Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_55.214335.432ON47643021450.0
KLTH0F16104g5.432ON54039417780.0
SAKL0G02486g5.432ON50039616310.0
Skud_15.2825.432ON48540015850.0
AER257W5.432ON47739615810.0
YOR119C (RIO1)5.432ON48440015770.0
KAFR0E039205.432ON49742015710.0
Suva_8.1725.432ON48640015650.0
Smik_15.2975.432ON48640015620.0
KLLA0E21121g5.432ON52642515470.0
NCAS0F033605.432ON50943315250.0
TBLA0A037605.432ON50440615170.0
TDEL0E019305.432ON50238315140.0
Kpol_1062.315.432ON51342815140.0
KNAG0C049305.432ON49640914940.0
Ecym_47635.432ON53840414840.0
TPHA0E017805.432ON50842614790.0
NDAI0B056505.432ON46238014540.0
CAGL0L11594g5.432ON50739514570.0
ZYRO0F09988g5.432ON46038413131e-178
TPHA0H009202.44ON4292291356e-08
NCAS0G015802.44ON4242281284e-07
CAGL0H08019g2.44ON4252391285e-07
Kwal_23.45632.44ON4252301241e-06
KAFR0A077602.44ON4252281195e-06
Suva_14.1362.44ON4262281171e-05
Smik_14.1252.44ON4202281171e-05
Skud_14.1292.44ON4252281133e-05
KNAG0F010602.44ON4282311107e-05
NDAI0F036002.44ON4212281107e-05
KLTH0B07722g2.44ON4282331081e-04
SAKL0E13552g2.44ON4192291053e-04
YNL207W (RIO2)2.44ON4252291044e-04
Ecym_64492.44ON4172311034e-04
Kpol_400.72.44ON4253001000.001
TDEL0A008602.44ON419241990.001
ZYRO0C10340g2.44ON416229950.005
Ecym_11191.104ON79149790.40
TPHA0J031505.168ON18082721.5
KLLA0F15576g5.200ON51251732.0
ZYRO0F13288g7.440ON98254732.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_55.21433
         (476 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_55.21433 s55 (835062..836492) [1431 bp, 476 aa] {ON} YOR119...   830   0.0  
KLTH0F16104g Chr6 (1306436..1308058) [1623 bp, 540 aa] {ON} simi...   689   0.0  
SAKL0G02486g Chr7 complement(206119..207621) [1503 bp, 500 aa] {...   632   0.0  
Skud_15.282 Chr15 complement(505219..506676) [1458 bp, 485 aa] {...   615   0.0  
AER257W Chr5 (1110411..1111844) [1434 bp, 477 aa] {ON} Syntenic ...   613   0.0  
YOR119C Chr15 complement(548792..550246) [1455 bp, 484 aa] {ON} ...   612   0.0  
KAFR0E03920 Chr5 complement(775345..776838) [1494 bp, 497 aa] {O...   609   0.0  
Suva_8.172 Chr8 complement(306553..308013) [1461 bp, 486 aa] {ON...   607   0.0  
Smik_15.297 Chr15 complement(509934..511394) [1461 bp, 486 aa] {...   606   0.0  
KLLA0E21121g Chr5 (1886452..1888032) [1581 bp, 526 aa] {ON} simi...   600   0.0  
NCAS0F03360 Chr6 complement(679314..680843) [1530 bp, 509 aa] {O...   592   0.0  
TBLA0A03760 Chr1 complement(938917..940431) [1515 bp, 504 aa] {O...   588   0.0  
TDEL0E01930 Chr5 (363913..365421) [1509 bp, 502 aa] {ON} Anc_5.4...   587   0.0  
Kpol_1062.31 s1062 (67759..69300) [1542 bp, 513 aa] {ON} (67759....   587   0.0  
KNAG0C04930 Chr3 (951832..953322) [1491 bp, 496 aa] {ON} Anc_5.4...   580   0.0  
Ecym_4763 Chr4 (1483168..1484784) [1617 bp, 538 aa] {ON} similar...   576   0.0  
TPHA0E01780 Chr5 (357819..359345) [1527 bp, 508 aa] {ON} Anc_5.4...   574   0.0  
NDAI0B05650 Chr2 complement(1380239..1381627) [1389 bp, 462 aa] ...   564   0.0  
CAGL0L11594g Chr12 (1239169..1240692) [1524 bp, 507 aa] {ON} hig...   565   0.0  
ZYRO0F09988g Chr6 complement(811306..812688) [1383 bp, 460 aa] {...   510   e-178
TPHA0H00920 Chr8 complement(188834..190123) [1290 bp, 429 aa] {O...    57   6e-08
NCAS0G01580 Chr7 (281438..282712) [1275 bp, 424 aa] {ON} Anc_2.44      54   4e-07
CAGL0H08019g Chr8 (781773..783050) [1278 bp, 425 aa] {ON} highly...    54   5e-07
Kwal_23.4563 s23 (768125..769402) [1278 bp, 425 aa] {ON} YNL207W...    52   1e-06
KAFR0A07760 Chr1 complement(1560351..1561628) [1278 bp, 425 aa] ...    50   5e-06
Suva_14.136 Chr14 (250349..251629) [1281 bp, 426 aa] {ON} YNL207...    50   1e-05
Smik_14.125 Chr14 (234660..235922) [1263 bp, 420 aa] {ON} YNL207...    50   1e-05
Skud_14.129 Chr14 (244224..245501) [1278 bp, 425 aa] {ON} YNL207...    48   3e-05
KNAG0F01060 Chr6 (188811..190097) [1287 bp, 428 aa] {ON} Anc_2.4...    47   7e-05
NDAI0F03600 Chr6 complement(860282..861547) [1266 bp, 421 aa] {O...    47   7e-05
KLTH0B07722g Chr2 complement(625231..626517) [1287 bp, 428 aa] {...    46   1e-04
SAKL0E13552g Chr5 complement(1118842..1120101) [1260 bp, 419 aa]...    45   3e-04
YNL207W Chr14 (255353..256630) [1278 bp, 425 aa] {ON}  RIO2Essen...    45   4e-04
Ecym_6449 Chr6 complement(873295..874548) [1254 bp, 417 aa] {ON}...    44   4e-04
Kpol_400.7 s400 complement(15841..17118) [1278 bp, 425 aa] {ON} ...    43   0.001
TDEL0A00860 Chr1 (143723..144982) [1260 bp, 419 aa] {ON} Anc_2.4...    43   0.001
ZYRO0C10340g Chr3 complement(793323..794573) [1251 bp, 416 aa] {...    41   0.005
Ecym_1119 Chr1 complement(244327..246702) [2376 bp, 791 aa] {ON}...    35   0.40 
TPHA0J03150 Chr10 complement(686778..687320) [543 bp, 180 aa] {O...    32   1.5  
KLLA0F15576g Chr6 (1437595..1439133) [1539 bp, 512 aa] {ON} simi...    33   2.0  
ZYRO0F13288g Chr6 (1089259..1092207) [2949 bp, 982 aa] {ON} simi...    33   2.4  

>Kwal_55.21433 s55 (835062..836492) [1431 bp, 476 aa] {ON} YOR119C
           (RIO1) - similar to a C.elegans ZK632.3 protein [contig
           130] FULL
          Length = 476

 Score =  830 bits (2145), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/430 (93%), Positives = 404/430 (93%)

Query: 1   MSLKDRMDNLRLRDNFEPQDDHINTQILDKHAHNIKADELSVSRGKTSKDKANRATVENV 60
           MSLKDRMDNLRLRDNFEPQDDHINTQILDKHAHNIKADELSVSRGKTSKDKANRATVENV
Sbjct: 1   MSLKDRMDNLRLRDNFEPQDDHINTQILDKHAHNIKADELSVSRGKTSKDKANRATVENV 60

Query: 61  LDPRTMRFLQALTSRGVISQFNGCVSTGKEANVYHAFAEIGAKNTEEAGEVLPNLEERRE 120
           LDPRTMRFLQALTSRGVISQFNGCVSTGKEANVYHAFAEIGAKNTEEAGEVLPNLEERRE
Sbjct: 61  LDPRTMRFLQALTSRGVISQFNGCVSTGKEANVYHAFAEIGAKNTEEAGEVLPNLEERRE 120

Query: 121 LAIKIFKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGLVP 180
           LAIKIFKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGLVP
Sbjct: 121 LAIKIFKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGLVP 180

Query: 181 APEPVEVRSNVLVMEFLSRGNGFASPRLKDYPYKDREETAHYYYTMVAYIRLLYQCCQLV 240
           APEPVEVRSNVLVMEFLSRGNGFASPRLKDYPYKDREETAHYYYTMVAYIRLLYQCCQLV
Sbjct: 181 APEPVEVRSNVLVMEFLSRGNGFASPRLKDYPYKDREETAHYYYTMVAYIRLLYQCCQLV 240

Query: 241 HADLSEYNAIVHNKELYIIDVSQSVQPEHPMSLDFLRMDIKNVNNYFERMSVDVFPERVI 300
           HADLSEYNAIVHNKELYIIDVSQSVQPEHPMSLDFLRMDIKNVNNYFERMSVDVFPERVI
Sbjct: 241 HADLSEYNAIVHNKELYIIDVSQSVQPEHPMSLDFLRMDIKNVNNYFERMSVDVFPERVI 300

Query: 301 FQFVISETLDKFSGDYTSSVDLRDYVSKNLPVKSGPQDEAEDEVFRSLHLVRNLGGLEER 360
           FQFVISETLDKFSGDYTSSVDLRDYVSKNLPVKSGPQDEAEDEVFRSLHLVRNLGGLEER
Sbjct: 301 FQFVISETLDKFSGDYTSSVDLRDYVSKNLPVKSGPQDEAEDEVFRSLHLVRNLGGLEER 360

Query: 361 DFDRFTLGKFDLLKSLIAHDNERVASTFTASEQFELXXXXXXXXXXXXXXXXXXXXXXXX 420
           DFDRFTLGKFDLLKSLIAHDNERVASTFTASEQFEL                        
Sbjct: 361 DFDRFTLGKFDLLKSLIAHDNERVASTFTASEQFELSSSSDEEDDDSESDEGEEEDDGSE 420

Query: 421 XXWYEKHTEL 430
             WYEKHTEL
Sbjct: 421 DEWYEKHTEL 430

>KLTH0F16104g Chr6 (1306436..1308058) [1623 bp, 540 aa] {ON} similar
           to uniprot|Q12196 YOR119C Saccharomyces cerevisiae RIO1
           Essential protein that plays a role in cell cycle
           progression
          Length = 540

 Score =  689 bits (1778), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/394 (82%), Positives = 362/394 (91%)

Query: 1   MSLKDRMDNLRLRDNFEPQDDHINTQILDKHAHNIKADELSVSRGKTSKDKANRATVENV 60
           MSL+D +  L L +      DHINTQILDKHAHNIK DELSV+R KTSKDKANRATVENV
Sbjct: 53  MSLEDGLGKLSLHEKHGADRDHINTQILDKHAHNIKTDELSVTRAKTSKDKANRATVENV 112

Query: 61  LDPRTMRFLQALTSRGVISQFNGCVSTGKEANVYHAFAEIGAKNTEEAGEVLPNLEERRE 120
           LDPRTMRFLQAL SRGVIS+FNGC+STGKEANVYHAFA  GAK++EE  +VLPN  ERRE
Sbjct: 113 LDPRTMRFLQALKSRGVISEFNGCLSTGKEANVYHAFAGYGAKSSEEEQKVLPNQGERRE 172

Query: 121 LAIKIFKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGLVP 180
            AIKI+KTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSG+VP
Sbjct: 173 YAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVVP 232

Query: 181 APEPVEVRSNVLVMEFLSRGNGFASPRLKDYPYKDREETAHYYYTMVAYIRLLYQCCQLV 240
           APEP+EV+SNVLVMEFL+RG+GFASP+LKD+PYKDR+ET +YY+TMVAYIRLLYQCCQLV
Sbjct: 233 APEPIEVKSNVLVMEFLNRGDGFASPKLKDFPYKDRDETLYYYHTMVAYIRLLYQCCQLV 292

Query: 241 HADLSEYNAIVHNKELYIIDVSQSVQPEHPMSLDFLRMDIKNVNNYFERMSVDVFPERVI 300
           HADLSEYN IVHN++LY+IDVSQSVQPEHPMSLDFLRMDIKN+N+YFERMS+D+FPER I
Sbjct: 293 HADLSEYNTIVHNQKLYVIDVSQSVQPEHPMSLDFLRMDIKNINSYFERMSIDIFPERAI 352

Query: 301 FQFVISETLDKFSGDYTSSVDLRDYVSKNLPVKSGPQDEAEDEVFRSLHLVRNLGGLEER 360
           FQFVIS+ L+KF G+YT++ DLR YV+K L  KSGP+DEAEDEVFRSLHLVRNLGGLEER
Sbjct: 353 FQFVISDKLEKFEGEYTNAEDLRQYVAKTLRPKSGPEDEAEDEVFRSLHLVRNLGGLEER 412

Query: 361 DFDRFTLGKFDLLKSLIAHDNERVASTFTASEQF 394
           DFDRFTLGKFDLLKSLIAHDN++VAS FTASEQ+
Sbjct: 413 DFDRFTLGKFDLLKSLIAHDNQKVASNFTASEQY 446

>SAKL0G02486g Chr7 complement(206119..207621) [1503 bp, 500 aa] {ON}
           similar to uniprot|Q12196 YOR119C Saccharomyces
           cerevisiae RIO1 Essential protein that plays a role in
           cell cycle progression
          Length = 500

 Score =  632 bits (1631), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/396 (75%), Positives = 346/396 (87%)

Query: 1   MSLKDRMDNLRLRDNFEPQDDHINTQILDKHAHNIKADELSVSRGKTSKDKANRATVENV 60
           MS++     L LRD  +   DH+N++ILDK++H IK DELS++RGKT+KDKANRATVENV
Sbjct: 1   MSVEASFSKLHLRDGPDEHRDHVNSRILDKYSHRIKTDELSLTRGKTNKDKANRATVENV 60

Query: 61  LDPRTMRFLQALTSRGVISQFNGCVSTGKEANVYHAFAEIGAKNTEEAGEVLPNLEERRE 120
           LDPRTMRFL+ L SRGV+S  NGC+STGKEANVYHAFA    + +EEA +   +   +RE
Sbjct: 61  LDPRTMRFLRGLVSRGVLSDLNGCLSTGKEANVYHAFAGNANQPSEEAEKDSKDELVKRE 120

Query: 121 LAIKIFKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGLVP 180
            A+KI+KTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRI+QSG++P
Sbjct: 121 YAVKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIHQSGVIP 180

Query: 181 APEPVEVRSNVLVMEFLSRGNGFASPRLKDYPYKDREETAHYYYTMVAYIRLLYQCCQLV 240
            P+P+EVRSNVLVMEFL+RGNGFASPRLKD+PYKDREE  +YY+TMVAY+RLLYQ CQLV
Sbjct: 181 CPQPIEVRSNVLVMEFLNRGNGFASPRLKDHPYKDREEIKYYYHTMVAYMRLLYQVCQLV 240

Query: 241 HADLSEYNAIVHNKELYIIDVSQSVQPEHPMSLDFLRMDIKNVNNYFERMSVDVFPERVI 300
           HADLSEYN IVH+  LY+IDVSQSVQPEHPMSLDFLRMDIKN+N+YFE+  +D+FPERVI
Sbjct: 241 HADLSEYNTIVHHDRLYMIDVSQSVQPEHPMSLDFLRMDIKNINSYFEKTGIDIFPERVI 300

Query: 301 FQFVISETLDKFSGDYTSSVDLRDYVSKNLPVKSGPQDEAEDEVFRSLHLVRNLGGLEER 360
           FQF+ISETLDKF GDY +  DLRDYVSKNLP+KS  +DEAEDEVFRSLHLVRNL GLEER
Sbjct: 301 FQFIISETLDKFQGDYHNDQDLRDYVSKNLPLKSTAEDEAEDEVFRSLHLVRNLNGLEER 360

Query: 361 DFDRFTLGKFDLLKSLIAHDNERVASTFTASEQFEL 396
           DFDRFT GKFDLLKSLIAHDN++ A+ F ASEQFE+
Sbjct: 361 DFDRFTDGKFDLLKSLIAHDNKKNATNFNASEQFEI 396

>Skud_15.282 Chr15 complement(505219..506676) [1458 bp, 485 aa] {ON}
           YOR119C (REAL)
          Length = 485

 Score =  615 bits (1585), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/400 (74%), Positives = 342/400 (85%), Gaps = 10/400 (2%)

Query: 1   MSLKDRMDNLRLRDNFEPQDDHINTQILDKHAHNIKADELSVSRGKTSKDKANRATVENV 60
           MSL+DR D L +    +   DHIN Q+L+K++H IK DELS S+ KTSKDKANRATVENV
Sbjct: 1   MSLEDRFDRLTVS---QRASDHINNQLLEKYSHKIKTDELSFSKAKTSKDKANRATVENV 57

Query: 61  LDPRTMRFLQALTSRGVISQFNGCVSTGKEANVYHAFAEIGAKNT--EEAG--EVLPNLE 116
           LDPRTMRFL+++ +RGVI+  NGC+STGKEANVYHAFA  G      EE G  EVL    
Sbjct: 58  LDPRTMRFLKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGQYEVLETDG 117

Query: 117 ERRELAIKIFKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQS 176
            R+E AIKI+KTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRI+QS
Sbjct: 118 LRKEYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIHQS 177

Query: 177 GLVPAPEPVEVRSNVLVMEFLSRGNGFASPRLKDYPYKDREETAHYYYTMVAYIRLLYQC 236
           G++PAP PVEV++NVLVMEFLSRGNGFASP+L+DYPY+DREE  HYY+TMVAY+RLLYQ 
Sbjct: 178 GVIPAPRPVEVKNNVLVMEFLSRGNGFASPKLRDYPYRDREEIFHYYHTMVAYMRLLYQV 237

Query: 237 CQLVHADLSEYNAIVHNKELYIIDVSQSVQPEHPMSLDFLRMDIKNVNNYFERMSVDVFP 296
           C+LVHADLSEYN I+HN +LY+IDVSQSV+PEHPMSLDFLRMDIKNVN YFE+M V +FP
Sbjct: 238 CRLVHADLSEYNTIIHNDKLYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKMGVSIFP 297

Query: 297 ERVIFQFVISETLDKFSGDYTSSVDLRDYVSKNLPVKSGPQDEAEDEVFRSLHLVRNLGG 356
           ERVIFQFVISE+L+KF GDY + +DL  Y++KNLP+KS  QDEAEDE+FRSLHLVR+LGG
Sbjct: 298 ERVIFQFVISESLEKFKGDYHNVIDLVGYIAKNLPIKSTEQDEAEDEIFRSLHLVRSLGG 357

Query: 357 LEERDFDRFTLGKFDLLKSLIAHDNERVASTFTASEQFEL 396
           LEERDFDR+T GKFDLLKSLIAHDNER    F ASEQFE 
Sbjct: 358 LEERDFDRYTDGKFDLLKSLIAHDNER---NFAASEQFEF 394

>AER257W Chr5 (1110411..1111844) [1434 bp, 477 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR119C (RIO1)
          Length = 477

 Score =  613 bits (1581), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/396 (75%), Positives = 344/396 (86%), Gaps = 15/396 (3%)

Query: 1   MSLKDRMDNLRLRDNFEPQDDHINTQILDKHAHNIKADELSVSRGKTSKDKANRATVENV 60
           M L+D++  L+LRD+     DH NT+IL+K A+ IK DELS+++GKT+KDKANRATVENV
Sbjct: 1   MDLEDQLRKLKLRDD----TDHDNTRILEKFANQIKTDELSLTKGKTNKDKANRATVENV 56

Query: 61  LDPRTMRFLQALTSRGVISQFNGCVSTGKEANVYHAFAEIGAKNTEEAGEVLPNLEERRE 120
           LDPRTMRFL+AL +RGV+S+FNGC+STGKEANVYHA +  GA  TE A        E+ E
Sbjct: 57  LDPRTMRFLRALVNRGVLSEFNGCLSTGKEANVYHALS--GA--TEGA-------PEKSE 105

Query: 121 LAIKIFKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGLVP 180
            A+KI+KTSILVFKDRERYVDGEFRFRN+RS HNPRKMIKIWAEKEFRNLKRIYQSG++P
Sbjct: 106 YAVKIYKTSILVFKDRERYVDGEFRFRNARSHHNPRKMIKIWAEKEFRNLKRIYQSGVIP 165

Query: 181 APEPVEVRSNVLVMEFLSRGNGFASPRLKDYPYKDREETAHYYYTMVAYIRLLYQCCQLV 240
            P+PVE++SNVLVMEFL+RG+GFASPRLKDYP+KDR+E  HYY+ MV+YIRLLYQ CQLV
Sbjct: 166 CPQPVEIKSNVLVMEFLNRGDGFASPRLKDYPFKDRDEIYHYYHVMVSYIRLLYQVCQLV 225

Query: 241 HADLSEYNAIVHNKELYIIDVSQSVQPEHPMSLDFLRMDIKNVNNYFERMSVDVFPERVI 300
           HADLSEYN+IVH  +LYIIDVSQSVQPEHPMSLDFLRMDIKN+N YFERM +D+FPERVI
Sbjct: 226 HADLSEYNSIVHQSKLYIIDVSQSVQPEHPMSLDFLRMDIKNINMYFERMGIDIFPERVI 285

Query: 301 FQFVISETLDKFSGDYTSSVDLRDYVSKNLPVKSGPQDEAEDEVFRSLHLVRNLGGLEER 360
           FQFVISETLDKF GD  S+ DLR YV+ NLP K   QDEAED+VFRSLHLVRNLGGLEER
Sbjct: 286 FQFVISETLDKFRGDMRSAEDLRSYVAANLPRKQTAQDEAEDQVFRSLHLVRNLGGLEER 345

Query: 361 DFDRFTLGKFDLLKSLIAHDNERVASTFTASEQFEL 396
           DFDRFT GKFDLLKSLIA DN ++++TFTASEQ++L
Sbjct: 346 DFDRFTDGKFDLLKSLIAQDNAKISNTFTASEQYDL 381

>YOR119C Chr15 complement(548792..550246) [1455 bp, 484 aa] {ON}
           RIO1Essential serine kinase involved in cell cycle
           progression and processing of the 20S pre-rRNA into
           mature 18S rRNA
          Length = 484

 Score =  612 bits (1577), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/400 (74%), Positives = 340/400 (85%), Gaps = 10/400 (2%)

Query: 1   MSLKDRMDNLRLRDNFEPQDDHINTQILDKHAHNIKADELSVSRGKTSKDKANRATVENV 60
           MSL+D+ D+L +    +   DHIN Q+L+K++H IK DELS SR KTSKDKANRATVENV
Sbjct: 1   MSLEDKFDSLSVS---QGASDHINNQLLEKYSHKIKTDELSFSRAKTSKDKANRATVENV 57

Query: 61  LDPRTMRFLQALTSRGVISQFNGCVSTGKEANVYHAFAEIGAKNT--EEAG--EVLPNLE 116
           LDPRTMRFL+++ +RGVI+  NGC+STGKEANVYHAFA  G      EE G  EVL    
Sbjct: 58  LDPRTMRFLKSMVTRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGQYEVLETDG 117

Query: 117 ERRELAIKIFKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQS 176
            R E AIKI+KTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQS
Sbjct: 118 SRAEYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQS 177

Query: 177 GLVPAPEPVEVRSNVLVMEFLSRGNGFASPRLKDYPYKDREETAHYYYTMVAYIRLLYQC 236
           G++PAP+P+EV++NVLVMEFLSRGNGFASP+LKDYPYK+R+E  HYY+TMVAY+RLLYQ 
Sbjct: 178 GVIPAPKPIEVKNNVLVMEFLSRGNGFASPKLKDYPYKNRDEIFHYYHTMVAYMRLLYQV 237

Query: 237 CQLVHADLSEYNAIVHNKELYIIDVSQSVQPEHPMSLDFLRMDIKNVNNYFERMSVDVFP 296
           C+LVHADLSEYN IVH+ +LY+IDVSQSV+PEHPMSLDFLRMDIKNVN YFE+M + +FP
Sbjct: 238 CRLVHADLSEYNTIVHDDKLYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKMGISIFP 297

Query: 297 ERVIFQFVISETLDKFSGDYTSSVDLRDYVSKNLPVKSGPQDEAEDEVFRSLHLVRNLGG 356
           ERVIFQFVISETL+KF GDY +   L  Y++ NLP+KS  QDEAEDE+FRSLHLVR+LGG
Sbjct: 298 ERVIFQFVISETLEKFKGDYNNISALVAYIASNLPIKSTEQDEAEDEIFRSLHLVRSLGG 357

Query: 357 LEERDFDRFTLGKFDLLKSLIAHDNERVASTFTASEQFEL 396
           LEERDFDR+T GKFDLLKSLIAHDNER    F ASEQFE 
Sbjct: 358 LEERDFDRYTDGKFDLLKSLIAHDNER---NFAASEQFEF 394

>KAFR0E03920 Chr5 complement(775345..776838) [1494 bp, 497 aa] {ON}
           Anc_5.432 YOR119C
          Length = 497

 Score =  609 bits (1571), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/420 (70%), Positives = 344/420 (81%), Gaps = 32/420 (7%)

Query: 1   MSLKDRMDNLRLRDNFEPQDDHINTQILDKHAHNIKADELSVSRGKTSKDKANRATVENV 60
           MS++D+ DNL++        DHIN QILDK+ H IK +E S+SRGKT+KDKANRATVENV
Sbjct: 1   MSIEDKFDNLKISGG-RGSSDHINNQILDKYGHKIKTNEFSLSRGKTNKDKANRATVENV 59

Query: 61  LDPRTMRFLQALTSRGVISQFNGCVSTGKEANVYHAFAEIGAKNTEEAGEVLPNLEE--- 117
           LDPRTM+FLQAL SRGVIS F+GC+STGKEANVYHAFA  G      AG+V   ++E   
Sbjct: 60  LDPRTMKFLQALMSRGVISSFDGCLSTGKEANVYHAFAGTG----RPAGQVPTLVQEEMS 115

Query: 118 ---------------------RRELAIKIFKTSILVFKDRERYVDGEFRFRNSRSQHNPR 156
                                R E AIKI+KTSILVFKDRERYVDGEFRFRN+RSQHNPR
Sbjct: 116 VPVDPSELSAQEDKDENSTDRREEYAIKIYKTSILVFKDRERYVDGEFRFRNARSQHNPR 175

Query: 157 KMIKIWAEKEFRNLKRIYQSGLVPAPEPVEVRSNVLVMEFLSRGNGFASPRLKDYPYKDR 216
           KMIKIWAEKEFRNLKRIYQS ++PAP+P+E+++NVLVMEFL+RG+GFASPRLKD+PYKDR
Sbjct: 176 KMIKIWAEKEFRNLKRIYQSEVIPAPKPIEIKNNVLVMEFLNRGDGFASPRLKDHPYKDR 235

Query: 217 EETAHYYYTMVAYIRLLYQCCQLVHADLSEYNAIVHNKELYIIDVSQSVQPEHPMSLDFL 276
           EE  HYY+T+VAYIRLLYQ C LVHADLSEYN +VH   LY+IDVSQSV+PEHPMSLDFL
Sbjct: 236 EEIFHYYHTLVAYIRLLYQVCHLVHADLSEYNTLVHQGRLYVIDVSQSVEPEHPMSLDFL 295

Query: 277 RMDIKNVNNYFERMSVDVFPERVIFQFVISETLDKFSGDYTSSVDLRDYVSKNLPVKSGP 336
           RMDIKNVN YFE+M +D+FPER+IFQFVISETLDKF+GDY SS DLRDYV +NLP+K+  
Sbjct: 296 RMDIKNVNFYFEKMGIDIFPERIIFQFVISETLDKFNGDYKSSDDLRDYVRQNLPIKATG 355

Query: 337 QDEAEDEVFRSLHLVRNLGGLEERDFDRFTLGKFDLLKSLIAHDNERVASTFTASEQFEL 396
           QDEAEDE+FRSL+LVRNL GLEERDFDR+T G+FDLLKSL+AHDNE+    F ASEQ+EL
Sbjct: 356 QDEAEDEIFRSLYLVRNLNGLEERDFDRYTEGRFDLLKSLLAHDNEK---NFAASEQYEL 412

>Suva_8.172 Chr8 complement(306553..308013) [1461 bp, 486 aa] {ON}
           YOR119C (REAL)
          Length = 486

 Score =  607 bits (1565), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/400 (73%), Positives = 339/400 (84%), Gaps = 10/400 (2%)

Query: 1   MSLKDRMDNLRLRDNFEPQDDHINTQILDKHAHNIKADELSVSRGKTSKDKANRATVENV 60
           MS +D+ + L +    +   DHIN Q+LDK +H IK DELS S+ KTSKDK+NRATVENV
Sbjct: 1   MSFEDKFEKLTVS---QRASDHINNQLLDKFSHKIKTDELSFSKAKTSKDKSNRATVENV 57

Query: 61  LDPRTMRFLQALTSRGVISQFNGCVSTGKEANVYHAFAEIGAKNT--EEAG--EVLPNLE 116
           LDPRTMRFL+++ +RGVI+  NGC+STGKEANVYHAFA  G      EE G  EVL    
Sbjct: 58  LDPRTMRFLKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKAPVVDEETGKYEVLETDG 117

Query: 117 ERRELAIKIFKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQS 176
            R E AIKI+KTSILVFKDRE+YVDGEFRFRN+RSQHNPRKMIKIWAEKEFRNLKRI+QS
Sbjct: 118 LRAEYAIKIYKTSILVFKDREKYVDGEFRFRNARSQHNPRKMIKIWAEKEFRNLKRIHQS 177

Query: 177 GLVPAPEPVEVRSNVLVMEFLSRGNGFASPRLKDYPYKDREETAHYYYTMVAYIRLLYQC 236
           G++PAP+PVEV++NVLVMEFLSRG+GFASP+LKDYPYKDREE  HYYYTMVAY+RLLYQ 
Sbjct: 178 GVIPAPKPVEVKNNVLVMEFLSRGDGFASPKLKDYPYKDREEIFHYYYTMVAYMRLLYQV 237

Query: 237 CQLVHADLSEYNAIVHNKELYIIDVSQSVQPEHPMSLDFLRMDIKNVNNYFERMSVDVFP 296
           C+LVHADLSEYN I+H+ +LY+IDVSQSV+PEHPMSLDFLRMDIKNVN YFE+M +++FP
Sbjct: 238 CRLVHADLSEYNTIIHDDQLYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKMGINIFP 297

Query: 297 ERVIFQFVISETLDKFSGDYTSSVDLRDYVSKNLPVKSGPQDEAEDEVFRSLHLVRNLGG 356
           ERVIFQFVISE L+KF GDY +  DL  Y+SKNLP+KS  QDEAEDE+FRSLHLVR+LGG
Sbjct: 298 ERVIFQFVISEVLEKFKGDYKNVPDLIGYISKNLPIKSTEQDEAEDEIFRSLHLVRSLGG 357

Query: 357 LEERDFDRFTLGKFDLLKSLIAHDNERVASTFTASEQFEL 396
           LEERDFDR+T GKFDLLKSLIAHDNER    F ASEQFE 
Sbjct: 358 LEERDFDRYTDGKFDLLKSLIAHDNER---NFAASEQFEF 394

>Smik_15.297 Chr15 complement(509934..511394) [1461 bp, 486 aa] {ON}
           YOR119C (REAL)
          Length = 486

 Score =  606 bits (1562), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/400 (73%), Positives = 338/400 (84%), Gaps = 10/400 (2%)

Query: 1   MSLKDRMDNLRLRDNFEPQDDHINTQILDKHAHNIKADELSVSRGKTSKDKANRATVENV 60
           MSL+D  D L +    +   DHIN Q+L+K++H IK DELS +R KTSKDKANRATVENV
Sbjct: 1   MSLEDNFDKLTVS---QRASDHINNQLLEKYSHKIKTDELSFNRAKTSKDKANRATVENV 57

Query: 61  LDPRTMRFLQALTSRGVISQFNGCVSTGKEANVYHAFAEIGAKNT--EEAG--EVLPNLE 116
           LDPRTMRFL+++ +RGVI+  NGC+STGKEANVYHAFA  G      EE G  EVL    
Sbjct: 58  LDPRTMRFLKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGKYEVLETDG 117

Query: 117 ERRELAIKIFKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQS 176
            R E AIKI+KTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQS
Sbjct: 118 PRPEYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQS 177

Query: 177 GLVPAPEPVEVRSNVLVMEFLSRGNGFASPRLKDYPYKDREETAHYYYTMVAYIRLLYQC 236
           G++PAP+P+EV++NVLVMEFLSRGNGFASP+LKDYPY+DR E  HYYYTMVAY+RLLYQ 
Sbjct: 178 GVIPAPKPIEVKNNVLVMEFLSRGNGFASPKLKDYPYRDRGEIFHYYYTMVAYMRLLYQV 237

Query: 237 CQLVHADLSEYNAIVHNKELYIIDVSQSVQPEHPMSLDFLRMDIKNVNNYFERMSVDVFP 296
           C+LVHADLSEYN I+H+ +L++IDVSQSV+PEHPMSLDFLRMDIKNVN YFE+M + +FP
Sbjct: 238 CRLVHADLSEYNTIIHDDKLFMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKMGISIFP 297

Query: 297 ERVIFQFVISETLDKFSGDYTSSVDLRDYVSKNLPVKSGPQDEAEDEVFRSLHLVRNLGG 356
           ERVIFQFVISE+L+KF  DY +  DL  Y++KNLP+KS  QDEAEDE+FRSLHLVR+LGG
Sbjct: 298 ERVIFQFVISESLEKFKDDYHNVTDLVGYIAKNLPIKSTEQDEAEDEIFRSLHLVRSLGG 357

Query: 357 LEERDFDRFTLGKFDLLKSLIAHDNERVASTFTASEQFEL 396
           LEERDFDR+T GKFDLLKSLIAHDNER    F ASEQFE 
Sbjct: 358 LEERDFDRYTDGKFDLLKSLIAHDNER---NFAASEQFEF 394

>KLLA0E21121g Chr5 (1886452..1888032) [1581 bp, 526 aa] {ON} similar
           to uniprot|Q12196 YOR119C Saccharomyces cerevisiae RIO1
           Essential protein that plays a role in cell cycle
           progression
          Length = 526

 Score =  600 bits (1547), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/425 (68%), Positives = 347/425 (81%), Gaps = 35/425 (8%)

Query: 1   MSLKDRMDNLRLRDNFEPQDDHINTQILDKHAHNIKADELSVSRGKTSKDKANRATVENV 60
           M++ D+++ L    N   +D+H+NTQIL+++A++IK DELS++RGKTSKDKANRATVENV
Sbjct: 2   MNIDDKLEKL----NLANRDEHVNTQILERYANSIKTDELSLTRGKTSKDKANRATVENV 57

Query: 61  LDPRTMRFLQALTSRGVISQFNGCVSTGKEANVYHAFA---------------EIGAKN- 104
           LDPRTMRFL+++ +RG++S FNGC+STGKEANVYHAFA                IGA   
Sbjct: 58  LDPRTMRFLKSMMNRGILSAFNGCLSTGKEANVYHAFAGNHEERHLLVEGHDDTIGAPQN 117

Query: 105 ------------TEEAGEVLPNLEE---RRELAIKIFKTSILVFKDRERYVDGEFRFRNS 149
                       +E+A       +E   ++E A+KI+KTSILVFKDRERYVDGEFRFRNS
Sbjct: 118 IESTKQKALTAESEDATSTSTATDEPKNKKEYAVKIYKTSILVFKDRERYVDGEFRFRNS 177

Query: 150 RSQHNPRKMIKIWAEKEFRNLKRIYQSGLVPAPEPVEVRSNVLVMEFLSRGNGFASPRLK 209
           RSQHNPRKMIKIWAEKEFRNLKRIYQSG++P P+P+EVRSNVLVMEFL+RG+GFASPRLK
Sbjct: 178 RSQHNPRKMIKIWAEKEFRNLKRIYQSGVIPCPKPIEVRSNVLVMEFLNRGDGFASPRLK 237

Query: 210 DYPYKDREETAHYYYTMVAYIRLLYQCCQLVHADLSEYNAIVHNKELYIIDVSQSVQPEH 269
           D+PYKDREE  HYY  M+AY+RLLYQ C+LVHADLSEYN+IVH  +LYIIDVSQSVQPEH
Sbjct: 238 DHPYKDREEIKHYYNLMIAYMRLLYQVCRLVHADLSEYNSIVHEDKLYIIDVSQSVQPEH 297

Query: 270 PMSLDFLRMDIKNVNNYFERMSVDVFPERVIFQFVISETLDKFSGDYTSSVDLRDYVSKN 329
           PMSLDFLRMDIKNVN+YF+++ +D+FPERVIFQF+ISE LDKF GDY SS DL  YV+ N
Sbjct: 298 PMSLDFLRMDIKNVNSYFQKLGIDIFPERVIFQFIISEVLDKFKGDYRSSDDLETYVADN 357

Query: 330 LPVKSGPQDEAEDEVFRSLHLVRNLGGLEERDFDRFTLGKFDLLKSLIAHDNERVASTFT 389
           LP+K   +DEAEDEVFRSLHL+RNLGGLEERDFDRFT GKFDLLKSLIA++N + +  FT
Sbjct: 358 LPLKLTDEDEAEDEVFRSLHLIRNLGGLEERDFDRFTDGKFDLLKSLIANENRKYSENFT 417

Query: 390 ASEQF 394
           ASEQ+
Sbjct: 418 ASEQY 422

>NCAS0F03360 Chr6 complement(679314..680843) [1530 bp, 509 aa] {ON}
           Anc_5.432 YOR119C
          Length = 509

 Score =  592 bits (1525), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/433 (66%), Positives = 347/433 (80%), Gaps = 42/433 (9%)

Query: 1   MSLKDRMDNLRLRDNFEPQDDHINTQILDKHAHNIKADELSVSRGKTSKDKANRATVENV 60
           MSL+D+ D L + +  EP+ +H N +ILDK+ H  K DE+S +R KT+KDKANRATVENV
Sbjct: 1   MSLEDKFDRLNISN--EPRTEHANNKILDKYEHKFKTDEMSFTRSKTNKDKANRATVENV 58

Query: 61  LDPRTMRFLQALTSRGVISQFNGCVSTGKEANVYHAFAE---------IGAK-------- 103
           LDPRTMRFL+ALTSRGVIS FNGC+STGKEANVYHAFA          + AK        
Sbjct: 59  LDPRTMRFLKALTSRGVISDFNGCLSTGKEANVYHAFAGDSKLHADVVLEAKEEEDEDED 118

Query: 104 -------------------NTEEAGEVLPNL-EERRELAIKIFKTSILVFKDRERYVDGE 143
                               TE   E+L  + ++++E A+KIFKTSILVFKDRERYVDGE
Sbjct: 119 ENEEDEDDLPIDHNLKEKLETELRPEMLTKVSQDKKEYAVKIFKTSILVFKDRERYVDGE 178

Query: 144 FRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGLVPAPEPVEVRSNVLVMEFLSRGNGF 203
           FRFRNSRSQHNPRKMIKIWAEKEFRNL+RIYQSG++P P+P+EV++NVLVMEFL RG+GF
Sbjct: 179 FRFRNSRSQHNPRKMIKIWAEKEFRNLRRIYQSGVIPVPKPIEVKNNVLVMEFLGRGDGF 238

Query: 204 ASPRLKDYPYKDREETAHYYYTMVAYIRLLYQCCQLVHADLSEYNAIVHNKELYIIDVSQ 263
           ASPRLKD+PYKDREE  HYY+T+VAY+RL+YQ C+LVHADLSEYN ++H  ++YIIDVSQ
Sbjct: 239 ASPRLKDHPYKDREEIFHYYHTIVAYMRLMYQICRLVHADLSEYNILIHKDKMYIIDVSQ 298

Query: 264 SVQPEHPMSLDFLRMDIKNVNNYFERMSVDVFPERVIFQFVISETLDKFSGDYTSSVDLR 323
           SV+PEHPMSLDFLRMDIKN+N YFE+M +D+FPERVIFQF+IS+TL+ F+GDY    DLR
Sbjct: 299 SVEPEHPMSLDFLRMDIKNINFYFEKMGIDIFPERVIFQFIISDTLENFNGDYRDYNDLR 358

Query: 324 DYVSKNLPVKSGPQDEAEDEVFRSLHLVRNLGGLEERDFDRFTLGKFDLLKSLIAHDNER 383
           DYV++NLP+K   QDEAEDE+FRSL+LVRNL GLEERDFDR+T GKFDLLKSLIAHDNE+
Sbjct: 359 DYVAQNLPIKKSEQDEAEDEIFRSLYLVRNLEGLEERDFDRYTDGKFDLLKSLIAHDNEK 418

Query: 384 VASTFTASEQFEL 396
               F+A+EQF+L
Sbjct: 419 ---NFSAAEQFDL 428

>TBLA0A03760 Chr1 complement(938917..940431) [1515 bp, 504 aa] {ON}
           Anc_5.432 YOR119C
          Length = 504

 Score =  588 bits (1517), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/406 (70%), Positives = 332/406 (81%), Gaps = 24/406 (5%)

Query: 12  LRDNFEPQD---DHINTQILDKHAHNIKADELSVSRGKTSKDKANRATVENVLDPRTMRF 68
           L D+F+  D   +H N +ILDKH H IK DE S+SRGKT+KDKANRATVENVLDPRTMRF
Sbjct: 3   LDDDFQKLDLSNNHDNNRILDKHGHKIKTDEFSISRGKTNKDKANRATVENVLDPRTMRF 62

Query: 69  LQALTSRGVISQFNGCVSTGKEANVYHAFAEIGAK----NTEEAGEVLPN---------- 114
           L+ALTSRG+IS FNGC+STGKEANVYHAFA          T ++ E L N          
Sbjct: 63  LKALTSRGIISDFNGCISTGKEANVYHAFAGDTISPFEPKTHDSFENLVNTYDPYSNPNN 122

Query: 115 ----LEERRELAIKIFKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNL 170
               LE R+E AIKI+KTSILVFKDRERYVDGE+RFRNSRSQHNPRKMIKIWAEKEFRNL
Sbjct: 123 NDTILEPRKEYAIKIYKTSILVFKDRERYVDGEYRFRNSRSQHNPRKMIKIWAEKEFRNL 182

Query: 171 KRIYQSGLVPAPEPVEVRSNVLVMEFLSRGNGFASPRLKDYPYKDREETAHYYYTMVAYI 230
           KRIYQS ++P P+P+EV++NVLVMEFL+RG+GFASPRLKDYPYKD  +  HYY+TM+ YI
Sbjct: 183 KRIYQSKVIPVPKPIEVKNNVLVMEFLNRGDGFASPRLKDYPYKDHNDIVHYYHTMIVYI 242

Query: 231 RLLYQCCQLVHADLSEYNAIVHNKELYIIDVSQSVQPEHPMSLDFLRMDIKNVNNYFERM 290
           RLLYQ C+LVHADLSEYN +VH  +LY+IDVSQSV+PEHPMSLDFLRMDIKN+NNYFERM
Sbjct: 243 RLLYQVCRLVHADLSEYNTLVHKNKLYVIDVSQSVEPEHPMSLDFLRMDIKNINNYFERM 302

Query: 291 SVDVFPERVIFQFVISETLDKFSGDYTSSVDLRDYVSKNLPVKSGPQDEAEDEVFRSLHL 350
            V +F ER+IFQF ISETLD F+G+Y++  DLR YV  NLP+K   +D+AEDE+FRSLHL
Sbjct: 303 GVAIFAERIIFQFTISETLDNFNGNYSNEDDLRMYVKNNLPLKVPGKDDAEDEIFRSLHL 362

Query: 351 VRNLGGLEERDFDRFTLGKFDLLKSLIAHDNERVASTFTASEQFEL 396
           VRNLGGLEERDFDR+T GKFDLLKSLIAHDNE+    F+ASEQ+  
Sbjct: 363 VRNLGGLEERDFDRYTDGKFDLLKSLIAHDNEK---NFSASEQYNF 405

>TDEL0E01930 Chr5 (363913..365421) [1509 bp, 502 aa] {ON} Anc_5.432
           YOR119C
          Length = 502

 Score =  587 bits (1514), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/383 (74%), Positives = 333/383 (86%), Gaps = 8/383 (2%)

Query: 1   MSLKDRMDNLRLRDNFEPQDDHINTQILDKHAHNIKADELSVSRGKTSKDKANRATVENV 60
           MSL+D+ D L +    E    H N QILDKH++NIK DELS +R K+SKDKANRATVENV
Sbjct: 1   MSLEDQFDRLDISHGRE----HANIQILDKHSNNIKTDELSFTRSKSSKDKANRATVENV 56

Query: 61  LDPRTMRFLQALTSRGVISQFNGCVSTGKEANVYHAFAEIGAKNTEEAGEVLPNLEERRE 120
           LDPRTMRFL+++ +RGVIS+FNGC+STGKEANVYHAFA    +++++ G V     E++E
Sbjct: 57  LDPRTMRFLKSMMNRGVISEFNGCLSTGKEANVYHAFAGESIEDSKD-GHVQG---EKKE 112

Query: 121 LAIKIFKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGLVP 180
           LAIKI+KTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNL+RI QSG++P
Sbjct: 113 LAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRINQSGVIP 172

Query: 181 APEPVEVRSNVLVMEFLSRGNGFASPRLKDYPYKDREETAHYYYTMVAYIRLLYQCCQLV 240
           AP+PVEV++NVLVMEFLSRG+GFASPRLKD+ + DR E  HYY+TM+AYIRLLYQ C+LV
Sbjct: 173 APKPVEVKNNVLVMEFLSRGDGFASPRLKDHLFADRAEIYHYYHTMLAYIRLLYQVCRLV 232

Query: 241 HADLSEYNAIVHNKELYIIDVSQSVQPEHPMSLDFLRMDIKNVNNYFERMSVDVFPERVI 300
           HADLSEYNAIVH+++LYIIDVSQSV+PEHPMSLDFLRMDIKN+N YFE+M +D+FPER+I
Sbjct: 233 HADLSEYNAIVHDQKLYIIDVSQSVEPEHPMSLDFLRMDIKNINAYFEKMGIDIFPERLI 292

Query: 301 FQFVISETLDKFSGDYTSSVDLRDYVSKNLPVKSGPQDEAEDEVFRSLHLVRNLGGLEER 360
           FQFVISETL+KF G+  SS DL +YVSK LPVKS   D  EDE+FRSLHLVRNL GLEER
Sbjct: 293 FQFVISETLEKFDGNPKSSADLSNYVSKALPVKSTTGDVEEDEIFRSLHLVRNLEGLEER 352

Query: 361 DFDRFTLGKFDLLKSLIAHDNER 383
           DFDRFT GKFDLLKSLIAHDNER
Sbjct: 353 DFDRFTDGKFDLLKSLIAHDNER 375

>Kpol_1062.31 s1062 (67759..69300) [1542 bp, 513 aa] {ON}
           (67759..69300) [1542 nt, 514 aa]
          Length = 513

 Score =  587 bits (1514), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/428 (67%), Positives = 341/428 (79%), Gaps = 41/428 (9%)

Query: 1   MSLKDRMDNLRLRDNFEPQDDHINTQILDKHAHNIKADELSVSRGKTSKDKANRATVENV 60
           MS  ++ D L++  N       +NT+IL+K+ H IK DELS ++GKT+KDKANRATVENV
Sbjct: 1   MSFDEKFDRLKISGN------DVNTRILEKYGHKIKTDELSFTKGKTNKDKANRATVENV 54

Query: 61  LDPRTMRFLQALTSRGVISQFNGCVSTGKEANVYHAFAEIG--AKNTEEAGEVLPNL--- 115
           LDPRTMRFL+ALT+RGVIS FNGC+STGKEANVYHAFA  G  ++NT+   E L  L   
Sbjct: 55  LDPRTMRFLKALTNRGVISAFNGCLSTGKEANVYHAFAGDGTSSRNTDVKVEDLVKLTSV 114

Query: 116 ---------------------------EERRELAIKIFKTSILVFKDRERYVDGEFRFRN 148
                                      E R+E AIKI+KTSILVFKDRERYVDGE+RFRN
Sbjct: 115 EVNQDSEEDNGDNNNVADIDGSKPEGVELRKEYAIKIYKTSILVFKDRERYVDGEYRFRN 174

Query: 149 SRSQHNPRKMIKIWAEKEFRNLKRIYQSGLVPAPEPVEVRSNVLVMEFLSRGNGFASPRL 208
           SRSQHNPRKMIKIWAEKEFRNL+RI+QSG++PAP+PVEV+SNVLVMEFL+RGNGFASPRL
Sbjct: 175 SRSQHNPRKMIKIWAEKEFRNLRRIHQSGVIPAPKPVEVKSNVLVMEFLNRGNGFASPRL 234

Query: 209 KDYPYKDREETAHYYYTMVAYIRLLYQCCQLVHADLSEYNAIVHNKELYIIDVSQSVQPE 268
           KDYPYKDR+E   YY+ +VAY+RLLYQ C+LVHADLSEYN IVH  +LY+IDVSQSV+PE
Sbjct: 235 KDYPYKDRDEIFWYYHILVAYMRLLYQVCRLVHADLSEYNTIVHQGKLYMIDVSQSVEPE 294

Query: 269 HPMSLDFLRMDIKNVNNYFERMSVDVFPERVIFQFVISETLDKFSGDYTSSVDLRDYVSK 328
           HPMSLDFLRMDIKNVN YFE+M +D+FPER+IFQFVISE L+ F GD  S+ DLR++V  
Sbjct: 295 HPMSLDFLRMDIKNVNGYFEKMGIDIFPERIIFQFVISEKLETFKGDLNSADDLREFVKN 354

Query: 329 NLPVKSGPQDEAEDEVFRSLHLVRNLGGLEERDFDRFTLGKFDLLKSLIAHDNERVASTF 388
           NLP+KS  +DEAEDEVFRSLHLVRNLGGLEERDFDRFT GKFDLLK+LIA DN++    F
Sbjct: 355 NLPIKSTDEDEAEDEVFRSLHLVRNLGGLEERDFDRFTDGKFDLLKTLIASDNQK---NF 411

Query: 389 TASEQFEL 396
           TASEQ+ +
Sbjct: 412 TASEQYGM 419

>KNAG0C04930 Chr3 (951832..953322) [1491 bp, 496 aa] {ON} Anc_5.432
           YOR119C
          Length = 496

 Score =  580 bits (1494), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/409 (70%), Positives = 331/409 (80%), Gaps = 21/409 (5%)

Query: 1   MSLKDRMDNLRLRDNFEPQDDHINTQILDKHAHNIKADELSVSR-GKTSKDKANRATVEN 59
           MS++++ + L +  +   +DD  N ++LDK+AH IK D+ S S+  KT+KDKANRATVEN
Sbjct: 1   MSVEEKFEKLSI--DHHVKDDTANNKLLDKYAHKIKNDQFSFSKVKKTTKDKANRATVEN 58

Query: 60  VLDPRTMRFLQALTSRGVISQFNGCVSTGKEANVYHAFAEIG---------------AKN 104
           VLDPRTMRFLQAL +RG+IS FNGC+STGKEANVYHAFA  G               A+ 
Sbjct: 59  VLDPRTMRFLQALMNRGIISDFNGCLSTGKEANVYHAFAGDGVSRASGTLPDEESLLARL 118

Query: 105 TEEAGEVLPNLEERRELAIKIFKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAE 164
           T+E   V  ++  ++E AIKIFKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAE
Sbjct: 119 TQEERAVQASVGGKKEYAIKIFKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAE 178

Query: 165 KEFRNLKRIYQSGLVPAPEPVEVRSNVLVMEFLSRGNGFASPRLKDYPYKDREETAHYYY 224
           KEFRNLKRIYQSG VP P+PVEV++NVLVMEFL+RG+GFASPRL+DYPYKD +    YY 
Sbjct: 179 KEFRNLKRIYQSGAVPVPKPVEVKNNVLVMEFLNRGDGFASPRLRDYPYKDTDSIRQYYC 238

Query: 225 TMVAYIRLLYQCCQLVHADLSEYNAIVHNKELYIIDVSQSVQPEHPMSLDFLRMDIKNVN 284
           T+VAY+RL+YQ C LVHADLSEYN +VHN  LYIIDVSQSVQPEHPMSLDFLRMDIKNVN
Sbjct: 239 TLVAYMRLMYQVCGLVHADLSEYNVLVHNDRLYIIDVSQSVQPEHPMSLDFLRMDIKNVN 298

Query: 285 NYFERMSVDVFPERVIFQFVISETLDKFSGDYTSSVDLRDYVSKNLPVKSGPQDEAEDEV 344
            YF +M +D+FPER+IFQFVISE+LDKF GDY SS DL +YV  NLPVK   QDE EDEV
Sbjct: 299 LYFGKMGIDIFPERIIFQFVISESLDKFEGDYKSSKDLTEYVESNLPVKKTEQDEMEDEV 358

Query: 345 FRSLHLVRNLGGLEERDFDRFTLGKFDLLKSLIAHDNERVASTFTASEQ 393
           FRSL+LVRNL GLEERDFDRFT GKFDLLKSL+AHD E+    FTA+EQ
Sbjct: 359 FRSLYLVRNLEGLEERDFDRFTEGKFDLLKSLLAHDMEK---NFTAAEQ 404

>Ecym_4763 Chr4 (1483168..1484784) [1617 bp, 538 aa] {ON} similar to
           Ashbya gossypii AER257W
          Length = 538

 Score =  576 bits (1484), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/404 (69%), Positives = 335/404 (82%), Gaps = 12/404 (2%)

Query: 1   MSLKDRMDNLRLRDNFEPQDDHINTQILDKHAHNIKADELSVSRGKTSKDKANRATVENV 60
           M L++++  L+L D+ E    H N++ILDK A+ IK DELSV+RGKTSKDKANRATVENV
Sbjct: 33  MDLENKLGRLKLLDHSE----HENSRILDKFANQIKTDELSVTRGKTSKDKANRATVENV 88

Query: 61  LDPRTMRFLQALTSRGVISQFNGCVSTGKEANVYHAFA---EIGAKNTE--EAGEVLPNL 115
           LDPRTMRFL++L  RG+I++FNGC+STGKEANVYHAF    +I  K  +      +  + 
Sbjct: 89  LDPRTMRFLRSLIHRGIITEFNGCLSTGKEANVYHAFGNAVDIVEKQHKVIRQSSICSDS 148

Query: 116 E---ERRELAIKIFKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKR 172
           E   ++ E AIKI+KTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKR
Sbjct: 149 EGDTKKVEYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKR 208

Query: 173 IYQSGLVPAPEPVEVRSNVLVMEFLSRGNGFASPRLKDYPYKDREETAHYYYTMVAYIRL 232
           IY +G++  P+P+E++SNVLVMEFL+RG+GFASP+LKDYPY DR+E  ++Y+ MVAYIRL
Sbjct: 209 IYHTGVISCPKPIEIKSNVLVMEFLNRGDGFASPKLKDYPYSDRQEIYYFYHVMVAYIRL 268

Query: 233 LYQCCQLVHADLSEYNAIVHNKELYIIDVSQSVQPEHPMSLDFLRMDIKNVNNYFERMSV 292
           LYQ CQLVHADLSEYN+IVH  +LYIIDVSQSVQPEHPMSLDFLRMDIKN+N YF ++ +
Sbjct: 269 LYQVCQLVHADLSEYNSIVHESKLYIIDVSQSVQPEHPMSLDFLRMDIKNINAYFVKIGI 328

Query: 293 DVFPERVIFQFVISETLDKFSGDYTSSVDLRDYVSKNLPVKSGPQDEAEDEVFRSLHLVR 352
           +VF ER IFQFVISE L+KF GDY S   L+ Y S+ LP+K   +DE EDE+FRSLHLVR
Sbjct: 329 NVFSERAIFQFVISEKLEKFKGDYRSYDHLQKYASEYLPLKLTEEDEVEDEIFRSLHLVR 388

Query: 353 NLGGLEERDFDRFTLGKFDLLKSLIAHDNERVASTFTASEQFEL 396
           NLGGLEE DFDRFT GKFDLLKSL++ DN++VA TFTASEQFEL
Sbjct: 389 NLGGLEEGDFDRFTNGKFDLLKSLVSQDNQKVAKTFTASEQFEL 432

>TPHA0E01780 Chr5 (357819..359345) [1527 bp, 508 aa] {ON} Anc_5.432
           YOR119C
          Length = 508

 Score =  574 bits (1479), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/426 (65%), Positives = 338/426 (79%), Gaps = 40/426 (9%)

Query: 1   MSLKDRMDNLRLRDNFEPQDDHINTQILDKHAHNIKADELSVSRGKTSKDKANRATVENV 60
           MSL+ + D L++ ++     +HIN++IL+K+ H IK DELS ++GKT+KDKANRATVENV
Sbjct: 1   MSLEGKFDKLKVHES-----EHINSKILEKYGHKIKTDELSDTKGKTNKDKANRATVENV 55

Query: 61  LDPRTMRFLQALTSRGVISQFNGCVSTGKEANVYHAFAEIGAKNTEEAGEVLPN------ 114
           LDPRTM+ L+ L +RGVI +FNGC+STGKEANVYHAFA  G    +   EVLP       
Sbjct: 56  LDPRTMKSLKTLINRGVIFEFNGCLSTGKEANVYHAFA--GDGKVKGNAEVLPQISELED 113

Query: 115 ------------------------LEERRELAIKIFKTSILVFKDRERYVDGEFRFRNSR 150
                                   L++R+E AIKI+KTSILVFKDRERYVDGEFRFRN+R
Sbjct: 114 VLNKELIPGQIEVPTIKSEEEQTQLKQRKEYAIKIYKTSILVFKDRERYVDGEFRFRNAR 173

Query: 151 SQHNPRKMIKIWAEKEFRNLKRIYQSGLVPAPEPVEVRSNVLVMEFLSRGNGFASPRLKD 210
           SQHNPRKMIKIWAEKEFRNL+RI+QSG++PAPEPVEV+ N+LVMEFL RG+GFASPRL+D
Sbjct: 174 SQHNPRKMIKIWAEKEFRNLRRIFQSGIIPAPEPVEVKYNILVMEFLGRGDGFASPRLRD 233

Query: 211 YPYKDREETAHYYYTMVAYIRLLYQCCQLVHADLSEYNAIVHNKELYIIDVSQSVQPEHP 270
           + YK REE  +YY+T+VAYIRLLYQ C+LVHADLSEYN IVH+ +LY+IDVSQSV+PEHP
Sbjct: 234 HQYKTREEIIYYYHTLVAYIRLLYQVCRLVHADLSEYNTIVHDDKLYVIDVSQSVEPEHP 293

Query: 271 MSLDFLRMDIKNVNNYFERMSVDVFPERVIFQFVISETLDKFSGDYTSSVDLRDYVSKNL 330
           MSLDFLRMDIKNVN YFE+M +D+FPER+IFQFVIS  LDKF+GD  SSVDLR+Y++  L
Sbjct: 294 MSLDFLRMDIKNVNGYFEKMGIDIFPERIIFQFVISSELDKFTGDPRSSVDLRNYIAHYL 353

Query: 331 PVKSGPQDEAEDEVFRSLHLVRNLGGLEERDFDRFTLGKFDLLKSLIAHDNERVASTFTA 390
           PVK   +DE +DE+FRSLHLVRNL GLEERDFDRFT GKFDLLK+LIA DN++    FTA
Sbjct: 354 PVKCTDEDELKDEIFRSLHLVRNLDGLEERDFDRFTDGKFDLLKTLIASDNQK---NFTA 410

Query: 391 SEQFEL 396
           S QF+ 
Sbjct: 411 STQFDF 416

>NDAI0B05650 Chr2 complement(1380239..1381627) [1389 bp, 462 aa]
           {ON} Anc_5.432 YOR119C
          Length = 462

 Score =  564 bits (1454), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/380 (71%), Positives = 316/380 (83%), Gaps = 26/380 (6%)

Query: 40  LSVSRGKTSKDKANRATVENVLDPRTMRFLQALTSRGVISQFNGCVSTGKEANVYHAFA- 98
           +S ++GKT+KDKANRATVENVLDPRTM+FL+ALTSRGVIS FNGC+STGKEANVYHAFA 
Sbjct: 1   MSFTKGKTNKDKANRATVENVLDPRTMKFLKALTSRGVISDFNGCLSTGKEANVYHAFAG 60

Query: 99  ----------------EIGAKNTEEAGEVLPNLEERR------ELAIKIFKTSILVFKDR 136
                            I  +  +E  E   N EE R      E A+KIFKTSILVFKDR
Sbjct: 61  DSKLHSDDTDEPHDDNNIDEEALKEKLETQINPEETRLQKDKKEYAVKIFKTSILVFKDR 120

Query: 137 ERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGLVPAPEPVEVRSNVLVMEF 196
           ERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNL+RIYQS ++P P+P+EV++NVL+MEF
Sbjct: 121 ERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRIYQSNVIPVPKPIEVKNNVLIMEF 180

Query: 197 LSRGNGFASPRLKDYPYKDREETAHYYYTMVAYIRLLYQCCQLVHADLSEYNAIVHNKEL 256
           L+RG+GFASPRL+DYPYKDREE  HYY+  +AY+RL+YQ C+LVHADLSEYN ++HN  +
Sbjct: 181 LNRGDGFASPRLRDYPYKDREEVIHYYHIAIAYMRLMYQVCRLVHADLSEYNILIHNNLM 240

Query: 257 YIIDVSQSVQPEHPMSLDFLRMDIKNVNNYFERMSVDVFPERVIFQFVISETLDKFSGDY 316
           YIIDVSQSV+PEHPMSLDFLRMDIKN+N YF+RM +D+FPERVIFQF+ISETLDKF+G+Y
Sbjct: 241 YIIDVSQSVEPEHPMSLDFLRMDIKNINMYFDRMGIDIFPERVIFQFIISETLDKFTGNY 300

Query: 317 TSSVDLRDYVSKNLPVKSGPQDEAEDEVFRSLHLVRNLGGLEERDFDRFTLGKFDLLKSL 376
               DLRDYV+K LP+K   QDEAEDE+FRSL+LVRNL GLEERDFDR+T GKFDLLKSL
Sbjct: 301 NDYNDLRDYVAKTLPIKKTAQDEAEDEIFRSLYLVRNLEGLEERDFDRYTDGKFDLLKSL 360

Query: 377 IAHDNERVASTFTASEQFEL 396
           IAHDNE+    F+A+EQFE+
Sbjct: 361 IAHDNEK---NFSAAEQFEI 377

>CAGL0L11594g Chr12 (1239169..1240692) [1524 bp, 507 aa] {ON} highly
           similar to uniprot|Q12196 Saccharomyces cerevisiae
           YOR119c
          Length = 507

 Score =  565 bits (1457), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/395 (67%), Positives = 320/395 (81%), Gaps = 26/395 (6%)

Query: 15  NFEPQDDHINTQILDKHAHNIKADELSVSRGKTSKDKANRATVENVLDPRTMRFLQALTS 74
           N +   DHIN QI+DK+ H IK DELS+++ KT+KDKANRATVENVLDPRTMRFL AL +
Sbjct: 10  NVKVSTDHINNQIMDKYGHKIKTDELSINKAKTNKDKANRATVENVLDPRTMRFLNALVN 69

Query: 75  RGVISQFNGCVSTGKEANVYHAFAEIGAKNTEEAGE--------VLPN------------ 114
           RGVI+  NGC+STGKEANVYHAFA       +++ E         +P+            
Sbjct: 70  RGVIAGLNGCLSTGKEANVYHAFAGSKMATEQQSDEPKEDIDANAIPSKGNIDISENRAK 129

Query: 115 ------LEERRELAIKIFKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFR 168
                  E R+E AIKI+KTSIL+FKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFR
Sbjct: 130 TAEDLIREGRKEYAIKIYKTSILIFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFR 189

Query: 169 NLKRIYQSGLVPAPEPVEVRSNVLVMEFLSRGNGFASPRLKDYPYKDREETAHYYYTMVA 228
           NLKRIYQ G++P+PEP+EV++NVLVMEFL+RG+GFASP+L+DYPYKDREE  +YY+ +V+
Sbjct: 190 NLKRIYQMGVIPSPEPIEVKNNVLVMEFLNRGDGFASPKLRDYPYKDREEIYYYYHILVS 249

Query: 229 YIRLLYQCCQLVHADLSEYNAIVHNKELYIIDVSQSVQPEHPMSLDFLRMDIKNVNNYFE 288
           Y+RLLYQ C+LVHADLSEYN IVH ++LY+IDVSQSV+PEHPMSLDFLRMDIKNVN YFE
Sbjct: 250 YMRLLYQVCRLVHADLSEYNTIVHKEKLYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFE 309

Query: 289 RMSVDVFPERVIFQFVISETLDKFSGDYTSSVDLRDYVSKNLPVKSGPQDEAEDEVFRSL 348
           +M +++F E+ IFQFVI++TLDKF GD  S  DLR YV+ N+P+K   +DEAEDEVFRSL
Sbjct: 310 KMGIEIFQEKAIFQFVITDTLDKFDGDMNSYEDLRKYVATNIPIKRTQEDEAEDEVFRSL 369

Query: 349 HLVRNLGGLEERDFDRFTLGKFDLLKSLIAHDNER 383
           HLVRNL GLEERDFDRFT GKFDLLKSL+A DN++
Sbjct: 370 HLVRNLEGLEERDFDRFTDGKFDLLKSLLAQDNKK 404

>ZYRO0F09988g Chr6 complement(811306..812688) [1383 bp, 460 aa] {ON}
           similar to uniprot|Q12196 YOR119C Saccharomyces
           cerevisiae RIO1 Essential protein that plays a role in
           cell cycle progression
          Length = 460

 Score =  510 bits (1313), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 254/384 (66%), Positives = 305/384 (79%), Gaps = 24/384 (6%)

Query: 1   MSLKDRMDNLRLRDNFEPQDDHINTQILDKHAHNIKADELSVSRG-KTSKDKANRATVEN 59
           MSL+   D L +  +   QD   NT+IL+K+ + I+    +  +G KT KDK++RATVEN
Sbjct: 1   MSLETEFDRLHVSKH---QD---NTRILEKYENRIENGGFTSGKGNKTYKDKSDRATVEN 54

Query: 60  VLDPRTMRFLQALTSRGVISQFNGCVSTGKEANVYHAFAEIGAKNTEEAGEVLPNLEERR 119
           VLDPRTM+FL ALT+RGVIS+FNGC+S+GKEANVYHAF   G                 +
Sbjct: 55  VLDPRTMKFLSALTNRGVISEFNGCISSGKEANVYHAFGPEG-----------------Q 97

Query: 120 ELAIKIFKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGLV 179
           ELAIKI+KTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNL+RI+ SG+V
Sbjct: 98  ELAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRIHSSGVV 157

Query: 180 PAPEPVEVRSNVLVMEFLSRGNGFASPRLKDYPYKDREETAHYYYTMVAYIRLLYQCCQL 239
           P   PVEV+SNVLVM+FL+RG+G  SPRLKDY YKD  E AHYYY  +AY+RLLYQ C+L
Sbjct: 158 PTACPVEVKSNVLVMQFLNRGDGAPSPRLKDYQYKDELEVAHYYYKAIAYMRLLYQVCRL 217

Query: 240 VHADLSEYNAIVHNKELYIIDVSQSVQPEHPMSLDFLRMDIKNVNNYFERMSVDVFPERV 299
           VHADLSEYN +VH   L+IIDVSQSV+P HPMSLDFLRMDIKN+N YF +M V +F ER+
Sbjct: 218 VHADLSEYNIVVHQNALHIIDVSQSVEPYHPMSLDFLRMDIKNINAYFGKMGVSLFQERM 277

Query: 300 IFQFVISETLDKFSGDYTSSVDLRDYVSKNLPVKSGPQDEAEDEVFRSLHLVRNLGGLEE 359
           IFQF+I+ETL+ F GDY ++ DL +Y+ ++LP+K+  +   EDE+FRSLHLVR+LGGLEE
Sbjct: 278 IFQFIIAETLEGFQGDYKTADDLVEYLVEHLPLKTPTEGADEDEIFRSLHLVRSLGGLEE 337

Query: 360 RDFDRFTLGKFDLLKSLIAHDNER 383
           RDFDRFT GKFDLLKSLIA+DNER
Sbjct: 338 RDFDRFTDGKFDLLKSLIANDNER 361

>TPHA0H00920 Chr8 complement(188834..190123) [1290 bp, 429 aa] {ON}
           Anc_2.44 YNL207W
          Length = 429

 Score = 56.6 bits (135), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 49/229 (21%), Positives = 100/229 (43%), Gaps = 39/229 (17%)

Query: 69  LQALTSRGVISQFNGCVSTGKEANVYHAFAEIGAKNTEEAGEVLPNLEERRELAI-KIFK 127
           L++L ++  +    G +  GKE+++Y    + G K               R L I ++ +
Sbjct: 85  LKSLLNKDTVYSIGGTIGVGKESDIYEGSDKNGNK---------------RVLKIHRLGR 129

Query: 128 TSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGLVPAPEPVEV 187
           TS    K+   Y+      R S    N   + K+ A KE++ +  +Y  G    PEP + 
Sbjct: 130 TSFHTVKNNRDYL------RRSNQGTNWMNLSKLAANKEYQFMSLLYTKGF-KVPEPFDN 182

Query: 188 RSNVLVMEFLSRGNGFASPRLKDYPYKDREETAHYYYTMVAYIRLLYQCCQLVHADLSEY 247
             +V+VME +    G+   RL+ +     ++    Y  ++ +I L      L+H D +E+
Sbjct: 183 SRHVIVMELI---RGYPMRRLRKH-----KDIPKLYSDLMKFI-LQLANSGLIHCDFNEF 233

Query: 248 NAIVHNK-------ELYIIDVSQSVQPEHPMSLDFLRMDIKNVNNYFER 289
           N ++ ++          +ID  Q +  +H  +  + + D+  +  +F++
Sbjct: 234 NIMIKDEVEDENDCGFVVIDFPQCISIQHKDADFYFKRDVDGIRRFFKK 282

>NCAS0G01580 Chr7 (281438..282712) [1275 bp, 424 aa] {ON} Anc_2.44
          Length = 424

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 47/228 (20%), Positives = 98/228 (42%), Gaps = 37/228 (16%)

Query: 69  LQALTSRGVISQFNGCVSTGKEANVYHAFAEIGAKNTEEAGEVLPNLEERRELAIKIFKT 128
           L+ + +R  I    G +  GKE+++Y   A  G           P + +   L     +T
Sbjct: 85  LKTMLNRNTIYSIGGSIGVGKESDIYQVSAVDGN----------PRVMKIHRLG----RT 130

Query: 129 SILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGLVPAPEPVEVR 188
           S    ++   Y+      RN++   N   + ++ A KE++ +  +Y  G    PEP +  
Sbjct: 131 SFHTVRNNRDYL------RNTKQGVNWMYLSRLAANKEYQFMSMLYTKGF-EVPEPFDNS 183

Query: 189 SNVLVMEFLSRGNGFASPRLKDYPYKDREETAHYYYTMVAYIRLLYQCCQLVHADLSEYN 248
            +++VME +    G+   RL+ +     +     Y  ++ +I  L     L+H D +E+N
Sbjct: 184 RHIIVMELIK---GYPMRRLRKH-----KNIPKLYSDLMNFIVKLGN-SGLIHCDFNEFN 234

Query: 249 AIVHNKE-------LYIIDVSQSVQPEHPMSLDFLRMDIKNVNNYFER 289
            ++ +K          +ID  Q +  +H  +  + + D+  +  +F++
Sbjct: 235 IMIKDKPEDENDCGFVVIDFPQCISIQHQDAAYYFQRDVDCIRRFFKK 282

>CAGL0H08019g Chr8 (781773..783050) [1278 bp, 425 aa] {ON} highly
           similar to uniprot|P40160 Saccharomyces cerevisiae
           YNL207w
          Length = 425

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 50/239 (20%), Positives = 100/239 (41%), Gaps = 40/239 (16%)

Query: 69  LQALTSRGVISQFNGCVSTGKEANVYHAFAEIGAKNTEEAGEVLPNLEERRELAIKIFKT 128
           L+ L ++ V+      +  GKE+++Y      G     +                ++ +T
Sbjct: 85  LRTLLNQEVVYSVGNTIGVGKESDIYQVSDRNGTAKVMKIH--------------RLGRT 130

Query: 129 SILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGLVPAPEPVEVR 188
           S    K+   Y+      RNSR   N   + K+ A KEF  +  +Y  G +  P+     
Sbjct: 131 SFHTVKNNRDYL------RNSRQGTNWMHLSKLAASKEFEFMSMLYAKGFI-VPQAYGCS 183

Query: 189 SNVLVMEFLSRGNGFASPRLKDYPYKDREETAHYYYTMVAYIRLLYQCCQLVHADLSEYN 248
            +V+VM+ +   +G+   RL+++     +     Y  ++ +I  L     L+H D +E+N
Sbjct: 184 RHVVVMDLI---DGYPMRRLREH-----KNIPKLYSDLMTFIVKLAN-SGLIHCDFNEFN 234

Query: 249 AIVHNKE---------LYIIDVSQSVQPEHPMSLDFLRMDIKNVNNYF-ERMSVDVFPE 297
            ++ N E           +ID  Q +  +H  +  + + D+  +  +F +++  D  PE
Sbjct: 235 IMIKNDEAVTDEKDCGFVVIDFPQCISIQHKDAEFYFKRDVDCIRRFFKKKLKYDPQPE 293

>Kwal_23.4563 s23 (768125..769402) [1278 bp, 425 aa] {ON} YNL207W
           (RIO2) -  [contig 4] FULL
          Length = 425

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 47/230 (20%), Positives = 101/230 (43%), Gaps = 42/230 (18%)

Query: 69  LQALTSRGVISQFNGCVSTGKEANVYHAFAEIGAKNTEEAGEVLPNLEERRELAI-KIFK 127
           L+A+ +R  +      +  GKE++VY   A+ G                 R L I ++ +
Sbjct: 85  LKAMLNRDTVYSIGNVIGVGKESDVYRVSAKDGTP---------------RVLKIHRLGR 129

Query: 128 TSILVFKDRERYVDGEFRFRNSRSQHNPRKMI-KIWAEKEFRNLKRIYQSGLVPAPEPVE 186
           TS    K+   Y+         R+Q      + ++ A KE++ +  +Y  G V  PEP +
Sbjct: 130 TSFTTVKNNRDYL--------KRNQSGSWMFLSRLAANKEYQFMSLLYSKGFV-VPEPFD 180

Query: 187 VRSNVLVMEFLSRGNGFASPRLKDYPYKDREETAHYYYTMVAYIRLLYQCCQLVHADLSE 246
              ++++M+ +   +G+   R++ +     +     Y  ++++I  L     L+H D +E
Sbjct: 181 NSRHMILMQLI---DGYPMRRMRSH-----KNLPKLYSDLMSFIVKLAN-HGLIHCDFNE 231

Query: 247 YNAIVHNK-------ELYIIDVSQSVQPEHPMSLDFLRMDIKNVNNYFER 289
           +N ++ NK          +ID  Q +  +H  + ++ + D+  +  +F +
Sbjct: 232 FNIMIKNKVTDADDCGFIVIDFPQCISIQHQDAEEYFKRDVDCIRRFFAK 281

>KAFR0A07760 Chr1 complement(1560351..1561628) [1278 bp, 425 aa]
           {ON} Anc_2.44 YNL207W
          Length = 425

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 45/228 (19%), Positives = 101/228 (44%), Gaps = 36/228 (15%)

Query: 69  LQALTSRGVISQFNGCVSTGKEANVYHAFAEIGAKNTEEAGEVLPNLEERRELAIKIFKT 128
           L+ + +R  +    G +  GKE+++Y      G   TE+  ++            ++ +T
Sbjct: 85  LKTMLNRETVYSVGGTIGVGKESDIYRVSDRNG---TEKVMKIH-----------RLGRT 130

Query: 129 SILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGLVPAPEPVEVR 188
           S    K++  Y+      +N+++  N   + KI A KE++ +  ++  G    PE  +  
Sbjct: 131 SFHTVKNKRDYIK-----KNAKNGVNWMYLSKIAAGKEYQFMTLLFAKGF-DVPEAFDCS 184

Query: 189 SNVLVMEFLSRGNGFASPRLKDYPYKDREETAHYYYTMVAYIRLLYQCCQLVHADLSEYN 248
            + +VME +    G+   RL+ +     +     Y  ++++I  L     L+H D +E+N
Sbjct: 185 RHCIVMELIK---GYPMRRLRKH-----KNIPKLYSDLMSFIVKLGN-SGLIHCDFNEFN 235

Query: 249 AIVHNK-------ELYIIDVSQSVQPEHPMSLDFLRMDIKNVNNYFER 289
            ++ +K          +ID  Q +  +H  +  + + D+  +  +F++
Sbjct: 236 IMIKDKVEDENDPGFVVIDFPQCISIQHNDAEFYFKRDVDCIRRFFKK 283

>Suva_14.136 Chr14 (250349..251629) [1281 bp, 426 aa] {ON} YNL207W
           (REAL)
          Length = 426

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 47/228 (20%), Positives = 99/228 (43%), Gaps = 37/228 (16%)

Query: 69  LQALTSRGVISQFNGCVSTGKEANVYHAFAEIGAKNTEEAGEVLPNLEERRELAIKIFKT 128
           L+ + +R  +      +  GKE+++Y        K +++ G   P + +   L     +T
Sbjct: 85  LKTMLNRDTVYSVGNTIGVGKESDIY--------KVSDKDGN--PRVIKIHRLG----RT 130

Query: 129 SILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGLVPAPEPVEVR 188
           S    ++   Y+      R S    N   + ++ A KE++ +  +Y  G    PEP +  
Sbjct: 131 SFHTVRNNRDYL------RKSSQGANWMHLSRLAANKEYQFMSMLYSKGF-KVPEPFDNS 183

Query: 189 SNVLVMEFLSRGNGFASPRLKDYPYKDREETAHYYYTMVAYIRLLYQCCQLVHADLSEYN 248
            +++VME +   NGF   RL+ +     +     Y  ++ +I  L     L+H D +E+N
Sbjct: 184 RHIVVMELI---NGFPMRRLRKH-----KNIPKLYSDLMCFIVQLGNS-GLIHCDFNEFN 234

Query: 249 AIVHNK-------ELYIIDVSQSVQPEHPMSLDFLRMDIKNVNNYFER 289
            ++ ++          +ID  Q V  +H  +  + + D+  +  +F++
Sbjct: 235 VMIKDELEDENDCGFVVIDFPQCVSIQHQDADYYFQRDVDCIRRFFKK 282

>Smik_14.125 Chr14 (234660..235922) [1263 bp, 420 aa] {ON} YNL207W
           (REAL)
          Length = 420

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 47/228 (20%), Positives = 99/228 (43%), Gaps = 37/228 (16%)

Query: 69  LQALTSRGVISQFNGCVSTGKEANVYHAFAEIGAKNTEEAGEVLPNLEERRELAIKIFKT 128
           L+ + +R  +      +  GKE+++Y    ++  KN +      P + +   L     +T
Sbjct: 85  LKTMLNRDTVYSVGNTIGVGKESDIY----KVSDKNGK------PRVMKIHRLG----RT 130

Query: 129 SILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGLVPAPEPVEVR 188
           S    ++   Y+      RNS    N   + ++ A KE++ +  +Y  G    PEP +  
Sbjct: 131 SFHSVRNNRDYL------RNSNQGANWMHLSRLAANKEYQFMSMLYSKGF-KVPEPFDNS 183

Query: 189 SNVLVMEFLSRGNGFASPRLKDYPYKDREETAHYYYTMVAYIRLLYQCCQLVHADLSEYN 248
            +++VME +    G+   RL+ +     +     Y  ++ +I  L     L+H D +E+N
Sbjct: 184 RHIVVMELIE---GYPMRRLRKH-----KNIPKLYSDLMCFIVELANS-GLIHCDFNEFN 234

Query: 249 AIVHNK-------ELYIIDVSQSVQPEHPMSLDFLRMDIKNVNNYFER 289
            ++ N+          +ID  Q V  +H  +  + + D+  +  +F++
Sbjct: 235 IMIKNEVEDEKDCGFVVIDFPQCVSIQHQDADYYFQRDVDCIRRFFKK 282

>Skud_14.129 Chr14 (244224..245501) [1278 bp, 425 aa] {ON} YNL207W
           (REAL)
          Length = 425

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 46/228 (20%), Positives = 98/228 (42%), Gaps = 37/228 (16%)

Query: 69  LQALTSRGVISQFNGCVSTGKEANVYHAFAEIGAKNTEEAGEVLPNLEERRELAIKIFKT 128
           L+ + +R  +      +  GKE+++Y    ++  KN        P + +   L     +T
Sbjct: 85  LKTMLNRNTVYSVGNTIGVGKESDIY----KVSDKNGN------PRVMKIHRLG----RT 130

Query: 129 SILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGLVPAPEPVEVR 188
           S    ++   Y+      +NS    N   + ++ A KE++ +  +Y  G    PEP +  
Sbjct: 131 SFHSVRNNRDYL------KNSNQGANWMHLSRLAANKEYQFMSMLYSKGF-KVPEPFDNS 183

Query: 189 SNVLVMEFLSRGNGFASPRLKDYPYKDREETAHYYYTMVAYIRLLYQCCQLVHADLSEYN 248
            +++VME +    G+   RL+ +     +     Y  ++ ++  L     L+H D +E+N
Sbjct: 184 RHIVVMELIE---GYPMRRLRKH-----KNIPKLYSDLMCFVVELANS-GLIHCDFNEFN 234

Query: 249 AIVHNK-------ELYIIDVSQSVQPEHPMSLDFLRMDIKNVNNYFER 289
            +V +K          +ID  Q V  +H  +  + + D+  +  +F++
Sbjct: 235 IMVKDKVEDEQDCGFVVIDFPQCVSIQHQDADYYFQRDVDCIRRFFKK 282

>KNAG0F01060 Chr6 (188811..190097) [1287 bp, 428 aa] {ON} Anc_2.44
           YNL207W
          Length = 428

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 45/231 (19%), Positives = 102/231 (44%), Gaps = 40/231 (17%)

Query: 69  LQALTSRGVISQFNGCVSTGKEANVYHAFAEIGAKNTEEAGEVLPNLEERRELAI-KIFK 127
           L+ + +R  +      +  GKE+++Y    ++  KN  E           + + I ++ +
Sbjct: 85  LKTMLNRDSLYSVGNTIGVGKESDIY----KVSDKNGVE-----------KVMKIHRLGR 129

Query: 128 TSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGLVPAPEPVEV 187
           TS    ++   Y+      +NS++  N   + K+ A KE++ +  ++  G    PEP + 
Sbjct: 130 TSFHTVRNNRDYLR-----KNSKNGANWMFLSKLAAAKEYQFMSLLHSRGF-RVPEPFDH 183

Query: 188 RSNVLVMEFLSRGNGFASPRLKDYPYKDREETAHYYYTMVAYIRLLYQCCQLVHADLSEY 247
             ++++ME +    GF   RL+ +     +     Y  ++ +I L      L+H D +E+
Sbjct: 184 SRHIIIMELIK---GFPMTRLRKH-----QNVPKLYSDLMKFI-LELGNSGLIHCDFNEF 234

Query: 248 NAIVHNK---------ELYIIDVSQSVQPEHPMSLDFLRMDIKNVNNYFER 289
           N ++ +K            +ID  Q +  +H  +  + + D+  +  +F++
Sbjct: 235 NIMIKDKLDGSDPNDTGFIVIDFPQCISIQHQDASFYFQRDVDCIRRFFKK 285

>NDAI0F03600 Chr6 complement(860282..861547) [1266 bp, 421 aa] {ON}
           Anc_2.44 YNL207W
          Length = 421

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 40/228 (17%), Positives = 96/228 (42%), Gaps = 36/228 (15%)

Query: 69  LQALTSRGVISQFNGCVSTGKEANVYHAFAEIGAKNTEEAGEVLPNLEERRELAIKIFKT 128
           L+ + +R  +    G +  GKE+++Y    + G     +                ++ +T
Sbjct: 85  LKTMLNRDTVYSIGGSIGVGKESDIYQVSDKNGVSKVMKIH--------------RLGRT 130

Query: 129 SILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGLVPAPEPVEVR 188
           S    ++   Y+      +N ++  N   + ++ A KE++ +  +Y  G    PEP +  
Sbjct: 131 SFHTVRNNRDYLK-----KNVKNGVNWMYLSQLAANKEYQFMSMLYTKGF-EVPEPFDNS 184

Query: 189 SNVLVMEFLSRGNGFASPRLKDYPYKDREETAHYYYTMVAYIRLLYQCCQLVHADLSEYN 248
            ++++M  +    G+   RL+ +           Y  ++ +I  L     L+H D +E+N
Sbjct: 185 RHIIIMGLIE---GYPMRRLRKH-----NNIPKLYNDLMKFIVRLAN-SGLIHCDFNEFN 235

Query: 249 AIVHNK-------ELYIIDVSQSVQPEHPMSLDFLRMDIKNVNNYFER 289
            ++ ++          +ID  Q +  +HP +  + + D+  +  +F++
Sbjct: 236 IMIKDEVEDENDCGFVVIDFPQCISIQHPDAEFYFQRDVDCIRRFFKK 283

>KLTH0B07722g Chr2 complement(625231..626517) [1287 bp, 428 aa] {ON}
           similar to uniprot|P40160 Saccharomyces cerevisiae
           YNL207W RIO2 Protein required for cell viability
          Length = 428

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 48/233 (20%), Positives = 96/233 (41%), Gaps = 48/233 (20%)

Query: 69  LQALTSRGVISQFNGCVSTGKEANVYHAFAEIGAKNTEEAGEVLPNLEERRELAI-KIFK 127
           L+A+ SR  I      +  GKE++VY   A+ G+                R L I ++ +
Sbjct: 85  LRAMLSRDTIYSVGNVIGVGKESDVYRVSAKDGSA---------------RVLKIHRLGR 129

Query: 128 TSILVFKDRERYVDGEFRFRNSRSQHNPRKMI-KIWAEKEFRNLKRIYQSGLVPAPEPVE 186
           TS    K+   Y+         R+Q      + ++ A KE++ +  ++  G    PEP +
Sbjct: 130 TSFTTVKNNRDYL--------KRNQSGSWMFLSRLAANKEYQFMSLLHSKGFT-VPEPFD 180

Query: 187 VRSNVLVMEFLSRGNGFASPRLKDYPYKD---REETAHYYYTMVAYIRLLYQCCQLVHAD 243
              ++++ME +             YP ++    +     Y  ++ +I  L     L+H D
Sbjct: 181 NSRHMILMELID-----------GYPMRNMRLHKNLPKLYSDLMLFIVKLANHG-LIHCD 228

Query: 244 LSEYNAIVHNK-------ELYIIDVSQSVQPEHPMSLDFLRMDIKNVNNYFER 289
            +E+N ++ N           +ID  Q +  +H  +  F + D+  +  +F++
Sbjct: 229 FNEFNIMIKNSVTGPEDNGFIVIDFPQCISIQHQDAEFFFKRDVDCIRRFFKK 281

>SAKL0E13552g Chr5 complement(1118842..1120101) [1260 bp, 419 aa]
           {ON} highly similar to uniprot|P40160 YNL207W
           Saccharomyces cerevisiae RIO2 Protein required for cell
           viability
          Length = 419

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 43/229 (18%), Positives = 99/229 (43%), Gaps = 40/229 (17%)

Query: 69  LQALTSRGVISQFNGCVSTGKEANVYHAFAEIGAKNTEEAGEVLPNLEERRELAI-KIFK 127
           L+A+ +R  +      +  GKE+++Y    ++  +N              R + I ++ +
Sbjct: 85  LKAMLNRDTVYSIGATIGVGKESDIY----QVSDRNGNS-----------RVMKIHRLGR 129

Query: 128 TSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGLVPAPEPVEV 187
           TS    K+   Y+ G       R   +   + ++ A KE++ +  +Y  G    PEP + 
Sbjct: 130 TSFQTVKNNRDYLKG-------RQSASWMFLSRLAANKEYQFMSLLYSKGF-KVPEPFDN 181

Query: 188 RSNVLVMEFLSRGNGFASPRLKDYPYKDREETAHYYYTMVAYIRLLYQCCQLVHADLSEY 247
             ++++ME +    G+   RL+ +      +    Y  ++ +I  L     L+H D +E+
Sbjct: 182 SRHIILMELIK---GYPMRRLRKH-----HDLPKLYSDLMCFIVNLAN-HGLIHCDFNEF 232

Query: 248 NAIVHNK-------ELYIIDVSQSVQPEHPMSLDFLRMDIKNVNNYFER 289
           N ++ ++          +ID  Q +  +H  +  + + D+  +  +F++
Sbjct: 233 NIMIKDEVDDENDCGFVVIDFPQCISIQHKDAEYYFQRDVDCIRRFFKK 281

>YNL207W Chr14 (255353..256630) [1278 bp, 425 aa] {ON}
           RIO2Essential serine kinase involved in the processing
           of the 20S pre-rRNA into mature 18S rRNA; has similarity
           to Rio1p
          Length = 425

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 44/229 (19%), Positives = 98/229 (42%), Gaps = 39/229 (17%)

Query: 69  LQALTSRGVISQFNGCVSTGKEANVYHAFAEIGAKNTEEAGEVLPNLEERRELAI-KIFK 127
           L+ + +R  +      +  GKE+++Y    ++  KN              R + I ++ +
Sbjct: 85  LKTMLNRDTVYSVGNTIGVGKESDIY----KVSDKNGNP-----------RVMKIHRLGR 129

Query: 128 TSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGLVPAPEPVEV 187
           TS    ++   Y+      + S    N   + ++ A KE++ +  +Y  G    PEP + 
Sbjct: 130 TSFHSVRNNRDYL------KKSNQGANWMHLSRLAANKEYQFMSMLYSKGF-KVPEPFDN 182

Query: 188 RSNVLVMEFLSRGNGFASPRLKDYPYKDREETAHYYYTMVAYIRLLYQCCQLVHADLSEY 247
             +++VME +    G+   RL+ +     +     Y  ++ +I  L     L+H D +E+
Sbjct: 183 SRHIVVMELIE---GYPMRRLRKH-----KNIPKLYSDLMCFIVDLANS-GLIHCDFNEF 233

Query: 248 NAIVHNK-------ELYIIDVSQSVQPEHPMSLDFLRMDIKNVNNYFER 289
           N ++ +K          +ID  Q +  +H  +  + + D+  +  +F++
Sbjct: 234 NIMIKDKLEDENDCGFVVIDFPQCISIQHQDADYYFQRDVDCIRRFFKK 282

>Ecym_6449 Chr6 complement(873295..874548) [1254 bp, 417 aa] {ON}
           similar to Ashbya gossypii ABL166W
          Length = 417

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 45/231 (19%), Positives = 103/231 (44%), Gaps = 44/231 (19%)

Query: 69  LQALTSRGVISQFNGCVSTGKEANVYHAFAEIGAKNTEEAGEVLPNLEERRELAIKIFK- 127
           L++L ++  +      +  GKE+++Y       + +T EA            L +KI + 
Sbjct: 85  LKSLLNKNALYSVGNTIGVGKESDIYQV-----STSTSEA------------LVMKIHRL 127

Query: 128 --TSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGLVPAPEPV 185
             TS    K+   Y+    R +++   H    +  + A KE++ +  +Y  G    P P 
Sbjct: 128 GRTSFHTVKNNRDYLK---RGQSASWMH----LSSLAANKEYQFMNLLYSKGF-KVPRPY 179

Query: 186 EVRSNVLVMEFLSRGNGFASPRLKDYPYKDREETAHYYYTMVAYIRLLYQCCQLVHADLS 245
           +   ++++ME++    G+   RL+++     ++    Y  ++ +I  L     L+H D +
Sbjct: 180 DNSRHIILMEYIK---GYPMRRLREH-----KDLPRLYSELMKFIVQLGNH-GLIHCDFN 230

Query: 246 EYNAIVHNKE-------LYIIDVSQSVQPEHPMSLDFLRMDIKNVNNYFER 289
           E+N ++ +K          +ID  Q +  +H  +  + + D++ +  +F++
Sbjct: 231 EFNIMIKDKTDGPDDLGFIVIDFPQCISIQHKDAEYYFQRDVECIRRFFKK 281

>Kpol_400.7 s400 complement(15841..17118) [1278 bp, 425 aa] {ON}
           complement(15841..17118) [1278 nt, 426 aa]
          Length = 425

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 55/300 (18%), Positives = 122/300 (40%), Gaps = 57/300 (19%)

Query: 69  LQALTSRGVISQFNGCVSTGKEANVYHAFAEIGAKNTEEAGEVLPNLEERRELAI-KIFK 127
           L++L ++  +      +  GKE+++Y A    G               E R + I ++ +
Sbjct: 85  LKSLLNKDTVYSVGNTIGVGKESDIYQASDRNG---------------EHRVMKIHRLGR 129

Query: 128 TSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGLVPAPEPVEV 187
           TS    K+   Y+      +      +   + ++ A KE++ +  +Y  G    P+  + 
Sbjct: 130 TSFHTVKNNRDYL------KKYNQGASWMFLSRVAANKEYQFMSLLYSKGFT-VPKAFDN 182

Query: 188 RSNVLVMEFLSRGNGFASPRLKDYPYKDREETAHYYYTMVAYIRLLYQCCQLVHADLSEY 247
             +++VME +    GF   RL+ +     +     Y  ++ +I  L     L+H D +E+
Sbjct: 183 SRHIVVMELIK---GFPLRRLRKH-----DNIPKLYSDLMCFIVNLAN-SGLIHCDFNEF 233

Query: 248 NAIVHNKE-------LYIIDVSQSVQPEHPMSLDFLRMDIKNVNNYFER----------- 289
           N ++ +++         +ID  Q +  +H  +  + + D+  +  +F++           
Sbjct: 234 NIMIKDEKDDENDCGFIVIDFPQCISIQHKDADFYFKRDVDCIRRFFKKKLKYEPQSDST 293

Query: 290 -MSVDVFPERVIFQFVISETLDKFSGDYTSSVDLRDYVSKNLPVKSGPQDEAEDEVFRSL 348
            + +D F +   +Q+ +      FS D   + +L + V  +   K  P D   +E   S+
Sbjct: 294 MLDLDGFGDGYKYQYPV------FSRDVERTDNLDELVQASGFSKKHPGDRYLEEAVESM 347

>TDEL0A00860 Chr1 (143723..144982) [1260 bp, 419 aa] {ON} Anc_2.44
           YNL207W
          Length = 419

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 41/241 (17%), Positives = 101/241 (41%), Gaps = 38/241 (15%)

Query: 69  LQALTSRGVISQFNGCVSTGKEANVYHAFAEIGAKNTEEAGEVLPNLEERRELAIKIFKT 128
           ++++ +R  +  F   +  GKE+++Y    + G     +                ++ +T
Sbjct: 85  VKSMLNRDTVYSFGNTIGVGKESDIYQVSDKNGVAKVMKIH--------------RLGRT 130

Query: 129 SILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGLVPAPEPVEVR 188
           S    K+   Y+      + +    N   +  + A+KE++ +  +Y  G +  P+P +  
Sbjct: 131 SFHTVKNNRDYL------KKNAHGTNWMHLSLLAAQKEYQFMSLLYSKGFI-VPQPYDNS 183

Query: 189 SNVLVMEFLSRGNGFASPRLKDYPYKDREETAHYYYTMVAYIRLLYQCCQLVHADLSEYN 248
            ++++ME +   +GF    L+++           Y  ++ +   L     L+H D +E+N
Sbjct: 184 RHIVLMELI---DGFPMRNLRNH-----SNIPKLYSDLMTFAVKLAN-SGLIHCDFNEFN 234

Query: 249 AIVHNK-------ELYIIDVSQSVQPEHPMSLDFLRMDIKNVNNYF-ERMSVDVFPERVI 300
            ++ N           +ID  Q +  +H  +  + + DI+ +  +F +++  D  P+  +
Sbjct: 235 IMIKNTVEDSKDCGFVVIDFPQCISIQHKDADFYFQRDIECIRRFFRKKLKYDPTPDPTM 294

Query: 301 F 301
            
Sbjct: 295 L 295

>ZYRO0C10340g Chr3 complement(793323..794573) [1251 bp, 416 aa] {ON}
           similar to uniprot|P40160 Saccharomyces cerevisiae
           YNL207W RIO2 Protein required for cell viability
          Length = 416

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 42/229 (18%), Positives = 95/229 (41%), Gaps = 38/229 (16%)

Query: 69  LQALTSRGVISQFNGCVSTGKEANVYHAFAEIGAKNTEEAGEVLPNLEERRELAIKIFKT 128
           ++A+ +R  +      +  GKE+++Y      G     +                ++ +T
Sbjct: 85  IKAMLNRDTVYSIGNTIGVGKESDIYKVSDRNGNAQVMKIH--------------RLGRT 130

Query: 129 SILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGLVPAPEPVEVR 188
           S    ++   Y+      ++SR   +   +  + A KE+  L  ++  G    PE  +  
Sbjct: 131 SFTSVRNNRDYL------KHSRQGTSWMHLSLLAAHKEYEFLALLHSRGF-QVPEAFDNS 183

Query: 189 SNVLVMEFLSRGNGFASPRLKDYPYKDREETAHYYYTMVAYIRLLYQCCQLVHADLSEYN 248
            ++++MEF+    GF    L+ +           Y  ++ +   L +   L+H D +E+N
Sbjct: 184 RHMVLMEFI---KGFPMKNLRTH-----SNIPKLYSDLMKFAVDLAKS-GLIHCDYNEFN 234

Query: 249 AIVHNKE--------LYIIDVSQSVQPEHPMSLDFLRMDIKNVNNYFER 289
            ++ +++          +ID  Q +  +HP +  F R DI+ +  +F++
Sbjct: 235 IMIKDQDTTDSSDCGFVVIDFPQCISIQHPDAEFFFRRDIECIRRFFKK 283

>Ecym_1119 Chr1 complement(244327..246702) [2376 bp, 791 aa] {ON}
           similar to Ashbya gossypii AFR647C
          Length = 791

 Score = 35.0 bits (79), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 32/49 (65%), Gaps = 3/49 (6%)

Query: 125 IFKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRI 173
           +F+T  + F+D++R+ +G    R   +QH+P +++K+    E+ ++KR+
Sbjct: 312 LFETKPMYFEDQKRFFNGVIEIR---TQHDPLELLKLCKRIEYEDMKRV 357

>TPHA0J03150 Chr10 complement(686778..687320) [543 bp, 180 aa] {ON}
           Anc_5.168 YGR167W
          Length = 180

 Score = 32.3 bits (72), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 41/82 (50%), Gaps = 6/82 (7%)

Query: 79  SQFNGCVST-GKEANVYHAFAEIGAKNTEEAGEVLPNLEERRELAI-----KIFKTSILV 132
           SQ NG  ST G++ +   A  E G    +EAGE +   +ERR+L I     K  +  + +
Sbjct: 33  SQVNGEASTAGEQMSGNDAELESGEYTYQEAGEAIRQWKERRDLEITDKDRKDQQEKVEL 92

Query: 133 FKDRERYVDGEFRFRNSRSQHN 154
            +D  +Y+D  +   N + + N
Sbjct: 93  EEDAVKYIDDFYETYNKKKETN 114

>KLLA0F15576g Chr6 (1437595..1439133) [1539 bp, 512 aa] {ON} similar
           to uniprot|Q07950 Saccharomyces cerevisiae YLR020C YEH2
           Steryl ester hydrolase catalyzes steryl ester hydrolysis
           at the plasma membrane involved in sterol metabolism
          Length = 512

 Score = 32.7 bits (73), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 28/51 (54%), Gaps = 2/51 (3%)

Query: 130 ILVFKDRE-RYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGLV 179
           IL+F  R+ R VDGE R  N    H P  + KIW   E+ +L  ++ S ++
Sbjct: 443 ILLFTPRQDRLVDGE-RLINHFINHEPHSVYKIWYIDEYSHLDVLWASDVI 492

>ZYRO0F13288g Chr6 (1089259..1092207) [2949 bp, 982 aa] {ON} similar
           to uniprot|P38164 Saccharomyces cerevisiae YBL104C
           Hypothetical ORF
          Length = 982

 Score = 32.7 bits (73), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 29/54 (53%), Gaps = 4/54 (7%)

Query: 315 DYTSSVDLRDYVSKNLPVKSGPQDEAEDEVFRSLHLVRNLGGLEERDFDRFTLG 368
           DY S    RD V+     K  PQ+EA+D + + +H V++ G +   DF  F +G
Sbjct: 17  DYVSVNPTRDEVTH---YKVDPQNEADDSIMK-MHTVKDFGSITCLDFSDFEVG 66

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.135    0.388 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 42,552,400
Number of extensions: 1838446
Number of successful extensions: 5376
Number of sequences better than 10.0: 53
Number of HSP's gapped: 5502
Number of HSP's successfully gapped: 56
Length of query: 476
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 363
Effective length of database: 40,524,141
Effective search space: 14710263183
Effective search space used: 14710263183
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)