +   +V    W SF+  A ++LRTMN NI T  +L  Y + F QF   ISTV PN+
Sbjct: 200 TSNCQFPEDVVYAEWGSFKLAATNLLRTMNNNIVT--NLESYSVKFEQFSKAISTVMPNI 257

Query: 253 LLPFESLMEHVLFLGRDLVDIDA-SQPPLLESKLVSEPLLAQLATVWPRELVFSRLQKLY 311
               +++MEH+L+   DLV   + S  P+L SK  ++ +LAQL T    E+ F++ Q LY
Sbjct: 258 FRALQNVMEHLLYQDSDLVSFPSNSAGPILTSKPTTQAVLAQLITALSNEMTFAKFQNLY 317

Query: 312 VGRDSGFSMRSFQAKAFKWMAPSILLIHGVRIPNDEEYAKSKNHRYKNFLEEYPRLKEED 371
           VGR+SGFSMRS QAK FKWMAP+++L+ G  + +DE+++K KN RY++FL +YP+LK+ D
Sbjct: 318 VGRESGFSMRSLQAKVFKWMAPTVMLLSGKCVLDDEDFSK-KNSRYRDFLSKYPKLKDRD 376

Query: 372 QVLLPPFSGKKKLLFAVYVNVPWKVTNSELFGDLKTTIIQLSPIQEVYKASRPGNIYFNT 431
           Q L      K K++FAVY+  PWK TN + FG   TTI+QLSP Q+V+KA+    +YFNT
Sbjct: 377 QHLSDLQKNKTKVVFAVYIPEPWKTTNKDYFGGSGTTIVQLSPTQDVFKAASNEVMYFNT 436

Query: 432 LGGGIGVGSPQPIVKPTSRKYLPGNVSLTIDPNLEFAVFRSAGFGGSIKPSSTIVN---- 487
           LGGGIG+G+ QP +K   + Y PGNVSLTID  LEFA FR  G+GG+  P   +      
Sbjct: 437 LGGGIGIGNNQPHIKNGVKSYSPGNVSLTIDSTLEFAAFRHVGYGGTFNPGLLLTQFNRE 496

Query: 488 ----EHKFLIQDIEAWGCGGEKELEEQMKNXXXXXXXXXXXXXINLKSINDDRALLEMAG 543
               E KFLIQD+E WGCGG++ELEEQ K              INL+S  +DRALLEMAG
Sbjct: 497 DDPFEIKFLIQDVEVWGCGGKEELEEQYKKWQWEEAEAKRRQNINLRSFGEDRALLEMAG 556

Query: 544 LVGQNQSGGSI 554
           LVG +Q+GGS+
Sbjct: 557 LVGHSQNGGSM 567

>ZYRO0F09966g Chr6 (809604..811268) [1665 bp, 554 aa] {ON} similar
           to uniprot|Q12108 YOR118W Saccharomyces cerevisiae
           Hypothetical ORF
          Length = 554

 Score =  440 bits (1131), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 248/549 (45%), Positives = 351/549 (63%), Gaps = 20/549 (3%)

Query: 17  QFNSEKDVIIWFDKKAIKSLTSPELVSFKANINGKDLSDVVTSDELLKVLRLDGVNETVS 76
            F S  D++  F+ +A+K  T  ELVSFK  + GKDL++ +T++EL K L +      + 
Sbjct: 15  HFTSNSDILKSFNDRALKQFTVTELVSFKNKL-GKDLNERLTNEELTKWLSVPQDEILLR 73

Query: 77  SLIFNCVQTLSNFPFIRDCYENITYSGLLKSCVLLNKARCLSYVKNKRYDHTKLVYISLA 136
            L++N VQ L NFP +++ YEN+T  G+LK+ +L N  RC  YVK++ YD  KL +I+L+
Sbjct: 74  ELLYNFVQVLGNFPLMKNSYENVTGIGVLKAIILTNPERCKKYVKSRNYDQLKLWFIALS 133

Query: 137 LNKTVKE---VXXXXXXXXXLDAPRIIATFNSVCVEELTVPSEVMLEFITLMLKMSKSTI 193
           + KTVKE   +          D  RI+ TF+ + V EL+VP   M+ FI+ +L ++    
Sbjct: 134 IRKTVKEDPNLSSSSSSEESFDVTRILKTFDGLHVNELSVPFAYMVPFISWLLILTTYCP 193

Query: 194 IKNSKLDPNVS--EGWESFRPFALSILRTMNTNIATQNDLLKYGITFSQFQSTISTVCPN 251
           I N KL+ NV+  + W S+   A +ILR+M     +        I +  F  T+ ++ P+
Sbjct: 194 INNCKLE-NVAMFDNWNSYIKSAHTILRSMRPMDESS------WIEYEPFAHTMRSIAPH 246

Query: 252 LLLPFESLMEHVLFLGRDLVD-IDASQPPLLESKLVSEPLLAQLATVWPRELVFSRLQKL 310
           +  P   +MEH+LF   +LVD +  ++  +  SKL++  LLAQ+++   ++L    LQ+L
Sbjct: 247 IFDPLTRVMEHLLFKDDELVDPLSENRGEIASSKLLNSALLAQISSALSKQLPIYHLQRL 306

Query: 311 YVGRDSGFSMRSFQAKAFKWMAPSILLIHGVRIPNDEEYAKSKNHRYKNFLEEYPRLK-- 368
           Y+GRD GFSMRSFQAK FKW AP+I+L+ G RI +DEEY+  KN R++ FL EYP+LK  
Sbjct: 307 YLGRDHGFSMRSFQAKVFKWSAPTIMLLRGKRILDDEEYS-VKNTRFRKFLHEYPKLKPS 365

Query: 369 EEDQVLLPPFSGKKKLLFAVYVNVPWKVTNSELFGDLKTTIIQLSPIQEVYKASRPGNIY 428
           + D  +   +  K K++ AVYV+ PWK+TN E FG   TTI+QLSP QEV+ +SR   +Y
Sbjct: 366 DMDTEVEEMYPAKSKIILAVYVSDPWKITNKEFFGGPHTTIVQLSPFQEVFGSSRENALY 425

Query: 429 FNTLGGGIGVGSPQPIVKPTSRKYLPGNVSLTIDPNLEFAVFRSAGFGGSIKPSSTIVN- 487
           FNT+GGGIG+G+ QP++K T++ Y PGNVSLT+D  LEFAV R AG GG +KP   + + 
Sbjct: 426 FNTIGGGIGIGNKQPVIKSTAKSYSPGNVSLTMDSALEFAVLRHAGQGGVLKPGLVVGDK 485

Query: 488 --EHKFLIQDIEAWGCGGEKELEEQMKNXXXXXXXXXXXXXINLKSINDDRALLEMAGLV 545
             E K L+QD+E WGCGGEKELEEQ+K              INL+SI +DRALLEMAGLV
Sbjct: 486 DFEVKMLLQDVEVWGCGGEKELEEQLKQWEWEESEAKRRQQINLRSIGEDRALLEMAGLV 545

Query: 546 GQNQSGGSI 554
           GQ QSGGS+
Sbjct: 546 GQAQSGGSV 554

>TPHA0H01790 Chr8 (412229..413926) [1698 bp, 565 aa] {ON} Anc_5.431
           YOR118W
          Length = 565

 Score =  424 bits (1090), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 230/545 (42%), Positives = 350/545 (64%), Gaps = 13/545 (2%)

Query: 20  SEKDVIIWFDKKAIKSLTSPELVSFKANINGKDLSDVVTSDELLKVLRLDGVNETVSSLI 79
           SE +++ +F+K+ I   ++ EL+ FK  +   D S ++    + K+L++  V++ + +LI
Sbjct: 24  SELEIVDYFNKRVISQFSNIELLCFKHLLEIDDYSTIIDDAVVYKLLQIQDVSDRLRNLI 83

Query: 80  FNCVQTLSNFPFIRDCYENITYSGLLKSCVLLNKARCLSYVKNKRYDHTKLVYISLALNK 139
            N ++ L+NFPFI    +N+T  GLLK+ V+L K + + Y  N + +  K+++I+L  + 
Sbjct: 84  LNFIKRLTNFPFISTVADNVTAYGLLKTIVILQKQKFIKYTNNNQLNMLKILFIALG-DY 142

Query: 140 TVKEVXXXXXXXXXLDAPRIIATFNSVCVEELTVPSEVMLEFITLMLKMSKSTIIKNSKL 199
             +E          +    I+ T++ + + +++V S  M+ F+T +L +S      NS +
Sbjct: 143 DREEDNKKILDCHNISISTILTTYDGIPIHDISVSSSNMISFLTWILALSNVCPTNNSIV 202

Query: 200 DP-NVSEGWESFRPFALSILRTMNTNIATQNDLLKYGITFSQFQSTISTVCPNLLLPFES 258
           D  ++ + WE +   A+S++R+MN +I   +D     I F QF++ + T+ P++ LP E 
Sbjct: 203 DTKHMFKYWEKYETSAISLVRSMNPDIIKPDD--NQNILFIQFKTALETIMPHVYLPLEH 260

Query: 259 LMEHVLFLGRDLVDIDASQPPLLESKLVSEPLLAQLATVWPRELVFSRLQKLYVGRDSGF 318
           L+ H+LF+   L+     +    ESKL++  + +QL+T+   ++V S+L KLY GR+SGF
Sbjct: 261 LLNHLLFMESSLIKSQEIEISFQESKLMTFAVASQLSTLLRNDVVISKLHKLYSGRESGF 320

Query: 319 SMRSFQAKAFKWMAPSILLIHGVRIPNDEEYAKSKNHRYKNFLEEYPRLKEEDQVLLPPF 378
           SMRSFQ+KAFKW AP+ILLI G+R+ +D EYA  KN RYK F+++YPRL++ DQ L P  
Sbjct: 321 SMRSFQSKAFKWNAPTILLISGMRVTDDVEYATKKNPRYKKFIDQYPRLRDLDQNLEPCH 380

Query: 379 SGKKKLLFAVYVNVPWKVTNSELFGDLKTTIIQLSPIQEVYKASRPGNIYFNTLGGGIGV 438
           S  +K+ FAVYV+ PWKV+N   FG LKT I++LSP Q+ ++A++PG IYFNT+GGGIG+
Sbjct: 381 SKLRKVTFAVYVDEPWKVSNKLQFGGLKTLIVELSPRQDCFRAAKPGVIYFNTVGGGIGI 440

Query: 439 GSPQPIVKPTSRKYLPGNVSLTIDPNLEFAVFRSAGFGGSIKPSS--------TIVNEHK 490
           GS QP+ K  S  Y PGNVSLTID +LEF  FR  G+GGSI+PSS        T   E +
Sbjct: 441 GSSQPVQKKNSLSYTPGNVSLTIDNSLEFGAFRHTGYGGSIEPSSILQKKEDATRTFEIR 500

Query: 491 FLIQDIEAWGCGGEKELEEQMKNXXXXXXXXXXXXXINLKSINDDRALLEMAGLVGQN-Q 549
           FLIQDIE WGCGGEKE++EQ+K              +NLKS+ +DRALLEMAG++G +  
Sbjct: 501 FLIQDIEVWGCGGEKEIDEQLKQWAWEEEEAKKRQRVNLKSMGEDRALLEMAGIIGNHAH 560

Query: 550 SGGSI 554
           SGGS+
Sbjct: 561 SGGSL 565

>KNAG0B04230 Chr2 complement(803845..805578) [1734 bp, 577 aa] {ON}
           Anc_5.431 YOR118W
          Length = 577

 Score =  417 bits (1073), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 218/548 (39%), Positives = 334/548 (60%), Gaps = 23/548 (4%)

Query: 28  FDKKAIKSLTSPELVSFKANIN-GKDLSDVVTSDELLK--VLRLDGVNETVSSLIFNCVQ 84
           ++ + ++   + EL +FK  +   + L+DVV   ELL+   L L+G  +  S L+   ++
Sbjct: 32  YNDRVLRQFNASELYTFKCRVGMTRQLNDVVLEQELLEWLCLPLEGHLQQPSKLLVGVIK 91

Query: 85  TLSNFPFIRDCYENITYSGLLKSCVLLNKARCLSYVKNKRYDHTKLVYISLALNKTVKEV 144
            L  FPFI +   N+T   LLK+ +L+N+ +CL Y+ NK Y+H +L++++L L +   + 
Sbjct: 92  VLGQFPFISNTGGNLTAVSLLKAVILINRGKCLKYIGNKSYNHLELIFMALYLAQDSHDS 151

Query: 145 XXXXXX--XXXLDAPRIIATF--NSVCVEELTVPSEVMLEFITLMLKMSKSTIIKNSKLD 200
                       +  ++I+++  NS CV E+TV ++ +L+F T++L +S      NS++D
Sbjct: 152 TKKESYDPKEPHNIEKVISSYDGNSDCVSEITVQADNLLQFTTMLLLLSARIPRPNSQID 211

Query: 201 PNVSEG-WESFRPFALSILRTMNTNIATQNDLLKYGITFSQFQSTISTVCPNLLLPFESL 259
              ++  W  +   A +++RTMN++I +      + I+F QF   IS + P +L   ++L
Sbjct: 212 LKTADNDWAKYEKSAYNVIRTMNSSIISS--CQTHTISFHQFYDVISILLPTILTTLDNL 269

Query: 260 MEHVLFLGRDLVDIDASQPPLLESKLVSEPLLAQLA-TVWPRELVFSRLQKLYVGRDSGF 318
           ++H+L+    LVD  A  P   E+K+++    A L   +  +    S+LQKLYVGRDSGF
Sbjct: 270 LQHLLYTPDQLVDHTALGPTFTETKVMNHGSFALLQFALADKGYPISKLQKLYVGRDSGF 329

Query: 319 SMRSFQAKAFKWMAPSILLIHGVRIPNDEEYAKSKNHRYKNFLEEYPRLKEEDQVLLPPF 378
           SMRSFQ K F W AP++L + G RI +D++Y+K+KN RY  FLE++ +L++ DQ L P  
Sbjct: 330 SMRSFQGKVFHWHAPTLLFVSGSRIQDDDDYSKNKNPRYSKFLEDFRKLRDTDQQLSPCL 389

Query: 379 SGKKKLLFAVYVNVPWKVTNSELFGDLKTTIIQLSPIQEVYKASRPGNIYFNTLGGGIGV 438
             K+K++F +Y+  PW+VTN + F   +TTI QLSP  +++KA+R   +YFNT+GGGIG+
Sbjct: 390 LKKRKVMFVIYIESPWRVTNKDYFSAGRTTIFQLSPELDIFKANRDDVVYFNTMGGGIGI 449

Query: 439 GSPQPIVKPTSRKYLPGNVSLTIDPNLEFAVFRSAGFGGSIKPSSTIVN----------- 487
           G  QP  K   R+Y PGN+SLT+D +LEF  FR+ G GG  +P +               
Sbjct: 450 GDTQPYTKVNYREYRPGNISLTLDSSLEFGAFRNVGPGGMFEPGALFTRRNGDGVVTSNS 509

Query: 488 -EHKFLIQDIEAWGCGGEKELEEQMKNXXXXXXXXXXXXXINLKSINDDRALLEMAGLVG 546
            E +FLIQD+E WGCGGEKEL EQMK              +NLKS+++DRALLEMAGLVG
Sbjct: 510 YELRFLIQDVEVWGCGGEKELSEQMKQLQWEETEAKRRQHVNLKSLSEDRALLEMAGLVG 569

Query: 547 QNQSGGSI 554
           Q+QSGGSI
Sbjct: 570 QHQSGGSI 577

>Kpol_1016.7 s1016 complement(14315..16003) [1689 bp, 562 aa] {ON}
           complement(14315..16003) [1689 nt, 563 aa]
          Length = 562

 Score =  414 bits (1063), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 231/549 (42%), Positives = 342/549 (62%), Gaps = 16/549 (2%)

Query: 16  PQFNSEKDVIIWFDKKAIKSLTSPELVSFKANINGKDLSDVVTSDELLKVLRLDGVNETV 75
           P+  S +D++ +F+ +++  L   E+  FK+ +  KDLSD +T DE   +LR+   N  +
Sbjct: 20  PELKSREDILDFFNNRSLSILLPMEIECFKSRLGDKDLSDPLTKDEFNTLLRIADSNSQL 79

Query: 76  SSLIFNCVQTLSNFPFIRDCYENITYSGLLKSCVLLNKARCLSYVKNKRYDHTKLVYISL 135
             L++N    +S FPF+ +  E++T  G+LK  +LL + R   Y+        KL++I L
Sbjct: 80  QILLWNFFLKISAFPFLSNRSESMTGFGILKGIILLTRERIKKYLGWSNAKLIKLIFIGL 139

Query: 136 ALNKTVKEVXXXXXXXXXLDAPRIIATFNSVCVEELTVPSEVMLEFITLMLKMSKSTIIK 195
               T +E               ++ T + + +   TV    ML FIT +L +S      
Sbjct: 140 ----TSQEKVGVKTEASVFKIQHVLDTLDGIDLASSTVKDTDMLSFITWLLLLSVHCPTS 195

Query: 196 NSKL-DPNVSEGWESFRPFALSILRTMNTNIATQNDLLKYGITFSQFQSTISTVCPNLLL 254
           N KL + ++ + W+ +   A S++R+MN  I T    +  GI++S F  TI  V  N++ 
Sbjct: 196 NCKLNEKSLYDKWKDYEIVASSMVRSMNKKITTTGKGI--GISYSDFSHTIVAVSKNVMS 253

Query: 255 PFESLMEHVLFLGRDLVDIDASQPPLLESKLVSEPLLAQLATVWPRELVFSRLQKLYVGR 314
           P E+++EH+L+   DL++       L E+KL++ PL+AQL TV P E+V S+LQKLYVGR
Sbjct: 254 PLENIVEHMLYKQDDLLEFPCLDTFLKETKLMTYPLVAQLCTVLPNEIVMSQLQKLYVGR 313

Query: 315 DSGFSMRSFQAKAFKWMAPSILLIHGVRIPNDEEYAKSKNHRYKNFLEEYPRLKEEDQVL 374
           +SG+SMRS Q+K F W A +ILL+ G RI +D EY+++KN RYK FLEEYP+LK+EDQ +
Sbjct: 314 ESGYSMRSLQSKVFNWKAATILLVSGTRIVDDIEYSENKNPRYKRFLEEYPKLKDEDQEM 373

Query: 375 LPPFSGKKKLLFAVYVNVPWKVTNSELFGDLKTTIIQLSPIQEVYKASRPGNIYFNTLGG 434
               + KKK+ FAVY++ PW+VTN   FG+ +T+II+LSP Q+ + + + G++YFNT+GG
Sbjct: 374 DDCHNLKKKVTFAVYIDEPWRVTNKNYFGEKRTSIIELSPRQDKFNSLKVGSVYFNTIGG 433

Query: 435 GIGVGSPQPIVKPTSRKYLPGNVSLTIDPNLEFAVFRSAGFGGSIKPSSTIVN------- 487
           GIG+G+ QP+ K  S +Y PGNVSLT+D  LEF VFR  G+GG+I PS  +         
Sbjct: 434 GIGIGNNQPVTKLNSVRYAPGNVSLTLDNTLEFGVFRHTGYGGTIGPSELLKKNNEENKA 493

Query: 488 -EHKFLIQDIEAWGCGGEKELEEQMKNXXXXXXXXXXXXXINLKSINDDRALLEMAGLVG 546
            E +FLI+D+E WGCGGEKELEEQ++              INLK++ +DRALLEMAG++G
Sbjct: 494 FEIRFLIRDVEVWGCGGEKELEEQLREWKWEEAEAKRRQEINLKTMGEDRALLEMAGIIG 553

Query: 547 QN-QSGGSI 554
           Q+ QSGGSI
Sbjct: 554 QHGQSGGSI 562

>AER258C Chr5 complement(1111936..1113609) [1674 bp, 557 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR118W
          Length = 557

 Score =  374 bits (960), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 206/548 (37%), Positives = 309/548 (56%), Gaps = 20/548 (3%)

Query: 18  FNSEKDVIIWFDKKAIKSLTSPELVSFKANINGKDLSDVVTSDELLKVLRLDGVNETV-- 75
           F     +I +F+ +A++ L++ E  +F  NI GK++      D L  +  L GV   V  
Sbjct: 19  FTDRDALIAFFNARALRQLSAVEQWAFHQNI-GKNIEPTEELD-LQALATLYGVPADVPW 76

Query: 76  -SSLIFNCVQTLSNFPFIRDCYENITYSGLLKSCVLLNKARCLSYVKNKRYDHTKLVYIS 134
            + + +  V  L++FP + DC    TY GLLK C+L NK R   Y   K YD   LV   
Sbjct: 77  FTEVFYTFVCRLTSFPLMNDC-SPPTYMGLLKVCLLFNKKRAARYTARKSYDVASLVLAL 135

Query: 135 LALNKTVKEVXXXXXXXXXLDAPRIIATFNSVCVEELTVPSEVMLEFITLMLKMSKSTII 194
           LA  +   +           D  ++I T +   + EL V    ++ +   + ++S+    
Sbjct: 136 LAPPRDACD-----ENVDQFDGDKLIDTLDGTFIAELEVRPNKLVRYSPFIAQISQVCNG 190

Query: 195 KNSKLDPNVSEGWESFRPFALSILRTMNTNIATQNDLLKYGITFSQFQSTISTVCPNLLL 254
            N  L  ++   W       L++LR++++ I +++D     IT+ QF   + +V PN+  
Sbjct: 191 SNEPLSRSMFPAWNRNNQIPLALLRSLDSTIVSRSDARSRSITYQQFAGGLRSVFPNVFD 250

Query: 255 PFESLMEHVLFLGRDLVDIDASQPPLLESKLVSEPLLAQLATVWPRELVFSRLQKLYVGR 314
                +E + ++ RD  +     P    S +V+  LL QL+T++PR  +F+ +Q+L+V  
Sbjct: 251 ALGLFLERLFYVKRDTTNKLLYTPTKETSTIVTNLLLTQLSTLYPRINLFTSMQRLFVAG 310

Query: 315 DSGFSMRSFQAKAFKWMAPSILLIHGVRIPNDEEYAKSKNHRYKNFLEEYPRLKEEDQVL 374
           D+GFSM  FQAK FKWMAP+IL + G RI  D+E   +KN RYK FL++YP LK+ +Q L
Sbjct: 311 DAGFSMSVFQAKVFKWMAPTILFVSGTRI-QDDEIVCTKNKRYKAFLQDYPALKDAEQQL 369

Query: 375 LPPFSGKKKLLFAVYVNVPWKVTNSELFGDLKTTIIQLSPIQEVYKASRPGNIYFNTLGG 434
                 K+ L++A++V  PWK+TN +LFGD+ TTIIQL+P Q+++KA    NIYFN +GG
Sbjct: 370 ALCDRKKRNLIYAIFVRDPWKITNKDLFGDMDTTIIQLAPRQKIFKAQEAPNIYFNAVGG 429

Query: 435 GIGVGSPQPIVKPTSRKYLPGNVSLTIDPNLEFAVFRSAGFGGSIKPSSTI--------V 486
           GIG GS QP VKP  ++Y PGNVS T+DP++EFAVFR+ G GG     S +         
Sbjct: 430 GIGFGSSQPSVKPAGKRYFPGNVSFTVDPSMEFAVFRNVGDGGMFSHGSAVPAPAEQPLS 489

Query: 487 NEHKFLIQDIEAWGCGGEKELEEQMKNXXXXXXXXXXXXXINLKSINDDRALLEMAGLVG 546
            EH+ +I+D+E WG GGE+EL++Q++              I     N+DRALLEMAG+VG
Sbjct: 490 YEHRLMIKDLEVWGYGGEEELQKQIQRWQWEEAEATKRKYIKTNGGNEDRALLEMAGIVG 549

Query: 547 QNQSGGSI 554
             QSGGS+
Sbjct: 550 HYQSGGSV 557

>CAGL0L11616g Chr12 complement(1240790..1242457) [1668 bp, 555 aa]
           {ON} similar to uniprot|Q12108 Saccharomyces cerevisiae
           YOR118w
          Length = 555

 Score =  366 bits (939), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 206/549 (37%), Positives = 317/549 (57%), Gaps = 21/549 (3%)

Query: 16  PQFNSEKDVIIWFDKKAIKSLTSPELVSFKANINGKDLSDVVTSDELLKVLRLDGVNETV 75
           PQF +  +++ +F+ + +K  T  E+ +FK   N  DL++ +    + + L LD     V
Sbjct: 18  PQFKTRDEILQYFNTRVVKLFTVTEIAAFKKRFNAIDLNEPIDDTLIKEALYLDA-QPNV 76

Query: 76  SSLIFNCVQTLSNFP-FIRDCYENITYSGLLKSCVLLNKARCLSYVKNK--RYDHTKLVY 132
            S +   ++ L NFP F +   ++IT  GLLK   ++N  R    V     RYD T    
Sbjct: 77  WSAVSETIRLLQNFPLFHQPIADSITGFGLLKVIAIINVKRFEKLVNTTITRYDIT---- 132

Query: 133 ISLALNKTVKEVXXXXXXXXXLDAPRIIATFNSVCVEELTVPSEVMLEFITLMLKMSKST 192
           ++L L    KE           D   I+ T++ + +E + +P + ++  +  +L +    
Sbjct: 133 VTLGLCGQAKESENKIKSTNLGD---ILKTYDHIEIESIHIPYDKLILLVAWLLTLVTGV 189

Query: 193 IIKNSKLD-PNVSEGWESFRPFALSILRTMNTN-IATQNDLLKYGITFSQFQSTISTVCP 250
              N K++  +    W +F+  A+SI  T++T+ +   ND+   GI  +   +  +T+  
Sbjct: 190 ATTNCKVELSDTIANWNNFKSSAISIANTISTSALGNANDI---GIPATDILNAFNTIMI 246

Query: 251 NLLLPFESLMEHVLFLGRDLVDIDASQPPLLESKLVSEPLLAQLATVWPRELVFSRLQKL 310
           +L+    +L EH+LF   DL+D       L    +++  L AQ+    P  +  ++LQKL
Sbjct: 247 SLVPYMSNLFEHLLFGVDDLIDHVNDLANLSHQDVLTPSLYAQVIIGLPNSITITKLQKL 306

Query: 311 YVGRDSGFSMRSFQAKAFKWMAPSILLIHGVRIPNDEEYAKSKNHRYKNFLEEYPRLKEE 370
           YVG++SGFSMRS Q+K F+W AP+++++ G RI +DE YA SKN RY++FL  +P+L+E 
Sbjct: 307 YVGKESGFSMRSLQSKVFRWKAPTLMIVSGTRISDDESYADSKNPRYRSFLYSFPKLREN 366

Query: 371 DQVLLPPFSGKKKLLFAVYVNVPWKVTNSELFGDLKTTIIQLSPIQEVYKASRPGNIYFN 430
           DQ L      KKK+ +AVY++ PWKV+N E FG    TI++L+P Q+ Y++     +YFN
Sbjct: 367 DQNLDAIHLTKKKVTYAVYIDEPWKVSNKEKFGATNMTIMELTPQQKTYQSCMERTMYFN 426

Query: 431 TLGGGIGVGSPQPIVKPTSRKYLPGNVSLTIDPNLEFAVFRSAGFGGSIKPS-----STI 485
           T+GGGIGVGS QPIVK    K++PGN+SLT+D +LEF VFR  G GG  K S      + 
Sbjct: 427 TIGGGIGVGSEQPIVKQNDIKFIPGNISLTMDSSLEFGVFRHVGAGGGFKTSLLDNDDSK 486

Query: 486 VNEHKFLIQDIEAWGCGGEKELEEQMKNXXXXXXXXXXXXXINLKSINDDRALLEMAGLV 545
             E +F+IQ++E WGCGGEKEL EQ+K              INL+S+++D+ALLEM GLV
Sbjct: 487 SFEIRFIIQNVEVWGCGGEKELAEQLKQLEWEEAEAKRRQTINLQSLSEDKALLEMVGLV 546

Query: 546 GQNQSGGSI 554
           GQ+QSGGS+
Sbjct: 547 GQHQSGGSV 555

>TBLA0A06530 Chr1 complement(1600111..1601589) [1479 bp, 492 aa]
           {ON} Anc_5.431 YOR118W
          Length = 492

 Score =  231 bits (588), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 165/523 (31%), Positives = 264/523 (50%), Gaps = 69/523 (13%)

Query: 36  LTSPELVSFKANINGKDLSDVVTSDELLKVLRLDGVNETVSSLIFNCVQTLSNFPFIRDC 95
            T  EL++F+  IN + L D+++  E++K   +      +  L    ++ L+ +P   + 
Sbjct: 25  FTVSELITFQKRIN-RSLDDIISDKEIIKFSYIPDSKPHLQHLYLRFIRNLNKYPSNDNI 83

Query: 96  YENITYSGLLKSCVLLNKARCLSYVKNKRY---DHTKLVYISLALNKTVKEVXXXXXXXX 152
              IT    LK   LLNK R     +NK +   +  K++++ L+                
Sbjct: 84  ---ITGYSYLKIITLLNKKR-----RNKMFPKIEWIKIIFMCLS---------------- 119

Query: 153 XLDAPRIIATFNSVCVEELTVPSEVMLEFITLMLKMSKSTIIKNSKLDPNVS---EGWES 209
             D       + +    ++ V    ++EFI+L+L ++ +       ++ +++     W++
Sbjct: 120 --DEEVQFPCWETT--HDIHVLENDLIEFISLLLTLNMNCCTDYCLINQDLTFNDHDWDT 175

Query: 210 F-RPFALSILRTMNTNIATQNDLLKYGITFSQFQSTISTVCPNLLLPFESLMEHVLFLGR 268
           + R  A  I+R M                  +F++ +  V PN+    ++L+EH L+   
Sbjct: 176 YWRKSASCIVRDMKE------------CNVEEFENVLLIV-PNIFDCLKNLIEHSLYTKD 222

Query: 269 DLVDIDASQPPLLESKLVSEPLLAQLATVWPRELVFSRLQKLYVGRDSGFSMRSFQAKAF 328
            L +         ++K+    L   L ++  R +  S   KLY+GR++G+SMRSFQ+K F
Sbjct: 223 QLKECPLGPSQFTKTKMNQAILCQILLSMRKRSMDIS---KLYIGRENGYSMRSFQSKVF 279

Query: 329 KWMAPSILLIHGVRIPNDEEYAKSKNHRYKNFLEEYPRLKEEDQVLLPPFSGKKKLLFAV 388
           KW AP+ILLI G +I ND+EY++ KN+RYK+FL  YPRLK+       P        FA+
Sbjct: 280 KWKAPTILLITGKKIINDQEYSE-KNNRYKSFLNSYPRLKDGKTTFQTPLH----YTFAI 334

Query: 389 YVNVPWKVTNSELFGDLKTTIIQLSPIQEVYKASRPGNIYFNTLGGGIGVGSPQPIVKPT 448
           Y+  PWK+T    FG L T IIQLSP Q+V+  + P  +YF+T   GIG+G+       +
Sbjct: 335 YIEEPWKMTKG-YFGGLHTKIIQLSPRQDVFTCTDPNAVYFHT-QNGIGIGNEH---MSS 389

Query: 449 SRKYLPGNVSLTIDPNLEFAVFRSAGFGGSIKPSSTIVNEHKF----LIQDIEAWGCGGE 504
             KY PGNVS+TID  LEFAVFR +G G  +  +  I N+  F     IQ +E WGCGG 
Sbjct: 390 DNKYKPGNVSITIDSTLEFAVFRHSGPG--VFKTGIIANQEIFEIRLHIQSVEVWGCGGA 447

Query: 505 KELEEQMKNXXXXXXXXXXXXXINLKSINDDRALLEMAGLVGQ 547
           KEL EQ                +++  + +DRALLE+AG++G+
Sbjct: 448 KELAEQKHEWEWEEREAQRRQHVSM-HVTEDRALLELAGIIGE 489

>YNL224C Chr14 complement(224796..227099) [2304 bp, 767 aa] {ON}
           SQS1Stimulates the ATPase and helicase activities of
           Prp43p; acts with Prp43p to stimulate 18s rRNA
           maturation by Nob1p; overexpression antagonizes the
           suppression of splicing defects by spp382 mutants;
           component of pre-ribosomal particles
          Length = 767

 Score = 35.4 bits (80), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 44/81 (54%), Gaps = 13/81 (16%)

Query: 166 VCVEELTVPSEVMLEFITLM------LKMSKSTIIKNSKLD-PNVSEGWESFRPFA---L 215
           VC+EE+  P EV +EF  ++      L +S+    K   +D PN  +G +++ PFA    
Sbjct: 226 VCIEEIARPREVAIEFDPILTIGKVELSVSEGNESKEISVDVPN--KGNKTYHPFAGYIS 283

Query: 216 SILRTMNTNIATQNDLLKYGI 236
           ++L  M+T+  + ND L Y I
Sbjct: 284 NVLHGMHTS-DSDNDELDYEI 303

>KLTH0E13706g Chr5 complement(1213291..1214445) [1155 bp, 384 aa]
           {ON} weakly similar to uniprot|P38292 Saccharomyces
           cerevisiae YBR168W PEX32 Peroxisomal integral membrane
           protein involved in negative regulation of peroxisome
           size partially functionally redundant with Pex31p
           genetic interactions suggest action at a step downstream
           of steps mediated by Pex28p and Pex29p
          Length = 384

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 42/78 (53%), Gaps = 13/78 (16%)

Query: 212 PFALSILRTMNTNIATQNDLLKYGITFSQ--FQSTISTV-CPNLLLPFESLMEHVLFLGR 268
           PF  S+L  ++TNI T  D    G +F++   +S + T+ C  LLL F      V ++  
Sbjct: 61  PFIHSVLLVLSTNILTVQD----GASFARRAVESWVGTMSCVLLLLSF------VYYISS 110

Query: 269 DLVDIDASQPPLLESKLV 286
            L +++A +PP LE  +V
Sbjct: 111 VLHELNADEPPTLEDIIV 128

>TPHA0L02020 Chr12 complement(419703..421454) [1752 bp, 583 aa] {ON}
           Anc_2.649 YKL012W
          Length = 583

 Score = 32.0 bits (71), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 26/43 (60%)

Query: 327 AFKWMAPSILLIHGVRIPNDEEYAKSKNHRYKNFLEEYPRLKE 369
           A + +A  ILL +G RIP+     + ++   KN+L + PRLK+
Sbjct: 418 AHRLVADQILLDNGFRIPDSSSKVQDEHTTVKNYLTQDPRLKD 460

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.136    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 55,151,970
Number of extensions: 2414033
Number of successful extensions: 6483
Number of sequences better than 10.0: 27
Number of HSP's gapped: 6596
Number of HSP's successfully gapped: 28
Length of query: 554
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 439
Effective length of database: 40,294,809
Effective search space: 17689421151
Effective search space used: 17689421151
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)